WorldWideScience

Sample records for samarium 138

  1. Synthesis of Samarium Cobalt Nanoblades

    Energy Technology Data Exchange (ETDEWEB)

    Darren M. Steele

    2010-08-25

    As new portable particle acceleration technologies become feasible the need for small high performance permanent magnets becomes critical. With particle accelerating cavities of a few microns, the photonic crystal fiber (PCF) candidate demands magnets of comparable size. To address this need, samarium cobalt (SmCo) nanoblades were attempted to be synthesized using the polyol process. Since it is preferable to have blades of 1-2 {micro}m in length, key parameters affecting size and morphology including method of stirring, reaction temperature, reaction time and addition of hydroxide were examined. Nanoparticles consisting of 70-200 nm spherical clusters with a 3-5 nm polyvinylpyrrolidone (PVP) coating were synthesized at 285 C and found to be ferromagnetic. Nanoblades of 25nm in length were observed at the surface of the nanoclusters and appeared to suggest agglomeration was occurring even with PVP employed. Morphology and size were characterized using a transmission electron microscope (TEM). Powder X-Ray Diffraction (XRD) analysis was conducted to determine composition but no supportive evidence for any particular SmCo phase has yet been observed.

  2. Particle-Size-Induced Valence Changes in Samarium Clusters

    Energy Technology Data Exchange (ETDEWEB)

    Mason, M. G.; Lee, S. -T.; Apai, G.; Davis, R. F.; Shirley, D. A.; Franciosi, A.; Weaver, J. H.

    1981-09-01

    Samarium clusters exhibit mixed-valence behavior which is sensitive to particle size. XPS and UPS data show samarium to be primarily divalent (4f{sup 6} ) at small particle size. The trivalent state (4f{sup 5} ) becomes progressively more abundant with increasing s1ze, becoming the dominant state for the bulk metal. These results are interpreted using a model in which band narrowing, due to reduced surface coordination, is more dominant than surface tension effects in establishing the valence of small samarium clusters.

  3. Yellow-green electroluminescence of samarium complexes of 8-hydroxyquinoline

    Energy Technology Data Exchange (ETDEWEB)

    Behzad, Sara Karimi; Najafi, Ezzatollah [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Amini, Mostafa M., E-mail: m-pouramini@sbu.ac.ir [Department of Chemistry Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Janghouri, Mohammad; Mohajerani, Ezeddin [Laser Research Institute Shahid Beheshti University G.C., Tehran 1983963113 (Iran, Islamic Republic of); Ng, Seik Weng [Department of Chemistry, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2014-12-15

    Four novel samarium complexes were prepared by reacting samarium(III) nitrate with 8-hydroxyquinoline, 2-methyl-8-hydroxyquinoline, and 1,10-phenanthroline and utilized as emitting materials in the electroluminescence device. All complexes were characterized by elemental analysis, infrared, UV–vis and {sup 1}H NMR spectroscopes and the molecular structure of a representative complex, [Sm{sub 2}(Me-HQ){sub 4}(NO{sub 3}){sub 6}] (1), was determined by single-crystal X-ray diffraction. Utilization of a π-conjugated (phenanthroline) ligand as a second ligand in the structure of the samarium complexes resulted in red shifts in both absorption and fluorescence spectra of complexes and moderately enhanced the photoluminescence intensity and the fluorescence quantum yield. The maximum emission peaks showed that a good correlation exists between the nature of the substituent group on the 8-hydroxyquinoline and the addition of the π-conjugated ligand in the structure of samarium complexes and emission wavelength. Devices with samarium(III) complexes with structure of ITO/PEDOT:PSS (90 nm)/PVK:PBD:Sm(III) complexes (75 nm)/Al (180 nm) were fabricated. In the electroluminescence (EL) spectra of the devices, a strong ligand-centered emission and narrow bands arising from the {sup 4}G{sub 5/2}→{sup 6}H{sub J} transitions (J=7/2, 9/2, and 11/2) of the samarium ion were observed for the complexes. The electroluminescent spectra of the samarium complexes were red-shifted as compared with the PVK:PBD blend. We believe that the electroluminescence performance of OLED devices based on samarium complexes relies on overlaps between the absorption of the samarium compounds and the emission of PVK:PBD. This revealed that it is possible to evaluate the electroluminescence performance of the samarium compounds-doped OLED devices based on the emission of PVK:PBD and the absorption of the dopants. - Highlights: • Four novel photoluminescence samarium complexes have been synthesized.

  4. 13.8

    CERN Document Server

    Gribbin, John

    2015-01-01

    The twentieth century gave us two great theories of physics. The general theory of relativity describes the behaviour of very large things; quantum theory the behaviour of very small things. In this landmark book, John Gribbin - one of the best-known writers of popular science over the past 30 years - presents his own version of the Holy Grail of physics, the search that has been going on for decades to find a unified 'Theory of Everything' that combines these ideas into one mathematical package, a single equation that could be printed on a T-shirt, containing the answer to life, the Universe and everything. With his inimitable mixture of science, history and biography, Gribbin shows how - despite scepticism among many physicists - these two great theories are indeed very compatible, and point to a deep truth about the nature of our existence. The answer lies, intriguingly, with the age of the Universe: 13.8 billion years.

  5. Biodistribution of samarium-153-EDTMP in rats treated with docetaxel

    Energy Technology Data Exchange (ETDEWEB)

    Villarim Neto, Arthur; Acucena, Maria Kadja Meneses Torres; Pereira, Kercia Regina Santos Gomes; Rego, Amalia Cinthia Meneses [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Postgraduate Program in Health Sciences; Azevedo, Italo Medeiros; Medeiros, Aldo Cunha [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Dept. of Surgery; Bernardo-Filho, Mario [State University of Rio de Janeiro, RJ (Brazil). Dept. of Biophysics and Biometry

    2009-01-15

    Purpose: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. Methods: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium) group received docetaxel (15 mg/kg) intraperitoneally in two cycles 11 days apart. The S (samarium/control) group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1 ml of samarium-153-EDTMP via orbital plexus (25 {mu} Ci. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI / g) was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland). Results: On the ninth day after the administration of the second chemotherapy cycle, the rats had a significant weight loss (314.50 +- 22.09 g) compared (p<0.5) to pre-treatment weight (353.66 {+-} 22.8). The % ATI/g in the samples of rats treated with samarium-153-EDTMP had a significant reduction in the right femur, left femur, kidney, liver and lungs of animals treated with docetaxel, compared to the control rats. Conclusion: The combination of docetaxel and samarium-153-EDTMP was associated with a lower response rate in the biodistribution of the radiopharmaceutical to targeted tissues. Further investigation into the impact of docetaxel on biodistribution of samarium-153-EDTMP would complement the findings of this study. (author)

  6. The Basis for Developing Samarium AMS for Fuel Cycle Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Buchholz, B A; Biegalski, S R; Whitney, S M; Tumey, S J; Weaver, C J

    2008-10-13

    Modeling of nuclear reactor fuel burnup indicates that the production of samarium isotopes can vary significantly with reactor type and fuel cycle. The isotopic concentrations of {sup 146}Sm, {sup 149}Sm, and {sup 151}Sm are potential signatures of fuel reprocessing, if analytical techniques can overcome the inherent challenges of lanthanide chemistry, isobaric interferences, and mass/charge interferences. We review the current limitations in measurement of the target samarium isotopes and describe potential approaches for developing Sm-AMS. AMS sample form and preparation chemistry will be discussed as well as possible spectrometer operating conditions.

  7. Optical characteristics of transparent samarium oxide thin films ...

    Indian Academy of Sciences (India)

    Optical characteristics of transparent samarium oxide thin films deposited by the radio-frequency sputtering technique. A A ATTA M M EL-NAHASS KHALED M ELSABAWY M M ABD EL-RAHEEM A M HASSANIEN A ALHUTHALI ALI BADAWI AMAR MERAZGA. Regular Volume 87 Issue 5 November 2016 Article ID 72 ...

  8. Optical properties of zinc–vanadium glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3() ZnO(40-)V2O5(60) (where = 0.1–0.5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been calculated.

  9. Optical properties of samarium doped zinc–tellurite glasses

    Indian Academy of Sciences (India)

    Unknown

    Optical properties of samarium doped zinc–tellurite glasses. B ERAIAH. Department of Physics, Karnatak University, Dharwad 580 003, India. Present address: Department of Physics, Bangalore University, Bangalore 560 056, India. MS received 20 March 2006; revised 13 June 2006. Abstract. Glasses with the composition, ...

  10. Effect of second ligand on the luminescence of Samarium (III ...

    Indian Academy of Sciences (India)

    Effect of second ligand on the luminescence of Samarium (III) dibenzoylmethane complexes: Syntheses, crystal structures, thermal analysis and luminescence study. MUHAMMAD IDIRIS SALEH, MIN YEE CHOO, TAI WEI CHAN and MOHD R RAZALI. ∗. School of Chemical Sciences, Universiti Sains Malaysia, Penang, ...

  11. Effect of second ligand on the luminescence of Samarium (III ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 127; Issue 12. Effect of second ligand on the luminescence of Samarium (III) dibenzoylmethane complexes: ... Muhammad Idiris Saleh1 Min Yee Choo1 Tai Wei Chan1 Mohd R Razali1. School of Chemical Sciences, Universiti Sains Malaysia, Penang, Malaysia ...

  12. Dependence of samarium-soil interaction on samarium concentration: Implications for environmental risk assessment.

    Science.gov (United States)

    Ramírez-Guinart, Oriol; Salaberria, Aitor; Vidal, Miquel; Rigol, Anna

    2018-03-01

    The sorption and desorption behaviour of samarium (Sm), an emerging contaminant, was examined in soil samples at varying Sm concentrations. The obtained sorption and desorption parameters revealed that soil possessed a high Sm retention capacity (sorption was higher than 99% and desorption lower than 2%) at low Sm concentrations, whereas at high Sm concentrations, the sorption-desorption behaviour varied among the soil samples tested. The fractionation of the Sm sorbed in soils, obtained by sequential extractions, allowed to suggest the soil properties (pH and organic matter solubility) and phases (organic matter, carbonates and clay minerals) governing the Sm-soil interaction. The sorption models constructed in the present work along with the sorption behaviour of Sm explained in terms of soil main characteristics will allow properly assessing the Sm-soil interaction depending on the contamination scenario under study. Moreover, the sorption and desorption K d values of radiosamarium in soils were strongly correlated with those of stable Sm at low concentrations (r = 0.98); indicating that the mobility of Sm radioisotopes and, thus, the risk of radioactive Sm contamination can be predicted using data from low concentrations of stable Sm. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Mechanism of the electrochemical deposition of samarium-based coatings

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz, Edgar J. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Ortega-Borges, Raul [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Godinez, Luis A. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Chapman, Thomas W. [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico); Meas-Vong, Yunny [Electrochemistry Department, Centro de Investigacion y Desarrollo Tecnologico en Electroquimica, Parque Tecnologico Queretaro Sanfandila, P.O. Box 064, Pedro Escobedo, 76700 Queretaro (Mexico)]. E-mail: yunnymeas@cideteq.mx

    2006-11-12

    Samarium-based films have been shown to form from aqueous solutions on the surfaces of metallic substrates such as steel or aluminum, and their presence has been reported to decrease substantially the corresponding corrosion rate of the underlying metallic substrate. Based on previous reports on the deposition of oxides or hydroxides of the closely related element cerium, this work demonstrates that samarium films are formed following a similar mechanism, which involves as the fundamental step an increase in interfacial pH resulting from cathodic oxygen-reduction or hydrogen-evolution reactions. With cyclic voltammetry (CV), electrochemical quartz-crystal microbalance (EQCM) measurements, rotating-disk electrode (RDE) tests, and surface characterization techniques, namely, scanning electron microscopy (SEM) and X-ray surface microanalysis (EDX), the postulated mechanism was verified, and the surface morphology of the resulting films was correlated with the nature of the reduction reaction that triggers film formation.

  14. Samarium Monosulfide (SmS): Reviewing Properties and Applications

    OpenAIRE

    Sousanis, Andreas; Smet, Philippe; Poelman, Dirk

    2017-01-01

    In this review, we give an overview of the properties and applications of samarium monosulfide, SmS, which has gained considerable interest as a switchable material. It shows a pressure-induced phase transition from the semiconducting to the metallic state by polishing, and it switches back to the semiconducting state by heating. The material also shows a magnetic transition, from the paramagnetic state to an antiferromagnetically ordered state. The switching behavior between the semiconducti...

  15. Optical properties of zinc–vanadium glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Abstract. Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3(x). ZnO(40−x)V2O5(60)(where x = 0·1–0·5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been ...

  16. Synthesis of nano-pore samarium (III)-imprinted polymer for preconcentrative separation of samarium ions from other lanthanide ions via solid phase extraction

    Energy Technology Data Exchange (ETDEWEB)

    Shirvani-Arani, Simindokht [Center of Excellence in Electrochemistry, Department of Chemistry, University of Tehran, P.O.Box:14155-6455, Tehran (Iran, Islamic Republic of); Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of); Ahmadi, Seyed Javad [Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of)], E-mail: sjahmadi@aeoi.org.ir; Bahrami-Samani, Ali [Nuclear Engineering and Physics Department, Amir Kabir University, P.O.Box: 15875-4413, Tehran (Iran, Islamic Republic of); Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of); Ghannadi-Maragheh, Mohammad [Jaber Ibne Hayan Research Laboratories, Nuclear Science and Technology Research Institute, P.O. Box: 11365-8486, Tehran (Iran, Islamic Republic of)

    2008-08-08

    A batch process was developed to separate samarium ions from some lanthanide ions by a novel solid phase which was prepared via the ion-imprinting technique. The samarium (III) ion-imprinted polymer (IIP) particles were synthesized by preparing the ternary complex of samarium ions with 5,7-dichloroquinoline-8-ol (DCQ) and 4-vinylpyridine (VP). Then, thermally copolymerization with styrene (functional monomer, STY) and divinylbenzene (cross-linking monomer, DVB) followed in the presence of 2-methoxy ethanol (porogen) and 2,2'-azobisisobutyronitrile (initiator, AIBN). The imprinted ion was removed by stirring the above particles with 50% (v/v) HCl to obtain the leached IIP particles. Moreover, control polymer (CP) particles were similarly prepared without the samarium ions. The unleached and leached IIP particles were characterized by X-ray diffraction (XRD), infra-red spectroscopy (IR), thermo gravimetric analysis (TGA) and scanning electron microscopy (SEM). Finally, preconcentration and selectivity studies for samarium and the other lanthanide ions were carried out. The preconcentration of the samarium (III) traces was studied during rebinding with the leached IIP particles as a function of pH, the weight of the polymer material, the preconcentration and the elution times, the eluent volume and the aqueous phase volume. These studies indicated that the samarium (III) amount as low as 1 {mu}g, present in 200 mL, could be preconcentrated into 25 mL of 1.0 M HCl.

  17. Ionization of Samarium by Chemical Releases in the Upper Atmosphere

    Science.gov (United States)

    Siefring, C. L.; Bernhardt, P. A.; Holmes, J. M.; Pedersen, T. R.; Caton, R.; Miller, D.; Groves, K. M.

    2014-12-01

    The release of Samarium vapor into the upper atmosphere was studied using during the Air Force Research Laboratory sponsored Metal Oxide Space Cloud (MOSC) rocket launches in May 2009. The Naval Research Laboratory supported these experiments with 3-D photochemical modeling of the artificial plasma cloud including (1) reactions with atomic oxygen, (2) photo excitation, (3) photoionization, (4) dissociative recombination, and (5) ion and neutral diffusion. NRL provided the experimental diagnostic instrument on the rocket which was a dual frequency radio beacon on the rocket to measure changes in total electron content. The AFRL provided ground based diagnostics of incoherent scatter radar and optical spectroscopy and imagery. The NRL Chemical Release Model (CRM) has over 600 excited states of atomic Samarium neutrals, atomic ions, along with Samarium Oxide Ions and electrons. Diffusive transport of neutrals in cylindrical geometry and ions along magnetic field lines is computed along with the reactive flow to predict the concentrations of Sm, Sm-Ion, Sm0, and SmO Ion. Comparison of the CRM with observations demonstrates that Sm release into the upper atmosphere initially produces enhanced electron densities and SmO-Ions. The diatomic ions recombine with electrons to yield neutral Sm and O. Only the photo ionization of Sm yields a stable atomic ion that does not substantially recombine. The MOSC releases in sunlight yielded long duration ion clouds that can be replicated with the CRM. The CRM predicts that Sm releases in darkness would not produce long duration plasma clouds because of the lack of photo excitation and photoionization.

  18. Reactive Materials for Evaporating Samarium (Pre-Print)

    Science.gov (United States)

    2016-04-15

    SUBJECT TERMS energetic materials, heat sources, pyrotechnic charges, easily ionized metals 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF...experiments.    Keywords:  energetic  materials, heat sources, pyrotechnic charges, easily ionized metals  1. Introduction Ejection of clouds of...results  were  negatively  affected  by  reduced  efficiency   of  release  and  ionization of samarium [8]. It is possible that not the entire charge of

  19. 21 CFR 133.138 - Edam cheese.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Edam cheese. 133.138 Section 133.138 Food and... CONSUMPTION CHEESES AND RELATED CHEESE PRODUCTS Requirements for Specific Standardized Cheese and Related Products § 133.138 Edam cheese. (a) Description. (1) Edam cheese is the food prepared by the procedure set...

  20. 7 CFR 1956.138 - Processing.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Processing. 1956.138 Section 1956.138 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) DEBT SETTLEMENT Debt Settlement-Community and Business Programs § 1956.138 Processing...

  1. Implementation of an analytical technique for Samarium; Implementacion de una tecnica analitica para Samario

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N. [ININ, Carretera Mexico-Toluca Km. 36.5, 52045 Estado de Mexico (Mexico)

    2004-07-01

    Since the Samarium presents the same chemical properties that the plutonium, it has been used as homologous in studies that allow us to know the behavior that the plutonium presents in solution, with the advantage of working with an inactive and not very dangerous element. At the moment studies of sorption of plutonium or samarium are made on some mineral matrices that present certain surface properties. Due to the low concentrations that are used in the studies of sorption of samarium on those reagent substrates, their detection becomes very difficult for the conventional analysis media. The luminescence is a technique that can detect lower concentrations, smaller at 1 X 10{sup -} {sup 2} M, but when fluorofors are used this limit of detection increases in several orders of magnitude. In this work it has been used the arsenazo-III as fluorofor agent since it reacts in a specific way with the samarium, forming a complex that presents a proportional luminescence to the concentration of the present samarium. The advantage of making the quantification of samarium by luminescence is that it can use the same instrumental equipment to determine the speciation of the samarium sipped in the zircon. (Author)

  2. Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

    Energy Technology Data Exchange (ETDEWEB)

    Mendes, B.M., E-mail: bmm@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Mendes, T.M.; Campos, T.P.R., E-mail: campos@nuclear.ufmg.b [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

    2011-07-01

    Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

  3. Luminescent solutions and powders of new samarium complexes with N,N',O,O'-chelating ligands

    Science.gov (United States)

    Kharcheva, Anastasia V.; Nikolskiy, Kirill S.; Borisova, Nataliya E.; Ivanov, Alexey V.; Reshetova, Marina D.; Yuzhakov, Viktor I.; Patsaeva, Svetlana V.

    2016-04-01

    Imaging techniques in biology and medicine are crucial tools to obtain information on structural and functional properties of living cells and organisms. To fulfill the requirements associated with application of these techniques it appears necessary to design markers with specific characteristics. Luminescent complexes of trivalent lanthanide ions with chelating ligands are of increasing importance in biomedical applications because of their millisecond luminescence lifetime, narrow emission band, high signal-to-noise ratio and minimal photodamage to biological samples. In order to extend the available emission wavelength range the luminescent samarium chelates are highly desirable. In this study the ligands with diamides of 2,2'-bipyridin-6,6'-dicarboxylic acid were used to improve photophysical characteristics of samarium complexes. We report the luminescence characteristics of samarium complexes with novel ligands. All complexes exhibited the characteristic emission of Sm (III) ion with the lines at 565, 597, 605, 645 and 654 nm, the intensity strongly depended on the ligand. Absorption and luminescence excitation spectra of Sm (III) complexes showed main peaks in the UV range demonstrating lanthanide coordination to the ligand. The absolute lumenescence quantum yield was measured for solutions in acetonitrile with excitation at 350 nm. The largest luminescence quantum yield was found for the samarium complex Bipy 6MePy Sm (3%) being much higher that for samarium complexes reported in the literature earlier. These results prove as well that samarium chelates are potential markers for multiparametric imaging techniques.

  4. Australian manufacture of Quadramet{sup TM} (Samarium-153 EDTMP)

    Energy Technology Data Exchange (ETDEWEB)

    Wood, N.R.; Whitwell, J. [Australian Nuclear Science and Technology Organisation (ANSTO), Lucas Heights, NSW (Australia). Australian Radioisotopes

    1997-10-01

    Quadramet{sup T} (Samarium-153 EDTMP) has been shown overseas to be potentially useful in the palliation of painful osteoblastic skeletal metastases and has been approved this year for general marketing in the USA. Australian Radioisotopes (ARI) has licensed this product from the Australian patent holders, Dow Chemical. Within the facilities of ARI, a hot cell has been dedicated to this product and fitted out to manufacture it weekly on a cycle related to the operating cycle of the Australian reactor HIFAR. Due to neutron flux limitations of HIFAR, the local formulation has an elemental Samarium content up to 200{mu}g/mL whereas the overseas formulation has a level of 20-46{mu}g/mL. All other specifications of the two products are essentially the same. In 1995 and 1996 a small clinical trial with 19 patients was held which demonstrated that the pharmacokinetic behaviour was also essentially the same by measuring blood clearance rates and skeletal uptake dynamics. Soft tissue uptake was also qualitatively determined. The ARI version is now the subject of an application for general marketing within Australia. Some useful characteristics of this agent are: almost complete excretion or fixation in the skeleton within 6 hours, rapid onset of clinical effect, applicability in most cases where an abnormal diagnostic bone scan correlates with painful sites, dosage can be tailored to individual patient uptake due to easy dose measurement and retreatment is quite possible. The use of this class of agents in pain palliation continues to increase. Australian manufacture of Quadramet{sup TM} provides a further option in the management of these difficult cases

  5. Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

    Energy Technology Data Exchange (ETDEWEB)

    Castrillejo, Y., E-mail: ycastril@qa.uva.es [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Fernandez, P. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Medina, J. [Dept Fisica Materia Condensada Cristalografia y Mineralogia, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Hernandez, P. [Centro de Investigaciones Quimicas, Universidad Autonoma del Estado de Hidalgo, Carr. Pachuca-Tulancingo Km. 4.5, C.P. 42076 Pachuca, Hidalgo (Mexico); Barrado, E. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain)

    2011-10-01

    This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) {r_reversible} Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al{sub 3}Sm and Al{sub 2}Sm.

  6. 40 CFR 35.138 - Competitive grants.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Competitive grants. 35.138 Section 35.138 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE... Competitive grants. (a) Some environmental program grants are awarded through a competitive process. An...

  7. Optical analysis of samarium doped sodium bismuth silicate glass.

    Science.gov (United States)

    Thomas, V; Sofin, R G S; Allen, M; Thomas, H; Biju, P R; Jose, G; Unnikrishnan, N V

    2017-01-15

    Samarium doped sodium bismuth silicate glass was synthesized using the melt quenching method. Detailed optical spectroscopic studies of the glassy material were carried out in the UV-Vis-NIR spectral range. Using the optical absorption spectra Judd-Ofelt (JO) parameters are derived. The calculated values of the JO parameters are utilized in evaluating the various radiative parameters such as electric dipole line strengths (Sed), radiative transition probabilities (Arad), radiative lifetimes (τrad), fluorescence branching ratios (β) and the integrated absorption cross- sections (σa) for stimulated emission from various excited states of Sm3+‡ ion. The principal fluorescence transitions are identified by recording the fluorescence spectrum. Our analysis revealed that the novel glassy system has the optimum values for the key parameters viz. spectroscopic quality factor, optical gain, stimulated emission cross section and quantum efficiency, which are required for a high performance optical amplifier. Calculated chromaticity co-ordinates (0.61, 0.38) also confirm its application potential in display devices. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. Samarium Monosulfide (SmS): Reviewing Properties and Applications.

    Science.gov (United States)

    Sousanis, Andreas; Smet, Philippe F; Poelman, Dirk

    2017-08-16

    In this review, we give an overview of the properties and applications of samarium monosulfide, SmS, which has gained considerable interest as a switchable material. It shows a pressure-induced phase transition from the semiconducting to the metallic state by polishing, and it switches back to the semiconducting state by heating. The material also shows a magnetic transition, from the paramagnetic state to an antiferromagnetically ordered state. The switching behavior between the semiconducting and metallic states could be exploited in several applications, such as high density optical storage and memory materials, thermovoltaic devices, infrared sensors and more. We discuss the electronic, optical and magnetic properties of SmS, its switching behavior, as well as the thin film deposition techniques which have been used, such as e-beam evaporation and sputtering. Moreover, applications and possible ideas for future work on this material are presented. Our scope is to present the properties of SmS, which were mainly measured in bulk crystals, while at the same time we describe the possible deposition methods that will push the study of SmS to nanoscale dimensions, opening an intriguing range of applications for low-dimensional, pressure-induced semiconductor-metal transition compounds.

  9. Excitation induced spectroscopic study and quenching effect in cerium samarium codoped lithium aluminoborate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Parvinder; Kaur, Simranpreet [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Singh, Gurinder Pal [Department of Physics, Khalsa College, Amritsar 143002 (India); Arora, Deepawali; Kumar, Sunil [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Singh, D.P., E-mail: dpsinghdr@yahoo.com [Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India)

    2016-08-15

    Lithium aluminium borate host has been codoped with cerium and samarium to prepare glass by conventional melt quench technique. Their structural and spectroscopic investigation has been carried out using XRD, FTIR and density measurements. The UV‐Vis absorption spectra and fluorescence spectra (λ{sub exc}.=380 nm and 400 nm) have been studied for spectroscopic analysis. The amorphous nature of the prepared samples is shown by XRD. The density is increasing with addition of cerium at the expense of aluminium, keeping other components constant. FTIR study also shows the presence of compact and stable tetrahedral BO{sub 4} units thus supporting the density results. The UV‐ Vis absorption spectra show a shift of optical absorption edge towards longer wavelength along with an increase in intensity of peaks with rising samarium concentration. The fluorescence spectra show a blue shift and subsequent suppression of cerium peaks with addition of samarium.

  10. Effect of samarium doping on the dielectric behavior of barium zircomium titanate ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Badapanda, T., E-mail: badapanda.tanmaya@gmail.com [Department of Physics, C.V. Raman College of Engineering, Bhubaneswar, Odisha-752054 (India); Sarangi, S.; Behera, B. [School of Physics, Sambalpur University, Jyoti Vihar Sambalpur, Odisha-768019 (India); Anwar, S. [Colloids and Materials Chemistry, Institute of Minerals and Materials Technology, Bhubaneswar, Odisha-751013 (India); Sinha, T. P. [Department of Physics, Bose Institute, Kolkata-700009 (India)

    2014-04-24

    Samarium doped Barium Zirconium Titanate ceramic with general formula Ba{sub 1−x}Sm{sub 2x/3}Zr{sub 0.05}Ti{sub 0.95}O{sub 3} [x=0.0,0.01,0.02,0.03,0.04] has been prepared by high energy ball milling. The X-ray diffraction (XRD) patterns confirmed that these ceramics have a single phase with perovskite-type upto x≤0.03 and a small secondary phase exist at x=0.04. The temperature dependent dielectric study shows a ferroelectric phase transition and transition temperature decreases with an increase in the Samarium content.

  11. Lithium Bromide/Water as Additives in Dearomatizing Samarium-Ketyl (Hetero)Arene Cyclizations.

    Science.gov (United States)

    Rao, Chintada Nageswara; Bentz, Christoph; Reissig, Hans-Ulrich

    2015-11-02

    New conditions for dearomatizing samarium-ketyl (hetero)arene cyclizations are reported. In many examples of these samarium diiodide-mediated reactions, lithium bromide and water can be used as additives instead of the carcinogenic and mutagenic hexamethylphosphoramide (HMPA). The best results were obtained for the cyclizations of N-acylated indole derivatives delivering the expected indolines in good yields and excellent diastereoselectivities. A new type of cyclization delivering indolyl-substituted allene derivatives is also described. The scope and limitations of the lithium bromide/water system are discussed. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. 45 CFR 147.138 - Patient protections.

    Science.gov (United States)

    2010-10-01

    ... INSURANCE REFORM REQUIREMENTS FOR THE GROUP AND INDIVIDUAL HEALTH INSURANCE MARKETS § 147.138 Patient... participant (in the individual market, primary subscriber) of the terms of the plan or health insurance.... If a group health plan, or a health insurance issuer offering group or individual health insurance...

  13. 49 CFR 176.138 - Deck stowage.

    Science.gov (United States)

    2010-10-01

    ... Requirements for Class 1 (Explosive) Materials Stowage § 176.138 Deck stowage. (a) [Reserved] (b) Class 1 (explosive) materials may not be stowed within a horizontal distance of 6 m (20 feet) from any fire.... They must be clear of walkways and cargo working areas, fire hydrants, steam pipes, and means of access...

  14. RNF138 joins the HR team

    DEFF Research Database (Denmark)

    Bekker-Jensen, Simon; Mailand, Niels

    2015-01-01

    Two studies show that the E3 ubiquitin ligase RNF138 is recruited to DNA double-strand break sites, where it ubiquitylates key repair factors to promote DNA-end resection and homologous recombination. These findings add insights into the multilayered regulatory mechanisms underlying DNA double-st...

  15. One-step synthesis of samarium-doped ceria and its CO catalysis

    Indian Academy of Sciences (India)

    The samarium-doped ceria (SDC) nanospheres were prepared by the one-step hydrothermal method and characterized by transmission electron microscope, scanning electron microscope, powder X-ray diffraction, X-ray photoelectron spectroscopy, energy-dispersive spectrometer and Raman spectra. According to the ...

  16. A spectroscopic comparison of samarium-doped LiYF4 and KY3F10

    NARCIS (Netherlands)

    Wells, J. P. R.; Sugiyama, A.; Han, T. P. J.; Gallagher, H. G.

    2000-01-01

    Laser selective excitation and fluorescence has been performed on LiYF4 and KY3F10 doped with samarium ions. In LiYF4, a single, tetragonal symmetry center associated with isovalent substitution of Sm3+ with lattice yttrium ions is present. By contrast, three Sm2+ centres and a single, tetragonal

  17. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  18. The Use of a Flexible Calix[4]arene Template to Stabilize a Cyclooctatetraindiyl Samarium-Potassium Complex

    Directory of Open Access Journals (Sweden)

    Geoffroy Guillemot

    2013-01-01

    Full Text Available A sandwich compound of cyclooctatetraendiyl (COT2− samarium-potassium was synthesized and analyzed using a flexible calix[4]arene dianion. This compound, [p-tBu-calix[4]-(OMe2(O2]arenediyl-samarium-(η8-cyclooctatetraendiyl-potassium (tetrahydrofurane3, is constructed as a linear sequence L-Sm--K-, where L, , and are specific ligands with L = O,O-dimethyl-calix[4]arene2−, = cyclo-octatetraendiyl, and = tetrahydrofurane templates.

  19. Solar nebula heterogeneity in p-process samarium and neodymium isotopes.

    Science.gov (United States)

    Andreasen, Rasmus; Sharma, Mukul

    2006-11-03

    Bulk carbonaceous chondrites display a deficit of approximately 100 parts per million (ppm) in 144Sm with respect to other meteorites and terrestrial standards, leading to a decrease in their 142Nd/144Nd ratios by approximately 11 ppm. The data require that samarium and neodymium isotopes produced by the p process associated with photodisintegration reactions in supernovae were heterogeneously distributed in the solar nebula. Other samarium and neodymium isotopes produced by rapid neutron capture (r process) in supernovae and by slow neutron capture (s process) in red giants were homogeneously distributed. The supernovae sources supplying the p- and r-process nuclides to the solar nebula were thus disconnected or only weakly connected.

  20. Samarium(II) iodide-mediated reductive annulations of ketones bearing a distal vinyl epoxide moiety

    Energy Technology Data Exchange (ETDEWEB)

    Molander, G.A.; Shakya, S.R. [Univ. of Colorado, Boulder, CO (United States)

    1996-08-23

    It was found that samarium (II) iodide promotes the intramolecular coupling of ketones with distal epoxy olefins while in the presence of hexamethylphosphoramide (HPMA). A number of epoxide compounds (1 a-k) fragment to form carbocycles with allylic alcohol side chains with high diastereoselectivity (2 a-k). Substituting tetramethylguanidine for HPMA reduces the diastereoselectivity. Adding Pd(0) as a catalyst reverses the diastereoselective sense. 40 refs., 1 tab.

  1. A temporal three-dimensional simulation of samarium release in the ionosphere

    Science.gov (United States)

    Zhao, Hai-Sheng; Feng, Jie; Xu, Zheng-Wen; Wu, Jian; Wu, Zhen-Sen; Xu, Bin; Xue, Kun; Xu, Tong; Hu, Yan-Li

    2016-10-01

    For understanding plasma processes of the ionosphere and magnetosphere, the alkali and alkaline-earth metals are usually released in space for artificially increasing the electron density. However, it is a limitation that these releases must be in sunlight where the photoionization can take place. In recent years, the lanthanide metals, such as samarium, have been released to produce electrons in reaction with atomic oxygen in the upper space. The reaction could proceed without sunlight so that the restriction on experimental periods is broken. Unfortunately, any sophisticated models even preliminary ones are unavailable yet in the literature. A temporal three-dimensional model is presented for the samarium release in detail with respect to various altitudes and mass. Especially, the plasma diffusion equation is remarkably extended from 2-D to 3-D by importing the influence of geomagnetic declination, which could be also useful for other chemical releases. The field-aligned terms are brought so as to the presented model can describe the diffusion along the geomagnetic field subtly. On the basis of the presented model, behaviors of radio waves propagating through the release area are simulated by using ray tracing. This model could be as the theoretical support for samarium releases, and it also helpful for the research on the generation and evolution of the ionosphere irregularities.

  2. 22 CFR Appendix A to Part 138 - Certification Regarding Lobbying

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Certification Regarding Lobbying A Appendix A to Part 138 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Pt. 138, App. A Appendix A to Part 138—Certification Regarding Lobbying Certification for Contracts, Grants...

  3. 22 CFR 138.300 - Professional and technical services.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professional and technical services. 138.300 Section 138.300 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Activities by Other Than Own Employees § 138.300 Professional and technical services. (a) The prohibition on...

  4. 32 CFR 935.138 - Motor bus operation.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Motor bus operation. 935.138 Section 935.138 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE TERRITORIAL AND INSULAR REGULATIONS WAKE ISLAND CODE Motor Vehicle Code § 935.138 Motor bus operation. Each person operating a motor...

  5. Liquid–liquid anion exchange extraction studies of samarium(III from salicylate media using high molecular weight amine

    Directory of Open Access Journals (Sweden)

    Aniruddha M. Mandhare

    2015-07-01

    Full Text Available Liquid–liquid extraction and separation of samarium(III were carried out by using 0.025 mol dm−3 2-octylaminopyridine(2-OAP in xylene at 298 K. The extraction behavior of samarium was studied as a function of pH, weak acid concentration, extractant concentration, diluent, and equilibration time. Samarium was quantitatively extracted at pH 7.5 to 10.0 from 0.01 mol dm−3 sodium salicylate solution with 0.025 mol dm−3 2-OAP. The possible composition of the extracted species in organic phase has been determined by using model of slope analysis method and extraction mechanism was found to proceed via an anion exchange mechanism. The stripping efficiency was found to be quantitative in HNO3, HCl and CH3COOH. The robustness of the procedure was demonstrated by the average recoveries obtained (>99.6% for samarium(III extraction in the presence of several cations and anions which are commonly associated with it. The proposed method facilitates the separation and determination of samarium(III from binary and synthetic mixtures. The various thermodynamic functions like free energy (ΔG, enthalpy (ΔH and entropy (ΔS of extraction mechanism were discussed.

  6. Samarium(II) iodide-mediated intramolecular conjugate additions of alpha,beta-unsaturated lactones.

    Science.gov (United States)

    Molander, Gary A; St Jean, David J

    2002-05-31

    Samarium(II) iodide, in the presence of catalytic amounts of nickel(II) iodide, has been used to promote intramolecular conjugate additions of alkyl halides onto alpha,beta-unsaturated lactones. This process has been shown to be applicable to a number of alpha,beta-unsaturated lactones, including tetrasubstituted olefins, and has been demonstrated to be quite general for the formation of saturated bicyclic and tricyclic lactones. The method presented herein provides a mild, efficient process to form structurally complex lactones from simple precursors.

  7. 42 CFR 433.138 - Identifying liable third parties.

    Science.gov (United States)

    2010-10-01

    ... relationship to the applicant or recipient, the social security number (SSN) of the policy holder, and the name... 42 Public Health 4 2010-10-01 2010-10-01 false Identifying liable third parties. 433.138 Section 433.138 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN...

  8. 7 CFR 1703.138-1703.139 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false 1703.138-1703.139 Section 1703.138-1703.139 Agriculture Regulations of the Department of Agriculture (Continued) RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE RURAL DEVELOPMENT Distance Learning and Telemedicine Combination Loan and Grant Program §§ 1703...

  9. 19 CFR 10.138 - Proof of use.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Proof of use. 10.138 Section 10.138 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY... of a given type of merchandise from a particular importer during a given period, or all such...

  10. 22 CFR 138.600 - Semi-annual compilation.

    Science.gov (United States)

    2010-04-01

    ... Relations of the Senate and the Committee on Foreign Affairs of the House of Representatives or the... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Semi-annual compilation. 138.600 Section 138.600 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Agency Reports...

  11. Ekstraksi Pemisahan Neodimium dari Samarium, Itrium dan Praseodimium Memakai Tri Butil Fosfat

    Directory of Open Access Journals (Sweden)

    Maria Veronica Purwani

    2017-05-01

    Full Text Available The extraction of Nd(OH3 (neodymium hydroxide concentrate containing Y (yttrium, Sm (samarium and Pr (praseodymium as product of monazite processed has been done. The purpose of this study is to determine the separation of Nd from Y, Pr and Nd Sm in Nd concentrate. The aqueous phase was concentrated Nd (OH3 in HNO3 and extractant while organic phase was Tri Butyl Phosphate (TBP in kerosene. Parameters studied were pH and concentration feed, concentration of TBP in kerosene, extraction time and stirring speed. The result showed that the optimization of separation extraction neodymium from samarium, yttrium and praseodymium in Nd(OH3 concentrated with TBP, obtained the optimum condition of pH = 0.2, concentration of feed 100 g /L, concentration of TBP in kerosene 5%, extraction time 15 minutes and stirring speed 150 rpm. With the conditions, Separation Factor (SF obtained for Nd-Y, Nd-Pr, Nd-Sm are 2.242, 4.811, 4.002 respectively, while D and extraction efficiency of Nd are 0.236 and 19.07%.

  12. X-Band Microwave Reflection Properties of Samarium/Bismuth-Substituted Barium Lanthanum Titanate Ceramics

    Science.gov (United States)

    Bahel, Shalini; Pubby, Kunal; Narang, Sukhleen Bindra

    2017-03-01

    Samarium/bismuth-substituted barium lanthanum titanate ceramics with chemical composition Ba4 (La_{1 - y - z} Smy Biz )_{9.33} Ti_{18} O_{54} ( y = 0.5, 0.7; z = 0.05, 0.10, 0.15), intended as microwave reflecting materials, have been investigated in microwave X-band (8.2 GHz to 12.4 GHz) and the effect of substitution on their dielectric properties, i.e., dielectric constant and dielectric loss tangent, has been studied by vector network analyzer. Dielectric analysis showed that the dielectric constant increased with increasing samarium as well as bismuth content. Dielectric relaxation was observed for all samples in the scanned frequency range. Microwave reflection and transmission analysis of ceramic pellets of thickness 4 mm was carried out using two methods, i.e., open- and short-circuit approach, both indicating very high values of reflected power and very low values of transmitted power for all the doped materials in comparison with the base composition. The doped compositions are therefore potential microwave shielding materials for use in anechoic chambers, microwave laboratories, and radar equipment. Double-layer reflectors are also proposed, having better reflection properties (˜99% reflection) compared with single-layer reflectors.

  13. Microstructure and hysteresis curves of samarium-holmium-iron garnet synthesized by coprecipitation

    Directory of Open Access Journals (Sweden)

    Caffarena Valeska da Rocha

    2003-01-01

    Full Text Available An investigation was made into the synthesis and magnetic properties of Sm(3-xHo xFe5O12 (samarium-holmium-iron garnet ferrite, as yet absent from the literature. The material in question was synthesized by co-precipitation, starting from hydrated chlorides of rare-earth elements and ferrous sulfate, and the mixed hydroxide co-precipitate was calcined at 1000 °C. Using PVA as a binder, rectangular cross section-shaped compacts were produced by means of steel-die pressing, drying and sintering from 1200 to 1450 °C. The main conclusions of this study were that the coercive force decreases as the sintering temperature increases, and that the effect of substituting holmium for samarium in SmIG is entirely different from that provided by replacing yttrium by gadolinium in YIG, which is the most important result of this work. An in-depth investigation will be necessary to determine the correlation between microstructure/magnetic properties and ceramic processing variables.

  14. Bone-seeking radiopharmaceuticals as targeted agents of osteosarcoma: samarium-153-EDTMP and radium-223.

    Science.gov (United States)

    Anderson, Peter M; Subbiah, Vivek; Rohren, Eric

    2014-01-01

    Osteosarcoma is a cancer characterized by formation of bone by malignant cells. Routine bone scan imaging with Tc-99m-MDP is done at diagnosis to evaluate primary tumor uptake and check for bone metastases. At time of relapse the Tc-99m-MDP bone scan also provides a specific means to assess formation of bone by malignant osteosarcoma cells and the potential for bone-seeking radiopharmaceuticals to deliver radioactivity directly into osteoblastic osteosarcoma lesions. This chapter will review and compare a bone-seeking radiopharmaceutical that emits beta-particles, samarium-153-EDTMP, with an alpha-particle emitter, radium-223. The charged alpha particles from radium-223 have far more mass and energy than beta particles (electrons) from Sm-153-EDTMP. Because radium-223 has less marrow toxicity and more radiobiological effectiveness, especially if inside the bone forming cancer cell than samarium-153-EDTMP, radium-223 may have greater potential to become widely used against osteosarcoma as a targeted therapy. Radium-223 also has more potential to be used with chemotherapy against osteosarcoma and bone metastases. Because osteosarcoma makes bone and radium-223 acts like calcium, this radiopharmaceutical could possibly become a new targeted means to achieve safe and effective reduction of tumor burden as well as facilitate better surgery and/or radiotherapy for difficult to resect large, or metastatic tumors.

  15. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Science.gov (United States)

    Liu, Peng; Wang, Yunjiao; Wang, Xue; Yang, Chao; Yi, Yanfeng

    2012-11-01

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm2O3 nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm2O3) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm2O3 composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm2O3 composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm2O3 composite at a current density of 20 mA cm-2 in a 1.0 M NaNO3 electrolyte solution, a maximum discharge capacity of 771 F g-1 was achieved in a half-cell setup configuration for the PPy/Sm2O3 composites electrode with the potential application to electrode materials for electrochemical capacitors.

  16. Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Liu Peng, E-mail: pliu@lzu.edu.cn; Wang Yunjiao; Wang Xue; Yang Chao; Yi Yanfeng [College of Chemistry and Chemical Engineering, Lanzhou University, Key Laboratory of Nonferrous Metal Chemistry and Resources Utilization of Gansu Province and State Key Laboratory of Applied Organic Chemistry (China)

    2012-11-15

    Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm{sub 2}O{sub 3} nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm{sub 2}O{sub 3}) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm{sub 2}O{sub 3} composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm{sub 2}O{sub 3} composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm{sub 2}O{sub 3} composite at a current density of 20 mA cm{sup -2} in a 1.0 M NaNO{sub 3} electrolyte solution, a maximum discharge capacity of 771 F g{sup -1} was achieved in a half-cell setup configuration for the PPy/Sm{sub 2}O{sub 3} composites electrode with the potential application to electrode materials for electrochemical capacitors.

  17. Dicty_cDB: VSA138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSA138 (Link to dictyBase) - - - Contig-U15185-1 VSA138E (Link to Original site)...- - - - - - VSA138E 332 Show VSA138 Library VS (Link to library) Clone ID VSA138 (Link to dictyBase)...AL116011 |AL116011.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 3e-15...AL116009 |AL116009.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 3e-15...AL115603 |AL115603.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 3e-15

  18. Behavior of Samarium III during the sorption process; Comportamiento del Samario-III durante el proceso de sorcion

    Energy Technology Data Exchange (ETDEWEB)

    Ordonez R, E.; Garcia G, N.; Garcia R, G. [ININ, Carr. Mexico-Toluca Km 36.5, Salazar, Estado de Mexico (Mexico)]. e-mail: edo@nuclear.inin.mx

    2004-07-01

    In this work the results of the behavior of samarium in solution are presented, in front of a fine powder of zirconium silicate (zircon). For that which is necessary to characterize the zircon, studying the crystallinity, the morphology, the surface area and the isoelectric point. The behavior of samarium in solution is studied by means of the elaboration of isotherm of sorption, using the technique by lots. One observes that to pH values of nearer to the isoelectric point (pH = 7.23) the process of sorption of the samarium begins, reaching a maximum to near pH at 9. The technique of luminescence is used to determine the concentration of the sipped samarium (phosphorescence) and also to make the speciation of the species formed in the surface of the zircon (phosphorescence). The results can be extrapolated with the plutonium when making the modeling of the migration of alpha emitting coming from the repositories of radioactive waste since both they have similar chemical properties (they are homologous). (Author)

  19. Neutron and Charged-Particle Induced Cross Sections for Radiochemistry in the Region of Samarium, Europium, and Gadolinium

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R D; Kelley, K; Dietrich, F S; Bauer, R; Mustafa, M

    2004-11-30

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron and proton induced nuclear reaction cross sections in the mass region of samarium, europium and gadolinium (62 {le} Z {le} 64, 82 {le} N {le} 96).

  20. Pemisahan Unsur Samarium dan Yttrium dari Mineral Tanah Jarang dengan Teknik Membran Cair Berpendukung (Supported Liquid Membrane

    Directory of Open Access Journals (Sweden)

    Amri Amin

    2009-06-01

    Full Text Available he increasing use of rare earth elements in high technology industries needs to be supported by developmental work for the separation of elements. The research objective is fiercely attracting and challenging considering the similarity of bath physical and chemical properties among these elements. The rate separation of samarium and yttrium elements using supported liquid membrane has been studied. Polytetrafluoroethylene (PTFE with pore size of 0.45 µm has been used as the membrane and di(2-ethylhexyl phosphate (D2EHP in hexane has been used as a carrier and nitric acid solution has been used as receiving phase. Result of experiments showed that the best separation rate of samarium and yttrium elements could be obtained at feeding phase of pH 3.0, di(2-ethylhexyl phosphate (D2EHP concentration of 0.3 M, agitation rate of 700 rpm, agitation time of 2 hours, and nitric acid and its solution concentrations of 1.0 M and 0.1 M, respectively. At this condition, separation rates of samarium and yttrium were 64.4 and 67.6%, respectively.   Keywords: liquid membrane, rare earth elements, samarium, yttrium

  1. Effects of the atomic environment on the electron binding energies in samarium

    Energy Technology Data Exchange (ETDEWEB)

    Inoyatov, A.Kh., E-mail: inoyatov@jinr.ru [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Institute of Applied Physics, National University, Tashkent, Republic of Uzbekistan (Uzbekistan); Kovalík, A. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Nuclear Physics Institute of the ASCR, CZ-25068 Řež near Prague (Czech Republic); Filosofov, D.V. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Ryšavý, M.; Vénos, D. [Nuclear Physics Institute of the ASCR, CZ-25068 Řež near Prague (Czech Republic); Yushkevich, Yu.V.; Perevoshchikov, L.L. [Laboratory of Nuclear Problems, JINR, Dubna, Moscow Region (Russian Federation); Zhdanov, V.S. [Nuclear Physics Institute, Almaty, Republic of Kazakhstan (Kazakhstan)

    2016-02-15

    Highlights: • Eight different matrices (evaporated and implanted at 30 keV) used. • The greatest average difference in the binding energies amounted to 3.1 ± 0.1 eV. • The presence of trivalent and divalent Sm ions found in some implanted samples. • No significant differences in Sm natural atomic level widths were observed. - Abstract: Effects of the atomic environment on the L{sub 1}, L{sub 2}, L{sub 3}, M{sub 1}, M{sub 2}, M{sub 3}, and N{sub 1} electron binding energies in samarium generated in the electron capture decay of radioactive {sup 149}Eu were investigated by means of the internal conversion electron spectroscopy using the conversion electron spectrum of the 22.5 keV M1 + E2 nuclear transition in the daughter {sup 149}Sm. In this investigation, four pairs of {sup 149}Eu sources prepared by vacuum evaporation deposition and by ion implantation at 30 keV with the use of four different source backing materials, namely polycrystalline carbon, aluminium, gadolinium and platinum foils, were employed. The greatest average difference of (3.1 ± 0.1) eV in the L{sub 1}, L{sub 2}, L{sub 3}, and M{sub 1} subshell electron binding energies was observed between the {sup 149}Eu sources prepared by ion implantation into the aluminium and platinum substrates. On the other hand, minimal differences in the electron binding energies were generally found between samarium generated in the evaporated layer and in the bulk for the individual investigated source backings with the exception of the gadolinium foil. A doublet structure of all investigated conversion electron lines with the average values of 8.1 ± 0.2 eV and 1.5 ± 0.1 for the separation energy and the intensity ratio of the low-energy to high-energy components, respectively, was observed for the {sup 149}Eu sources prepared by ion implantation into the aluminium and carbon foils. This structure was presumably caused by the presence of both the trivalent and divalent Sm ions in the sources. No

  2. 33 CFR 138.65 - Issuance of Certificates.

    Science.gov (United States)

    2010-07-01

    ... Section 138.65 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... Responsibility (Water Pollution) (Form CG-5585) in electronic form. Copies of the Certificate may be downloaded from NPFC's E-COFR Web site. ...

  3. Multiphoton laser wave-mixing absorption spectroscopy for samarium using a graphite furnace atomizer

    Energy Technology Data Exchange (ETDEWEB)

    Maniaci, Michael J.; Tong, William G. E-mail: william.tong@sdsu.edu

    2004-07-30

    Nonlinear laser wave-mixing optical technique is presented as a sensitive atomic spectroscopic method for the analysis of rare earth elements using an unmodified commercially available graphite furnace (GF) atomizer. A simple nonplanar backward-scattering degenerate four-wave mixing optical arrangement offers sub-picogram detection sensitivity with sub-Doppler Lorentzian-broadened resolution. Nonlinear wave mixing is an unusually sensitive absorption-based optical method that offers both excellent detection sensitivity and sub-Doppler spectral resolution. A mass detection limit of 0.7 pg and a concentration detection limit of 70 pg/ml are determined for a rare earth element, samarium, using the 429.7-nm excitation line.

  4. Samarium Doped Cerium Oxide Clusters: a Study on the Modulation of Electronic Structure

    Science.gov (United States)

    Topolski, Josey E.; Kafader, Jared O.; Marrero-Colon, Vicmarie; Chick Jarrold, Caroline

    2017-06-01

    Cerium oxide is known for its use in solid oxide fuel cells due to its high ionic conductivity. The doping of trivalent samarium atoms into cerium oxide is known to enhance the ionic conductivity through the generation of additional oxygen vacancies. This study probes the electronic structure of Sm_{x}Ce_{y}O_{z} (x+y=3, z=2-4) anion and neutral clusters. Anion photoelectron spectra of these mixed metal clusters exhibit additional spectral features not present in the previously studied cerium oxide clusters. Density functional theory calculations have been used to aid interpretation of collected spectra. The results of this work can be used to inform the design of materials used for solid oxide fuel cells.

  5. Chelating Ligand-Mediated Hydrothermal Synthesis of Samarium Orthovanadate with Decavanadate as Vanadium Source

    Directory of Open Access Journals (Sweden)

    Quanguo Li

    2013-01-01

    Full Text Available A new ethylenediaminetetraacetic acid- (EDTA- mediated hydrothermal route to prepare chrysanthemum-shaped samarium orthovanadate (SmVO4 nanocrystals with decavanadate (K6V10O28·9H2O as vanadium source has been developed. The present hydrothermal approach is simple and reproducible and employs a relatively mild reaction temperature. The EDTA, pH value, and temperature of the reaction systems play important roles in determining the morphologies and growth process of the SmVO4 products. The products have been characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM, Fourier transform infrared spectroscopy (FT-IR, photoluminescence spectra (PL, and UV-Vis spectroscopy.

  6. The Magnetocaloric Effect and Heat Capacity of Suspensions of High-Dispersity Samarium Ferrite

    Science.gov (United States)

    Korolev, V. V.; Aref'ev, I. M.; Ramazanova, A. G.

    2008-02-01

    The magnetocaloric effect and specific heat capacity of an aqueous suspension of samarium ferrite were determined calorimetrically over the temperature range 288-343 K in magnetic fields of 0-0.7 T. The data obtained were used to calculate changes in the magnetic component of the molar heat capacity and entropy of the magnetic phase and changes in the enthalpy of the process under an applied magnetic field. The magnetocaloric effect was found to increase nonlinearly as the magnetic field induction grew. The corresponding temperature dependences contained a maximum at 313 K related to the second-order magnetic phase transition at the Curie point. The field and temperature dependences of heat capacity contained a maximum in fields of 0.4 T and a minimum at the magnetic phase transition temperature.

  7. Preparation of hollow core/shell microspheres of hematite and its adsorption ability for samarium.

    Science.gov (United States)

    Yu, Sheng-Hui; Yao, Qi-Zhi; Zhou, Gen-Tao; Fu, Sheng-Quan

    2014-07-09

    Hollow core/shell hematite microspheres with diameter of ca. 1-2 μm have been successfully achieved by calcining the precursor composite microspheres of pyrite and polyvinylpyrrolidone (PVP) in air. The synthesized products were characterized by a wide range of techniques including powder X-ray diffraction (XRD), field-emission scanning electron microscopy (FESEM), energy-dispersive X-ray spectroscopy (EDX), transmission electron microscopy (TEM), high-resolution TEM (HRTEM), thermogravimetric analysis (TGA) and differential scanning calorimetry (DSC), and Brunauer-Emmett-Teller (BET) gas sorptometry. Temperature- and time-dependent experiments unveil that the precursor pyrite-PVP composite microspheres finally transform into hollow core/shell hematite microspheres in air through a multistep process including the oxidation and sulfation of pyrite, combustion of PVP occluded in the precursor, desulfation, aggregation, and fusion of nanosized hematite as well as mass transportation from the interior to the exterior of the microspheres. The formation of the hollow core/shell microspheres dominantly depends on the calcination temperature under current experimental conditions, and the aggregation of hematite nanocrystals and the core shrinking during the oxidation of pyrite are responsible for the formation of the hollow structures. Moreover, the adsorption ability of the hematite for Sm(III) was also tested. The results exhibit that the hematite microspheres have good adsorption activity for trivalent samarium, and that its adsorption capacity strongly depends on the pH of the solution, and the maximum adsorption capacity for Sm(III) is 14.48 mg/g at neutral pH. As samarium is a typical member of the lanthanide series, our results suggest that the hollow hematite microspheres have potential application in removal of rare earth elements (REEs) entering the water environment.

  8. The influence of the technological parameters on the ionic conductivity of samarium doped ceria thin films

    Directory of Open Access Journals (Sweden)

    Mantas Sriubas

    2015-03-01

    Full Text Available Sm0,20Ce0,80O2 powder was used for the formation of samarium doped cerium oxide (SDC thin films using e-beam. Surface area of powder was 34.9 m2/g and particle size – 0.3-0.5 μm. Thin films were deposited using physical vapor deposition system on SiO2 and Alloy 600 substrates. 2 Å/s – 16 Å/s growth rate and 20 °C – 600 °C substrate temperature were used during the deposition. Ionic conductivity investigation revealed that the maximum ionic conductivity (1.67 S/m has the thin film deposited on 300 °C temperature substrate using 4 Å/s growth rate. Minimum ionic conductivity (0.26 S/m has thin film which was deposited on 20 °C temperature substrate using 8 Å/s growth rate. Vacancy activation energies vary in 0.87 eV – 0.97 eV range. Furthermore the calculations of crystallite size revealed that crystallite size increases with increasing substrate temperature: from 7.50 nm to 46.23 nm on SiO2 substrate and from 9.30 nm to 44.62 nm on Alloy 600 substrate. Molar concentration of samarium in initial evaporated material is 19.38 mol% and varies from 11.37 mol% to 21 mol% in formed thin films depending on technological parameters.DOI: http://dx.doi.org/10.5755/j01.ms.21.1.5700

  9. Formation of Core-Shell Nanoparticles Composed of Magnetite and Samarium Oxide in Magnetospirillum magneticum Strain RSS-1.

    Science.gov (United States)

    Shimoshige, Hirokazu; Nakajima, Yoshikata; Kobayashi, Hideki; Yanagisawa, Keiichi; Nagaoka, Yutaka; Shimamura, Shigeru; Mizuki, Toru; Inoue, Akira; Maekawa, Toru

    2017-01-01

    Magnetotactic bacteria (MTB) synthesize magnetosomes composed of membrane-enveloped magnetite (Fe3O4) or greigite (Fe3S4) particles in the cells. Recently, several studies have shown some possibilities of controlling the biomineralization process and altering the magnetic properties of magnetosomes by adding some transition metals to the culture media under various environmental conditions. Here, we successfully grow Magnetospirillum magneticum strain RSS-1, which are isolated from a freshwater environment, and find that synthesis of magnetosomes are encouraged in RSS-1 in the presence of samarium and that each core magnetic crystal composed of magnetite is covered with a thin layer of samarium oxide (Sm2O3). The present results show some possibilities of magnetic recovery of transition metals and synthesis of some novel structures composed of magnetic particles and transition metals utilizing MTB.

  10. Co-reduction of aluminium and lanthanide ions in molten fluorides: Application to cerium and samarium extraction from nuclear wastes

    Energy Technology Data Exchange (ETDEWEB)

    Gibilaro, M. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France); Massot, L. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France)], E-mail: massot@chimie.ups-tlse.fr; Chamelot, P.; Taxil, P. [Laboratoire de Genie Chimique UMR 5503, Departement Procedes Electrochimiques, Universite de Toulouse, 31062 Toulouse Cedex 9 (France)

    2009-09-01

    This work concerns the method of co-reduction process with aluminium ions in LiF-CaF{sub 2} medium (79-21 mol.%) on tungsten electrode for cerium and samarium extraction. Electrochemical techniques such as cyclic and square wave voltammetries, and potentiostatic electrolyses were used to study the co-reduction of CeF{sub 3} and SmF{sub 3} with AlF{sub 3}. For each of these elements, specific peaks of Al-Ce and Al-Sm alloys formation were observed by voltammetry as well as peaks of pure cerium and aluminium, and pure samarium and aluminium respectively. The difference of potential measured between the solvent reduction and the alloy formation suggests expecting an extraction efficiency of 99.99% of each lanthanide by the process. Different intermetallic compounds were obtained for different potentiostatic electrolysis and were characterised by Scanning Electron Microscopy with EDS probe. The validity of the process was verified by carrying out cerium and samarium extractions in the form of Al-Ln alloy; the extraction efficiency was 99.5% for Ce(III) and 99.4% for Sm(III)

  11. Structural and luminescence properties of samarium doped lead alumino borate glasses

    Science.gov (United States)

    Mohan, Shaweta; Kaur, Simranpreet; Singh, D. P.; Kaur, Puneet

    2017-11-01

    The study reports the effect of samarium concentration on the physical, structural and spectroscopic characteristics of samarium doped lead alumino borate glasses having composition 20PbO-(10-x)Al2O3-70B2O3-xSm2O3; x = 0.1, 0.5, 1.0 and 2.0 mol %. The glasses were fabricated by conventional melt-quenching technique and then characterized by XRD, FTIR, optical absorption and fluorescence spectra. X-ray diffraction studies confirmed the amorphous nature of the prepared glasses. FTIR spectra indicate the presence of BO3, BO4, AlO6 and a few other structural groups. Various physical properties such as density, molar volume, refractive index, rare earth ion concentration, boron-boron distance and polarizability etc. were determined using conventional methods and standard formulae. The Judd-Ofelt theory was applied on the optical absorption spectra of the glasses to evaluate the three phenomenological intensity parameters Ω2, Ω4 and Ω6. The value of Ω2 was found to be highest for glass with 1 mol% Sm2O3 and attributed to the asymmetry of the ligand field at the rare earth ion site and the rare earth oxygen (Sm-O) covalency. The calculated intensity parameters and fluorescence spectra were further used to predict the radiative transition probability (A), radiative lifetime (τR), branching ratio (βR), peak wavelength (λp), effective line widths (Δλeff) and stimulated emission cross-section (σ) for the characteristic 4G5/2 → 6H5/2, 6H7/2 and 6H9/2 transitions of the Sm3+ ion. Concentration quenching was observed for 2 mol% concentration of Sm2O3 and ascribed to energy transfer through various cross-relaxation channels between Sm3+ ions. Reasonably high values of branching ratios and stimulated emission cross-section for the prepared glasses points towards their utility in the development of visible lasers emitting in the reddish-orange spectral region. However, the glass with 1 mol% Sm2O3 was found to show better radiative properties.

  12. Phenotype abnormality: 138 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 138 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u644i decreased efficiency... for trait of beta-fructofuranosidase activity ... decreased efficiency ... beta-fructofuranosidase activity

  13. 42 CFR 460.138 - Committees with community input.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Committees with community input. 460.138 Section... community input. A PACE organization must establish one or more committees, with community input, to do the... implementation of, and results from, the quality assessment and performance improvement plan. (c) Provide input...

  14. Nuclear structure in odd-odd nucleus [sup 138]Pr

    Energy Technology Data Exchange (ETDEWEB)

    Rizzutto, M.A.; Cybulska, E.W.; Vanin, V.R.; Oliveira, J.R.B.; Emediato, L.G.R.; Ribas, R.V.; Seale, W.A.; Rao, M.N.; Medina, N.H.; Botelho, S.; Acquadro, J.C.; Lima, C.L. (Sao Paulo Univ., SP (Brazil). Lab. Pelletron)

    1992-12-01

    With the view of extending the systematics of odd-odd Pr nuclei toward the N=82 closed shell, high-spin states in [sup 138]Pr nucleus have been investigated with the [sup 128]Te([sup 14]N, 4n[gamma]) reaction. Configurations and spin assignments are suggested for three of the observed band-structures. (orig.).

  15. X-ray Induced Luminescence Spectroscopy of Samarium Doped Barium Sulfate Prepared by Sintering Method

    Science.gov (United States)

    Kumeda, T.; Maeda, K.; Shirano, Y.; Fujiwara, K.; Sakai, K.; Ikari, T.

    2015-06-01

    X-ray induced luminescence (XL) properties of phosphor materials made of samarium doped barium sulfate have been investigated. The samples were prepared by sintering method heated at 900-1250 °C for 3 hours in air from the mixture of BaSO4 and Sm2O3. The concentration of Sm were prepared from 0.01-6 at.%. In as-prepared sample, the Sm3+ was detected by photoluminescence (PL). The PL intensity is maximum about 2 at.% with Sm, and then starts decreasing. The PL intensity showed concentration quenching. The XL observed Sm2+ and Sm3+ ions. The XL was shown from the sample sintered up to 1200 °C. The XL intensity increased with Sm concentration up to 1 at.%. The intensity was almost constant larger than 1 at.% Sm. These concentration dependences is different since the X-ray energy absorbed to the host material at once, and the energy transferred to both Sm3+ and Sm2+ ions. Sm doped BaSO4 is found a host for XL phosphor materials.

  16. High-κ Samarium-Based Metal-Organic Framework for Gate Dielectric Applications.

    Science.gov (United States)

    Pathak, Abhishek; Chiou, Guan Ru; Gade, Narsinga Rao; Usman, Muhammad; Mendiratta, Shruti; Luo, Tzuoo-Tsair; Tseng, Tien Wen; Chen, Jenq-Wei; Chen, Fu-Rong; Chen, Kuei-Hsien; Chen, Li-Chyong; Lu, Kuang-Lieh

    2017-07-05

    The self-assembly of a samarium-based metal-organic framework [Sm2(bhc)(H2O)6]n (1) in good yield was achieved by reacting Sm(NO3)3·6H2O with benzenehexacarboxylic acid (bhc) in a mixture of H2O-EtOH under hydrothermal conditions. A structural analysis showed that compound 1 crystallized in a space group of Pnmn and adopted a 3D structure with (4,8) connected nets. Temperature dependent dielectric measurements showed that compound 1 behaves as a high dielectric material with a high dielectric constant (κ = 45.1) at 5 kHz and 310 K, which is comparable to the values for some of the most commonly available dielectric inorganic metal oxides such as Sm2O3, Ta2O5, HfO2, and ZrO2. In addition, electrical measurements of 1 revealed an electrical conductivity of about 2.15 × 10-7 S/cm at a frequency of 5 kHz with a low leakage current (Ileakage = 8.13 × 10-12 Amm-2). Dielectric investigations of the Sm-based MOF provide an effective path for the development of high dielectric materials in the future.

  17. Pyroelectric properties and electrical conductivity in samarium doped BiFeO 3 ceramics

    KAUST Repository

    Yao, Yingbang

    2012-06-01

    Samarium (Sm 3+) doped BiFeO 3 (BFO) ceramics were prepared by a modified solid-state-reaction method which adopted a rapid heating as well as cooling during the sintering process. The pyroelectric coefficient increased from 93 to 137 μC/m 2 K as the Sm 3+ doping level increased from 1 mol% to 8 mol%. Temperature dependence of the pyroelectric coefficient showed an abrupt decrease above 80 °C in all samples, which was associated with the increase of electrical conductivity with temperature. This electrical conduction was attributed to oxygen vacancy existing in the samples. An activation energy of ∼0.7 eV for the conduction process was found to be irrespective of the Sm 3+ doping level. On the other hand, the magnetic Néel temperature (T N) decreased with increasing Sm 3+ doping level. On the basis of our results, the effects of Sm doping level on the pyroelectric and electrical properties of the BFO were revealed. © 2011 Elsevier Ltd. All rights reserved.

  18. Characterization of luminescent samarium doped HfO{sub 2} coatings synthesized by spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Chacon-Roa, C [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Guzman-Mendoza, J [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Aguilar-Frutis, M [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion, C.P. 11500, Mexico D.F. (Mexico); Garcia-Hipolito, M [Departamento de Materiales Metalicos y Ceramicos, Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, A.P. 70-360 Coyoacan 04510, Mexico, D.F. (Mexico); Alvarez-Fragoso, O [Departamento de Materiales Metalicos y Ceramicos, Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, A.P. 70-360 Coyoacan 04510, Mexico, D.F. (Mexico); Falcony, C [Departamento de Fisica, CINVESTAV-IPN, A. P. 14-740, 07000 Mexico D.F. (Mexico)

    2008-01-07

    Trivalent samarium (Sm{sup 3+}) doped hafnium oxide (HfO{sub 2}) films were deposited using the spray pyrolysis deposition technique. The films were deposited on Corning glass substrates at temperatures ranging from 300 to 550 deg. C using chlorides as raw materials. Films, mostly amorphous, were obtained when deposition temperatures were below 350 deg. C. However, for temperatures higher than 400 deg. C, the films became polycrystalline, presenting the HfO{sub 2} monoclinic phase. Scanning electron microscopy of the films revealed a rough surface morphology with spherical particles. Also, electron energy dispersive analysis was performed on these films. The photoluminescence and cathodoluminescence characteristics of the HfO{sub 2} : SmCl{sub 3} films, measured at room temperature, exhibited four main bands centred at 570, 610, 652 and 716 nm, which are due to the well-known intra-4f transitions of the Sm{sup 3+} ion. It was found that the overall emission intensity rose as the deposition temperature was increased. Furthermore, a concentration quenching of the luminescence intensity was also observed.

  19. Samarium-153 EDTMP for metastatic bone pain palliation: the impact of europium impurities.

    Science.gov (United States)

    Kalef-Ezra, J A; Valakis, S T; Pallada, S

    2015-02-01

    To evaluate the impact on the radiation protection policies of the radiocontaminants in Samarium-153 ethylenediamine tetramethylene phosphonate ((153)Sm-EDTMP). The internal contamination of patients treated with (153)Sm-EDMTP for palliation of painful disseminated multiple bone metastases due to long-lived impurities was assessed by direct measurements. These measurements were coupled with dose-rate measurements close to their bodies and spectroscopic analysis of the residual activity in post-treatment radiopharmaceutical vials. Whole-body counting carried out in six patients showed a 30-81-kBq europium -152 plus europium-154 contamination. The 0.85 mean (152)Eu- to -(154)Eu activity ratio obtained by direct counting was similar to that assessed by analysis of post-treatment residual activities in twelve radiopharmaceutical vials following radiopharmaceutical injection. The long-lived radiocontaminants in the patient's bodies and the treatment wastes require modifications of the applicable radiation protection policies. Copyright © 2014 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

  20. Luminescence of trivalent samarium ions in silver and tin co-doped aluminophosphate glass

    Science.gov (United States)

    Jiménez, José A.; Lysenko, Sergiy; Liu, Huimin; Sendova, Mariana

    2011-06-01

    This work presents the spectroscopic properties of trivalent samarium ions in a melt-quenched aluminophosphate glass containing silver and tin. Addition of 4 mol% of each Ag 2O and SnO into the glass system with 2 mol% Sm 2O 3 results in Sm 3+ ions luminescence under non-resonant UV excitation owing to energy transfer from single silver ions and/or twofold-coordinated Sn centers. Assessment of luminescence spectra and decay dynamics suggest the energy transfer mechanism to be essentially of the resonant radiative type. Moreover, a connection between the luminescent and structural properties of the rare-earth doped glass system was demonstrated. Raman spectroscopy characterization revealed that no significant variation in the glass matrix is induced by Sm 3+ doping at the concentration employed. A comparison was made with a structural study performed on the Eu 3+ doped system (containing 2 mol% Eu 2O 3 along with 4 mol% of each Ag 2O and SnO) where the radiative energy transfer mechanism was previously established. The data appears consistent regarding the lack of variation in glass structure upon the Eu 3+ and Sm 3+ doping in connection with the dominance of the radiative transfer in the matrix. Thermal treatment of the material leads to precipitation of Ag nanoparticles of a broad size range inside the dielectric as observed by transmission electron microspcopy. Assessment of 4G 5/2 excited state decay in Sm 3+ ions shows no influence from the silver particles.

  1. Samarium (III) adsorption on bentonite modified with N-(2-hydroxyethyl) ethylenediamine.

    Science.gov (United States)

    Li, Dandan; Chang, Xijun; Hu, Zheng; Wang, Qihui; Li, Ruijun; Chai, Xiaoli

    2011-02-15

    A new material has been synthesized using dry process to activate bentonite followed by N-(2-hydroxyethyl) ethylenediamine connecting chlorosilane coupling agent. The synthesized new material was characterized by elemental analysis, FT-IR and thermogravimetry which proved that bentonite was successfully modified. The most interesting trait of the new material was its selective adsorption for rare earth elements. A variety of conditions of the new material were investigated for adsorption. The optimal conditions were determined with respect to pH and shaking time. Samarium (Sm) was quantitatively adsorbed at pH 4 and shaking time of 2 min onto the new material. Under these conditions the maximum static adsorption capacity of Sm(III) was found to be 17.7 mg g(-1). The adsorbed Sm(III) ion were quantitatively eluted by 2.0 mL 0.1 mol L(-1) HCl and 5% CS (NH(2))(2) solution. According to IUPAC definition, the detection limit (3σ) of this method was 0.60 ng mL(-1). The relative standard deviation (RSD) under optimum conditions was less than 3% (n=8). The new material also was applied for the preconcentration of trace Sm(III) in environmental samples with satisfactory results. Copyright © 2010 Elsevier B.V. All rights reserved.

  2. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Mandiwana, Vusani, E-mail: VMandiwana@csir.co.za; Kalombo, Lonji, E-mail: LKalombo@csir.co.za [Centre of Polymers and Composites, CSIR (South Africa); Venter, Kobus, E-mail: Kobus.Venter@mrc.ac.za [South African Medical Research Council (South Africa); Sathekge, Mike, E-mail: Mike.Sathekge@up.ac.za [University of Pretoria and Steve Biko Academic Hospital, Department of Nuclear Medicine (South Africa); Grobler, Anne, E-mail: Anne.Grobler@nwu.ac.za; Zeevaart, Jan Rijn, E-mail: zeevaart@necsa.co.za [North-West University, DST/NWU Preclinical Drug Development Platform (South Africa)

    2015-09-15

    Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly(d,l-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([{sup 153}Sm]Sm{sub 2}O{sub 3}) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive {sup 153}Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The {sup 153}Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [{sup 153}Sm]Sm{sub 2}O{sub 3} loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [{sup 153}Sm]Sm{sub 2}O{sub 3}-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

  3. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    Science.gov (United States)

    Mandiwana, Vusani; Kalombo, Lonji; Venter, Kobus; Sathekge, Mike; Grobler, Anne; Zeevaart, Jan Rijn

    2015-09-01

    Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly( d, l-lactide- co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([153Sm]Sm2O3) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive 153Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The 153Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [153Sm]Sm2O3 loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [153Sm]Sm2O3-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

  4. Fabrication and properties of samarium doped calcium sulphate thin films using spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Reghima, Meriem [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia); Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Faculté des Sciences de Bizerte, Université de Carthage, Zarzouna 7021 (Tunisia); Guasch, Cathy [Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Azzaza, Sonia; Alleg, Safia [Laboratoire de Magnétisme et Spectroscopie des Solides (LM2S), Département de Physique, Faculté des Sciences, Université Badji Mokhtar Annaba, B.P. 12, 23000 Annaba (Algeria); Kamoun-Turki, Najoua [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia)

    2016-10-01

    Using low cost spray pyrolysis technique, polycrystalline CaSO{sub 4} thin films were successfully grown on a glass substrate with a thickness of about 1 μm. Samarium doping has been performed on CaSO{sub 4} thin films to explore luminescence properties. The characterizations of these films were carried out using X-ray diffraction, Scanning Electron Microscopy and optical measurements. The structural analyses reveal the existence of hexagonal CaSO{sub 4} phase with a (200) preferred orientation belonging to CaS compound for substrate temperatures below 350 °C. It is shown that the crystallinity of the sprayed thin films can be improved by increasing substrate temperature up to 250 °C. Warren-Averbach analysis has been applied on X-ray diffractogram to determine structural parameters involving the phase with its amount, the grain size and the lattice parameters using Maud software. The surface topography shows a rough surface covered by densely packed agglomerated clusters having faceted and hexagonal shapes. Energy dispersive microscopy measurements confirm the presence of calcium and sulfur in equal proportions as well as high percentage of oxygen. Photoluminescence at room temperature revealed that luminescence peaks are attributed to the intrinsic emission of pure CaSO{sub 4} phase. - Highlights: • Warren Averbach analysis reveal the presence of hcp structure of CaSO{sub 4} phase. • A mixture of CaSO{sub 4} and CaHO{sub 4.5}S phases has been detected for lower T{sub s}. • For increasing T{sub s}, the CaHO{sub 4.5}S phase has been disappeared. • The origin of PL peaks has been identified.

  5. Spacecraft thermal control coatings (AO 138-6)

    Science.gov (United States)

    Paillous, Alain; Guillaumon, Jean Claude

    1991-01-01

    The experiment A0 138-6 was located on the trailing edge of LDEF as part of the Experiment FRECOPA. Material specimens 2 x 2 cm, independently mounted in sample-holders with their surface in the same reference plane, were exposed to space. Materials include paints (conductive or not), SSMs, polymeric films, surface coatings, composite materials, and metals. The results show that for some materials the degradation was higher for samples in the canister than for those directly mounted on the tray; contamination problems were ruled out, the higher temperature experienced by the samples inside the canister probably explains this phenomenon.

  6. Optical properties and electronic transitions of zinc oxide, ferric oxide, cerium oxide, and samarium oxide in the ultraviolet and extreme ultraviolet

    DEFF Research Database (Denmark)

    Pauly, N; Yubero, F; Espinós, J P

    2017-01-01

    Optical properties and electronic transitions of four oxides, namely zinc oxide, ferric oxide, cerium oxide, and samarium oxide, are determined in the ultraviolet and extreme ultraviolet by reflection electron energy loss spectroscopy using primary electron energies in the range 0.3-2.0 keV. This...

  7. [Therapeutic effect of 138 imported falciparum malaria patients].

    Science.gov (United States)

    Yu, Zhen-Hua; Wang, Fu-Yong; Wei, Dong-Dong; Yin, Bin; Wei, Yan-Bin; Zhao, Gui-Hua; Zhang, Ben-Gang; Wang, Yong-Bin

    2014-12-01

    To summarize the clinical characteristics of imported falciparum malaria patients and the treatment, so as to provide the evidences for improving the diagnosis and treatment of the disease. A total of 138 imported falciparum malaria patients who received the treatment in Shandong Institute of Parasitic Diseases from January 2007 to February 2013 were adopted as the observation subjects, and their clinical data were collected and analyzed. All the 138 patients were back from African countries. The main manifestations were fever, headache, asthenia, and hepatosplenomegaly, and most of them were with decreased RBC, PLT levels and increased LDH levels, and 36.96% of them were misdiagnosed as respiratory diseases, nephritis, hepatitis and so on. Through antimalarial treatment of artemether or artesunate or dihydroartemisinin and primaquine, or dihydroartemisinin and piperaquine, and symptomatic treatment, the short-term and long-term cure rates were 98.55% and 94.93% respectively, with 1 case unrecovered and 1 died. Artemisinins are still the most effective antimalarial drugs for falciparum malaria. However, some patients recrudesce as the Plasmodium in their body is resistant or insensitive to these drugs. We should pay more attention to the antimalarial and symptomatic treatments in the early stage of severe malaria so as to improve the cure rate.

  8. Optical response and magnetic characteristic of samarium doped zinc phosphate glasses containing nickel nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Azmi, Siti Amlah M.; Sahar, M.R., E-mail: mrahim057@gmail.com

    2015-11-01

    A magnetic glass of composition 40ZnO–(58−x) P{sub 2}O{sub 5}–1Sm{sub 2}O{sub 3}–xNiO, with x=0.0, 1.0, 1.5 and 2.0 mol% is prepared by melt-quenching technique. The glass is characterized by X-ray diffraction, high-resolution transmission electron microscope (HRTEM), photoluminescence (PL) spectroscopy and vibrating sample magnetometer (VSM) analysis. The X-rays diffraction confirms the amorphous nature of the glass while the HRTEM analysis reveals the presence of nickel nanoparticles in the glass samples. High-resolution TEM reveals that the lattice spacing of nickel nanoparticles is 0.35 nm at (100) plane. Photoluminescence emission shows the existence of four peaks that correspond to the transition from the upper level of {sup 4}G{sub 5/2} to the lower level of {sup 6}H{sub 5/2}, {sup 6}H{sub 7/2}, {sup 6}H{sub 9/2,} and {sup 6}H{sub 11/2.} It is observed that all peaks experience significant quenching effect with the increasing concentration of nickel nanoparticles, suggesting a strong energy transfer from excited samarium ions to the nickel ions. The glass magnetization and susceptibility at 12 kOe at room temperature are found to be in the range of (3.87±0.17×10{sup −2}–7.19±0.39×10{sup −2}) emu/g and (3.24±0.16×10{sup −6}–5.99±0.29×10{sup −6}) emu/Oe g respectively. The obtained hysteresis curve indicates that the glass samples are paramagnetic materials. The studied glass can be further used towards the development of magneto-optical functional glass. - Highlights: • Sm{sup 3+} doped zinc phosphate glass embedded with Ni NPs has been prepared. • The Laue pattern and lattice spacing of Ni NPs are confirmed by HRTEM image. • The magnetic response of glasses has been studied through VSM analysis. • Enhancement factor and decay half-lifetime are investigated.

  9. Treatment of bone pain secondary to metastases using samarium-153-EDTMP

    Directory of Open Access Journals (Sweden)

    Elba Cristina Sá de Camargo Etchebehere

    Full Text Available CONTEXT: More than 50% of patients with prostate, breast or lung cancer will develop painful bone metastases. The purpose of treating bone metastases is to relieve pain, reduce the use of steroids and to maintain motion. OBJECTIVE: To evaluate the use of samarium-153-EDTMP (153Sm-EDTMP for the treatment of bone pain secondary to metastases that is refractory to clinical management. TYPE OF STUDY: Retrospective. SETTING: Division of Nuclear Medicine, Universidade Estadual de Campinas (Unicamp. METHODS: Fifty-eight patients were studied (34 males with mean age 62 years; 31 patients had prostate cancer, 20 had breast cancer, three had lung cancer, one had lung hemangioendothelioma, one had parathyroid adenocarcinoma, one had osteosarcoma and one had an unknown primary tumor. All patients had multiple bone metastases demonstrated by bone scintigraphy using 99mTc-MDP,and were treated with 153Sm-EDTMP. Response to treatment was graded as good (pain reduction of 50-100%, intermediate (25-49% and poor (0-24%. RESULTS: All patients showed good uptake of 153Sm-EDTMP by bone metastases. Among the patients with prostate cancer, intermediate or good response to therapy occurred in 80.6% (25 patients and poor response in 19.4% (6. Among the patients with breast cancer, 85% (17 showed intermediate or good response to therapy while 15% (3 showed poor response. All three patients with lung cancer showed poor response to treatment. The lung hemangioendothelioma and unknown primary lesion patients showed intermediate response to treatment; the osteosarcoma and parathyroid adenocarcinoma patients showed good response to treatment. No significant myelotoxicity occurred. DISCUSSION: Pain control is important for improving the quality of life of patients with advanced cancers. The mechanism by which pain is relieved with the use of radionuclides is still not yet completely understood, however, the treatment is simple and provides a low risk of mielotoxicity

  10. Anchoring samarium oxide nanoparticles on reduced graphene oxide for high-performance supercapacitor

    Energy Technology Data Exchange (ETDEWEB)

    Dezfuli, Amin Shiralizadeh [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Ganjali, Mohammad Reza, E-mail: ganjali@khayam.ut.ac.ir [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Biosensor Research Center, Endocrinology & Metabolism Molecular-Cellular Sciences Institute, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Naderi, Hamid Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)

    2017-04-30

    Highlights: • Samarium oxide nanoparticles have been anchored on the surface of reduced graphene oxide for the first time. • Sm{sub 2}O{sub 3}/RGO nanocomposite show high capacitance, good rate and cycling performance. • Sm{sub 2}O{sub 3}/RGO nanocomposite can serve as efficient electrode material for energy storage. • The best composite electrode exhibits specific capacitance of 321 F g{sup −1} in 2 mV s{sup −1}. - Abstract: We have synthesized Sm{sub 2}O{sub 3} nanoparticles (SmNs) and anchored them onto the surface of reduced graphene oxide (RGO) through a self-assembly thereof by utilizing a facile sonochemical procedure. The nanomaterials were characterized by means of powder X-ray diffraction (XRD), Field-emission scanning electron microscopy (FE-SEM), fourier transform infrared spectroscopy (FT-IR) spectra, and X-ray photoelectron spectroscopy (XPS). As the next step, the supercapacitive behavior of the resulting nanocomposites were investigated when used as electrode material, through with cyclic voltammetric (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS) techniques. The SmNs decorated RGO (SmN-RGO) nanocomposites were found to possess a specific capacitance (SC) of 321 F g{sup −1} when used in a 0.5 M Na{sub 2}SO{sub 4} solution as an electrolyte, in a scan rate of 2 mV s{sup −1}. The SC of the SmN-RGO based electrodes were also found to be 268 F g{sup −1} at a current density of 2 A g{sup −1} through galvanostatic charge-discharge tests. The outstanding properties of the SmN-RGOs were attributed to synergy of the high charge mobility of SmNs and the flexibility of the sheets of RGOs. Additionally, the nano-composite revealed a unique cycling durability (maintaining 99% of its SC even after 4000 cycles).

  11. Phenotypic, genomic and functional characterization reveals no differences between CD138++ and CD138low subpopulations in multiple myeloma cell lines.

    Science.gov (United States)

    Paíno, Teresa; Sarasquete, María E; Paiva, Bruno; Krzeminski, Patryk; San-Segundo, Laura; Corchete, Luis A; Redondo, Alba; Garayoa, Mercedes; García-Sanz, Ramón; Gutiérrez, Norma C; Ocio, Enrique M; San-Miguel, Jesús F

    2014-01-01

    Despite recent advances in the treatment of multiple myeloma (MM), it remains an incurable disease potentially due to the presence of resistant myeloma cancer stem cells (MM-CSC). Although the presence of clonogenic cells in MM was described three decades ago, the phenotype of MM-CSC is still controversial, especially with respect to the expression of syndecan-1 (CD138). Here, we demonstrate the presence of two subpopulations--CD138++ (95-99%) and CD138low (1-5%)--in eight MM cell lines. To find out possible stem-cell-like features, we have phenotypically, genomic and functionally characterized the two subpopulations. Our results show that the minor CD138low subpopulation is morphologically identical to the CD138++ fraction and does not represent a more immature B-cell compartment (with lack of CD19, CD20 and CD27 expression). Moreover, both subpopulations have similar gene expression and genomic profiles. Importantly, both CD138++ and CD138low subpopulations have similar sensitivity to bortezomib, melphalan and doxorubicin. Finally, serial engraftment in CB17-SCID mice shows that CD138++ as well as CD138low cells have self-renewal potential and they are phenotypically interconvertible. Overall, our results differ from previously published data in MM cell lines which attribute a B-cell phenotype to MM-CSC. Future characterization of clonal plasma cell subpopulations in MM patients' samples will guarantee the discovery of more reliable markers able to discriminate true clonogenic myeloma cells.

  12. Complete genome sequence of an attenuated Sparfloxacin resistant Streptococcus agalactiae strain 138spar

    Science.gov (United States)

    Through selection of resistance to sparfloxacin, an attenuated Streptococcus agalactiae strain 138spar was obtained from its virulent parent strain S. agalactiae 138P. The full genome of S. agalactiae 138spar is 1,838,126 bp. The availability of this genome will allow comparative genomics to identi...

  13. MicroRNA-138 modulates metastasis and EMT in breast cancer cells by targeting vimentin.

    Science.gov (United States)

    Zhang, Jun; Liu, Dan; Feng, Zhuo; Mao, Jun; Zhang, Chunying; Lu, Ying; Li, Jiazhi; Zhang, Qingqing; Li, Qing; Li, Lianhong

    2016-02-01

    Increasing evidence indicates that dysregulation of microRNAs (miRNAs) plays critical roles in malignant transformation and tumor progression. In this study, in order to investigate the association of miR-138 with breast cancer we investigated the role of miR-138 in breast cancer metastasis. Levels of miR-138 were determined by qRT-PCR in 45 breast cancer samples. Cell migration and invasion assays were performed in a stably expressing miRNA-138 breast cancer cell line established using a lentivirus expression system. Epithelial-mesenchymal transition (EMT) was evaluated using qRT-PCR and Western Blots to detect epithelial marker E-cadherin and mesenchymal marker, vimentin. Luciferase reporter assays were used to identify downstream targets and biological function of miR-138. Breast cancer tissues had significantly lower expression of miR-138 compared to non-tumor tissues. Low miR-138 levels were associated with lymph node metastasis and invasion. miR-138 overexpression inhibited metastasis of breast cancer cells. miR-138 overexpression also down-regulated vimentin expression and upregulated E-cadherin expression, suggesting that miR-138 inhibited EMT. Our results support the involvement of miR-138 in breast tumorigenesis, especially lymph node metastasis. We propose that miR-138 might be used as therapeutic agent for breast cancer. Copyright © 2015. Published by Elsevier Masson SAS.

  14. MiR-138 Suppresses Cell Proliferation by Targeting Bag-1 in Gallbladder Carcinoma

    Science.gov (United States)

    Gong, Wei; Weng, Mingzhe; Quan, Zhiwei

    2015-01-01

    Background MiR-138 is frequently downregulated in different cancer types and is thought to be involved in the progression of tumorigenesis. However, the molecular mechanism of miR-138 involvement in gallbladder carcinoma still remains unknown. Methods The expression of miR-138 in 49 gallbladder carcinoma samples and paired normal gallbladder samples was analyzed using quantitative reverse transcription–polymerase chain reaction. The biological functions of miR-138 and Bag-1 (Bcl-2-associated athanogene-1) on cell proliferation were examined using 3-(4, 5-dimethylthiazolyl-2)-2,5-diphenyltetrazolium bromide and apoptosis assays. Targets of miR-138 were predicted using bioinformatics and validated using luciferase reporter and Western blot analyses. The in vivo effects of miR-138 were examined using subcutaneous inoculation of gallbladder carcinoma cells in Balb/c nude mice. Results Compared with their paired normal gallbladder samples, the gallbladder carcinoma samples had decreased expression of miR-138 and increased expression of Bag-1. Overexpression of miR-138 inhibited the proliferation of gallbladder carcinoma cells. Bag-1 was defined as a novel target of miR-138. Both the inhibition of Bag-1 by miR-138 and the silencing of Bag-1 by siRNA led to alterations of apoptosis-related proteins such as Bcl-2 and Bax. Restoring expression of Bag-1 eliminates the effects of miR-138 on cell proliferation and apoptosis. Furthermore, overexpression of miR-138 markedly inhibited the growth of tumors in the gallbladder carcinoma xenograft model in nude mice. Conclusions Expression of miR-138 is frequently reduced in gallbladder carcinoma when compared to normal cells. Overexpression of miR-138 inhibited cell proliferation by directly suppressing the expression of Bag-1. These results suggest that miR-138 plays an important role in inhibiting the growth of gallbladder carcinoma. PMID:25962180

  15. Effect of Current Density on Thermodynamic Properties of Nanocrystalline Palladium Capped Samarium Hydride Thin Film Switchable Mirrors

    Directory of Open Access Journals (Sweden)

    Pushpendra Kumar

    2007-01-01

    Full Text Available A 55 nm samarium film capped with a 10 nm palladium overlayer switched from a metallic reflecting to a semiconducting, transparent in visible state during ex-situ hydrogen loading via electrochemical means in 1 M KOH electrolytic aqueous solution at room temperature. The switching between metal to semiconductor was accompanied by measurement of transmittance during hydrogen loading/unloading. The effect of current density on switching and thermodynamic properties was studied between dihydride state (FCC phase and trihydride state (hexagonal phase. From the plateau of partial pressure of hydrogen at x=2.6, enthalpy of formation was calculated at different current densities. The diffusion coefficients and switching kinetics are shown to depend on applied current density.

  16. Targeted bone marrow radioablation with 153Samarium-lexidronam promotes allogeneic hematopoietic chimerism and donor-specific immunologic hyporesponsiveness.

    Science.gov (United States)

    Inverardi, Luca; Linetsky, Elina; Pileggi, Antonello; Molano, R Damaris; Serafini, Aldo; Paganelli, Giovanni; Ricordi, Camillo

    2004-03-15

    Transplantation tolerance, defined as acceptance of a graft by an otherwise fully immunocompetent host, has been an elusive goal. Although robust tolerance has been achieved by the induction of stable hematopoietic chimerism after bone marrow transplantation, lethal or sublethal radiation conditioning used to induce long-term chimerism precludes its clinical use. We studied whether targeted delivery of radiation to bone marrow could allow for bone marrow cell (BMC) engraftment, chimerism, and donor-specific tolerance in the absence of the side effects associated with external irradiation. We administered a radioactive bone-seeking compound (Samarium-Lexidronam, Quadramet, Berlex Laboratories, Wayne, NJ) together with transient T-cell costimulatory blockade to recipient mice. Allogeneic BMCs were given 7 or 14 days after preconditioning. Costimulatory blockade was obtained by the use of an anti-CD154 antibody for 4 weeks. Chimerism was assessed by flow cytometry. Mice then received donor-specific and third-party skin grafts. Graft survival was analyzed with mechanisms of donor-specific hyporesponsiveness. High levels of stable chimerism across an allogeneic barrier were achieved in mice by a single administration of Samarium-Lexidronam, transient T-cell costimulatory blockade, and BMC transplantation. A large percentage of chimeric animals retained donor-derived skin grafts for more than 120 days without requiring additional immunosuppression, suggesting that harsh cytotoxic preconditioning is not necessary to achieve stable chimerism and donor specific hyporesponsiveness. Analysis of the T-cell repertoire in chimeras indicates T-cell deletional mechanisms. These data broaden the potential use of BMC transplantation for tolerance induction and argue for its potential in treating autoimmune diseases.

  17. Sorption of samarium in soils: influence of soil properties and Sm concentration

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez-Guinart, Oriol; Salaberria, Aitor; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

    2014-07-01

    Due to the fact that barriers of Deep Geological Repositories (DGR) may lose efficiency before the radioisotopes present in the High Level Radioactive Waste (HLRW) completely decay, it is possible that, in the long-term, radioactive leachates may escape from the DGR and reach the soil and water compartments in the biosphere. Therefore, it is required to examine the interaction and mobility of radionuclides present in the HLRW, or their chemical analogues, to predict the impact of their eventual incorporation in the biosphere and to assess the derived risk. Although relevant data have been recently obtained for a few radionuclides in soils, there are still some important gaps for some radionuclides, such us for samarium (Sm). Sm is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in HLRW in the form of the radioactive isotope {sup 151}Sm. The main objective of this work was to obtain sorption data (K{sub d}) of {sup 151}Sm gathered from a set of soil samples physicochemical fully-characterized (pH, texture, cationic exchange capacity, soil solution cationic composition, organic matter, carbonate and metallic oxides content, etc.). Additionally, as an alternative for testing sorption capacity of radionuclides in soils is the use of the corresponding stable isotope or a chemical analogue, the influence of Sm concentration was also checked. To evaluate {sup 151}Sm sorption, batch assays were carried out for each soil sample, which consisted in a pre-equilibration step of 2 g of each soil with 50 ml of double deionised water, and a subsequent equilibration step with the same solution, but labelled with {sup 151}Sm. The activity of {sup 151}Sm in initial and final solutions was measured by liquid scintillation and K{sub d} ({sup 151}Sm) data were calculated. The reversibly sorbed fraction was estimated by the application of a single extraction test, with double deionised water, to soil residues coming from the previous

  18. A prospective study of 138 arthroscopies of the temporomandibular joint

    Directory of Open Access Journals (Sweden)

    Paulo Alexandre da Silva

    2015-08-01

    Full Text Available INTRODUCTION: Internal derangements (ID of the temporomandibular joint (TMJ have a multifactorial etiology and are most often treated conservatively by splints, physical therapy and medications. Only in 2-5% of cases are the treatment surgical, either by arthroscopy or arthrotomy.OBJECTIVE: To evaluate improvement of mouth opening, pain relief during function, position of the articular disk and complications following Arthroscopic Lyse and Lavage (ALL.METHODS: A prospective study of 78 patients (138 TMJs with TMJ ID, 5 males and 73 females, mean age 29.7 years, treated between January 2010 and April 2013, who were refractory to conservative treatment, had limited mouth opening and pain localized to the TMJ during function, and who were submitted to TMJ ALL and followed for a period of 12 months, with periodic reviews.RESULTS: ALL was effective in 93.6% of cases, with 85.3% experiencing improvement in mouth opening and 91.2% in pain reduction during function, 63% improvement in disk position and a rate of complications of 6.2%.CONCLUSION: In this study the ALL exhibited a high rate of success with low morbidity in internal derangements of the TMJ.

  19. Yrast 6+ Seniority Isomers of 136,138Sn

    Science.gov (United States)

    Simpson, G. S.; Gey, G.; Jungclaus, A.; Taprogge, J.; Nishimura, S.; Sieja, K.; Doornenbal, P.; Lorusso, G.; Söderström, P.-A.; Sumikama, T.; Xu, Z. Y.; Baba, H.; Browne, F.; Fukuda, N.; Inabe, N.; Isobe, T.; Jung, H. S.; Kameda, D.; Kim, G. D.; Kim, Y.-K.; Kojouharov, I.; Kubo, T.; Kurz, N.; Kwon, Y. K.; Li, Z.; Sakurai, H.; Schaffner, H.; Shimizu, Y.; Suzuki, H.; Takeda, H.; Vajta, Z.; Watanabe, H.; Wu, J.; Yagi, A.; Yoshinaga, K.; Bönig, S.; Daugas, J.-M.; Drouet, F.; Gernhäuser, R.; Ilieva, S.; Kröll, T.; Montaner-Pizá, A.; Moschner, K.; Mücher, D.; Naïdja, H.; Nishibata, H.; Nowacki, F.; Odahara, A.; Orlandi, R.; Steiger, K.; Wendt, A.

    2014-09-01

    Delayed γ-ray cascades, originating from the decay of (6+) isomeric states, in the very neutron-rich, semimagic isotopes 136,138Sn have been observed following the projectile fission of a 238U beam at RIBF, RIKEN. The wave functions of these isomeric states are proposed to be predominantly a fully aligned pair of f7/2 neutrons. Shell-model calculations, performed using a realistic effective interaction, reproduce well the energies of the excited states of these nuclei and the measured transition rates, with the exception of the B(E2;6+→4+) rate of 136Sn, which deviates from a simple seniority scheme. Empirically reducing the νf7/22 orbit matrix elements produces a 41+ state with almost equal seniority 2 and 4 components, correctly reproducing the experimental B(E2;6+→4+) rate of 136Sn. These data provide a key benchmark for shell-model interactions far from stability.

  20. Stress-inducible alternative translation initiation of human cytomegalovirus latency protein pUL138.

    Science.gov (United States)

    Grainger, Lora; Cicchini, Louis; Rak, Michael; Petrucelli, Alex; Fitzgerald, Kerry D; Semler, Bert L; Goodrum, Felicia

    2010-09-01

    We have previously characterized a 21-kDa protein encoded by UL138 (pUL138) as a viral factor inherent to low-passage strains of human cytomegalovirus (HCMV) that is required for latent infection in vitro. pUL138 is encoded on 3.6-, 2.7-, and 1.4-kb 3' coterminal transcripts that are produced during productive and latent infections. pUL138 is encoded at the 3' end of each transcript and is preceded by an extensive 5' sequence (approximately 0.5 to 2.5 kb) containing several putative open reading frames (ORFs). We determined that three putative ORFs upstream of UL138 (UL133, UL135, and UL136) encode proteins. The UL138 transcripts are polycistronic, such that each transcript expresses pUL138 in addition to the most-5' ORF. The upstream coding sequences (CDS) present a significant challenge for the translation of pUL138 in mammalian cells. We hypothesized that sequences 5' of UL138 mediate translation initiation of pUL138 by alternative strategies. Accordingly, a 663-nucloetide (nt) sequence overlapping the UL136 CDS supported expression of a downstream cistron in a bicistronic reporter system. We did not detect cryptic promoter activity or RNA splicing events that could account for downstream cistron expression. These data are consistent with the sequence element functioning as an internal ribosome entry site (IRES). Interestingly, pUL138 expression from the 3.6- and 2.7-kb transcripts was induced by serum stress, which concomitantly inhibited normal cap-dependent translation. Our work suggests that an alternative and stress-inducible strategy of translation initiation ensures expression of pUL138 under a variety of cellular contexts. The UL138 polycistronic transcripts serve to coordinate the expression of multiple proteins, including a viral determinant of HCMV latency.

  1. Crystal growth of semiorganic complex- samarium chloride coordinated thiourea-L-tartaric acid and its studies on structure and optical characteristics

    Science.gov (United States)

    Slathia, Goldy; Singh, Harjinder; Ramya, E.; Rao, D. Narayana; Bamzai, K. K.

    2017-05-01

    The semi-organic complex of samarium chloride coordinated thiourea-L-tartaric acid (SCTLT) has been grown as a single crystal by slow evaporation technique at room temperature. For structural studies, the grown crystal was subjected to single crystal X-ray diffraction and Fourier transform infra-red (FTIR) spectroscopy. Low cut off wavelength and transparent characteristics were explored by UV-VIS optical characterization. Third-order nonlinear optical properties of grown crystal were investigated by Z-scan technique.

  2. Sorption of samarium in iron (II) and (III) phosphates in aqueous systems; Sorcion de samario en fosfatos de hierro (II) y (III) en sistemas acuosos

    Energy Technology Data Exchange (ETDEWEB)

    Diaz F, J.C

    2006-07-01

    The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

  3. Trace amounts of rare earth elements in high purity samarium oxide by sector field inductively coupled plasma mass spectrometry after separation by HPLC

    Energy Technology Data Exchange (ETDEWEB)

    Pedreira, W.R. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil) and Fundacao Jorge Duprat Figueiredo de Seguranca e Medicina do Trabalho (FUNDACENTRO), 05409-002 Sao Paulo, SP (Brazil)]. E-mail: walter.pedreira@fundacentro.gov.br; Queiroz, C.A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Abrao, A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Rocha, S.M. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Vasconcellos, M.E. de [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), 05508-900 Sao Paulo, SP (Brazil); Boaventura, G.R. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil); Pimentel, M.M. [Instituto de Geociencias, Universidade de Brasilia (UnB), 70910-900 Brasilia, DF (Brazil)

    2006-07-20

    Today there is an increasing need for high purity rare earth compounds in various fields, the optical, the electronics, the ceramic, the nuclear and geochemistry. Samarium oxide has special uses in glass, phosphors, lasers and thermoelectric devices. Calcium chloride crystals treated with samarium have been employed in lasers, which produce light beams intense enough to burn metal. In general, the inductively coupled plasma mass spectrometry (ICP-MS) presents some advantages for trace element analysis, due to high sensitivity and resolution, when compared with other analytical techniques such as ICP optical emission spectrometry (ICP-OES). In this work, sector field inductively coupled plasma mass spectrometry was used. Sixteen elements (Sc, Y and 14 lanthanides) were determined selectively with the ICP-MS system using a concentration gradient method. The detection limits with the ICP-MS system were about 0.2 (La) pg mL{sup -1} to 8 (Gd) pg mL{sup -1}. The %R.S.D. of the methods varying between 0.9 and 1.5% for a set of five (n = 5) replicates was found for the IPEN's material and for the certificate reference sample. Determination of trace REEs in two high pure samarium oxides samples (IPEN and JMC) was performed. IPEN's material is highly pure (>99.99%) and was successfully analyzed without spectral interference (MO{sup +} and MOH{sup +})

  4. 22 CFR Appendix B to Part 138 - Disclosure Form To Report Lobbying

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Disclosure Form To Report Lobbying B Appendix B to Part 138 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Pt. 138, App. B Appendix B to Part 138—Disclosure Form To Report Lobbying EC06OC91.000 EC06OC91.001 EC06OC91...

  5. Down-regulation of human cytomegalovirus UL138, a novel latency ...

    Indian Academy of Sciences (India)

    Fifteen putative targets of hcmv-miR-UL36 were identified using hybrid PCR, one being the HCMV UL138 gene that has previously been identified as a novel latency-associated determinant of HCMV infection. Down-regulation of UL138 expression by hcmv-miR-UL36 was validated using luciferase reporter assays and ...

  6. Galvanic interactions of HE15 /MDN138 & HE15 /MDN250 alloys in natural seawater

    Science.gov (United States)

    Parthiban, G. T.; Subramanian, G.; Muthuraman, K.; Ramakrishna Rao, P.

    2017-06-01

    HE15 is a heat treatable high strength alloy with excellent machinability find wide applications in aerospace and defence industries. In view of their excellent mechanical properties, workability, machinability, heat treatment characteristics and good resistance to general and stress corrosion cracking, MDN138 & MDN250 have been widely used in petrochemical, nuclear and aerospace industries. The galvanic corrosion behaviour of the metal combinations HE15 /MDN138 and HE15 /MDN250, with 1:1 area ratio, has been studied in natural seawater using the open well facility of CECRI's Offshore Platform at Tuticorin for a year. The open circuit potentials of MDN138, MDN250 and HE15 of the individual metal, the galvanic potential and galvanic current of the couples HE15 /MDN138 and HE15 /MDN250 were periodically monitored throughout the study period. The calcareous deposits on MDN138 and MDN250 in galvanic contact with HE15 were analyzed using XRD. The electrochemical behaviors of MDN138, MDN250 and HE15 in seawater have been studied using an electrochemical work station. The surface characteristics of MDN138 and MDN250 in galvanic contact with HE15 have been examined with scanning electron microscope. The results of the study reveal that HE15 offered required amount of protection to MDN138 & MDN250.

  7. 33 CFR 138.240 - Procedure for calculating limit of liability adjustments for inflation.

    Science.gov (United States)

    2010-07-01

    ... of liability adjustments for inflation. 138.240 Section 138.240 Navigation and Navigable Waters COAST... calculating limit of liability adjustments for inflation. (a) Formula for calculating a cumulative percent... every three years from the year the limits of liability were last adjusted for inflation, the Director...

  8. 25 CFR 170.138 - Can roads be built in roadless and wild areas?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can roads be built in roadless and wild areas? 170.138 Section 170.138 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and...

  9. Complete genome sequence of a virulent Streptococcus agalactiae strain 138P isolated from diseased Nile tilapia

    Science.gov (United States)

    Streptococcus agalactiae strain 138P was isolated from the kidney of diseased Nile tilapia in Idaho during a 2007 streptococcal disease outbreak. The full genome of S. agalactiae 138P is 1,838,716 bp. The availability of this genome will allow comparative genomics to identify genes for antigen disco...

  10. Die kontekstuele funksie van Hebreërs 13:8

    African Journals Online (AJOL)

    29 Jul 2015 ... The contextual function of Hebrews 13:8. In this article the contextual function of Hebrews. 13:8 is investigated. This verse is rather enigmatic as regards its meaning and contextual function. Scholars usually find that verse 8 combines with the immediately preceding and following verses, that is, verses 7 ...

  11. 11 CFR 100.138 - Sale of food and beverages by vendor.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Sale of food and beverages by vendor. 100.138...) Exceptions to Expenditures § 100.138 Sale of food and beverages by vendor. The sale of any food or beverage..., is not an expenditure, provided that the charge is at least equal to the cost of such food or...

  12. Site-directed mutagenesis of human immunodeficiency virus type 1 reverse transcriptase at amino acid position 138.

    Science.gov (United States)

    Pelemans, H; Aertsen, A; Van Laethem, K; Vandamme, A M; De Clercq, E; Pérez-Pérez, M J; San-Félix, A; Velázquez, S; Camarasa, M J; Balzarini, J

    2001-02-01

    TSAO derivatives represent a class of nonnucleoside reverse transcriptase inhibitors (NNRTIs) that consistently select for the Glu138Lys resistance mutation in HIV-1 reverse transcriptase (RT). Seven RT mutants (i.e., Ala, Asp, Gln, Gly, Lys, Phe, and Tyr) were constructed by site-directed mutagenesis. The mutant Glu138Asp, Glu138Lys, Glu138Gln, Glu138Ala, and Glu138Gly RTs retained marked catalytic activity. In contrast, the Glu138Phe and Glu138Tyr RT mutants showed poor RNA-dependent DNA polymerase activity (30 and 4% of wild-type, respectively). TSAO derivatives lost their inhibitory activity against all mutant enzymes, except against the closely related Glu138Asp RT mutant that remained as sensitive to TSAOs as did wild-type RT. Other NNRTIs, including delavirdine, emivirine, and UC-781, and the NRTI ddGTP retained pronounced inhibitory activity against all mutant enzymes. When the amino acid mutations at position 138 of RT were introduced in recombinant virus clones, the sensitivity/resistance spectrum obtained toward the TSAOs and other NNRTIs was similar to those observed for the isolated recombinant mutant enzymes. The Glu138Lys RT mutant virus had the most marked resistance to TSAOs, followed by the Glu138Gln, Glu138Phe, Glu138Gly, Glu138Tyr, and Glu138Ala virus mutants. The Glu138Asp RT mutant virus kept full sensitivity to the TSAO derivatives. Mixtures of Glu138Lys RT mutant virus with the other virus clones mutated at the 138 position resulted in all cases, except for the Glu138Asp and Glu138Gly RT mutant viruses, in an outgrowth of the Glu138Lys RT mutant virus. Since the Glu138Lys RT proved most resistant to TSAO derivatives, was among the most catalytically efficient enzymes, and resulted in highly replication-competent virus, our data explain why the Glu138Lys RT mutant virus strains but not virus strains containing other amino acids at position 138 invariably emerge in cell cultures under TSAO drug pressure. Copyright 2001 Academic Press.

  13. Flow Cytometry Assessment of In Vitro Generated CD138+ Human Plasma Cells

    Directory of Open Access Journals (Sweden)

    Rayelle Itoua Maïga

    2014-01-01

    Full Text Available The in vitro CD40-CD154 interaction promotes human B lymphocytes differentiation into plasma cells. Currently, CD138 is the hallmark marker enabling the detection of human plasma cells, both in vitro and in vivo; its presence can be monitored by flow cytometry using a specific antibody. We have developed a culture system allowing for the differentiation of memory B lymphocytes. In order to detect the newly formed plasma cells, we have compared their staining using five anti-CD138 monoclonal antibodies (mAbs. As a reference, we also tested human cell lines, peripheral blood mononuclear cells, and bone marrow samples. The five anti-CD138 mAbs stained RPMI-8226 cells (>98% with variable stain index (SI. The highest SI was obtained with B-A38 mAb while the lowest SI was obtained with DL-101 and 1D4 mAbs. However, the anti-CD138 mAbs were not showing equivalent CD138+ cells frequencies within the generated plasma cells. B-A38, B-B4, and MI-15 were similar (15–25% while DL-101 mAb stained a higher proportion of CD138-positive cells (38–42%. DL-101 and B-A38 mAbs stained similar populations in bone marrow samples but differed in their capacity to bind to CD138high and CD138lo cell lines. In conclusion, such cellular fluctuations suggest heterogeneity in human plasma cell populations and/or in CD138 molecules.

  14. Effectiveness of radiation synovectomy with samarium-{sup 153} particulate hydroxyapatite in rheumatoid arthritis patients with knee synovitis: a controlled randomized double-blind trial

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Marla Francisca dos; Furtado, Rita Nely Vilar; Konai, Monique Sayuri; Natour, Jamil, E-mail: jnatour@unifesp.b [Universidade Federal de Sao Paulo (UNIFESP-EPM), Sao Paulo, SP (Brazil). Divisao de Reumatologia; Castiglioni, Mario Luiz Vieira; Marchetti, Renata Rosa [Universidade Federal de Sao Paulo (UNIFESP-EPM), Sao Paulo, SP (Brazil). Divisao de Medicina Nuclear

    2009-07-01

    Objectives: the aim of the present study was to investigate the effectiveness of Samarium{sup 153}-particulate hydroxyapatite radiation synovectomy in rheumatoid arthritis patients with chronic knee synovitis. Methods: fifty-eight rheumatoid arthritis patients (60 knees) with chronic knee synovitis participated in a controlled double-blinded trial. Patients were randomized to receive either an intra-articular injection with 40 mg triamcinolone hexacetonide alone (TH group) or 40 mg triamcinolone hexacetonide combined with 15 mCi Samarium{sup 153}-particulate hydroxyapatite (Sm/TH group). Blinded examination at baseline (T0) and at 1 (T1), 4 (T4), 12 (T12), 32 (T32), and 48 (T48) weeks post-intervention were performed on all patients and included a visual analog scale for joint pain and swelling as well as data on morning stiffness, flexion, extension, knee circumference, Likert scale of improvement, percentage of improvement, SF-36 generic quality of life questionnaire, Stanford Health Assessment Questionnaire (HAQ), Lequesne index, use of non-steroidal anti-inflammatory drugs or oral corticosteroids, events and adverse effects, calls to the physician, and hospital visits. Results: the sample was homogeneous at baseline, and there were no withdrawals. Improvement was observed in both groups in relation to T0, but no statistically significant differences between groups were observed regarding all variables at the time points studied. The Sm/TH group exhibited more adverse effects at T1 (p<0.05), but these were mild and transitory. No severe adverse effects were reported during follow-up. Conclusion: intra-articular injection of Samarium{sup 153}-particulate hydroxyapatite (15 mCi) with 40 mg of triamcinolone hexacetonide is not superior to triamcinolone hexacetonide alone for the treatment of knee synovitis in patients with rheumatoid arthritis at 1 y of follow-up. (author)

  15. The properties of samarium-doped zinc oxide/phthalocyanine structure for optoelectronics prepared by pulsed laser deposition and organic molecular evaporation

    Czech Academy of Sciences Publication Activity Database

    Novotný, Michal; Marešová, Eva; Fitl, Přemysl; Vlček, Jan; Bergmann, M.; Vondráček, Martin; Yatskiv, Roman; Bulíř, Jiří; Hubík, Pavel; Hruška, Petr; Drahokoupil, Jan; Abdellaoui, N.; Vrňata, M.; Lančok, Ján

    2016-01-01

    Roč. 122, č. 3 (2016), 1-8, č. článku 225. ISSN 0947-8396 R&D Projects: GA MŠk(CZ) LG15050; GA ČR(CZ) GAP108/11/0958; GA MŠk(CZ) LM2011029; GA ČR(CZ) GA14-10279S; GA MŠk(CZ) 7AMB14FR010 Institutional support: RVO:68378271 ; RVO:67985882 Keywords : samarium-doped zinc oxide zinc/phthalocyanine deposition * evaporation * pulsed laser deposition * thin films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.455, year: 2016

  16. Neutron Activated Samarium-153 Microparticles for Transarterial Radioembolization of Liver Tumour with Post-Procedure Imaging Capabilities

    Science.gov (United States)

    Hashikin, Nurul Ab. Aziz; Yeong, Chai-Hong; Abdullah, Basri Johan Jeet; Ng, Kwan-Hoong; Chung, Lip-Yong; Dahalan, Rehir; Perkins, Alan Christopher

    2015-01-01

    Introduction Samarium-153 (153Sm) styrene divinylbenzene microparticles were developed as a surrogate for Yttrium-90 (90Y) microspheres in liver radioembolization therapy. Unlike the pure beta emitter 90Y, 153Sm possess both therapeutic beta and diagnostic gamma radiations, making it possible for post-procedure imaging following therapy. Methods The microparticles were prepared using commercially available cation exchange resin, Amberlite IR-120 H+ (620–830 μm), which were reduced to 20–40 μm via ball mill grinding and sieve separation. The microparticles were labelled with 152Sm via ion exchange process with 152SmCl3, prior to neutron activation to produce radioactive 153Sm through 152Sm(n,γ)153Sm reaction. Therapeutic activity of 3 GBq was referred based on the recommended activity used in 90Y-microspheres therapy. The samples were irradiated in 1.494 x 1012 n.cm-2.s-1 neutron flux for 6 h to achieve the nominal activity of 3.1 GBq.g-1. Physicochemical characterisation of the microparticles, gamma spectrometry, and in vitro radiolabelling studies were carried out to study the performance and stability of the microparticles. Results Fourier Transform Infrared (FTIR) spectroscopy of the Amberlite IR-120 resins showed unaffected functional groups, following size reduction of the beads. However, as shown by the electron microscope, the microparticles were irregular in shape. The radioactivity achieved after 6 h neutron activation was 3.104 ± 0.029 GBq. The specific activity per microparticle was 53.855 ± 0.503 Bq. Gamma spectrometry and elemental analysis showed no radioactive impurities in the samples. Radiolabelling efficiencies of 153Sm-Amberlite in distilled water and blood plasma over 48 h were excellent and higher than 95%. Conclusion The laboratory work revealed that the 153Sm-Amberlite microparticles demonstrated superior characteristics for potential use in hepatic radioembolization. PMID:26382059

  17. Preparation and examination of properties of samarium-153-EDTMP complex; Otrzymywanie chelatu kwasu etylenodiaminotetrametylenofosfonowego (EDTMP) z samarem-153 i badanie jego wlasciwosci

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, M. [Institute of Atomic Energy, Otwock-Swierk (Poland); Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W. [Osrodek Badawczo-Rozwojowy Izotopow, Otwock-Swierk (Poland); Licinska, I. [Instytut Lekow, Warsaw (Poland)

    1995-12-31

    Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of {sup 153}Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, {beta}{sup -}-decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of {sup 153}Sm-EDTMP chelate were examined in a broad range of samarium concentration and {sup 153}Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of {sup 153}Sm-EDTMP chelate as compared with molecules of ``free``EDTMP. The results of biodistribution of {sup 153}Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of {sup 153}Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs.

  18. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints

    Directory of Open Access Journals (Sweden)

    Mohammed Najeeb Al Hallak

    2009-08-01

    Full Text Available 153Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate and Samarium-153 [1]. 153Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of 153Sm-EDTMP leads to contamination with 154Eu (Europium-154 [2]. A previous study only alluded to the retention of 154Eu in the bones after receiving treatment with 153Sm-EDTMP [2]. Activation of the alarm at security checkpoints after 153Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received 153Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing theAmerican-Canadian border. We assume that the 154Eu which remained in the patients’ bones activated the sensors. Methods: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received 153Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. Results: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of 154Eu emissions. Conclusion: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of 154Eu retained in patients who received 153Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of 153Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with 153Sm-EDTMP at Roger Maris Cancer Center

  19. The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints.

    Science.gov (United States)

    Najeeb Al Hallak, Mohammed; McCurdy, Matt; Zouain, Nicolas; Hayes, Justin

    2009-08-28

    (153)Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate) and Samarium-153 [1]. (153)Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of (153)Sm-EDTMP leads to contamination with (154)Eu (Europium-154) [2]. A previous study only alluded to the retention of (154)Eu in the bones after receiving treatment with (153)Sm-EDTMP [2]. Activation of the alarm at security checkpoints after (153)Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received (153)Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA) activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing the American-Canadian border. We assume that the (154)Eu which remained in the patients' bones activated the sensors. METHODS: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received (153)Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. RESULTS: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of (154)Eu emissions. CONCLUSION: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of (154)Eu retained in patients who received (153)Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of (153)Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with (153)Sm-EDTMP at Roger Maris Cancer

  20. Soluble CD138/Syndecan-1 Increases in the Sera of Patients with Moderately Differentiated Bladder Cancer.

    Science.gov (United States)

    Sanaee, Mohammad Nabi; Malekzadeh, Mahyar; Khezri, Abdolaziz; Ghaderi, Abbas; Doroudchi, Mehrnoosh

    2015-01-01

    CD138/Syndecan-1 (Sdc-1) is expressed on the tumor and stromal cells of invasive bladder carcinoma. CD138/Sdc-1 shedding from the cell surface is associated with the invasive phenotype in lung and breast cancers. Soluble CD138/Sdc-1 was measured in the sera of 86 bladder cancer patients and 57 healthy individuals by a commercial ELISA assay. Soluble Sdc-1 was increased in the sera of patients with bladder cancer (138.42 ± 81.85 vs. 86.48 ± 82.58 ng/ml, p = 0.0003). Patients aged over 70 years had higher levels of CD138/Sdc-1 in their sera (159.7 ± 15.77 vs. 124.5 ± 9.99 ng/ml, p = 0.025), and soluble Sdc-1 levels were higher in the sera of patients with moderately differentiated tumors compared to poorly differentiated ones (170.47 ± 85.06 vs. 101.79 ± 68.24 ng/ml, p = 0.01). The soluble Sdc-1 level was higher in muscle-invasive (154.45 ± 83.60 vs. 89.9 ± 55.02 ng/ml) but not lymphatic-invasive (106.25 ± 52.10 vs. 123.43 ± 63.76 ng/ml) tumors (p = 0.027 and 0.45, respectively). A non-significant trend of soluble Sdc-1 increase in the sera of male patients compared to female patients was observed (145.38 ± 85.47 vs. 110.20 ± 59.04 ng/ml, p = 0.054). The elevated levels of soluble CD138/Sdc-1 in older bladder cancer patients and those with muscular invasion sheds some light on the mechanisms of the disease invasion. © 2015 S. Karger AG, Basel.

  1. MicroRNA-138 regulates osteogenic differentiation of human stromal (mesenchymal) stem cells in vivo

    DEFF Research Database (Denmark)

    Eskildsen, Tilde; Taipaleenmäki, H.; Stenvang, Jan

    2011-01-01

    Elucidating the molecular mechanisms that regulate human stromal (mesenchymal) stem cell (hMSC) differentiation into osteogenic lineage is important for the development of anabolic therapies for treatment of osteoporosis. MicroRNAs (miRNAs) are short, noncoding RNAs that act as key regulators......, overexpression of miR-138 reduced ectopic bone formation in vivo by 85%, and conversely, in vivo bone formation was enhanced by 60% when miR-138 was antagonized. Target prediction analysis and experimental validation by luciferase 3' UTR reporter assay confirmed focal adhesion kinase, a kinase playing a central...

  2. Complete genome sequence of a virulent Streptococcus agalactiae strain 138P isolated from disease Nile tilapia

    Science.gov (United States)

    The complete genome of a virulent Streptococcus agalactiae strain 138P is 1838701 bp in size, containing 1831 genes. The genome has 1593 coding sequences, 152 pseudo genes, 16 rRNAs, 69 tRNAs, and 1 non-coding RNA. The annotation of the genome is added by the NCBI Prokaryotic Genome Annotation Pipel...

  3. Complete genome sequence of an attenuated Sparfloxacin-resistant Streptococcus agalactiae strain 138spar

    Science.gov (United States)

    The complete genome of a sparfloxacin-resistant Streptococcus agalactiae vaccine strain 138spar is 1,838,126 bp in size. The genome has 1892 coding sequences and 82 RNAs. The annotation of the genome is added by the NCBI Prokaryotic Genome Annotation Pipeline. The publishing of this genome will allo...

  4. Abundances of La 138 and Ta 180 Through ν-Nucleosynthesis in ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 38; Issue 1. Abundances of La138 and Ta180 Through ν-Nucleosynthesis in 20 M ⊙ Type II Supernova Progenitor, Guided by Stellar Models for Seeds. N. Lahkar S. Kalita H. L. Duorah K. Duorah. Research Article Volume 38 Issue 1 March 2017 Article ID 8 ...

  5. Carbide precipitates in solution-quenched PH13-8 Mo stainless ...

    Indian Academy of Sciences (India)

    This paper deals with the small-angle neutron scattering (SANS) investigation on solution-quenched PH13-8 Mo stainless steel. From the nature of the variation of the functionality of the profiles for varying specimen thickness and also from the transmission electron microscopy (TEM), it has been established that the ...

  6. Formation of a new adduct based on fullerene tris-malonate samarium salt C60-[C60(=C(COO)2)3]Sm2

    Science.gov (United States)

    Petrov, A. A.; Keskinov, V. A.; Semenov, K. N.; Charykov, N. A.; Letenko, D. G.; Nikitin, V. A.

    2017-03-01

    Gram quantities of a new adduct based on light fullerene tris-malonate samarium salt C60 [C60(=C(COO)2)3]Sm2 are obtained via the reaction of ion exchange. The obtained adduct is studied by means of electron and infrared spectroscopy, X-ray and elemental analysis, electron microscopy, and thermogravimetry. The polythermal solubility of [C60(=C(COO)2)3]Sm2 in water is determined in ampoules via saturation within 20-70°C. The composition of crystalline hydrate [C60(=C(COO)2)3]Sm2 · 36H2O, which exists in equilibrium with the saturated solution, is estimated.

  7. Biodistribution of samarium-153-EDTMP in rats treated with docetaxel Biodistribuição de EDTMP-153-samário em ratos tratados com docetaxel

    Directory of Open Access Journals (Sweden)

    Arthur Villarim Neto

    2009-02-01

    Full Text Available PURPOSE: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. METHODS: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium group received docetaxel (15 mg/kg intraperitoneally in two cycles 11 days apart. The S (samarium/control group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1ml of samarium-153-EDTMP via orbital plexus (25µCi. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI/g was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland. RESULTS: On the 9th day after the administration of the 2nd chemotherapy cycle, the rats had a significant weight loss (314.50±22.09g compared (pOBJETIVO: Muitos pacientes com metástases ósseas são tratados com radiofármacos associados com quimioterapia para alívio da dor óssea. O objetivo do trabalho foi estudar a influência do docetaxel na biodistribuição do EDTMP-153-samário nos ossos e outros órgãos de ratos. MÉTODOS: Ratos Wistar foram aleatoriamente alocados em 2 grupos de 6 animais cada. O grupo DS (docetaxel/samário recebeu docetaxel (15 mg/kg intraperitoneal em dois ciclos com 11 dias de intervalo. Os ratos do grupo S (samário/controle não foram tratados com docetaxel. Nove dias após a quimioterapia, todos os animais receberam 0,1ml de EDTMP-153-samário via plexo orbital (25µCi. Após 2 horas, os animais foram mortos e feitas biópsias de cérebro, tireóide, pulmão, coração, estômago, cólon, fígado, rim e fêmures. O percentual de radioatividade por grama (%ATI/g de tecido de cada bi

  8. Marrow irradiation with high-dose 153Samarium-EDTMP followed by chemotherapy and hematopoietic stem cell infusion for acute myelogenous leukemia.

    Science.gov (United States)

    Rodriguez, Vilmarie; Anderson, Peter M; Litzow, Mark R; Erlandson, Linda; Trotz, Barbara A; Arndt, Carola A S; Khan, Shakila P; Wiseman, Gregory A

    2006-08-01

    In four patients, aged 15 - 20 years, with high-risk acute myeloid leukemia (AML), high-dose samarium 153-labelled ethylenediaminetetramethylenephosphonate (153Sm-EDTMP) was used for targeted marrow irradiation before preparative chemotherapy conditioning regimens and allogeneic (three patients) or autologous (one patient) hematopoietic stem cell transplantation. The dose of 153Sm-EDTMP was 703 MBq/kg (n = 1) or 1110 MBq/kg (n = 3). No side-effects occurred during the 30-min infusion of 153Sm-EDTMP. Samarium - melphalan regimens were given to three patients; one had 153Sm-EDTMP - busulfan + cyclophosphamide. Total body radioactivity was below the 133 MBq safe limit before infusion of stem cells (day 14 after 153Sm-EDTMP). No hemorrhagic cystitis, nephrotoxicity or serious infections occurred. Leukocyte engraftment (white blood cell count >0.5 x 10(9)/l) occurred between 12 and 23 days after stem cell infusion (mean of 17 days). Complete cytogenetic and morphologic remission of AML was evident on follow-up marrow aspirate and biopsy specimens from all patients. In two of the four study patients, the disease remains in complete remission and the patients have an excellent quality of life (Eastern Cooperative Oncology Group performance status 0; no medications) and no organ toxicity more than 2 years and more than 4 years, respectively, after their blood and bone marrow transplantations. Thus, in adolescents and adults, 153Sm-EDTMP may provide a relatively simple and effective means for using irradiation to eliminate AML within the marrow.

  9. MiR-138 Inhibits Tumor Growth Through Repression of EZH2 in Non-Small Cell Lung Cancer

    Directory of Open Access Journals (Sweden)

    Huijun Zhang

    2013-01-01

    Full Text Available Background/Aims: MicroRNAs (miRNAs play important roles in tumorigenesis. We investigated the roles and mechanisms of miR-138 in human non-small cell lung cancer (NSCLC. Methods: The expression of miR-138 was first examined in NSCLC cell lines and tumourtissues by real-time PCR The in vitro and in vivo functional effect of miR-138 was examined further. A luciferase reporter assay was conducted to confirm target association between miR-138 and the enhancer of zeste homolog 2 (EZH2. Results: miR-138 was frequently downregulated in NSCLC cells and tissues. Overexpression of miR-138 inhibited proliferation of NSCLC cells in vitro and tumor growth in vivo. The EZH2 oncogene, which is often overexpressed in various human cancers and acts as an important regulator of cell growth and tumor invasion, was identified as a novel target of miR-138. miR-138 can bind to the 3′ untranslated region (3′ UTR of EZH2 and suppress the expression of EZH2 at both mRNA and protein levels. Furthermore, knockdown of EZH2 phenocopied the tumor suppressive effects of miR-138 in cell models, whereas ectopic expression of EZH2 rescued the suppressive effects of miR-138. Conclusion: These findings define a tumor suppressor function for miR-138 in NSCLC and further suggest that miR-138 may represent a potential therapeutic target for NSCLC patients.

  10. MicroRNA-138 is a potential regulator of memory performance in humans

    Directory of Open Access Journals (Sweden)

    Julia eSchröder

    2014-07-01

    Full Text Available Genetic factors underlie a substantial proportion of individual differences in cognitive functions in humans, including processes related to episodic and working memory. While genetic association studies have proposed several candidate memory genes, these currently explain only a minor fraction of the phenotypic variance. Here, we performed genome-wide screening on 13 episodic and working memory phenotypes in 1,318 participants of the Berlin Aging Study II aged 60 years or older. The analyses highlight a number of novel single nucleotide polymorphisms (SNPs associated with memory performance, including one located in a putative regulatory region of microRNA (miRNA hsa-mir-138-5p (rs9882688, P-value = 7.8x10-9. Expression quantitative trait locus analyses on next-generation RNA-sequencing data revealed that rs9882688 genotypes show a significant correlation with the expression levels of this miRNA in 309 human lymphoblastoid cell lines (P-value = 5x10-4. In silico modeling of other top-ranking GWAS signals identified an additional memory-associated SNP in the 3' untranslated region (3'UTR of DCP1B, a gene encoding a core component of the mRNA decapping complex in humans, predicted to interfere with hsa-mir-138-5p binding. This prediction was confirmed in vitro by luciferase assays showing differential binding of hsa-mir-138-5p to 3'UTR reporter constructs in two human cell lines (HEK293: P-value = 0.0470; SH-SY5Y: P-value = 0.0866. Finally, expression profiling of hsa-mir-138-5p and DCP1B mRNA in human post-mortem brain tissue revealed that both molecules are expressed simultaneously in frontal cortex and hippocampus, suggesting that the proposed interaction between hsa-mir-138-5p and DCP1B may also take place in vivo. In summary, by combining unbiased genome-wide screening with extensive in silico modeling, in vitro functional assays, and gene expression profiling, our study identified miRNA-138 as a potential molecular regulator of human memory

  11. Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study; Sintesis de complejos de samario con el ligante derivado de base de Schiff Quinolinica. Caracterizacion y estudio fotofisico

    Energy Technology Data Exchange (ETDEWEB)

    Lucas H, J.

    2016-07-01

    In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

  12. Precipitate modification in PH13-8 Mo type maraging steel

    Energy Technology Data Exchange (ETDEWEB)

    Leitner, H., E-mail: harald.leitner@unileoben.ac.at [Department of Physical Metallurgy and Materials Testing, Montanuniversitaet Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Christian Doppler Laboratory for Early Stages of Precipitation, Montanuniversitaet Leoben, Franz-Josef-Strsse 18, A-8700 Leoben (Austria); Schnitzer, R. [Department of Physical Metallurgy and Materials Testing, Montanuniversitaet Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Christian Doppler Laboratory for Early Stages of Precipitation, Montanuniversitaet Leoben, Franz-Josef-Strsse 18, A-8700 Leoben (Austria); Schober, M. [Department of Physical Metallurgy and Materials Testing, Montanuniversitaet Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Zinner, S. [Boehler Edelstahl GmbH, Mariazellerstrasse 25, A-8605 Kapfenberg (Austria)

    2011-07-15

    The evolution of precipitates in PH13-8 Mo type stainless maraging steel alloyed with Cu was investigated during aging at 525 {sup o}C. Atom probe tomography was used to follow the evolution of precipitates with respect to type and chemical composition. It was found that Cu modifies the precipitation sequence in such alloys. Instead of Ni{sub 3}(Ti,Al) and G-phase the formation of NiAl and G-phase occurred. The modification of the precipitation sequence is due to the incorporation of Cu in NiAl precipitates. However, both types of precipitates develop out of an undefined precursor phase, in contrast to other Cu-alloyed PH13-8 Mo maraging steel grades.

  13. C/EBPβ mediates RNA polymerase III-driven transcription of oncomiR-138 in malignant gliomas

    Science.gov (United States)

    Di Pascale, Federica; Nama, Srikanth; Muhuri, Manish; Quah, Shan; Ismail, Hisyam M; Chan, Xin Hui Derryn; Sundaram, Gopinath M; Ramalingam, Rajkumar; Burke, Brian

    2018-01-01

    Abstract MicroRNA-138 (miR-138) is a pro-survival oncomiR for glioma stem cells. In malignant gliomas, dysregulated expression of microRNAs, such as miR-138, promotes Tumour initiation and progression. Here, we identify the ancillary role of the CCAAT/enhancer binding protein β (C/EBPβ) as a transcriptional activator of miR-138. We demonstrate that a short 158 bp DNA sequence encoding the precursor of miR-138-2 is essential and sufficient for transcription of miR-138. This short sequence includes the A-box and B-box elements characteristic of RNA Polymerase III (Pol III) promoters, and is also directly bound by C/EBPβ via an embedded ‘C/EBPβ responsive element’ (CRE). CRE and the Pol III B-box element overlap, suggesting that C/EBPβ and transcription factor 3C (TFIIIC) interact at the miR-138-2 locus. We propose that this interaction is essential for the recruitment of the RNA Pol III initiation complex and associated transcription of the oncomiR, miR-138 in malignant gliomas. PMID:29136251

  14. 14 CFR 91.138 - Temporary flight restrictions in national disaster areas in the State of Hawaii.

    Science.gov (United States)

    2010-01-01

    ... disaster areas in the State of Hawaii. 91.138 Section 91.138 Aeronautics and Space FEDERAL AVIATION... areas in the State of Hawaii. (a) When the Administrator has determined, pursuant to a request and justification provided by the Governor of the State of Hawaii, or the Governor's designee, that an inhabited...

  15. miR-138 protects cardiomyocytes from hypoxia-induced apoptosis via MLK3/JNK/c-jun pathway

    Energy Technology Data Exchange (ETDEWEB)

    He, Siyi; Liu, Peng; Jian, Zhao; Li, Jingwei; Zhu, Yun; Feng, Zezhou; Xiao, Yingbin, E-mail: xiaoyb@vip.sina.com

    2013-11-29

    Highlights: •First time to find miR-138 is up-regulated in hypoxic cardiomyocytes. •First time to find miR-138 targets MLK3 and regulates JNK/c-jun pathway. •Rare myocardial biopsy of patients with CHD were collected. •Both silence and overexpression of miR-138 were implemented. •Various methods were used to detect cell function. -- Abstract: Cardiomyocytes experience a series of complex endogenous regulatory mechanisms against apoptosis induced by chronic hypoxia. MicroRNAs are a class of endogenous small non-coding RNAs that regulate cellular pathophysiological processes. Recently, microRNA-138 (miR-138) has been found related to hypoxia, and beneficial for cell proliferation. Therefore, we intend to study the role of miR-138 in hypoxic cardiomyocytes and the main mechanism. Myocardial samples of patients with congenital heart disease (CHD) were collected to test miR-138 expression. Agomir or antagomir of miR-138 was transfected into H9C2 cells to investigate its effect on cell apoptosis. Higher miR-138 expression was observed in patients with cyanotic CHD, and its expression gradually increased with prolonged hypoxia time in H9C2 cells. Using MTT and LDH assays, cell growth was significantly greater in the agomir group than in the negative control (NC) group, while antagomir decreased cell survival. Dual luciferase reporter gene and Western-blot results confirmed MLK3 was a direct target of miR-138. It was found that miR-138 attenuated hypoxia-induced apoptosis using TUNEL, Hoechst staining and Annexin V-PE/7-AAD flow cytometry analysis. We further detected expression of apoptosis-related proteins. In the agomir group, the level of pro-apoptotic proteins such as cleaved-caspase-3, cleaved-PARP and Bad significantly reduced, while Bcl-2 and Bcl-2/Bax ratio increased. Opposite changes were observed in the antagomir group. Downstream targets of MLK3, JNK and c-jun, were also suppressed by miR-138. Our study demonstrates that up-regulation of miR-138 plays

  16. Targeting Glioma Stem Cells by Functional Inhibition of a Prosurvival OncomiR-138 in Malignant Gliomas

    Directory of Open Access Journals (Sweden)

    Xin Hui Derryn Chan

    2012-09-01

    Full Text Available Malignant gliomas are the most aggressive forms of brain tumors, associated with high rates of morbidity and mortality. Recurrence and tumorigenesis are attributed to a subpopulation of tumor-initiating glioma stem cells (GSCs that are intrinsically resistant to therapy. Initiation and progression of gliomas have been linked to alterations in microRNA expression. Here, we report the identification of microRNA-138 (miR-138 as a molecular signature of GSCs and demonstrate a vital role for miR-138 in promoting growth and survival of bona fide tumor-initiating cells with self-renewal potential. Sequence-specific functional inhibition of miR-138 prevents tumorsphere formation in vitro and impedes tumorigenesis in vivo. We delineate the components of the miR-138 regulatory network by loss-of-function analysis to identify specific regulators of apoptosis. Finally, the higher expression of miR-138 in GSCs compared to non-neoplastic tissue and association with tumor recurrence and survival highlights the clinical significance of miR-138 as a prognostic biomarker and a therapeutic target for treatment of malignant gliomas.

  17. Pyrolysis result of polyethylene waste as fuel for solid oxide fuel cell with samarium doped-ceria (SDC)-carbonate as electrolyte

    Science.gov (United States)

    Syahputra, R. J. E.; Rahmawati, F.; Prameswari, A. P.; Saktian, R.

    2017-02-01

    In this research, the result of pyrolysis on polyethylene was used as fuel for a solid oxide fuel cell (SOFC). The pyrolysis result is a liquid which consists of hydrocarbon chains. According to GC-MS analysis, the hydrocarbons mainly consist of C7 to C20 hydrocarbon chain. Then, the liquid was applied to a single cell of NSDC-L | NSDC | NSDC-L. NSDC is a composite SDC (samarium doped-ceria) with sodium carbonate. Meanwhile, NSDC-L is a composite of NSDC with LiNiCuO (LNC). NSDC and LNC were analyzed by X-ray diffraction to understand their crystal structure. The result shows that presence of carbonate did not change the crystal structure of SDC. SEM EDX analysis for fuel cell before and after being loaded with polyethylene oil to get information of element diffusion to the electrolyte. Meanwhile, the conductivity properties were investigated through impedance measurement. The presence of carbonate even increases the electrical conductivity. The single cell test with the pyrolysis result of polyethylene at 300 - 600 °C, found that the highest power density is at 600 °C with the maximum power density of 0.14 mW/cm2 and open circuit voltage of 0.4 Volt. Elemental analysis at three point spots of single cell NDSC-L |NSDC|NSDC-L found that a migration of ions was occurred during fuel operation at 300 - 600 °C.

  18. Effects of some rare earth and carbonate-based co-dopants on structural and electrical properties of samarium doped ceria (SDC) electrolytes for solid oxide fuel cells

    Science.gov (United States)

    Anwar, Mustafa; Khan, Zuhair S.; Mustafa, Kamal; Rana, Akmal

    2015-09-01

    In the present study, samarium doped ceria (SDC) and SDC-based composite with the addition of K2CO3 were prepared by co-precipitation route and effects of pH of the solution and calcination temperature on microstructure of SDC and SDC-K2CO3, respectively, were investigated. Furthermore, experimentation was performed to investigate into the ionic conductivity of pure SDC by co-doping with yttrium i.e., YSDC, XRD and SEM studies show that the crystallite size and particle size of SDC increases with the increase in pH. The SEM images of all the samples of SDC synthesized at different pH values showed the irregular shaped and dispersed particles. SDC-K2CO3 was calcined at 600∘C, 700∘C and 800∘C for 4 h and XRD results showed that crystallite size increases while lattice strain, decreases with the increase in calcination temperature and no peaks were detected for K2CO3 as it is present in an amorphous form. The ionic conductivity of the electrolytes increases with the increase in temperature and SDC-K2CO3 shows the highest value of ionic conductivity as compared to SDC and YSDC. Chemical compatibility tests were performed between the co-doped electrolyte and lithiated NiO cathode at high temperature. It revealed that the couple could be used up to the temperature of 700∘C.

  19. Calculation of the Dose of Samarium-153-Ethylene Diamine Tetramethylene Phosphonate (153Sm-EDTMP as a Radiopharmaceutical for Pain Relief of bone Metastasis

    Directory of Open Access Journals (Sweden)

    Fatemeh Razghandi

    2016-04-01

    Full Text Available Introduction One of the important applications of nuclear physics in medicine is the use of radioactive elements as radiopharmaceuticals. Metastatic bone disease is the most common form of malignant bone tumors. Samarium-153-ethylene diamine tetramethylene phosphonate (153Sm-EDTMP as a radiopharmaceutical is used for pain palliation. This radiopharmaceutical usually emits beta particles, which have a high uptake in bone tissues. The purpose of this study was to calculate the radiation dose distribution of 153Sm-EDTMP in bone and other tissues, using MCNPX Monte Carlo code in the particle transport model. Materials and Methods Dose delivery to the bone was simulated by seeking radiopharmaceuticals on the bone surface. The phantom model had a simple cylindrical geometry and included bone, bone marrow, and soft tissue. Results The simulation results showed that a significant amount of radiation dose was delivered to the bone by the use of this radiopharmaceutical. Conclusion Thebone acted as a fine protective shield against rays for the bone marrow. Therefore, the trivial absorbed dose by the bone marrow caused less damage to bone-making cells. Also, the high absorbed dose of the bone could destroy cancer cells and relieve the pain in the bone.

  20. Synthesis, quality control and biological evaluation of tris[(1,10-phenanthroline)[{sup 153}Sm]samarium(III)]trithiocyanate complex as a therapeutic agent

    Energy Technology Data Exchange (ETDEWEB)

    Naseri, Z.; Kharat, A. Nemati [Tehran Univ. (Iran, Islamic Republic of). Inorganic Chemistry Dept.; Hakimi, A. [Islamic Azad Univ., Tehran (Iran, Islamic Republic of). Dept. of Nuclear Engineering, Science and Research Branch; Jalilian, A.R.; Shirvani-Arani, S.; Bahrami-Samani, A.; Ghannadi-Maragheh, M. [Nuclear Science and Technology Research Institute (NSTRI), Tehran (IR). Radiopharmaceutical Research and Development Lab (RRDL)

    2012-07-01

    Therapeutic radiopharmaceuticals are designed to deliver high doses of radiation to selected target organs or tissues with an aim of minimizing unwanted radiation to surrounding healthy tissue. In this work, [tris(1,10-phenanthroline)[{sup 153}Sm]samarium(III)]trithiocyanate ({sup 153}Sm-TPTTC) was developed for possible therapeutic properties. The cold compound, i.e. {sup nat}Sm-TPTTC was prepared and characterized by IR, UV, mass and {sup 1}H-NMR spectroscopy. {sup 153}Sm-TPTTC was prepared in two steps using [{sup 153}Sm]SmCl{sub 3}, obtained by neutron activation of an enriched {sup 152}Sm sample. Stability tests, partition coefficient determination, toxicity tests and biodistribution studies of the complex in wild-type and fibrosarcoma-bearing mice were determined. The radiolabeled complex was prepared in high radiochemical purity (> 99% precipitation method) and specific activity of 278 GBq/mmol and demonstrated significant stability at 4, 25 and 37 C (in presence of human serum). Initial complex biodistribution data showed significant liver accumulation in wild-type mice and significant tumor accumulation in fibrosarcoma-bearing mice with tumor:blood and tumor:muscle ratios of 3.55 (2 h) and 38.26 (96 h) respectively. {sup 153}Sm-TPTTC properties suggest an efficient tumor targeting agent with high tumor-avidity. Further investigation on the therapeutic properties must be conducted. (orig.)

  1. The mass of the Mars-sized exoplanet Kepler-138 b from transit timing.

    Science.gov (United States)

    Jontof-Hutter, Daniel; Rowe, Jason F; Lissauer, Jack J; Fabrycky, Daniel C; Ford, Eric B

    2015-06-18

    Extrasolar planets that pass in front of their host star (transit) cause a temporary decrease in the apparent brightness of the star, providing a direct measure of the planet's size and orbital period. In some systems with multiple transiting planets, the times of the transits are measurably affected by the gravitational interactions between neighbouring planets. In favourable cases, the departures from Keplerian orbits (that is, unaffected by gravitational effects) implied by the observed transit times permit the planetary masses to be measured, which is key to determining their bulk densities. Characterizing rocky planets is particularly difficult, because they are generally smaller and less massive than gaseous planets. Therefore, few exoplanets near the size of Earth have had their masses measured. Here we report the sizes and masses of three planets orbiting Kepler-138, a star much fainter and cooler than the Sun. We determine that the mass of the Mars-sized inner planet, Kepler-138 b, is 0.066(+0.059)(-0.037) Earth masses. Its density is 2.6(+2.4)(-1.5) grams per cubic centimetre. The middle and outer planets are both slightly larger than Earth. The middle planet's density (6.2(+5.8)(-3.4) grams per cubic centimetre) is similar to that of Earth, and the outer planet is less than half as dense at 2.1(+2.2)(-1.2) grams per cubic centimetre, implying that it contains a greater portion of low-density components such as water and hydrogen.

  2. Long and Short Isoforms of the Human Cytomegalovirus UL138 Protein Silence IE Transcription and Promote Latency.

    Science.gov (United States)

    Lee, Song Hee; Caviness, Katie; Albright, Emily R; Lee, Jeong-Hee; Gelbmann, Christopher B; Rak, Mike; Goodrum, Felicia; Kalejta, Robert F

    2016-10-15

    The UL133-138 locus present in clinical strains of human cytomegalovirus (HCMV) encodes proteins required for latency and reactivation in CD34(+) hematopoietic progenitor cells and virion maturation in endothelial cells. The encoded proteins form multiple homo- and hetero-interactions and localize within secretory membranes. One of these genes, UL136 gene, is expressed as at least five different protein isoforms with overlapping and unique functions. Here we show that another gene from this locus, the UL138 gene, also generates more than one protein isoform. A long form of UL138 (pUL138-L) initiates translation from codon 1, possesses an amino-terminal signal sequence, and is a type one integral membrane protein. Here we identify a short protein isoform (pUL138-S) initiating from codon 16 that displays a subcellular localization similar to that of pUL138-L. Reporter, short-term transcription, and long-term virus production assays revealed that both pUL138-L and pUL138-S are able to suppress major immediate early (IE) gene transcription and the generation of infectious virions in cells in which HCMV latency is studied. The long form appears to be more potent at silencing IE transcription shortly after infection, while the short form seems more potent at restricting progeny virion production at later times, indicating that both isoforms of UL138 likely cooperate to promote HCMV latency. Latency allows herpesviruses to persist for the lives of their hosts in the face of effective immune control measures for productively infected cells. Controlling latent reservoirs is an attractive antiviral approach complicated by knowledge deficits for how latently infected cells are established, maintained, and reactivated. This is especially true for betaherpesviruses. The functional consequences of HCMV UL138 protein expression during latency include repression of viral IE1 transcription and suppression of virus replication. Here we show that short and long isoforms of UL138

  3. Heat stress attenuates new cell generation in the hypothalamus: a role for miR-138.

    Science.gov (United States)

    Kisliouk, T; Cramer, T; Meiri, N

    2014-09-26

    The anterior hypothalamus (Ant Hyp) of the brain serves as the main regulator of numerous homeostatic functions, among them body temperature. Fine-tuning of the thermal-response set point during the critical postnatal sensory-developmental period involves neuronal network remodeling which might also be accompanied by alterations in hypothalamic cell populations. Here we demonstrate that heat stress during the critical period of thermal-control establishment interferes with generation of new cells in the chick hypothalamus. Whereas conditioning of the 3-day-old chicks under high ambient temperatures for 24h diminished the number of newborn cells in anterior hypothalamic structures 1 week after the treatment, mild heat stress did not influence the amount of new cells. Phenotypic analysis of these newborn cells indicated a predominant decrease in non-neuronal cell precursors, i.e. cells that do not express doublecortin (DCX). Furthermore, heat challenge of 10-day-old previously high-temperature-conditioned chicks abolished hypothalamic neurogenesis and significantly decreased the number of cells of non-neural origin. As a potential regulatory mechanism for the underlying generation of new cells in the hypothalamus, we investigated the role of the microRNA (miRNA) miR-138, previously reported by us to promote hypothalamic cell migration in vitro and whose levels are reduced during heat stress. Intracranial injection into the third ventricle of miR-138 led to an increase in the number of newborn cells in the Ant Hyp, an effect which might be partially mediated by inhibition of its direct target reelin. These data demonstrate the role of ambient temperature on the generation of new cells in the hypothalamus during the critical period of thermal-control establishment and highlight the long-term effect of severe heat stress on hypothalamic cell population. Moreover, miRNAs, miR-138 in particular, can regulate new cell generation in the hypothalamus. Copyright © 2014 IBRO

  4. Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues; Capacidad de retencion de samario (III) en circon para su posible uso en barreras de contencion para confinamiento de residuos nucleares

    Energy Technology Data Exchange (ETDEWEB)

    Garcia G, N

    2006-07-01

    Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH{sub PCN}) and density of surface sites (D{sub s}). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

  5. Results of the radiological survey at 23 Yardboro Avenue, Albany, New York (AL138)

    Energy Technology Data Exchange (ETDEWEB)

    Marley, J.L.

    1987-12-01

    A number of properties in the Albany/Colonie area have been identified as being potentially contaminated with uranium originating from the former National Lead Company's uranium forming plant in Colonie, New York. The property at 23 Yardboro Avenue in Albany, New York (AL138) was the subject of a radiological investigation initiated May 7, 1986. The property was a residence with a one and one-half-story frame house located on a rectangular lot. An asphalt driveway or parking area is located at the east side of the house. An area of /approximately/10 m /times/ 14 m at the rear was inaccessible. A diagram of the property showing the approximate boundaries and the 3-m grid network established for measurements outside the house is shown. The lot included in the radiological survey was /approximately/14 m wide by 36 m deep. Front and rear views of the property are shown. 13 refs., 5 figs., 5 tabs.

  6. HH137 and 138: Discovering New Knots and a Molecular Outflow with Gemini and APEX

    Science.gov (United States)

    Ferrero, L. V.; Cappa, C. E.; Gomez, M.

    2017-07-01

    We present a multi-frequency study of HH 137 and HH 138 using Gemini images and APEX molecular line data, as well as Spitzer images. Several 2.12 micron knots linked to HH137 are identified in the Gemini image. 12^CO(3-2), 13^CO(3-2), and C18^O(3-2) line data reveal the molecular counterpart of HH 137. Spitzer combined images suggest the location of the exciting source of HH 137, almost coincident with a high-density molecular clump detected in C18^O. We derive the main physical parameters of the molecular clump and the molecular outflow, and propose a simple scenario for the whole complex.

  7. Role of laccase from Coriolus versicolor MTCC-138 in selective oxidation of aromatic methyl group.

    Science.gov (United States)

    Chaurasia, Pankaj Kumar; Singh, Sunil Kumar; Bharati, Shashi Lata

    2014-01-01

    Now a day, laccases are the most promising enzymes in the area of biotechnology and synthesis. One of the best applications of laccases is the selective oxidation of aromatic methyl group to aldehyde group. Such transformations are valuable because it is difficult to stop the reaction at aldehyde stage. Chemical methods used for such biotransformations areexpensive and give poor yields. But, the laccase-catalyzed biotransformations of such type are non-expensive and yield is excellent. Authors have used crude laccase obtained from the liquid culture growth medium of fungal strain Coriolus versicolor MTCC-138 for the biotransformations of toluene, 3-nitrotoluene, and 4-chlorotoluene to benzaldehyde, 3-nitrobenzaldehyde, and 4-chlorobenzaldehyde, respectively, instead of purified laccase because purification process requires much time and cost. This communication reports that crude laccase can also be used in the place of purified laccase as effective biocatalyst.

  8. The postconcussion syndrome in sports and recreation: clinical features and demography in 138 athletes.

    Science.gov (United States)

    Tator, Charles H; Davis, Hannah

    2014-10-01

    There are still many unanswered questions about postconcussion syndrome (PCS) in sports and recreation. The predictors of PCS are unknown, although a history of previous concussion has been suspected. To explore the clinical features and demography of PCS in athletes. A retrospective cohort study was performed by chart review of clinical and demographic data of 285 consecutive concussed patients, 138 of whom had sports-related PCS based on ≥ 3 postconcussion symptoms lasting ≥ 1 month. The 138 athletes with PCS averaged 22.8 years of age, and 70 (50.7%) were ≤ 18 years of age. They averaged 3.4 concussions (range, 1 to > 12). Only 19.6% had no previous concussion. There was a history of previous psychiatric condition, attention-deficit disorder or attention-deficit/hyperactive disorder, learning disability, or previous migraine headaches in 21.0%. Ice hockey caused the highest number of the most recent concussions at 72 cases (52.2%). Soccer, snow skiing, equestrian sports, and basketball were less frequent causes. The average number of persistent symptoms was 7.6, and the median duration of PCS was 6 months at the first examination. More than 80% of PCS cases had at least 1 other previous concussion. Half of the athletes with PCS were ≤ 18 years of age. PCS was associated with 7.6 symptoms per athlete. The duration of PCS and the number of symptoms were not related to the number of previous concussions, loss of consciousness, or return to play. Further research on treatment and prevention of PCS is required.

  9. Assessment of bone marrow plasma cell infiltrates in multiple myeloma: the added value of CD138 immunohistochemistry

    Science.gov (United States)

    Al-Quran, Samer Z.; Yang, Lijun; Magill, James M.; Braylan, Raul C.; Douglas-Nikitin, Vonda K.

    2012-01-01

    Summary Assessment of bone marrow involvement by malignant plasma cells is an important element in the diagnosis and follow-up of patients with multiple myeloma and other plasma cell dyscrasias. Microscope-based differential counts of bone marrow aspirates are used as the primary method to evaluate bone marrow plasma cell percentages. However, multiple myeloma is often a focal process, a fact that impacts the accuracy and reliability of the results of bone marrow plasma cell percentages obtained by differential counts of bone marrow aspirate smears. Moreover, the interobserver and intraobserver reproducibility of counting bone marrow plasma cells microscopically has not been adequately tested. CD138 allows excellent assessment of plasma cell numbers and distribution in bone marrow biopsies. We compared estimates of plasma cell percentages in bone marrow aspirates and in hematoxylin-eosin– and CD138-stained bone marrow biopsy sections (CD138 sections) in 79 bone marrows from patients with multiple myeloma. There was a notable discrepancy in bone marrow plasma cell percentages using the different methods of observation. In particular, there was a relatively poor concordance of plasma cell percentage estimation between aspirate smears and CD138 sections. Estimates of plasma cell percentage using CD138 sections demonstrated the highest interobserver concordance. This observation was supported by computer-assisted image analysis. In addition, CD138 expression highlighted patterns of plasma cell infiltration indicative of neoplasia even in the absence of plasmacytosis. We conclude that examination of CD138 sections should be considered for routine use in the estimation of plasma cell load in the bone marrow. PMID:17714757

  10. SU-C-201-06: Utility of Quantitative 3D SPECT/CT Imaging in Patient Specific Internal Dosimetry of 153-Samarium with GATE Monte Carlo Package

    Energy Technology Data Exchange (ETDEWEB)

    Fallahpoor, M; Abbasi, M [Tehran University of Medical Sciences, Vali-Asr Hospital, Tehran, Tehran (Iran, Islamic Republic of); Sen, A [University of Houston, Houston, TX (United States); Parach, A [Shahid Sadoughi University of Medical Sciences, Yazd, Yazd (Iran, Islamic Republic of); Kalantari, F [UT Southwestern Medical Center, Dallas, TX (United States)

    2015-06-15

    Purpose: Patient-specific 3-dimensional (3D) internal dosimetry in targeted radionuclide therapy is essential for efficient treatment. Two major steps to achieve reliable results are: 1) generating quantitative 3D images of radionuclide distribution and attenuation coefficients and 2) using a reliable method for dose calculation based on activity and attenuation map. In this research, internal dosimetry for 153-Samarium (153-Sm) was done by SPECT-CT images coupled GATE Monte Carlo package for internal dosimetry. Methods: A 50 years old woman with bone metastases from breast cancer was prescribed 153-Sm treatment (Gamma: 103keV and beta: 0.81MeV). A SPECT/CT scan was performed with the Siemens Simbia-T scanner. SPECT and CT images were registered using default registration software. SPECT quantification was achieved by compensating for all image degrading factors including body attenuation, Compton scattering and collimator-detector response (CDR). Triple energy window method was used to estimate and eliminate the scattered photons. Iterative ordered-subsets expectation maximization (OSEM) with correction for attenuation and distance-dependent CDR was used for image reconstruction. Bilinear energy mapping is used to convert Hounsfield units in CT image to attenuation map. Organ borders were defined by the itk-SNAP toolkit segmentation on CT image. GATE was then used for internal dose calculation. The Specific Absorbed Fractions (SAFs) and S-values were reported as MIRD schema. Results: The results showed that the largest SAFs and S-values are in osseous organs as expected. S-value for lung is the highest after spine that can be important in 153-Sm therapy. Conclusion: We presented the utility of SPECT-CT images and Monte Carlo for patient-specific dosimetry as a reliable and accurate method. It has several advantages over template-based methods or simplified dose estimation methods. With advent of high speed computers, Monte Carlo can be used for treatment planning

  11. Fabrication of catalytically active nanocrystalline samarium (Sm)-doped cerium oxide (CeO2) thin films using electron beam evaporation

    Science.gov (United States)

    Kundu, Subrata; Sutradhar, Narottam; Thangamuthu, R.; Subramanian, B.; Panda, Asit Baran; Jayachandran, M.

    2012-08-01

    Samarium (Sm)-doped cerium oxide (CeO2) thin films were fabricated using electron beam evaporation technique. The synthesized films were deposited either on glass or ITO substrates and studied their nature by annealing at different temperatures. The optical properties and other morphological studies were done by UV-Vis, XRD, XPS, SEM, EDS, and FT-IR analysis. XRD and XPS analysis clearly confirm the presence of Sm in the ceria site. From the SEM study, it was found that after annealing at high temperature ( 300 or 500 °C), the particles size was reduced due to breakdown of large aggregates of particles which is also confirmed from UV-Vis, XPS, and XRD analyses. The FT-IR study proves the presence of -COO-, -OH, or ammonium group on the particles surface. The deposition of Sm-doped CeO2 nanomaterials was found more feasible on ITO substrate compared to that of glass substrate in terms of stability and depth of film thickness. The Sm-doped CeO2 nanomaterial acts as a re-usable catalyst for the reduction of organic dye molecules in the presence of NaBH4. The catalysis rate was compared by considering the electron transfer process during the reduction. The synthesized Sm-doped CeO2 thin films might find wide variety of applications in various emerging fields like solid oxide fuel cells (SOFCs), oxygen sensor or as catalyst in different types of organic and inorganic catalytic reactions. The fabrication process is very simple, straightforward, less time consuming, and cost effective.

  12. Fabrication of catalytically active nanocrystalline samarium (Sm)-doped cerium oxide (CeO{sub 2}) thin films using electron beam evaporation

    Energy Technology Data Exchange (ETDEWEB)

    Kundu, Subrata, E-mail: skundu@cecri.res.in [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India); Sutradhar, Narottam [G. B. Marg, Central Salt and Marine Chemical Research Institute - CSIR (India); Thangamuthu, R.; Subramanian, B. [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India); Panda, Asit Baran [G. B. Marg, Central Salt and Marine Chemical Research Institute (CSIR) (India); Jayachandran, M., E-mail: mjayam54@yahoo.com [Council of Scientific and Industrial Research (CSIR), Electrochemical Materials Science (ECMS) Division, Central Electrochemical Research Institute - CECRI (India)

    2012-08-15

    Samarium (Sm)-doped cerium oxide (CeO{sub 2}) thin films were fabricated using electron beam evaporation technique. The synthesized films were deposited either on glass or ITO substrates and studied their nature by annealing at different temperatures. The optical properties and other morphological studies were done by UV-Vis, XRD, XPS, SEM, EDS, and FT-IR analysis. XRD and XPS analysis clearly confirm the presence of Sm in the ceria site. From the SEM study, it was found that after annealing at high temperature ({approx}300 or 500 Degree-Sign C), the particles size was reduced due to breakdown of large aggregates of particles which is also confirmed from UV-Vis, XPS, and XRD analyses. The FT-IR study proves the presence of -COO-, -OH, or ammonium group on the particles surface. The deposition of Sm-doped CeO{sub 2} nanomaterials was found more feasible on ITO substrate compared to that of glass substrate in terms of stability and depth of film thickness. The Sm-doped CeO{sub 2} nanomaterial acts as a re-usable catalyst for the reduction of organic dye molecules in the presence of NaBH{sub 4}. The catalysis rate was compared by considering the electron transfer process during the reduction. The synthesized Sm-doped CeO{sub 2} thin films might find wide variety of applications in various emerging fields like solid oxide fuel cells (SOFCs), oxygen sensor or as catalyst in different types of organic and inorganic catalytic reactions. The fabrication process is very simple, straightforward, less time consuming, and cost effective.Graphical Abstract.

  13. Processing of ovine PrP(ARQ)C-EGFP chimeras containing Asn138 and Cys151 polymorphisms.

    Science.gov (United States)

    Bragason, Birkir Thor; Palsdottir, Astridur

    2005-10-21

    Polymorphisms in the prion protein, PrP(C), affect the susceptibility of sheep to scrapie. Three rare polymorphisms, M137T, S138N, and R151C, have been found in Icelandic sheep. Observations suggest that R151C may be associated with lower scrapie susceptibility, whereas S138N is neutral. The effects of the S138N and R151C polymorphisms on the cellular processing of PrP(C) were examined in a model system consisting of the expression of ovine PrP(C)-EGFP (green fluorescent protein) chimeras in the mouse neuroblastoma cell line N2a. Chimeras with the haplotypes A136R154Q171 (ARQ), AN138RQ, and AC151RQ were compared. The chimeras did not differ regarding their translocation into the secretory system, glycosylation, and transport to the cell surface. However, the AC151RQ chimera differed from the other chimeras regarding disulfide bonding characteristics; furthermore, a slight difference was detected between AC151RQ and the other chimeras by limited proteolysis. The processing of the ARQ and AN138RQ chimeras was identical in the experiments performed consistent with observations that it is neutral.

  14. Effect of floor space allowances on growth performance of finishing pigs marketed at 138 kilograms.

    Science.gov (United States)

    Johnston, L J; Rozeboom, D W; Goodband, R D; Moeller, S J; Shannon, M C; Schieck, S J

    2017-11-01

    Current floor space allowances were determined in research studies conducted 10 to 20 yr ago using pigs that were marketed at a BW of about 113 kg or less. Currently, pork producers are regularly marketing pigs that weigh over 128 kg. Given this precipitous increase in market weight, we conducted 2 experiments to determine if floor space allowances previously determined apply to pigs marketed at greater than 128 kg. Experiment 1 was conducted at 5 university research stations throughout the Upper Midwest region. In this experiment, we evaluated the growth performance, salivary cortisol concentrations, and lesion scores of pigs weighing between 27 and 138 kg provided 0.71, 0.80, 0.89, 0.98, or 1.07 m/pig of floor space. Within each station, group size (range = 6 to 19 pigs) remained constant across floor space treatments but pen size was altered to achieve the desired space allocations. There were 14 replicate pens for each treatment. Overall, increasing floor space allowance increased final BW (linear, = 0.04) and tended (linear, space allocation. Salivary cortisol concentrations and lesion scores were not affected by floor space allowances. Experiment 2 focused on floor space needs of pigs nearing market weight and was conducted at 4 research stations. Pigs weighing about 130 kg were assigned to pens that provided 0.71, 0.80, 0.89, 0.98, or 1.07 m/pig of floor space. Group size ranged from 4 to 11 pigs per pen but was constant across floor space treatments within station. The study lasted 2 wk and there were 8 replicate pens per treatment. As floor space allowance increased, ADG (0.86, 0.95, 0.95, 1.10, and 1.06 kg; linear, < 0.01), ADFI (3.03, 3.26, 3.22, 3.49, and 3.25 kg; quadratic, < 0.05), and final BW (145.6, 145.7, 146.4, 148.3, and 147.9 kg; linear, < 0.01) increased. Based on the results of these 2 experiments, pigs marketed at about 138 kg require at least 0.89 m/pig to support optimal growth performance. However, heavier pigs (about 148 kg) at the end

  15. Anle138b partly ameliorates motor deficits despite failure of neuroprotection in a model of advanced multiple system atrophy

    Directory of Open Access Journals (Sweden)

    Lisa eFellner

    2016-03-01

    Full Text Available The neurodegenerative disorder multiple system atrophy (MSA is characterized by autonomic failure, cerebellar ataxia and parkinsonism in any combination associated with predominantly oligodendroglial α-synuclein (α-syn aggregates (glial cytoplasmic inclusions=GCIs. To date, there is no effective disease modifying therapy. Previous experiments have shown that the aggregation inhibitor anle138b reduces neurodegeneration, as well as behavioral deficits in both transgenic and toxin mouse models of Parkinson’s disease (PD. Here we analyzed whether anle138b improves motor skills and reduces neuronal loss, as well as oligodendroglial α-syn aggregation in the PLP-α-syn transgenic mouse challenged with the mitochondrial toxin 3-nitropropionic acid (3-NP to model full-blown MSA. Following one month of treatment with anle138b, MSA mice showed signs of motor improvement affecting stride length, but not pole, grip strength and beam test performance. Loss of dopaminergic nigral neurons and Purkinje cells was not attenuated and GCI density remained unchanged. These data suggest that the pathology in transgenic PLP-α-syn mice receiving 3-NP might be too advanced to detect significant effects of anle138b treatment on neuronal loss and intracytoplasmic α-syn inclusion bodies. However, the partial motor amelioration may indicate potential efficacy of anle138b treatment that may be mediated by its actions on α-syn oligomers or may reflect improvement of neuronal dysfunction in neural at risk populations. Further studies are required to address the efficacy of anle138b in transgenic α-syn models of early-stage MSA and in the absence of additional toxin application.

  16. Genome-Wide Analysis of CCA1-Like Proteins in Soybean and Functional Characterization of GmMYB138a

    Directory of Open Access Journals (Sweden)

    Shaomin Bian

    2017-09-01

    Full Text Available Plant CIRCADIAN CLOCK ASSOCIATED1 (CCA1-like proteins are a class of single-repeat MYELOBLASTOSIS ONCOGENE (MYB transcription factors generally featured by a highly conserved motif SHAQK(Y/FF, which play important roles in multiple biological processes. Soybean is an important grain legume for seed protein and edible vegetable oil. However, essential understandings regarding CCA1-like proteins are very limited in soybean. In this study, 54 CCA1-like proteins were identified by data mining of soybean genome. Phylogenetic analysis indicated that soybean CCA1-like subfamily showed evolutionary conservation and diversification. These CCA1-like genes displayed tissue-specific expression patterns, and analysis of genomic organization and evolution revealed 23 duplicated gene pairs. Among them, GmMYB138a was chosen for further investigation. Our protein–protein interaction studies revealed that GmMYB138a, but not its alternatively spliced isoform, interacts with a 14-3-3 protein (GmSGF14l. Although GmMYB138a was predominately localized in nucleus, the resulting complex of GmMYB138a and GmSGF14l was almost evenly distributed in nucleus and cytoplasm, supporting that 14-3-3s interact with their clients to alter their subcellular localization. Additionally, qPCR analysis suggested that GmMYB138a and GmSGF14l synergistically or antagonistically respond to drought, cold and salt stresses. Our findings will contribute to future research in regard to functions of soybean CCA1-like subfamily, especially regulatory mechanisms of GmMYB138a in response to abiotic stresses.

  17. Isolation of Circulating Plasma Cells in Multiple Myeloma Using CD138 Antibody-Based Capture in a Microfluidic Device

    Science.gov (United States)

    Qasaimeh, Mohammad A.; Wu, Yichao C.; Bose, Suman; Menachery, Anoop; Talluri, Srikanth; Gonzalez, Gabriel; Fulciniti, Mariateresa; Karp, Jeffrey M.; Prabhala, Rao H.; Karnik, Rohit

    2017-04-01

    The necessity for bone marrow aspiration and the lack of highly sensitive assays to detect residual disease present challenges for effective management of multiple myeloma (MM), a plasma cell cancer. We show that a microfluidic cell capture based on CD138 antigen, which is highly expressed on plasma cells, permits quantitation of rare circulating plasma cells (CPCs) in blood and subsequent fluorescence-based assays. The microfluidic device is based on a herringbone channel design, and exhibits an estimated cell capture efficiency of ~40-70%, permitting detection of numbers in blood samples of MM patients in remission (20-24 CD138+ cells/mL), and yet higher numbers in MM patients exhibiting disease (45-184 CD138+ cells/mL). Analysis of CPCs isolated using the device was consistent with serum immunoglobulin assays that are commonly used in MM diagnostics. These results indicate the potential of CD138-based microfluidic CPC capture as a useful ‘liquid biopsy’ that may complement or partially replace bone marrow aspiration.

  18. Crystal structure and tautomerism of Pigment Yellow 138 determined by X-ray powder diffraction and solid-state NMR

    DEFF Research Database (Denmark)

    Gumbert, Silke D.; Körbitzer, Meike; Alig, Edith

    2016-01-01

    The crystal structure of C.I. Pigment Yellow 138 was determined from X-ray powder diffraction data using real-space methods with subsequent Rietveld refinements. The tautomeric state was investigated by solid-state 1D and 2D multinuclear NMR experiments. In the crystals, the compound exhibits...... is not a packing effect, but caused by intramolecular steric hindrance....

  19. Crystal structure of monoclinic samarium and cubic europium sesquioxides and bound coherent neutron scattering lengths of the isotopes {sup 154}Sm and {sup 153}Eu

    Energy Technology Data Exchange (ETDEWEB)

    Kohlmann, Holger [Leipzig Univ. (Germany). Inst. of Inorganic Chemistry; Hein, Christina; Kautenburger, Ralf [Saarland Univ., Saarbruecken (Germany). Inorganic Solid State Chemistry; Hansen, Thomas C.; Ritter, Clemens [Institut Laue-Langevin, Grenoble (France); Doyle, Stephen [Karlsruhe Institute of Technology, Eggenstein-Leopoldshafen (Germany). Inst. for Synchrotron Radiation (ISS)

    2016-11-01

    The crystal structures of monoclinic samarium and cubic europium sesquioxide, Sm{sub 2}O{sub 3} and Eu{sub 2}O{sub 3}, were reinvestigated by powder diffraction methods (laboratory X-ray, synchrotron, neutron). Rietveld analysis yields more precise structural parameters than previously known, especially for oxygen atoms. Interatomic distances d(Sm-O) in Sm{sub 2}O{sub 3} range from 226.3(4) to 275.9(2) pm [average 241.6(3) pm] for the monoclinic B type Sm{sub 2}O{sub 3} [space group C2/m, a = 1418.04(3) pm, b = 362.660(7) pm, c = 885.48(2) pm, β = 100.028(1) ], d(Eu-O) in Eu{sub 2}O{sub 3} from 229.9(2) to 238.8(2) pm for the cubic bixbyite (C) type [space group Ia anti 3, a = 1086.87(1) pm]. Neutron diffraction at 50 K and 2 K did not show any sign for magnetic ordering in Sm{sub 2}O{sub 3}. Isotopically enriched {sup 154}Sm{sub 2}O{sub 3} and {sup 153}Eu{sub 2}O{sub 3} were used for the neutron diffraction work because of the enormous absorption cross section of the natural isotopic mixtures for thermal neutrons. The isotopic purity was determined by inductively coupled plasma - mass spectrometry to be 98.9% for {sup 154}Sm and 99.8% for {sup 153}Eu. Advanced analysis of the neutron diffraction data suggest that the bound coherent scattering lengths of {sup 154}Sm and {sup 153}Eu need to be revised. We tentatively propose b{sub c}({sup 154}Sm) = 8.97(6) fm and b{sub c}({sup 153}Eu) = 8.85(3) fm for a neutron wavelength of 186.6 pm to be better values for these isotopes, showing up to 8% deviation from accepted literature values. It is shown that inaccurate scattering lengths may result in severe problems in crystal structure refinements causing erroneous structural details such as occupation parameters, which might be critically linked to physical properties like superconductivity in multinary oxides.

  20. The Lateral Thigh Perforator Flap for Autologous Breast Reconstruction: A Prospective Analysis of 138 Flaps.

    Science.gov (United States)

    Tuinder, Stefania M H; Beugels, Jop; Lataster, Arno; de Haan, Michiel W; Piatkowski, Andrzej; Saint-Cyr, Michel; van der Hulst, René R W J; Allen, Robert J

    2018-02-01

    The septocutaneous tensor fasciae latae or lateral thigh perforator flap was previously introduced by the authors' group as an alternative flap for autologous breast reconstruction when the abdomen is not suitable as a donor site. The authors analyzed their experience with the lateral thigh perforator flap and present the surgical refinements that were introduced. A prospective study was conducted of all lateral thigh perforator flap breast reconstructions performed since September of 2012. Patient demographics, operative details, complications, and flap reexplorations were recorded. Preoperative imaging with magnetic resonance angiography was performed in all patients. Surgical refinements introduced during this study included limitation of the flap width and the use of quilting sutures at the donor site. A total of 138 lateral thigh perforator flap breast reconstructions were performed in 86 consecutive patients. Median operative times were 277 minutes (range, 196 to 561 minutes) for unilateral procedures and 451 minutes (range, 335 to 710 minutes) for bilateral. Median flap weight was 348 g (range, 175 to 814 g). Two total flap losses (1.4 percent) were recorded, and 11 flaps (8.0 percent) required reexploration, which resulted in viable flaps. The incidence of donor-site complications was reduced significantly after the surgical refinements were introduced. Wound problems decreased from 40.0 percent to 6.3 percent, seroma decreased from 25.0 percent to 9.5 percent, and infection decreased from 27.5 percent to 9.5 percent. The lateral thigh perforator flap is an excellent option for autologous breast reconstruction, with minimal recipient-site complications. The surgical refinements resulted in a significant reduction of donor-site complications. Therefore, the lateral thigh perforator flap is currently the authors' second choice after the deep inferior epigastric artery perforator flap. Therapeutic, IV.

  1. MicroRNA-138 enhances TRAIL-induced apoptosis through interferon-stimulated gene 15 downregulation in hepatocellular carcinoma cells.

    Science.gov (United States)

    Zuo, Chaohui; Sheng, Xinyi; Liu, Zhuo; Ma, Min; Xiong, Shuhan; Deng, Hongyu; Li, Sha; Yang, Darong; Wang, Xiaohong; Xiao, Hua; Quan, Hu; Xia, Man

    2017-06-01

    Hepatocellular carcinoma is a leading cause of cancer-related mortality worldwide. TRAIL (tumor necrosis factor-related apoptosis-inducing ligand) is a potential target for cancer therapy. However, many cancer cells are resistant to TRAIL-induced apoptosis and its mechanism is not well understood. In this study, to identify potential therapeutic targets for TRAIL-resistant cancer cells, we compared the expression levels of interferon-stimulated gene 15 in TRAIL-sensitive and TRAIL-resistant hepatocellular carcinoma cell lines. Western blot analysis showed that interferon-stimulated gene 15 expression levels were significantly higher in resistant HLCZ01and Huh7 cells than in sensitive LH86 and SMMC-7721 cells. Interferon-stimulated gene 15 knockdown in resistance cells led to TRAIL sensitivity. Conversely, interferon-stimulated gene 15 overexpression in sensitive cells resulted in TRAIL resistance. Our bioinformatics search detected a putative target sequence for microRNA miR-138 in the 3' untranslated region of the interferon-stimulated gene 15. Real-time quantitative polymerase chain reaction analysis demonstrated that miR-138 was significantly downregulated in TRAIL-resistant cells compared to TRAIL-sensitive cells. Forced expression of miR-138 in resistant cells decreased both messenger RNA and protein levels of interferon-stimulated gene 15, and when exposed to TRAIL, activated poly(adenosine diphosphate-ribose) polymerase, indicating sensitization to TRAIL. The results suggested that miR-138 regulates the interferon-stimulated gene 15 expression by directly targeting the 3' untranslated region of interferon-stimulated gene 15 and modulates the sensitivity to TRAIL-induced apoptosis. MiR-138 may be a target for therapeutic intervention in TRAIL-based drug treatments of resistant hepatocellular carcinoma or could be a biomarker to select patients who may benefit from the treatment.

  2. La prise en charge du pneumothorax spontané: à propos de 138 cas

    Science.gov (United States)

    Habibi, Bouchra; Achachi, Leila; Hayoun, Sohaib; Raoufi, Mohammed; Herrak, Laila; Ftouh, Mustapha El

    2017-01-01

    Le pneumothorax est définit par la présence d’air dans la cavité pleurale. L’objectif de notre étude rétrospective du pneumothorax spontanés au servie de pneumologie à l’hôpital Ibn Sina rabat (2009-2011) est de déterminer le profil épidémiologique, clinique, radiologique, thérapeutique et évolutif. Il s’agit de 138 patients: 128 hommes et 10 femmes (17 à 83 ans), un âge moyen de 44,5 +/- 17,4 ans; sexe ratio 12/8. Le tabagisme est noté chez 81,2%. La symptomatologie clinique est la douleur thoracique (92%), la dyspnée (60%). Et sur la radiographie thoracique: on trouve un PNO (pneumothorax) unilatéral total (110 cas); partiel (10 cas); localisé (6 cas); bilatéral (4 cas); à droite dans 51,4% et à gauche dans 45,7%. On a recensé 70% de pneumothorax spontanés primitifs et 30% de PNO secondaire à (BPCO 44%, et tuberculose pulmonaire 39%). La prise en charge initiale est l’hospitalisation de tous les patients : le drainage thoracique (95%), l’exsufflation à l’aiguille (1%). Le repos et l’O2 (4%). Le retour du poumon à la paroi a été obtenu avant 10 jours chez 63%. L’évolution est favorable chez 89%. Et les complications immédiates: l’emphysème sous cutané (5 cas); une infection (6 cas) et 3 décès (arrêt cardio-respiratoire); les complications à distance sont les récidives dans 11,6%; une 1ère récidive chez 13 cas (drainage thoracique chez 11 cas et oxygénothérapie chez 2 cas) et une 2ème récidive chez 3 cas (recours à la chirurgie). Ce travail montre l’intérêt du drainage thoracique et la surveillance dans la prise en charge du pneumothorax pour éviter les complications et surtout pour éviter les récidives avec un éventuel recours à la chirurgie. PMID:28533875

  3. Porta-enxertos para o cultivar Máximo IAC 138-22 de uvas de vinho em Monte Alegre do Sul, SP Rootstocks for wine grape cultivar IAC 138-22

    Directory of Open Access Journals (Sweden)

    Maurilo Monteiro Terra

    1990-01-01

    Full Text Available Em Monte Alegre do Sul, SP, efetuou-se um experimento de longa duração para observar o comportamento do cultivar IAC 138-22 (Máximo de uvas para vinho, sobre cinco porta-enxertos: RR 101-14, 'Golia', "Ripária do Traviú', IAC 572 e IAC 313. Em oito colheitas sucessivas anuais, de 1974 a 1981, analisaram-se as produções médias de uvas por planta. Os resultados indicaram que o IAC 572' foi o melhor porta-enxerto para o IAC 138-22 'Máximo'. O IAC 313 superou o IAC 572 em um dos anos estudados. Todos os outros porta-enxertos apresentaram desempenho inferior.A long term experiment was conducted at Monte Alegre do Sul, State of São Paulo, Brazil, to study the behaviour of wine grape cultivar IAC 138-22 Máximo on five rootstocks: RR 101 14, 'Golia', "Ripária do Traviú', IAC 313 and IAC 572 The yields of eight consecutive annual harvests (from 1974 to 1981 were analysed. The results indicated that IAC 572 was the best rootstock. IAC 313 can also be used but with fair results. "Ripária do Traviú', RR 101-14 and 'Golia' are not recommended as rootstocks for IAC 138-22. Considering the row spacing (2 x 1m which allows 5,000 plants/ha, the difference between average yields of the best and the worst rootstock was 8,475kg/ha of grapes, a considerable figure for the grape grower.

  4. A functional screen implicates microRNA-138-dependent regulation of the depalmitoylation enzyme APT1 in dendritic spine morphogenesis

    DEFF Research Database (Denmark)

    Siegel, Gabriele; Obernosterer, Gregor; Fiore, Roberto

    2009-01-01

    of acyl protein thioesterase 1 (APT1), an enzyme regulating the palmitoylation status of proteins that are known to function at the synapse, including the alpha(13) subunits of G proteins (Galpha(13)). RNA-interference-mediated knockdown of APT1 and the expression of membrane-localized Galpha(13) both......The microRNA pathway has been implicated in the regulation of synaptic protein synthesis and ultimately in dendritic spine morphogenesis, a phenomenon associated with long-lasting forms of memory. However, the particular microRNAs (miRNAs) involved are largely unknown. Here we identify specific miRNAs...... that function at synapses to control dendritic spine structure by performing a functional screen. One of the identified miRNAs, miR-138, is highly enriched in the brain, localized within dendrites and negatively regulates the size of dendritic spines in rat hippocampal neurons. miR-138 controls the expression...

  5. Genome sequence of the flexirubin-pigmented soil bacterium Niabella soli type strain (JS13-8(T)).

    Science.gov (United States)

    Anderson, Iain; Munk, Christine; Lapidus, Alla; Nolan, Matt; Lucas, Susan; Tice, Hope; Del Rio, Tijana Glavina; Cheng, Jan-Fang; Han, Cliff; Tapia, Roxanne; Goodwin, Lynne; Pitluck, Sam; Liolios, Konstantinos; Mavromatis, Konstantinos; Pagani, Ioanna; Mikhailova, Natalia; Pati, Amrita; Chen, Amy; Palaniappan, Krishna; Land, Miriam; Rohde, Manfred; Tindall, Brian J; Göker, Markus; Detter, John C; Woyke, Tanja; Bristow, James; Eisen, Jonathan A; Markowitz, Victor; Hugenholtz, Philip; Kyrpides, Nikos C; Klenk, Hans-Peter; Ivanova, Natalia

    2012-12-19

    Niabella soli Weon et al. 2008 is a member of the Chitinophagaceae, a family within the class Sphingobacteriia that is poorly characterized at the genome level, thus far. N. soli strain JS13-8(T) is of interest for its ability to produce a variety of glycosyl hydrolases. The genome of N. soli strain JS13-8(T) is only the second genome sequence of a type strain from the family Chitinophagaceae to be published, and the first one from the genus Niabella. Here we describe the features of this organism, together with the complete genome sequence and annotation. The 4,697,343 bp long chromosome with its 3,931 protein-coding and 49 RNA genes is a part of the Genomic Encyclopedia ofBacteria andArchaea project.

  6. Genome sequence of the flexirubin-pigmented soil bacterium Niabella soli type strain (JS13-8T)

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, Iain [U.S. Department of Energy, Joint Genome Institute; Munk, Christine [U.S. Department of Energy, Joint Genome Institute; Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Lucas, Susan [U.S. Department of Energy, Joint Genome Institute; Tice, Hope [U.S. Department of Energy, Joint Genome Institute; Glavina Del Rio, Tijana [U.S. Department of Energy, Joint Genome Institute; Cheng, Jan-Fang [U.S. Department of Energy, Joint Genome Institute; Han, Cliff [Los Alamos National Laboratory (LANL); Tapia, Roxanne [Los Alamos National Laboratory (LANL); Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Liolios, Konstantinos [U.S. Department of Energy, Joint Genome Institute; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Pagani, Ioanna [U.S. Department of Energy, Joint Genome Institute; Mikhailova, Natalia [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Chen, Amy [U.S. Department of Energy, Joint Genome Institute; Palaniappan, Krishna [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Rohde, Manfred [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Tindall, Brian [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Bristow, James [U.S. Department of Energy, Joint Genome Institute; Eisen, Jonathan [U.S. Department of Energy, Joint Genome Institute; Markowitz, Victor [U.S. Department of Energy, Joint Genome Institute; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Ivanova, N [U.S. Department of Energy, Joint Genome Institute

    2012-01-01

    Niabella soli Weon et al. 2008 is a member of the Chitinophagaceae, a family within the class Sphingobacteriia that is poorly characterized at the genome level, thus far. N. soli strain JS13-8T is of interest for its ability to produce a variety of glycosyl hydrolases. The ge- nome of N. soli strain JS13-8T is only the second genome sequence of a type strain from the family Chitinophagaceae to be published, and the first one from the genus Niabella. Here we describe the features of this organism, together with the complete genome sequence and annotation. The 4,697,343 bp long chromosome with its 3,931 protein-coding and 49 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

  7. Highly CO2-Tolerant Cathode for Intermediate-Temperature Solid Oxide Fuel Cells: Samarium-Doped Ceria-Protected SrCo0.85Ta0.15O3-δ Hybrid.

    Science.gov (United States)

    Li, Mengran; Zhou, Wei; Zhu, Zhonghua

    2017-01-25

    Susceptibility to CO2 is one of the major challenges for the long-term stability of the alkaline-earth-containing cathodes for intermediate-temperature solid oxide fuel cells. To alleviate the adverse effects from CO2, we incorporated samarium-stabilized ceria (SDC) into a SrCo0.85Ta0.15O3-δ (SCT15) cathode by either mechanical mixing or a wet impregnation method and evaluated their cathode performance stability in the presence of a gas mixture of 10% CO2, 21% O2, and 69% N2. We observed that the CO2 tolerance of the hybrid cathode outperforms the pure SCT15 cathode by over 5 times at 550 °C. This significant enhancement is likely attributable to the low CO2 adsorption and reactivity of the SDC protective layer, which are demonstrated through thermogravimetric analysis, energy-dispersive spectroscopy, and electrical conductivity study.

  8. α-Solanine Modulates the Radiosensitivity of Esophageal Cancer Cells by Inducing MicroRNA 138 Expression

    Directory of Open Access Journals (Sweden)

    Yuanyuan Wang

    2016-08-01

    Full Text Available Background: Esophageal cancer (EC is one of the most common malignant tumors in the world. Due to difficulties with performing the operation, most patients choose to have palliative treatment instead. Radiotherapy is one of the main palliative treatments of EC. However, the clinical efficacy of radiotherapy is not satisfactory α-Solanine is a bioactive component of steroidal glycoalkaloids which has been demonstrated to exhibit anti-metastasis activity in different cancers. In the present study, we determined the effect of α-solanine on the radiosensitivity of EC cells and priliminarily explored the underlying molecular mechanisms. Methods: Cell Counting Kit-8 (CCK-8 assay was conducted to found the cytotoxic effect of α-solanine on EC cells. CCK-8 assay and colony-forming survival assays were performed to explore the effect of α-solanine on cell viability and proliferation of EC cells after irradiation. Immunofluorescence and comet assays were used to detect the effect of α-solanine on DNA repair capacity of EC cells after irradiation. The flow cytometry (FCM and Hoechst/PI staining were conductd to study the effect of α-solanine on apoptosis of EC cells after irradiation. Results: The cytotoxic effect of α-solanine to EC cells was dose-dependent. The results of CCK-8, colony-forming survival assay, immunofluorescence, comet assay, FCM and Hoechst/PI staining showed that α-solanine could enhance the radiosensitivity of EC cells. α-Solanine could downregulate Survivin expression level by upregulating miR-138 expression in EC cells. Upregulation of miR-138 and knock down Survivin both enhanced the radiosensitivity of EC cells. Moreover, Survivin could restore the effect of α-solanine and miR-138 on radiosensitivity of EC cells. Conclusions: α-solanine could enhance the radiosensitivity of esophageal cancer cells by inducing microRNA-138 expression, and probably be an effective radiosensitizer in treating EC.

  9. α-Solanine Modulates the Radiosensitivity of Esophageal Cancer Cells by Inducing MicroRNA 138 Expression.

    Science.gov (United States)

    Wang, Yuanyuan; Wu, Jianbo; Guo, Wei; Sun, Qianqian; Chen, Xiaonan; Zang, Wenqiao; Dong, Ziming; Zhao, Guoqiang

    2016-01-01

    Esophageal cancer (EC) is one of the most common malignant tumors in the world. Due to difficulties with performing the operation, most patients choose to have palliative treatment instead. Radiotherapy is one of the main palliative treatments of EC. However, the clinical efficacy of radiotherapy is not satisfactory α-Solanine is a bioactive component of steroidal glycoalkaloids which has been demonstrated to exhibit anti-metastasis activity in different cancers. In the present study, we determined the effect of α-solanine on the radiosensitivity of EC cells and priliminarily explored the underlying molecular mechanisms. Cell Counting Kit-8 (CCK-8) assay was conducted to found the cytotoxic effect of α-solanine on EC cells. CCK-8 assay and colony-forming survival assays were performed to explore the effect of α-solanine on cell viability and proliferation of EC cells after irradiation. Immunofluorescence and comet assays were used to detect the effect of α-solanine on DNA repair capacity of EC cells after irradiation. The flow cytometry (FCM) and Hoechst/PI staining were conductd to study the effect of α-solanine on apoptosis of EC cells after irradiation. The cytotoxic effect of α-solanine to EC cells was dose-dependent. The results of CCK-8, colony-forming survival assay, immunofluorescence, comet assay, FCM and Hoechst/PI staining showed that α-solanine could enhance the radiosensitivity of EC cells. α-Solanine could downregulate Survivin expression level by upregulating miR-138 expression in EC cells. Upregulation of miR-138 and knock down Survivin both enhanced the radiosensitivity of EC cells. Moreover, Survivin could restore the effect of α-solanine and miR-138 on radiosensitivity of EC cells. α-solanine could enhance the radiosensitivity of esophageal cancer cells by inducing microRNA-138 expression, and probably be an effective radiosensitizer in treating EC. © 2016 The Author(s) Published by S. Karger AG, Basel.

  10. 42 CFR 435.138 - Disabled widows and widowers aged 60 through 64 who would be eligible for SSI except for early...

    Science.gov (United States)

    2010-10-01

    ... would be eligible for SSI except for early receipt of social security benefits. 435.138 Section 435.138... SSI except for early receipt of social security benefits. (a) If the agency provides Medicaid to aged... disabled widows and widowers who— (1) Are at least age 60; (2) Are not entitled to hospital insurance...

  11. Influence of a low calcium and phosphorus diet on the anabolic effect of human parathyroid hormone (1-38) in female rats

    DEFF Research Database (Denmark)

    Steiner, P.D.; Forrer, R.; Kneissel, Michaela

    2001-01-01

    Parathyroid hormone (PTH) or synthetic N-terminal PTH fragments administered intermittently have been established as anabolic agents in animal and human bones. In the present study, the influence of a low calcium diet on the anabolic effect of human PTH(1-38) [hPTH(1-38)] was investigated. Forty...

  12. 40 CFR 125.138 - As an owner or operator of a new offshore oil and gas extraction facility, must I keep records...

    Science.gov (United States)

    2010-07-01

    ... offshore oil and gas extraction facility, must I keep records and report? 125.138 Section 125.138... and report? As an owner or operator of a new offshore oil and gas extraction facility you are required... Intake Structures for New Offshore Oil and Gas Extraction Facilities Under Section 316(b) of the Act...

  13. Stress corrosion study of PH13-8Mo stainless steel using the Slow Strain Rate Technique

    Science.gov (United States)

    Torres, Pablo D.

    1989-01-01

    The need for a fast and reliable method to study stress corrosion in metals has caused increased interest in the Slow Strain Rate Technique (SSRT) during the last few decades. PH13-8MoH950 and H1000 round tensile specimens were studied by this method. Percent reduction-in-area, time-to-failure, elongation at fracture, and fracture energy were used to express the loss in ductility, which has been used to indicate susceptibility to stress corrosion cracking (SCC). Results from a 3.5 percent salt solution (corrosive medium) were compared to those in air (inert medium). A tendency to early failure was found when testing in the vicinity of 1.0 x 10(-6) mm/mm/sec in the 3.5 percent salt solution. PH13-8Mo H1000 was found to be less likely to suffer SCC than PH13-8Mo H950. This program showed that the SSRT is promising for the SCC characterization of metals and results can be obtained in much shorter times (18 hr for PH steels) than those required using conventional techniques.

  14. Anticancer function of α-solanine in lung adenocarcinoma cells by inducing microRNA-138 expression.

    Science.gov (United States)

    Zhang, Furui; Yang, Rui; Zhang, Guojun; Cheng, Ruirui; Bai, Yong; Zhao, Huasi; Lu, Xinhua; Li, Hui; Chen, Shanshan; Li, Juan; Wu, Shujun; Li, Ping; Chen, Xiaonan; Sun, Qianqian; Zhao, Guoqiang

    2016-05-01

    Currently, lung cancer is still a main cause of malignancy-associated death worldwide. Even though various methods for prevention and treatment of lung cancer have been improved in recent decades, the 5-year survival rate has remained very low. Insights into the anticancer function of small-molecule anticancer compounds have opened our visual field about cancer therapy. α-Solanine has been well studied for its antitumor properties, but its effect in lung cancer and associated molecular mechanisms have not yet been evaluated. To explore the anticancer function of α-solanine, we performed an MTT assay, Transwell arrays, colony-forming survival assay, quantitative reverse transcription PCR (qRT-PCR), Western blotting, and dual luciferase reporter assays in A549 and H1299 cells. We found that α-solanine not only inhibited cell migration and invasion ability but also enhanced the chemosensitivity and radiosensitivity of A549 and H1299 cells. Moreover, we discovered that α-solanine could affect the expression of miR-138 and focal adhesion kinase (FAK), both of which were also found to affect the chemosensitivity and radiosensitivity of A549 and H1299 cells. In conclusion, α-solanine could affect miR-138 and FAK expression to restrict cell migration and invasion and enhance the chemosensitivity and radiosensitivity of A549 and H1299 cells. The α-solanine/miR-138/FAK cascade can probably be a potential therapy target against lung adenocarcinoma.

  15. Ferrites Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} doped with samarium: structural analysis, morphological and electromagnetic; Ferritas Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} dopada com samario: analise estrutural, morfologica e eletromagnetica

    Energy Technology Data Exchange (ETDEWEB)

    Costa, A.C.F.M.; Diniz, A.P., E-mail: anacristina@dema.ufcg.edu.br [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Unidade Academinca de Engenharia de Materiais; Viana, K.M.S. [Universidade Federal do Rio Grande do Norte (UFRN), Natal, PE (Brazil). Escola de Ciencias e Tecnologia; Cornejo, D.R. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Fisica; Kiminami, R.H.G.A. [Universidade Federal de Sao Carlos (UFSCar), SP (Brazil). Departamento de Engenharia de Materiais

    2010-07-01

    This paper proposes to investigate the sintering at 1200 deg C/2h of Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2-x}Sm{sub x}O{sub 4} ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

  16. Circulating sCD138 and Some Angiogenesis-Involved Cytokines Help to Anticipate the Disease Progression of Early-Stage B-Cell Chronic Lymphocytic Leukemia

    Directory of Open Access Journals (Sweden)

    2006-01-01

    Full Text Available Syndecan-1 (CD138 is a transmembrane heparin sulfate proteoglycan expressed on distinct stages of differentiation of B-lymphoid cells. Its prognostic value in B-cell chronic lymphocytic leukemia (B-CLL has not been evaluated so far. The serum concentration of sCD138 and some angiogenesis-involved cytokines: vascular endothelial growth factor (VEGF, basis fibroblast growth factor (bFGF, and endostatin were studied in 52 previously untreated patients with B-CLL. We found that bFGF and sCD138 levels were significantly higher in B-CLL patients than in controls. In patients with sCD138 level or endostatin level below the median value the lymphocyte count was higher than in patients with serum level of those cytokines above the median value. In patients with progressive disease bFGF level was significantly higher and sCD138 level significantly lower than in patients with stable one. Moreover, high sCD138 level was associated with longer lymphocyte doubling-free survival, and, on the limit of statistical significance, a high endostatin level was associated with shorter progression-free survival. We conclude that serum sCD138 level is increased in early stage B-CLL patients and may have a positive prognostic value as to the dynamics of the disease.

  17. ROOTSTOCKS EFFECTS ON THE PHYSICOCHEMICAL CHARACTERISTICS OF BORDÔ, ISABEL AND IAC 138-22 MÁXIMO MUST AND WINE

    Directory of Open Access Journals (Sweden)

    MARLON JOCIMAR RODRIGUES DA SILVA

    2017-09-01

    Full Text Available ABSTRACT It has been demonstrated that rootstocks can influence grape characteristics, but there are few data in literature about the rootstocks influence in the wine characteristics, especially in wines elaborated with Vitis labrusca or hybrid grapes. This study evaluated the influence of ‘IAC 766’ and ‘106-8 Mgt’ rootstocks on the physicochemical characteristics of ‘Bordô’, ‘Isabel’ and ‘IAC 138-22 ‘Máximo’ musts and wines. The musts were evaluated for pH, soluble solids, total acidity and soluble solids/acidity ratio. The wines were evaluated for density, alcohol content; total, volatile and fixed acidity; pH, dry extract, reducing sugars, reduced dry extract, alcohol in weight/reduced dry extract; free and total sulfur dioxide; anthocyanins, polyphenols index (I 280; polyphenols and total flavonoids and antioxidant activity. The ‘Bordô’, ‘Isabel’ and IAC 138-22 ‘Máximo’ musts had low soluble solids for winemaking. The ‘106-8 Mgt’ rootstock promoted higher dry extract content and reduced dry extract in Bordô wine, and lower total and fixed acidity in IAC 138-22 Máximo wine. In Isabel wine, higher pH was promoted by the ‘IAC 766’ rootstock. Aside from low total acidity of the Bordô wine, all the physicochemical characteristics of the wines studied are in accordance with Brazilian law. There was no effect of rootstocks in the phenolics content and antioxidant activity of wines.

  18. miR-138 suppresses the proliferation, metastasis and autophagy of non-small cell lung cancer by targeting Sirt1.

    Science.gov (United States)

    Ye, Zaiting; Fang, Bingmu; Pan, Jiongwei; Zhang, Ning; Huang, Jinwei; Xie, Congying; Lou, Tianzheng; Cao, Zhuo

    2017-06-01

    The present study determined the role and mechanism of miR-138 in non-small cell lung cancer (NSCLC). In total, 45 freshly resected clinical NSCLC tissues were collected. The expression of miR-138 in tissues and cell lines were determined by real-time quantitative PCR. miR-138 mimics were transfected into A549 and Calu-3 cells in vitro, and then the effects of miR-138 on lung cancer cell proliferation, cell cycle, invasion and metastasis were investigated by CCK-8 assay, Transwell and flow cytometry, respectively. The protein expression of the potential target gene Sirt1 in lung cancer cells were determined by western blot analysis. Dual-luciferase reporter assay was performed to further confirm whether Sirt1 was the target gene of miR-138. The expression of miR-138 was significantly lower in lung cancer tissues and was negatively correlated to the differentiation degree and lymph node metastasis of lung cancer. In vitro experiment results showed that miR-138 inhibited lung cancer cell proliferation, invasion and migration. It was verified that miR-138 could downregulate Sirt1 protein expression, inhibit epithelial-mesenchymal transition (EMT), decrease the activity of AMPK signaling pathway and elevate mTOR phosphorylation level. Dual-luciferase reporter assay demonstrated that miR-138 could directly regulate Sirt1. Downregulation of Sirt1 alone can also cause the same molecular and biological function changes. Western blot analysis and confocal microscopy results indicated that overexpression of miR-138 or interference of Sirt1 expression could inhibit lung cancer cell autophagy activity possibly through AMPK-mTOR signaling pathway. miR-138 plays a tumor suppressor function in lung cancer. It may inhibit the proliferation, invasion and migration of lung cancer through downregulation of Sirt1 expression and activation of cell autophagy. The downregulation of miR-138 is closely related to the development of lung cancer.

  19. MiR-138 promotes smooth muscle cells proliferation and migration in db/db mice through down-regulation of SIRT1

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Juan [Department of Gynecology, Changzhou Maternity and Children Health Hospital, Changzhou, Jiangsu 213003 (China); Li, Li; Yun, Hui-fang [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China); Han, Ye-shan, E-mail: yeshanhan123@163.com [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China)

    2015-08-07

    Background: Diabetic vascular smooth muscle cells (VSMCs) exhibit significantly increased rates of proliferation and migration, which was the most common pathological change in atherosclerosis. In addition, the study about the role for miRNAs in the regulation of VSMC proliferation is just beginning to emerge and additional miRNAs involved in VSMC proliferation modulation should be identified. Methods: The expression of miR-138 and SIRT1 were examined in SMCs separated from db/db mice and in SMC lines C-12511 exposed to high glucose with qRT-PCR and western blot. The regulation of miR-138 on the expression of SMCs was detected with luciferase report assay. VSMCs proliferation and migration assays were performed to examine the effect of miR-138 inhibitor on VSMCs proliferation and migration. Results: We discovered that higher mRNA level of miR-138 and reduced expression of SIRT1 were observed in SMCs separated from db/db mice and in SMC lines C-12511. Moreover, luciferase report assay showed that the activity of SIRT1 3′-UTR was highly increased by miR-138 inhibitor and reduced by miR-138 mimic. In addition, we examined that the up-regulation of NF-κB induced by high glucose in SMCs was reversed by resveratrol and miR-138 inhibitor. MTT and migration assays showed that miR-138 inhibitor attenuated the proliferation and migration of smooth muscle cells. Conclusion: In this study, we revealed that miR-138 might promote proliferation and migration of SMC in db/db mice through suppressing the expression of SIRT1. - Highlights: • Higher mRNA level of miR-138 was observed in SMCs from db/db mice. • The mRNA and protein level of SIRT1 in SMCs from db/db mice were greatly reduced. • miR-138 could regulate the expression of SIRT1 in SMCs. • SIRT1 overexpression reversed the up-regulation of acetylized p65 and NF-κB induced by high glucose. • MiR-138 inhibitor reversed VSMCs proliferation and migration induced by high glucose.

  20. Study of 138 Neisseria meningitidis strains isolated from blood or cerebrospinal fluid in Lombardy between 2007 and 2010

    Directory of Open Access Journals (Sweden)

    Laura Daprai

    2012-06-01

    Full Text Available Neisseria meningitidis, Streptococcus pneumoniae, and Haemophilus influenzae type b cause the majority of cases of bacterial septicaemia in children and young adults. Disease epidemiology is evolving rapidly due to the introduction of vaccines and changing in bacterial antibiotic-resistance patterns. (Asymptomatic nasopharyngeal colonization with Neisseria meningitides occurs in 5-10% of adult. The aim of this study was to calculate the frequency of each serogroup of this pathogens involved in invasive infection and to study susceptibility to antibiotics of these strains. Between March 2007 and June 2010 we received, from 43 hospitals of Lombardy, 138 strains of Neisseria meningitidis, from 138 patients aged (2-80yrs. The most frequent serogroup was B (58%, followed by serogroup C (34%, serogroup G (4% and W 135 (2%. Serogroup A end X accounted for 1% of invasive infection, each. We observed a decrease in susceptibility towards penicillin in 38% of strains. In addition we studied, by REP- PCR, genotype of 9 strains selected on the basis of epidemiological data.Among these strains, 3 different clusters according to the 3 small epidemic outbreaks occurred between June and September 2009, were recognised. Seven of these strains, although belonged to the same serogroup, brought about two different clusters. The present findings demonstrated that phenotypic data are not sufficient to define epidemic clusters, therefore molecular genotyping is required.

  1. 47 CFR 25.138 - Blanket Licensing provisions of GSO FSS Earth Stations in the 18.3-18.8 GHz (space-to-Earth), 19...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Blanket Licensing provisions of GSO FSS Earth Stations in the 18.3-18.8 GHz (space-to-Earth), 19.7-20.2 GHz (space-to-Earth), 28.35-28.6 GHz (Earth-to-space), and 29.25-30.0 GHz (Earth-to-space) bands. 25.138 Section 25.138 Telecommunication FEDERAL...

  2. COMPETITION BEETWEN DYNAMIC RECUPERATION AND RECRYSTALLIZATION OF ASTM F 138 AUSTENITIC STAINLESS STEEL UTILIZED IN MEDICAL DEVICES

    Directory of Open Access Journals (Sweden)

    Fabio Henrique Casarini Geronimo

    2013-06-01

    Full Text Available ASTM F 138 austenitic stainless steel has being used in the manufacture of orthopedical devices by hot forging. In this work, the flow stress curves are determined by hot torsion tests in a wide range of temperatures and strain rates. With the observed microestrutural evolution by optical microscopy in different hot forming conditions in addiction with EBSD (Electron Backscatter Diffraction techniques it is possible to obtained the recrystallized volume fraction and the misorientation angles of the samples. Due to the intermediate level of stacking fault energy of this material, during the dynamic softening occurs a competition between recrystallization and recovery. The aim of this work is to identify the softening mechanisms in this stainless steel, as well as in which hot work conditions they become more active.

  3. InP nanowire array solar cells achieving 13.8% efficiency by exceeding the ray optics limit.

    Science.gov (United States)

    Wallentin, Jesper; Anttu, Nicklas; Asoli, Damir; Huffman, Maria; Aberg, Ingvar; Magnusson, Martin H; Siefer, Gerald; Fuss-Kailuweit, Peter; Dimroth, Frank; Witzigmann, Bernd; Xu, H Q; Samuelson, Lars; Deppert, Knut; Borgström, Magnus T

    2013-03-01

    Photovoltaics based on nanowire arrays could reduce cost and materials consumption compared with planar devices but have exhibited low efficiency of light absorption and carrier collection. We fabricated a variety of millimeter-sized arrays of p-type/intrinsic/n-type (p-i-n) doped InP nanowires and found that the nanowire diameter and the length of the top n-segment were critical for cell performance. Efficiencies up to 13.8% (comparable to the record planar InP cell) were achieved by using resonant light trapping in 180-nanometer-diameter nanowires that only covered 12% of the surface. The share of sunlight converted into photocurrent (71%) was six times the limit in a simple ray optics description. Furthermore, the highest open-circuit voltage of 0.906 volt exceeds that of its planar counterpart, despite about 30 times higher surface-to-volume ratio of the nanowire cell.

  4. Validation of interphase fluorescence in situ hybridization (iFISH for multiple myeloma using CD138 positive cells

    Directory of Open Access Journals (Sweden)

    Renata Kiyomi Kishimoto

    2016-06-01

    Full Text Available ABSTRACT BACKGROUND: Multiple myeloma is a plasma cell neoplasm with acquired genetic abnormalities of clinical and prognostic importance. Multiple myeloma differs from other hematologic malignancies due to a high fraction of low proliferating malignant plasma cells and the paucity of plasma cells in bone marrow aspiration samples, making cytogenetic analysis a challenge. An abnormal karyotype is found in only one-third of patients with multiple myeloma and interphase fluorescence in situ hybridization is the most useful test for studying the chromosomal abnormalities present in almost 90% of cases. However, it is necessary to study the genetic abnormalities in plasma cells after their identification or selection by morphology, immunophenotyping or sorting. Other challenges are the selection of the most informative FISH panel and determining cut-off levels for FISH probes. This study reports the validation of interphase fluorescence in situ hybridization using CD138 positive cells, according to proposed guidelines published by the European Myeloma Network (EMN in 2012. METHOD: Bone marrow samples from patients with multiple myeloma were used to standardize a panel of five probes [1q amplification, 13q14 deletion, 17p deletion, t(4;14, and t(14;16] in CD138+ cells purified by magnetic cell sorting. RESULTS: This test was validated with a low turnaround time and good reproducibility. Five of six samples showed genetic abnormalities. Monosomy/deletion 13 plus t(4;14 were found in two cases. CONCLUSION: This technique together with magnetic cell sorting is effective and can be used in the routine laboratory practice. In addition, magnetic cell sorting provides a pure plasma cell population that allows other molecular and genomic studies.

  5. Retrospective evaluation of bone pain palliation after samarium-153-EDTMP therapy Avaliação retrospectiva do tratamento da dor óssea metastática com Samário-153-EDTMP

    Directory of Open Access Journals (Sweden)

    Marcelo Tatit Sapienza

    2004-01-01

    Full Text Available PURPOSE: The aim of this study was to evaluate the degree of metastatic bone pain palliation and medullar toxicity associated with samarium-153-EDTMP treatment. METHODS: Seventy-three patients with metastatic bone pain having previously undergone therapy with samarium-153-EDTMP (1 mCi/kg were retrospectively evaluated. Routine follow-up included pain evaluation and blood counts for 2 months after treatment. Pain was evaluated using a subjective scale (from 0 to 10 before and for 8 weeks after the treatment. Blood counts were obtained before treatment and once a week for 2 months during follow-up. Dosimetry, based upon the urinary excretion of the isotope, was estimated in 41 individuals, and the resulting radiation absorbed doses were correlated with hematological data. RESULTS: Reduction in pain scores of 75% to 100% was obtained in 36 patients (49%, with a decrease of 50% to 75%, 25% to 50%, and 0% to 25% in, respectively, 20 (27%, 10 (14%, and 7 (10% patients. There was no significant relationship between the pain response and location of the primary tumor (breast or prostate cancer. Mild to moderate myelosuppression was noted in 75.3% of patients, usually with hematological recovery at 8 weeks. The mean bone marrow dose was 347 ± 65 cGy, and only a weak correlation was found between absorbed dose and myelosuppression (Pearson coefficient = .4. CONCLUSIONS: Samarium-153-EDTMP is a valuable method for metastatic bone pain palliation. A mild to moderate and transitory myelosuppression is the main toxicity observed after samarium therapy, showing a weak correlation with dosimetric measures.OBJETIVO: O presente trabalho teve por objetivo avaliar o efeito paliativo da dor e a toxicidade medular associados ao tratamento com Samário-153-EDTMP em pacientes com metástases ósseas. MÉTODOS: O estudo foi realizado de forma retrospectiva, a partir do levantamento de prontuário de 178 pacientes submetidos a tratamento com 1mCi/kg de 153Sm

  6. The dynamics of the laser-induced metal-semiconductor phase transition of samarium sulfide (SmS); Die Dynamik des laserinduzierten Metall-Halbleiter-Phasenuebergangs von Samariumsulfid (SmS)

    Energy Technology Data Exchange (ETDEWEB)

    Kaempfer, Tino

    2009-12-15

    The present thesis is dedicated to the experimental study of the metal-semiconductor phase transition of samarium sulfide (SmS): Temperature- and time-resolved experiments on the characterization of the phase transition of mixed-valence SmS samples (M-SmS) are presented. The measurement of the dynamics of the laser-induced phase transition pursues via time-resolved ultrashort-time microscopy and by X-ray diffraction with sub-picosecond time resolution. The electronic and structural processes, which follow an excitation of M-SmS with infrared femtosecond laser pulses, are physically interpreted on the base of the results obtained in this thesis and model imaginations. [German] Die vorliegende Arbeit ist der experimentellen Untersuchung des Metall-Halbleiter-Phasenuebergangs von Samariumsulfid (SmS) gewidmet. Es werden temperatur- und zeitaufgeloeste Experimente zur Charakterisierung des Phasenuebergangs gemischt-valenter SmS Proben (M-SmS) vorgestellt. Die Messung der Dynamik des laserinduzierten Phasenuebergangs erfolgt ueber zeitaufgeloeste Ultrakurzzeit-Mikroskopie und durch Roentgenbeugung mit subpikosekunden Zeitaufloesung. Die elektronischen und strukturellen Prozesse, welche einer Anregung von M-SmS mit infraroten Femtosekunden-Laserpulsen folgen, werden auf der Basis der in dieser Arbeit gewonnenen Ergebnisse und Modellvorstellungen physikalisch interpretiert. (orig.)

  7. Anticonvulsant efficacy of the low-affinity partial benzodiazepine receptor agonist ELB 138 in a dog seizure model and in epileptic dogs with spontaneously recurrent seizures.

    Science.gov (United States)

    Löscher, Wolfgang; Potschka, Heidrun; Rieck, Susanne; Tipold, Andrea; Rundfeldt, Chris

    2004-10-01

    Ataxia, sedation, amnesia, ethanol and barbiturate potentiation, loss of efficacy (tolerance), development of dependence, and the potential for drug abuse limit the clinical use of benzodiazepines (BZDs) for long-term treatment of epilepsy or anxiety. BZD ligands that are in current use act as full allosteric modulators of gamma-aminobutyric acid (GABA)-gated chloride channels and, on long-term administration, trigger a functional uncoupling between the GABAA and BZD recognition sites. Partial allosteric modulators, which have a low intrinsic activity at the BZD recognition site of the GABAA receptor, might eventually overcome the limitations of full agonists such as diazepam (DZP). In the present study, the new low-affinity partial BZD-receptor agonist ELB 138 [former name AWD 131-138; 1-(4-chlorophenyl)-4-morpholino-imidazolin-2-one] was evaluated in a dog seizure model and in epileptic dogs with spontaneously recurrent seizures. ELB 138 was shown to increase potently the pentylenetetrazole (PTZ) seizure threshold in dogs. Prolonged oral administration with twice-daily dosing of ELB 138 with either 5 or 40 mg/kg over a 5-week period was not associated with loss of anticonvulsant efficacy in the PTZ dog model. To study whether physical dependence developed during long-term treatment, the BZD antagonist flumazenil was injected after 5 weeks of treatment with ELB 138. Compared with prolonged treatment with DZP, only relatively mild abstinence symptoms were precipitated in dogs treated with ELB 138, particularly at the lower dosage (5 mg/kg, b.i.d.). In a prospective trial in dogs with newly diagnosed epilepsy, ELB 138 markedly reduced seizure frequency and severity without significant difference to standard treatments (phenobarbital or primidone) but was much better tolerated than the standard drugs. In dogs with chronic epilepsy, most dogs exhibited a reduction in seizure frequency and severity during add-on treatment with ELB 138. The data demonstrate that the

  8. Human CD38hiCD138+ Plasma Cells Can Be Generated In Vitro from CD40-Activated Switched-Memory B Lymphocytes

    Directory of Open Access Journals (Sweden)

    Rayelle Itoua Maïga

    2014-01-01

    Full Text Available B lymphocyte differentiation into long-lived plasma cells is the keystone event for the production of long-term protective antibodies. CD40-CD154 and CD27-CD70 interactions are involved in human B lymphocyte differentiation into CD38hiCD138+ cells in vivo as well as in vitro. In this study, we have compared these interactions in their capacity to drive switched-memory B lymphocytes differentiation into CD38hiCD138+ plasma cells. The targeted B lymphocytes were isolated from human peripheral blood, expanded for 19 days, and then submitted to CD70 or CD154 interactions for 14 days. The expanded B lymphocytes were constitutively expressing CD39, whereas CD31’s expression was noticed only following the in vitro differentiation step (day 5 and was exclusively present on the CD38hi cell population. Furthermore, the generated CD38hiCD138+ cells showed a higher proportion of CD31+ cells than the CD38hiCD138- cells. Besides, analyses done with human blood and bone marrow plasma cells showed that in vivo and de novo generated CD38hiCD138+ cells have a similar CD31 expression profile but are distinct according to their reduced CD39 expression level. Overall, we have evidences that in vitro generated plasma cells are heterogeneous and appear as CD39+ precursors to the ones present in bone marrow niches.

  9. errata 137..138

    Indian Academy of Sciences (India)

    uz: 2. On page 454, a typographical error has been found out in eq. (48). The expression for. ∆0 should read as: ∆0 ¼ b. 02. 2 $2$1$2$0. 3рq2 А q1Ю А f 0. 3р f 0. 1$2q2 А f 0. 2$1q1Ю: All the analytical expressions and numerical results do not change due to these errors. Proc. Indian Acad. Sci. (Math. Sci.), Vol. 111, No.

  10. Carrageenan-based semi-IPN nanocomposite hydrogels: Swelling kinetic and slow release of sequestrene Fe 138 fertilizer

    Directory of Open Access Journals (Sweden)

    Mohammad Kazem Bahrami

    2016-09-01

    Full Text Available Nanocomposite hydrogels based on kappa-carrageenan were synthesized by incorporating natural sodium montmorillonite (Cloisite nanoclay. Acrylamide (AAm and methylenebisacrylamide (MBA were used as a monomer and a crosslinker, respectively. Effects of reaction variables on the swelling kinetics were studied. The results revealed that the rate of swelling for nanocomposites with high content of MBA was higher than those of nanocomposites consisting of low content of MBA. Similar to the effect of MBA, the rate of swelling enhanced as the carrageenan content was decreased. The influence of clay content on swelling rate was not remarkable. The experimental swelling data were evaluated by pseudo-first-order and pseudo-second-order kinetic models. The swelling data described well by pseudo-second-order kinetic model. Sequestrene Fe 138 (Sq as an agrochemical was loaded into nanocomposites and releasing of this active agent from nanocomposites was studied. The clay-free hydrogel released the whole loaded Sq; whereas the presence of clay restricted the release of Sq.

  11. Gross karyotypic and phenotypic alterations among different progenies of the Candida glabrata CBS138/ATCC2001 reference strain.

    Directory of Open Access Journals (Sweden)

    Oliver Bader

    Full Text Available Genomic plasticity is a mechanism for adaptation to environmental cues such as host responses and antifungal drug pressure in many fungi including the human pathogenic yeast Candida glabrata. In this study we evaluated the phenotypic and genotypic stability of the world-wide used C. glabrata reference strain CBS138/ATCC2001 under laboratory conditions. A set of ten lineages of this wild type strain and genetically modified progenies were obtained from different scientific laboratories, and analyzed for genotypic and phenotypic alterations. Even though the derivates were indistinguishable by multi locus sequence typing, different phenotypic groups that correlated with specific karyotypic changes were observed. In addition, modifications in the adherence capacity to plastic surface emerged that were shown to correlate with quantitative changes in adhesin gene expression rather than subtelomeric gene loss or differences in the number of macrosatellite repeats within adhesin genes. These results confirm the genomic plasticity of C. glabrata and show that chromosomal aberrations and functional adaptations may occur not only during infection and under antimicrobial therapy, but also under laboratory conditions without extreme selective pressures. These alterations can significantly affect phenotypic properties such as cell surface attributes including adhesion and the cell wall carbohydrate composition and therefore, if unnoticed, may adulterate the outcome of genetic studies.

  12. Advances in the molecular functions of syndecan-1 (SDC1/CD138) in the pathogenesis of malignancies.

    Science.gov (United States)

    Gharbaran, Rajendra

    2015-04-01

    Syndecan-1 (SDC1, synd, CD138) is the most widely studied member of four structurally related cell surface heparan sulfate proteoglycans (HSPG). Although SDC1 has been implicated in a wide range of biological functions, its altered expression often produces malignant phenotypes, which arise from increased cell proliferation and cell growth, cell survival, cell invasion and metastasis, and angiogenesis. Recent studies revealed much about the underlying molecular roles of SDC1 in these processes. The changes in SDC1 expression also have a direct impact on the clinical course of cancers, as evident by its prognostic significance. Accumulating evidence suggest that SDC1 is involved in stimulation of cancer stem cells (CSC) or tumor initiating cells (TIC) and this may affect disease relapse, and resistance to therapy. This review discusses the progress on the pro-tumorigenic role(s) of SDC1 and how these roles may impact the clinical aspect of the disease. Also discussed, are the current strategies for targeting SDC1 or its related signaling. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  13. Enzymatic properties and sensitivity to inhibitors of human immunodeficiency virus type 1 (HIV-1) reverse transcriptase with Glu-138-->Arg and Tyr-188-->His mutations.

    Science.gov (United States)

    Zhang, H; Vrang, L; Bäckbro, K; Unge, T; Noréen, R; Oberg, B

    1994-05-01

    Two mutants of HIV-1 reverse transcriptase (RT), Tyr-188-->His and Glu-138-->Arg have been prepared and their catalytic properties and sensitivities to inhibitors studied. As compared to wild type RT, a reduction in catalytic efficiency and turn over number was observed, especially for the Tyr-188-->His mutant. The non-nucleoside inhibitors nevirapine, L-697,661 and 9-Cl-TIBO caused a mixed type of inhibition of RT (Arg-138) with respect to substrate, and with the exception of a non-competitive inhibition by nevirapine, also a mixed type of inhibition of RT (His-188). Foscarnet (PFA) caused a non-competitive type of inhibition of RT (Arg-138) and a mixed inhibition of RT (His-188). The inhibition by ddG-TP was competitive with both mutant RTs. Inhibition by nevirapine gave IC50 values of 0.15, 0.23 and 0.72 microM; by 9-Cl-TIBO of 0.20, 2.50 and 10.3 microM; by L-697,661 of 0.064, 0.28 and 0.60 microM; by ddGTP of 0.13, 0.14 and 0.02 microM; by PFA of 17.0, 48.0 and 15.0 microM for RT wt, RT (Arg-138) and RT (His-188), respectively.

  14. Crystallization in Zr41.2Ti13.8Cu12.5Ni10Be22.5 bulk metallic glass under pressure

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Zhou, T.J.; Rasmussen, Helge Kildahl

    2000-01-01

    The effect of pressure on the crystallization behavior of the bulk metallic glass-forming Zr41.2Ti13.8Cu12.5Ni10Be22.5 alloy with a wide supercooled liquid region has been investigated by in situ high-pressure and high-temperature x-ray powder diffraction measurements using synchrotron radiation....

  15. Radiographic Predictors for Mechanical Failure After Adult Spinal Deformity Surgery: A Retrospective Cohort Study in 138 Patients.

    Science.gov (United States)

    Hallager, Dennis W; Karstensen, Sven; Bukhari, Naeem; Gehrchen, Martin; Dahl, Benny

    2017-07-15

    Retrospective cohort study at a single institution. We aimed at estimating the rate of revision procedures and identify radiographic predictors of mechanical failure after adult spinal deformity surgery. Mechanical failure rates after adult spinal deformity surgery range 12% to 37% in literature. Although the importance of spinal and spino-pelvic alignment is well documented for surgical outcome and ideal alignment has been proposed as sagittal vertical axis (SVA) spinal deformity patients who underwent corrective surgery with at least 5 levels of instrumentation between January 2008 and December 2012 at a single tertiary spine unit were followed for at least 2 years. Time to death or failure was recorded and cause-specific Cox regressions were applied to evaluate predictors for mechanical failure or death. A total of 138 patients with median age of 61 years were included for analysis. Follow up ranged 2.1 to 6.8 years. In total 47% had revision and estimated failure rates were 16% at 1 year increasing to 56% at 5 years. A multivariate analysis adjusting for age at surgery showed increased hazard of failure from LL change > 30°, postoperative TK > 50°, and SS ≤30°. LL change was mostly because of 3-column osteotomy and ending the instrumentation at L5 or S1 increased the hazard of failure more than 6 fold compared with more cranial lumbar levels. Mechanical failure rate was 47% after adult spinal deformity corrective surgery. LL change > 30°, postoperative TK > 50°, and postoperative SS ≤30° were independent radiographic predictors associated with increased hazard of failure. 4.

  16. Association between gender inequality index and child mortality rates: a cross-national study of 138 countries.

    Science.gov (United States)

    Brinda, Ethel Mary; Rajkumar, Anto P; Enemark, Ulrika

    2015-03-09

    Gender inequality weakens maternal health and harms children through many direct and indirect pathways. Allied biological disadvantage and psychosocial adversities challenge the survival of children of both genders. United Nations Development Programme (UNDP) has recently developed a Gender Inequality Index to measure the multidimensional nature of gender inequality. The global impact of Gender Inequality Index on the child mortality rates remains uncertain. We employed an ecological study to investigate the association between child mortality rates and Gender Inequality Indices of 138 countries for which UNDP has published the Gender Inequality Index. Data on child mortality rates and on potential confounders, such as, per capita gross domestic product and immunization coverage, were obtained from the official World Health Organization and World Bank sources. We employed multivariate non-parametric robust regression models to study the relationship between these variables. Women in low and middle income countries (LMICs) suffer significantly more gender inequality (p infant (β = 70.28; 95% CI 51.93-88.64) and under five mortality rates (β = 68.14; 95% CI 49.71-86.58), after adjusting for the effects of potential confounders (p mortality rates. Our results suggest that the initiatives to curtail child mortality rates should extend beyond medical interventions and should prioritize women's rights and autonomy. We discuss major pathways connecting gender inequality and child mortality. We present the socio-economic problems, which sustain higher gender inequality and child mortality in LMICs. We further discuss the potential solutions pertinent to LMICs. Dissipating gender barriers and focusing on social well-being of women may augment the survival of children of both genders.

  17. Circular RNA Atp9b, a competing endogenous RNA, regulates the progression of osteoarthritis by targeting miR-138-5p.

    Science.gov (United States)

    Zhou, Zhi-Bin; Du, Di; Huang, Gao-Xiang; Chen, Aimin; Zhu, Lei

    2018-03-10

    Osteoarthritis (OA) is the most common joint disease and is mainly characterized by degradation of the articular cartilage. Recently, circular RNAs (circRNAs), novel noncoding RNAs with different biological functions and pathological implications, have been reported to be closely associated with various diseases. Growing evidence indicates that circRNAs act as competing endogenous RNAs (ceRNAs) that bind with microRNAs (miRNAs) and regulate their downstream functions. Here, we identified a new circRNA, circRNA_Atp9b, and further investigated its function in OA using a well-established mouse chondrocyte model. We demonstrated that circRNA_Atp9b expression was significantly up-regulated in mouse chondrocytes after stimulation with interleukin-1 beta (IL-1β), and that knockdown of circRNA_Atp9b promoted the expression of type II collagen while inhibiting the generation of MMP13, COX-2 and IL-6. Moreover, there was a negative correlation between the expression levels of circRNA_Atp9b and microRNA (miR)-138-5p, indicating that miR-138-5p also played a role in IL-1β-induced chondrocytes. Bioinformatics analysis predicted circRNA_Atp9b directly target miR-138-5p, which was validated by dual-luciferase assay. Further functional experiments revealed that down-regulation of miR-138-5p partly reversed the effects of circRNA_Atp9b on extracellular matrix (ECM) catabolism and inflammation. Taken together, these results suggest that circRNA_Atp9b regulates OA progression by modulating ECM catabolism and inflammation in chondrocytes via sponging miR-138-5p. Our findings provide novel insight into the regulatory mechanism of circRNA_Atp9b in OA and may contribute to establishing potential therapeutic strategies. Copyright © 2018 Elsevier B.V. All rights reserved.

  18. Envelope Protein Mutations L107F and E138K Are Important for Neurovirulence Attenuation for Japanese Encephalitis Virus SA14-14-2 Strain.

    Science.gov (United States)

    Yang, Jian; Yang, Huiqiang; Li, Zhushi; Wang, Wei; Lin, Hua; Liu, Lina; Ni, Qianzhi; Liu, Xinyu; Zeng, Xianwu; Wu, Yonglin; Li, Yuhua

    2017-01-21

    The attenuated Japanese encephalitis virus (JEV) strain SA14-14-2 has been successfully utilized to prevent JEV infection; however, the attenuation determinants have not been fully elucidated. The envelope (E) protein of the attenuated JEV SA14-14-2 strain differs from that of the virulent parental SA14 strain at eight amino acid positions (E107, E138, E176, E177, E264, E279, E315, and E439). Here, we investigated the SA14-14-2-attenuation determinants by mutating E107, E138, E176, E177, and E279 in SA14-14-2 to their status in the parental virulent strain and tested the replication capacity, neurovirulence, neuroinvasiveness, and mortality associated with the mutated viruses in mice, as compared with those of JEV SA14-14-2 and SA14. Our findings indicated that revertant mutations at the E138 or E107 position significantly increased SA14-14-2 virulence, whereas other revertant mutations exhibited significant increases in neurovirulence only when combined with E138, E107, and other mutations. Revertant mutations at all eight positions in the E protein resulted in the highest degree of SA14-14-2 virulence, although this was still lower than that observed in SA14. These results demonstrated the critical role of the viral E protein in controlling JEV virulence and identified the amino acids at the E107 and E138 positions as the key determinants of SA14-14-2 neurovirulence.

  19. Single-dose anti-CD138 radioimmunotherapy: bismuth-213 is more efficient than lutetium-177 for treatment of multiple myeloma in a preclinical model

    Directory of Open Access Journals (Sweden)

    Nolwenn eFichou

    2015-11-01

    Full Text Available Objectives: Radioimmunotherapy (RIT has emerged as a potential treatment option for multiple myeloma (MM. In humans, a dosimetry study recently showed the relevance of RIT using an antibody targeting the CD138 antigen. The therapeutic efficacy of RIT using an anti-CD138 antibody coupled to 213Bi, an α-emitter, was also demonstrated in a preclinical MM model. Since then, RIT with β-emitters has shown efficacy in treating hematologic cancer. In this paper, we investigate the therapeutic efficacy of RIT in the 5T33 murine MM model using a new anti-CD138 monoclonal antibody labeled either with 213Bi for α-RIT or 177Lu for β-RIT.Methods: A new monoclonal anti-CD138 antibody, 9E7.4, was generated by immunizing a rat with a murine CD138-derived peptide. Antibody specificity was validated by flow cytometry, biodistribution and α-RIT studies. Then, a β-RIT dose-escalation assay with the 177Lu-radiolabeled 9E7.4 mAb was performed in KalwRij C57/BL6 mice 10 days after i.v. engraftment with 5T33 MM cells. Animal survival and toxicological parameters were assessed to define the optimal activity.Results: α-RIT performed with 3.7 MBq of 213Bi-labeled 9E7.4 anti-CD138 mAb increased median survival to 80 days compared to 37 days for the untreated control and effected cure in 45% of animals. β-RIT performed with 18.5 MBq of 177Lu-labeled 9E7.4 mAb was well tolerated and significantly increased mouse survival (54 versus 37 days in the control group; however, no mice were cured with this treatment.Conclusion: This study revealed the advantages of α-RIT in the treatment of MM in a preclinical model where β-RIT shows almost no efficacy.

  20. Food Insecurity Is Associated with Subjective Well-Being among Individuals from 138 Countries in the 2014 Gallup World Poll.

    Science.gov (United States)

    Frongillo, Edward A; Nguyen, Hoa T; Smith, Michael D; Coleman-Jensen, Alisha

    2017-04-01

    Background: Food insecurity is an aspect of living conditions that is particularly important for quality of life, health, and subjective well-being. The implementation of the 8-item Food Insecurity Experience Scale in 147 countries in the 2014 Gallup World Poll provided an unprecedented opportunity to understand the association of food insecurity with subjective well-being.Objective: We examined how food insecurity relates with measures of living conditions and how food insecurity and other living conditions relate with physical health and, in turn, subjective well-being.Methods: Data were collected from individuals aged ≥15 y by telephone in 38 countries and via face-to-face interviews in 111 others. The available sample was 132,618 (138 countries) and 122,137 (137 countries) for the daily experience and life evaluation indexes of subjective well-being, respectively. Daily experience was a continuous measure and life evaluation was categorized into thriving, struggling, and suffering. We estimated 6 linear or logistic regression models for each index controlling for country as a fixed effect.Results: Food insecurity was associated with the other 3 measures of living conditions: household income, shelter and housing, and employment. Food insecurity explained poor physical health and lower subjective well-being beyond other measures of living conditions. Instrumental and emotional support was associated with higher subjective well-being. The associations of food insecurity with subjective well-being were larger than with other explanatory variables. Food insecurity was associated with subjective well-being within each of the 4 World Bank income classes of countries, with a larger magnitude of differences for the higher-income classes.Conclusions: Food insecurity was strongly and negatively associated with subjective well-being in a large global sample of individuals aged ≥15 y. These results demonstrate the consistency of goal 2 of the Sustainable Development

  1. Sleep duration and mortality: a prospective study of 113 138 middle-aged and elderly Chinese men and women.

    Science.gov (United States)

    Cai, Hui; Shu, Xiao-Ou; Xiang, Yong-Bing; Yang, Gong; Li, Honglan; Ji, Bu-Tian; Gao, Jing; Gao, Yu-Tang; Zheng, Wei

    2015-04-01

    To evaluate associations of sleep duration with total mortality and disease-specific mortality in a Chinese population. Prospective study conducted from 1996 (for women)/2002 (for men) to 2010. A population-based cohort study in Shanghai, China. None. A total of 113,138 participants (68,548 women and 44,590 men) of the Shanghai Women's and Men's Health Studies, aged 44-79 y and 40-75 y (women and men, respectively) at sleep duration assessment, were included in the study. In-person interviews were conducted to collect information on sleep duration, socioeconomic status, living conditions, history of chronic disease, participation in regular exercise, and family history of disease. The cohort has been followed using a combination of biannual in-person interviews and record linkages with Shanghai's population-based death registry. Survival status of participants on December 31, 2010 was included as the study outcome. Relative risks were calculated using a Cox proportional model stratified by sex and comorbidity score. There were 4,277 deaths (2,356 among women; 1,921 among men) during a median follow-up time of 7.12 y for women and 6.07 y for men. Among both women and men, sleep duration showed a J-shaped association with total mortality. Hazard ratios (95% confidence intervals) were 1.15 (1.01-1.32), 1.06 (0.94-1.20), 1.17 (1.04-1.32), 1.36 (1.13-1.64), and 2.11 (1.77-2.52) for women and 1.06 (0.90-1.25), 1.07 (0.94-1.23), 1.13 (1.00-1.28), 1.34 (1.10-1.62), and 1.55 (1.29-1.86) for men who slept 4-5, 6, 8, 9, and ≥ 10 h per day, respectively, compared with those who slept 7 h per day. Associations for disease-specific mortality, including cardiovascular disease, stroke, diabetes, and cancer, also generally followed the same J-shaped pattern. The sleep duration-mortality association was more evident among participants with comorbidities, but varied little by sex. In our study population of Chinese adults, shorter and longer sleep durations were independently

  2. Risk factors for surgical site infection in a teaching hospital: a prospective study of 1,138 patients

    Directory of Open Access Journals (Sweden)

    Cheng K

    2015-08-01

    Full Text Available Keping Cheng, Jiawei Li, Qingfang Kong, Changxian Wang, Nanyuan Ye, Guohua Xia Department of Infection Control, Zhongda Hospital, School of Medicine, Southeast University, Nanjing, Jiangsu Province, People’s Republic of China Background: The purpose of this study was to identify risk factors for surgical site infection (SSI in a teaching hospital.Methods: A prospective study was initiated to investigate risk factors for SSI at a university-affiliated tertiary care center from July 2013 to December 2014. The chi-square test for categorical variables was used to determine the significance of association, whereas the multivariate logistic regression model was used to examine independent risk factors for SSI.Results: A total of 1,138 patients met the inclusion criteria, in whom 36 cases of infection occurred during the hospitalization period and two cases occurred after discharge. Univariate analysis showed that SSI was associated with the type of operation, wound classification, volume of blood loss, blood transfusion, American Society of Anesthesiology score before surgery, risk index, duration of surgery, diabetes, cancer, gastrointestinal catheter, urinary catheter, postoperative drainage, and preprocedural white blood cell count. Multivariate analysis identified six independent parameters correlating with the occurrence of SSI: diabetes (odds ratio [OR] 6.400; 95% confidence interval [CI] 2.582–15.866; P=0.000; cancer (OR 2.427; 95% CI 1.028–5.732; P=0.043; preprocedural white blood cell count more than 10×109/L (OR 6.988; CI 3.165–15.425; P=0.000; wound classification (clean contaminated [OR: 7.893; CI: 2.244–27.762; P=0.001]; contaminated [OR: 7.031; CI: 1.652–29.922; P=0.008]; dirty [OR: 48.778; CI: 5.418–439.164; P=0.001]; operative duration more than 120 minutes (OR 4.289; CI 1.773–10.378; P=0.001; and postoperative drainage (OR 3.957; CI 1.422–11.008; P=0.008.Conclusion: Our data suggest that all these risk factors

  3. New limits on 2ε, εβ{sup +} and 2β{sup +} decay of {sup 136}Ce and {sup 138}Ce with deeply purified cerium sample

    Energy Technology Data Exchange (ETDEWEB)

    Belli, P.; Bernabei, R. [INFN Sezione Roma ' ' Tor Vergata' ' , Rome (Italy); Universita di Roma ' ' Tor Vergata' ' , Dipartimento di Fisica, Rome (Italy); Boiko, R.S. [Institute for Nuclear Research, Kyiv (Ukraine); National University of Life and Environmental Sciences of Ukraine, Kyiv (Ukraine); Cappella, F. [INFN Sezione Roma, Rome (Italy); Cerulli, R.; Laubenstein, M. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Danevich, F.A.; Kropivyansky, B.N.; Polischuk, O.G.; Tretyak, V.I. [Institute for Nuclear Research, Kyiv (Ukraine); Incicchitti, A. [INFN Sezione Roma, Rome (Italy); Universita di Roma ' ' La Sapienza' ' , Dipartimento di Fisica, Rome (Italy); Mokina, V.M. [Institute for Nuclear Research, Kyiv (Ukraine); INFN Sezione Roma, Rome (Italy)

    2017-08-15

    A search for double electron capture (2ε), electron capture with positron emission (εβ{sup +}), and double positron emission (2β{sup +}) in {sup 136}Ce and {sup 138}Ce was realized with a 465 cm{sup 3} ultra-low background HP Ge γ spectrometer over 2299 h at the Gran Sasso underground laboratory. A 627 g sample of cerium oxide deeply purified by liquid-liquid extraction method was used as a source of γ quanta expected in double β decay of the cerium isotopes. New improved half-life limits were set on different modes and channels of double β decay of {sup 136}Ce and {sup 138}Ce at the level of T{sub 1/2} > 10{sup 17}-10{sup 18} yr. (orig.)

  4. Lipopolysaccharide-induced activation of NF-{kappa}B non-canonical pathway requires BCL10 serine 138 and NIK phosphorylations

    Energy Technology Data Exchange (ETDEWEB)

    Bhattacharyya, Sumit; Borthakur, Alip; Dudeja, Pradeep K. [Department of Medicine, University of Illinois at Chicago and Jesse Brown VA Medical Center, Chicago, IL 60612-7227 (United States); Tobacman, Joanne K., E-mail: jkt@uic.edu [Department of Medicine, University of Illinois at Chicago and Jesse Brown VA Medical Center, Chicago, IL 60612-7227 (United States)

    2010-11-15

    Background and aims: B-cell lymphoma/leukemia (BCL)-10 and reactive oxygen species mediate two pathways of NF-{kappa}B (RelA) activation by lipopolysaccharide (LPS) in human colonic epithelial cells. The pathway for LPS activation of RelB by the non-canonical pathway (RelB) in non-myeloid cells was not yet reported, but important for understanding the range of potential microbial LPS-induced effects in inflammatory bowel disease. Methods: Experiments were performed in human colonic epithelial cells and in mouse embryonic fibroblasts deficient in components of the IkappaB kinase (IKK) signalosome, in order to detect mediators of the non-canonical pathway of NF-{kappa}B activation, including nuclear RelB and p52 and phospho- and total NF-{kappa}B inducing kinase (NIK). BCL10 was silenced by siRNA and effects of mutations of specific phosphorylation sites of BCL10 (Ser138Gly and Ser218Gly) were determined. Results: By the non-canonical pathway, LPS exposure increased nuclear RelB and p52, and phospho-NIK, with no change in total NIK. Phosphorylation of BCL10 serine 138 was required for NIK phosphorylation, since mutation of this residue eliminated the increases in phospho-NIK and nuclear RelB and p52. Mutations of either serine 138 or serine 218 reduced RelA, p50, and phospho-I{kappa}B{alpha} of the canonical pathway. Effects of LPS stimulation and BCL10 silencing on NIK phosphorylation were demonstrated in confocal images. Conclusions: LPS induces activation of both canonical and non-canonical pathways of NF-{kappa}B in human colonic epithelial cells, and the non-canonical pathway requires phosphorylations of BCL10 (serine 138) and NIK. These findings demonstrate the important role of BCL10 in mediating LPS-induced inflammation in human colonic epithelial cells and may open new avenues for therapeutic interventions.

  5. Phosphate ytterbium-doped single-mode all-solid photonic crystal fiber with output power of 13.8 W

    Science.gov (United States)

    Wang, Longfei; He, Dongbing; Feng, Suya; Yu, Chunlei; Hu, Lili; Qiu, Jianrong; Chen, Danping

    2015-01-01

    Single-mode ytterbium-doped phosphate all-solid photonic crystal fiber (AS-PCF) with 13.8 W output power and 32% slope efficiency was reported. By altering the diameter of the rods around the doped core and thus breaking the symmetry of the fiber, a polarization-maintaining AS-PCF with degree of polarization of >85% was also achieved, for the first time to knowledge, in a phosphate PCF. PMID:25684731

  6. Study of the interactions of 13.8 GeV/c protons with the heavy nuclei of the emulsions exposed in magnetic fuel of 170 kgauss; Estudio de las interacciones de protones de 13,8 geV/c con los nucleos pesados de emusiones

    Energy Technology Data Exchange (ETDEWEB)

    Gomez Aleixandre, J. L.

    1967-07-01

    145 stars with N{sub h}>8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c {pi}- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs.

  7. The K2-138 System: A Near-resonant Chain of Five Sub-Neptune Planets Discovered by Citizen Scientists

    Science.gov (United States)

    Christiansen, Jessie L.; Crossfield, Ian J. M.; Barentsen, Geert; Lintott, Chris J.; Barclay, Thomas; Simmons, Brooke. D.; Petigura, Erik; Schlieder, Joshua E.; Dressing, Courtney D.; Vanderburg, Andrew; Allen, Campbell; McMaster, Adam; Miller, Grant; Veldthuis, Martin; Allen, Sarah; Wolfenbarger, Zach; Cox, Brian; Zemiro, Julia; Howard, Andrew W.; Livingston, John; Sinukoff, Evan; Catron, Timothy; Grey, Andrew; Kusch, Joshua J. E.; Terentev, Ivan; Vales, Martin; Kristiansen, Martti H.

    2018-02-01

    K2-138 is a moderately bright (V = 12.2, K = 10.3) main-sequence K star observed in Campaign 12 of the NASA K2 mission. It hosts five small (1.6–3.3 {R}\\oplus ) transiting planets in a compact architecture. The periods of the five planets are 2.35, 3.56, 5.40, 8.26, and 12.76 days, forming an unbroken chain of near 3:2 resonances. Although we do not detect the predicted 2–5 minute transit timing variations (TTVs) with the K2 timing precision, they may be observable by higher-cadence observations with, for example, Spitzer or CHEOPS. The planets are amenable to mass measurement by precision radial velocity measurements, and therefore K2-138 could represent a new benchmark system for comparing radial velocity and TTV masses. K2-138 is the first exoplanet discovery by citizen scientists participating in the Exoplanet Explorers project on the Zooniverse platform.

  8. Thermal-neutron cross sections and resonance integrals of {sup 138}Ba and {sup 141}Pr using Am-Be neutron source

    Energy Technology Data Exchange (ETDEWEB)

    Panikkath, Priyada; Mohanakrishnan, P. [Manipal University, Manipal Centre for Natural Sciences, Karnataka (India)

    2016-09-15

    The thermal-neutron capture cross sections and resonance integrals of {sup 138}Ba(n, γ){sup 139}Ba and {sup 141}Pr(n, γ){sup 142}Pr were measured by activation method using an isotopic Am-Be neutron source. The estimations were with respect to that of {sup 55}Mn(n, γ){sup 56}Mn and {sup 197}Au(n, γ){sup 198}Au reference monitors. The measured thermal-capture cross section of {sup 138}Ba with respect to {sup 55}Mn is 0.410±0.023 b and with respect to {sup 197}Au is 0.386±0.019 b. The measured thermal-capture cross section of {sup 141}Pr with respect to {sup 55}Mn is 11.36±1.29 b and with respect to {sup 197}Au is 10.43±1.14 b. The resonance integrals for {sup 138}Ba are 0.380±0.033 b ({sup 55}Mn) and 0.364±0.027 b ({sup 197}Au) and for {sup 141}Pr are 21.05±2.88 b ({sup 55}Mn) and 15.27±1.87 b ({sup 197}Au). The comparison between the present measurements and various reported values are discussed. The cross sections corresponding to the selected isotopes are measured using an Am-Be source facility for the first time. (orig.)

  9. MiR-26a and miR-138 block the G1/S transition by targeting the cell cycle regulating network in prostate cancer cells.

    Science.gov (United States)

    Erdmann, Kati; Kaulke, Knut; Rieger, Christiane; Salomo, Karsten; Wirth, Manfred P; Fuessel, Susanne

    2016-11-01

    The tumor-suppressive microRNAs miR-26a and miR-138 are significantly down-regulated in prostate cancer (PCa) and have been identified as direct regulators of enhancer of zeste homolog 2 (EZH2), which is a known oncogene in PCa. In the present study, the influence of miR-26a and miR-138 on EZH2 and cellular function including the impact on the cell cycle regulating network was evaluated in PCa cells. PC-3 and DU-145 PCa cells were transfected with 100 nM of miRNA mimics, siRNA against EZH2 (siR-EZH2) or control constructs for 4 h. Analyses of gene expression and cellular function were conducted 48 h after transfection. Both miRNAs influenced the EZH2 expression and activity only marginally, whereas siR-EZH2 led to a notable decrease of the EZH2 expression and activity. Both miRNAs inhibited short- and/or long-term proliferation of PCa cells but showed no effect on viability and apoptosis. In PC-3 cells, miR-26a and miR-138 caused a significant surplus of cells in the G0/G1 phase of 6 and 12 %, respectively, thus blocking the G1/S-phase transition. Treatment with siR-EZH2 was without substantial influence on cellular function and cell cycle. Therefore, alternative target genes involved in cell cycle regulation were identified in silico. MiR-26a significantly diminished the expression of its targets CCNE1, CCNE2 and CDK6, whereas CCND1, CCND3 and CDK6 were suppressed by their regulator miR-138. The present findings suggest an anti-proliferative role for miR-26a and miR-138 in PCa by blocking the G1/S-phase transition independent of EZH2 but via a concerted inhibition of crucial cell cycle regulators.

  10. Experimental determinations of the enthalpy of a coal-derived (138/sup 0/)-373(/sup 0/F) naphtha fraction produced by the solvent-refined coal process

    Energy Technology Data Exchange (ETDEWEB)

    Yesavage, V.F.; Andrew, J.R.; Sharma, R.; Kidnay, A.J.

    1978-01-01

    Experimental determinations of the enthalpy of a coal-derived 138/sup 0/-373/sup 0/F naphtha fraction produced by the solvent refined coal process were made with a Freon 11 reference fluid boiloff calorimeter at inlet temperatures of 160/sup 0/-719/sup 0/F, pressures of 30-1500 psia, and an outlet temperature of 65/sup 0/F; 145 measurements were obtained over the liquid, vapor, two-phase, and critical regions. The estimated accuracy of the data was (PLUS OF MINUS)0.5%. Although the experimental data for this particular system were in fair agreement with prediction methods developed for petroleum fractions.

  11. Experimental determinations of the enthalpy of a coal-derived (138-373 F) naphtha fraction produced by the solvent-refined coal process

    Energy Technology Data Exchange (ETDEWEB)

    Yesavage, V.F; Andrew, J.R.; Sharma, R.; Kidnay, A.J.

    1978-01-01

    Experimental determination of the enthalpy of a coal-derived 138-373 F naphtha fraction produced by the solvent refined coal process were made with a Freon 11 reference fluid boiloff calorimeter at inlet temperatures of 160-719 F, pressures of 30-1500 psia, and an outlet temperature of 65 F; 145 measurements were obtained over the liquid, vapor, two-phase, and critical regions. The estimated accuracy of the data was (plus or minus) 0.5%. Although the experimental data for this particular system were in fair agreement with prediction methods developed for petroleum fractions.

  12. A limited plasma cell flow cytometry panel with reflex CD138 immunohistochemistry is an optimal workflow process for evaluating plasma cell neoplasms in bone marrow specimens.

    Science.gov (United States)

    Chen, Zhongchuan Will; Perkins, Sherrie L; Weiss, Ronald L; Bahler, David W; Hussong, Jerry W; Salama, Mohamed E

    2015-01-01

    To determine the optimal workflow combination of flow cytometry (FC) and immunohistochemistry tests for efficient and cost-effective evaluation of plasma cell (PC) neoplasms (PCNs) in bone marrow (BM) specimens. Various workflow combinations of immunohistochemistry and FC for 4,031 BM specimens worked up for PCNs were compared. Turnaround time (TAT), immunohistochemistry usage, technical charges, and addendum/amendment rates were compared between periods to determine the optimal workflow combination. Five distinct workflow periods were identified, with varying combinations of full or limited FC panels for assessing PC clonality and CD138/κ/λ immunohistochemistry for PC quantification. Replacement of full FC with limited FC was associated with significant reductions in TAT and number of immunostains performed per case. Elimination of immunohistochemistry on cases determined to be polyclonal by FC also resulted in significant reductions in immunohistochemistry usage and significant cost savings. Assessment of PC clonality using a limited FC panel followed by reflex CD138 immunohistochemistry on cases that are monoclonal by FC provides an optimal and cost-effective workflow for evaluating PCNs in BM samples. Copyright© by the American Society for Clinical Pathology.

  13. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    INTRODUCTION. Fluorescent materials, particularly blue fluorescent materials have gained strong interest because ... emitting complexes in different technical applications, such as emitting materials for organic light emitting ..... properties of three novel two-dimensional lanthanide coordination polymers with mixed aromatic ...

  14. Pyroelectric Ferroelectric and Resistivity Studies on Samarium ...

    African Journals Online (AJOL)

    Barium Strontium Sodium Niobate (Ba1-xSrx)2NaNb5O15 (BSNN) belongs to tungsten bronze ferroelectric morphotrophic phase boundary (MPB) system at x = 0.6, having large spontaneous polarisation, pyroelectric coefficient and low dielectic constant and is expected to be applicable for piezoceramic filter and ...

  15. A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

    African Journals Online (AJOL)

    emitting complexes in different technical applications, such as emitting materials for organic light emitting diodes, sensitizers in solar energy conversion, chemical sensors and so forth [6-9]. The ability of bipy to act as a rigid ..... properties of three-dimensional organic-inorganic hybrids based on α-metatungstate. Inorg. Chim.

  16. M184I/V substitutions and E138K/M184I/V double substitutions in HIV reverse transcriptase do not significantly affect the antiviral activity of EFdA.

    Science.gov (United States)

    Oliveira, Maureen; Brenner, Bluma G; Xu, Hongtao; Ibanescu, Ruxandra-Ilinca; Mesplède, Thibault; Wainberg, Mark A

    2017-11-01

    4'-Ethynyl-2-fluoro-2'-deoxyadenosine (EFdA) is a potent nucleoside analogue inhibitor of HIV that has an unusually long half-life. Cell culture selections with either EFdA or lamivudine using both subtype B and non-B clinical isolates selected the M184I/V substitutions in reverse transcriptase (RT). Unlike lamivudine, however, EFdA retained significant activity against viruses containing the M184I/V substitutions. In other clinical trials that evaluated rilpivirine together with emtricitabine in first-line therapy, the emergence of both the M184I/V and E138K mutations in RT was demonstrated. Moreover, the M184I/V and E138K substitutions were shown to be compensatory for each other with regard to both efficiency of RT activity and viral replicative capacity. This creates concern that E138K might emerge as a compensatory mutation for M184I/V in the aftermath of the use of EFdA. We wished to determine whether the E138K mutation in HIV RT together with M184I/V would compromise the activity of EFdA. Recombinant viruses containing the M184I/V and/or E138K substitutions were generated by site-directed mutagenesis and evaluated in tissue culture for susceptibility to various nucleoside compounds, including EFdA. Susceptibility to EFdA was retained in M184I/V viruses that also contained the E138K substitution. Moreover, the E138K substitution was not generated in these studies under selection pressure with EFdA. These findings help to alleviate concern that EFdA may not be active against viruses that contain both the M184I/V and E138K substitutions in RT.

  17. From dense hot Jupiter to low-density Neptune: The discovery of WASP-127b, WASP-136b, and WASP-138b

    Science.gov (United States)

    Lam, K. W. F.; Faedi, F.; Brown, D. J. A.; Anderson, D. R.; Delrez, L.; Gillon, M.; Hébrard, G.; Lendl, M.; Mancini, L.; Southworth, J.; Smalley, B.; Triaud, A. H. M.; Turner, O. D.; Hay, K. L.; Armstrong, D. J.; Barros, S. C. C.; Bonomo, A. S.; Bouchy, F.; Boumis, P.; Collier Cameron, A.; Doyle, A. P.; Hellier, C.; Henning, T.; Jehin, E.; King, G.; Kirk, J.; Louden, T.; Maxted, P. F. L.; McCormac, J. J.; Osborn, H. P.; Palle, E.; Pepe, F.; Pollacco, D.; Prieto-Arranz, J.; Queloz, D.; Rey, J.; Ségransan, D.; Udry, S.; Walker, S.; West, R. G.; Wheatley, P. J.

    2017-03-01

    We report three newly discovered exoplanets from the SuperWASP survey. WASP-127b is a heavily inflated super-Neptune of mass 0.18±0.02 MJ and radius 1.37±0.04 RJ. This is one of the least massive planets discovered by the WASP project. It orbits a bright host star (Vmag = 10.16) of spectral type G5 with a period of 4.17 days. WASP-127b is a low-density planet that has an extended atmosphere with a scale height of 2500 ± 400 km, making it an ideal candidate for transmission spectroscopy. WASP-136b and WASP-138b are both hot Jupiters with mass and radii of 1.51 ± 0.08 MJ and 1.38 ± 0.16 RJ, and 1.22 ± 0.08 MJ and 1.09 ± 0.05 RJ, respectively. WASP-136b is in a 5.22-day orbit around an F9 subgiant star with a mass of 1.41 ± 0.07 M⊙ and a radius of 2.21 ± 0.22 R⊙. The discovery of WASP-136b could help constrain the characteristics of the giant planet population around evolved stars. WASP-138b orbits an F7 star with a period of 3.63 days. Its radius agrees with theoretical values from standard models, suggesting the presence of a heavy element core with a mass of 10 M⊕. The discovery of these new planets helps in exploring the diverse compositional range of short-period planets, and will aid our understanding of the physical characteristics of both gas giants and low-density planets. Radial velocity and photometry tables are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/599/A3

  18. Association between the porcine Escherichia coli F18 receptor genotype and phenotype and susceptibility to colonisation and postweaning diarrhoea caused by E-coli O138 : F18

    DEFF Research Database (Denmark)

    Frydendahl, K.; Jensen, Tim Kåre; Andersen, Jens Strodl

    2003-01-01

    Porcine postweaning Escherichia coli enteritis is a cause of significant morbidity and mortality in pigs worldwide, and effective prevention remains an unsolved problem. This study examined the correlation between susceptibility of pigs to experimental infection with an E. coli F18 strain...... and the porcine intestinal F18 receptor genotypes. Thirty-one pigs classified as either belonging to the susceptible or the resistant genotype were inoculated with cultures of an E. coli 0138:F18 isolated from a pig with postweaning diarrhoea. Susceptibility to colonisation and diarrhoea was assessed by clinical...... and heterozygotic susceptible pigs. Faecal shedding of the challenge strain correlated with the genetic receptor profile. Twenty pigs examined immunohistochemically revealed focal to extensive small intestinal mucosal colonisation by E. coli O138:F18 in nine of 10 susceptible and three of 10 resistant pigs. Results...

  19. A de novo 1.38 Mb duplication of 1q31.1 in a boy with hemifacial microsomia, anophthalmia, anotia, macrostomia, and cleft lip and palate.

    Science.gov (United States)

    Huang, Xue-shuang; Zhu, Bao; Jiang, Hai-ou; Wu, Su-fan; Zhang, Zai-qi; Xiao, Lin; Yi, Li-lan; Zhang, Jian-xiang

    2013-04-01

    We reported a 2-year-old boy with developmental delay, mild mental retardation, and severe craniofacial malformation, including facial asymmetry with hypoplasia of the left zygoma, maxilla, and mandible, and left anophthalmia and anotia. A genome-wide screen revealed a 1.38 Mb duplication on chromosome 1q31.1, which was absent in his parents and 27 healthy controls. The duplication region contains two Refseq genes, PLA2G4A and C1orf99, which have not been reported to be implicated in craniofacial malformation. Functional studies of these genes and additional clinical analysis are necessary to elucidate the pathogenesis of craniofacial malformation. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  20. Letter - X-ray diffraction and Mossbauer spectroscopy of Fe{sup 3+}-bearing Mg-silicate post-perovskite at 128-138 GPa.

    Energy Technology Data Exchange (ETDEWEB)

    Catalli, K.; Shim, S. H.; Prakapenka, V. B.; Zhao, J.; Sturhahn, W. (X-Ray Science Division); (Massachusetts Inst. of Tech.); (Univ. of Chicago)

    2010-01-01

    The effect of ferric iron on the properties of Mg-silicate post-perovskite (PPv) were studied up to 138 GPa using synchrotron X-ray diffraction and Moessbauer spectroscopy. Our diffraction measurements revealed that the incorporation of Fe{sup 3+} has virtually no effect on the volume of PPv, in contrast to Fe{sup 2+}, which increases the volume. Therefore, incorporation of Fe{sup 3+} increases the density of PPv much more effectively than Fe{sup 2+}. Moessbauer spectroscopy suggests that Fe{sup 3+} enters PPv through charge-coupled substitution and is high spin in the bipolar prismatic site and low spin in the octahedral site (i.e., mixed spin state). Our results may have important implications for the gravitational stability of lower-mantle heterogeneities.

  1. Perioperative mortality after non-hepatic general surgery in patients with liver cirrhosis: an analysis of 138 operations in the 2000s using Child and MELD scores.

    Science.gov (United States)

    Neeff, Hannes; Mariaskin, Dimitri; Spangenberg, Hans-Christian; Hopt, Ulrich T; Makowiec, Frank

    2011-01-01

    Despite of advances in modern surgical and intensive care treatment, perioperative mortality remains high in patients with liver cirrhosis undergoing nonhepatic general surgery. In the few existing articles, mortality was reported to be as high as 70% in patients with poor liver function (high Child or model for end-stage liver disease (MELD) score). Since data are limited, we analyzed our recent experience with cirrhotic patients undergoing emergent or elective nonhepatic general surgery at a German university hospital. Since 2000, 138 nonhepatic general surgical procedures (99 intra-abdominal, 39 abdominal wall) were performed in patients with liver cirrhosis. Liver cirrhosis was preoperatively classified according to the Child (41 Child A, 59 B, 38 C) and the MELD score (MELD median 13). Sixty-eight (49%) of the patients underwent emergent operations. Most abdominal wall operations were for hernias. Intra-abdominal operations consisted of GI tract procedures (n=53), cholecystectomies (n=15), and various others (n=31). Perioperative data were gained by retrospective analysis. Overall perioperative mortality in all 138 cases was 28% (9% in elective surgery, 47% in emergent surgery; pabdominal than after abdominal wall operations (35% vs. 8%; p=0.001) or in patients requiring transfusions (43% vs. 5% without transfusions; p15; phigh in patients with liver cirrhosisundergoing general surgery, especially in emergent situations. Patients with poor liver function and/or need for blood transfusions even had a very high mortality. In our experience, the Child score (together with other variables) independently correlates with perioperative mortality in emergent operations whereas the MELD score was inferior in predicting the outcome.

  2. Leu138 in bovine prion peptide fibrils is involved in seeding discrimination related to codon 129 M/V polymorphism in the prion peptide seeding experiment.

    Science.gov (United States)

    Liao, Tai-Yan; Lee, Lily Y-L; Chen, Rita P-Y

    2011-11-01

    The risk of acquiring variant Creutzfeldt-Jakob disease is closely related to polymorphism at codon 129 of the human prion gene, because almost all variant Creutzfeldt-Jakob disease patients are Met/Met homozygotes. Although animal transmission experiments corroborated this seeding discrimination, the origin of the differential seeding efficiency of the bovine prion seed for human codon 129 polymorphism remained elusive. Here, we used a short prion protein (PrP) peptide as a model system to test whether seeding discrimination can be found in this simple system. We used a previously developed 'seed-titration method' and time-resolved CD spectroscopy to compare sequence-dependent seeding efficiency regarding codon 129 polymorphism. Our results showed that the Met→Val substitution on the human PrP (huPrP) peptide decreased seeding efficiency by 10 times when fibrils formed from bovine PrP (bPrP) peptide were used as the seed. To explore whether the different seeding barrier is due to the chemical and structural properties of Met and Val or whether another residue is involved in this peptide model, we constructed three bPrP mutants, V112M, L138I and N143S, in each of which one residue was replaced by the corresponding human residue. Our data showed that Leu138 in the bPrP seed might be the key residue causing the different seeding efficiencies related to 129M/V polymorphism and the interference effect of huPrP129V in the huPrP129M/V mixture. We propose a 'surface competition hypothesis' to explain the big seeding barrier caused by 129V in the PrP peptide seeding experiment. © 2011 The Authors Journal compilation © 2011 FEBS.

  3. 136 - 138_Gumel et al.

    African Journals Online (AJOL)

    USER

    Thoracic Cavity and Its Contents. Meat inspection at Hadejia abattoir was carried out by the officials of Veterinary division of Jigawa State. Ministry of Agriculture. All operation in the abattoir were manual and records are kept by the management. Postmortem inspection was carried out according to the method describe by ...

  4. Avaliação da resistência à corrosão de implantes em aços inoxidáveis ISO 5832-9 e F138 removidos de pacientes

    Directory of Open Access Journals (Sweden)

    Elison da Fonseca e Silva

    2012-01-01

    Full Text Available This work has compared the surfaces of two different steel samples used as orthopedical implants, classified as ASTM F138 and ISO5832-9, through optical emission spectroscopy, by means of SEM and EDS. The samples (implants were also submitted to potentiodynamic cyclic polarization in Ringer lactate and NaCl 0.9 M L-1 solutions; ISO5832-9 sample did not show any kind of localized corrosion, but in the case of F138 steel was observed a pit localized corrosion in both solutions. In Ringer lactate solution it was observed a loss of about 63% for nickel and 26% for iron for F138 stell, compared to the initial composition.

  5. Achados neuropatológicos na síndrome da imunodeficiência adquirida (sida: revisão de 138 casos

    Directory of Open Access Journals (Sweden)

    Marco V. Wainstein

    1992-06-01

    Full Text Available Com o objetivo de determinar a incidência das direrentes afecções que podem atingir o Sistema Nervoso Central (SNC na Síndrome da Imunodeficiência Adquirida (SIDA realizou- se um estudo retrospectivo através de necrópsias realizadas no Hospital de Clínicas de Porto Alegre. Para tanto, foram examinadas 138 necrópsias de pacientes portadores de SIDA que haviam morrido entre janeiro de 1985 e dezembo de 1990. Todos os cérebrosforam analisados macroscópica e microscopicamente através da hematoxilina-eosina e, quando necessário, colorações, especiais como Grocott, PAS, Giemsa e Ziehl-Nielsen, foram empregadas. As principais lesões encontradas foram: toxoplasmose cerebral em 29 casos (21 %; criptococose em 17 (12%; tuberculose em dois (1% e um (0,7% de candidíase. Além destas lesões inflamatórias foram observados 15 casos (10% com lesões vasculares; oito (6% com gliose e sete (5% com achados sugestivos de encefalopatia pelo HIV. Podemos concluir que o SNC é um dos principais órgãos-alvo da SIDA e que a toxoplasmose cerebral é a principal forma de acometimento do SNC nestes pacientes.This is an autopsy s study performed in a retrospective fashion to determine the incidence of diseases that could affect the Central Nervous System in AIDS. For this purpose, 138 autopsies of patients with AIDS performed at the "Hospital de Clinicas de Porto Alegre ", Brazil, between january/85 and december/90 were studied. All the brains were evaluated macroscopically and microscopically mainly through hematoxylin-eosin staining and if necessary special tecniques like PAS,Grocott, Giemsa and Ziehl-Nielsen were done. Results have revealed 29 (21% cases with cerebral toxoplasmosis; cryptococosis in 17 (12%; tuberculosis in two (1% and one case (0,7% of candidiasis. Besides these inflammatory lesions, 15 (10%presented vascular lesion; 8(6% had gliosis and 7(5% cases had suggestive findings ofHTV-encephalopath. We can conclude that the CNS is a

  6. Fate of pathological prion (PrP(sc)92-138) in soil and water: prion-clay nanoparticle molecular dynamics.

    Science.gov (United States)

    Chapron, Yves; Charlet, Laurent; Sahai, Nita

    2014-01-01

    Pathogenic prion protein scrapie (PrP(sc)) may contaminate soils for decades and remain in water in colloidal suspension, providing infection pathways for animals through the inhalation of ingested dust and soil particles, and drinking water. We used molecular dynamics simulations to understand the strong binding mechanism of this pathogenic peptide with clay mineral surfaces and compared our results to experimental works. We restricted our model to the moiety PrP(92-138), which is a portion of the whole PrP(sc) molecule responsible for infectivity and modeled it using explicit solvating water molecules in contact with a pyrophyllite cleavage plane. Pyrophyllite is taken as a model for common soil clay, but it has no permanent structural charge. However, partial residual negative charges occur on the cleavage plane slab surface due to a slab charge unbalance. The charge is isotropic in 2D and it was balanced with K(+) ions. After partially removing potassium ions, the peptide anchors to the clay surface via up to 10 hydrogen bonds, between protonated lysine or histidine residues and the oxygen atoms of the siloxane cavities. Our results provide insight to the mechanism responsible for the strong association between the PrP(sc) peptide and clay nanoparticles and the associations present in contaminated soil and water which may lead to the infection of animals.

  7. Decay of the $r$-process nuclides $^{137, 138, 139}$Sb, and the A=130 solar $r$-process abundance peak

    CERN Document Server

    Arndt, O; Farouqi, K; Koester, U; Kratz, K-L; Pfeiffer, B; Walters, W B; Hoteling, N; Fedosseev, V; Hennrich, S; Woehr, A; Shergur, J; Hecht, A A

    2011-01-01

    Half-life (T(1/2)) and beta-delayed neutron branching (P(n)) values of 492(25) ms and 49(8)\\%, 350(15) ms and 72(8)\\%, and 93(13) ms and 90(10)\\% for the r-process nuclei (137,138,139)Sb, respectively, have been measured at the CERN On-Line Isotope Mass Separator (ISOLDE) facility by counting beta-delayed neutrons. More precise T(1/2) and P(n) values of 300(15) ms and 27(4)\\%, and 273(7) ms and 50(8)\\% for (136,137)Sn, respectively, have also been measured. The sources were prepared by using the selective ionization of Sb or Sn with the Resonance Ionization Laser Ion Source and the high-resolution mass separator. The new data for Sb isotopes are compared with calculated T(1/2) and P(n) values for both spherical and nonspherical shapes. The data have been incorporated into parametrized nucleosynthesis calculations of the r process in high-entropy winds of core-collapse supernovae in order to study the properties of the A = 130 solar-system r-process abundance peak.

  8. A Study of the r-Process Path Nuclides,$^{137,138,139}$Sb using the Enhanced Selectivity of Resonance Ionization Laser Ionization

    CERN Multimedia

    Walters, W

    2002-01-01

    The particular features of the r-process abundances with 100 < A < 150 have demonstrated the close connection between knowledge of nuclear structure and decay along the r-process path and the astrophysical environement in which these elements are produced. Key to this connection has been the measurement of data for nuclides (mostly even-N nuclides) that lie in the actual r-process path. Such data are of direct use in r-process calculations and they also serve to refine and test the predictive power of nuclear models where little or no data now exist. In this experiment we seek to use the newly developed ionization scheme for the Resonance Ionization Laser Ion Source (RILIS) to achieve selective ionization of neutron-rich antimony isotopes in order to measure the decay properties of r-process path nuclides $^{137,138,139}$Sb. These properties include the half-lives, delayed neutron branches, and daughter $\\gamma$-rays. The new nuclear structure data for the daughter Te nuclides is also of considerable in...

  9. Application of an immune-magnetic cell sorting method for CD138-positive plasma cells in FISH analysis of multiple myeloma.

    Science.gov (United States)

    Shin, S Y; Jang, S; Park, C-J; Chi, H-S; Lee, J-H; Lee, J H; Lee, K H; Suh, C; Lim, S E; Seo, E-J

    2012-10-01

    Interphase fluorescence in situ hybridization (FISH) analysis of multiple myeloma (MM) may indiscriminately count signals of nonplasma cells, thus decreasing specificity and sensitivity. We aimed to evaluate the usefulness of an immune-magnetic sorting method for plasma cells in FISH analysis of MM and define optimal sample preparation conditions. Plasma cells were purified using EasySep(®) CD138 Positive Selection Cocktail and Magnetic Nanoparticles (Invitrogen). We compared FISH results with and without plasma cell purification for three sample preparation methods: direct harvest, 24-h culture, and 96-h culture with interleukin-4 in five newly diagnosed MM patients. Archived fixed bone marrow cells of 17 MM patients were also studied. The percentage of abnormal cells identified was significantly higher with plasma cell purification than without purification (median, 88.0%; range, 84.0-100.0%vs. 15.0%, 12.5-29.5%, respectively). The three sample preparation methods showed comparable results. Immune-magnetic sorting also significantly increased the percentage of abnormal cells identified in FISH analysis of archived fixed bone marrow cells (P cell sorting significantly increased the percentage of abnormal cells identified in FISH analysis of MM samples for all sample preparation methods. This method could also be applied for retrospective FISH analysis of archived fixed bone marrow cells. © 2012 Blackwell Publishing Ltd.

  10. Cigarette smoking, binge drinking, physical activity, and diet in 138 Asian American and Pacific Islander community college students in Brooklyn, New York.

    Science.gov (United States)

    Arliss, Rebecca M

    2007-02-01

    Assessment of cigarette smoking, alcohol consumption, physical activity, and diet in the Asian American and Pacific Islander (AAPI) community has been neglected. A questionnaire was used to investigate these health risk behaviors in 466 students at an urban community college and results for the 138 AAPI study participants were compared to the 328 non-Asians. Results for AAPI study participants showed that twenty percent (20.3%) were current cigarette smokers and 7.7% smoked eleven or more cigarettes per day. Ten percent (10.7%) reported binge drinking on one to two days per month and 17.3% reported binge drinking on three or more days per month. With regard to physical activity, 28.8% participated in stretching, 23.6% in strength and toning, 29.4% in moderate exercise, and 25.4% in vigorous exercise. Results indicated that on the day preceding the survey, only 11.9% consumed five or more servings of fruits and vegetables, 88.4% ate no more than two servings of high-fat foods, and 37.6% consumed tofu, soymilk, or other soy food. AAPI study participants were more likely to frequently binge drink (p < .05), less likely to participate in strength and toning exercises (p < .05), and more likely to consume soy foods daily (p < .01) than non-Asian study participants. Recommendations are presented for health promotion program planning.

  11. Determination of specific radioactivity of samarium-153 product. 1. Quantitative determination of samarium by spectrophotometry

    Energy Technology Data Exchange (ETDEWEB)

    Izumo, Mishiroku [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Nemoto, Masahiro [Tokyo Nuclear Service Co., Ltd., Tokyo (Japan)

    2002-03-01

    On the specific radioactivity of Sm-153 for the radiotherapy of cancers, a simple method for determination of the amount of Sm was described. The method used Arsenazo III as a colorimetric reagent. The sample irradiated in the reactor was dissolved in 1M HCl solution. A small part of it was taken and mixed with Arsenazo III at pH 3.2, and the amount of Sm was determined by the spectrophotometric method at a wavelength of 652 nm. The molar absorptivity of Sm at 652 nm was 6.6x10{sup 3} m{sup -1}{center_dot}mm{sup -1}. The error of measurement in the partial different conditions was about 2% of the value determined. The effects of impurities, Fe, Zn and Cu mixing in the Sm during operation, were clarified. (author)

  12. Cytotoxic CD8+ T cells and CD138+ plasma cells prevail in cerebrospinal fluid in non-paraneoplastic cerebellar ataxia with contactin-associated protein-2 antibodies

    Directory of Open Access Journals (Sweden)

    Melzer Nico

    2012-07-01

    Full Text Available Abstract Objective The purpose of this paper is to report a patient with otherwise unexplained cerebellar ataxia with serum antibodies against contactin-associated protein-2 (CASPR-2 and provide a detailed description of the composition of cellular infiltrates in the cerebrospinal fluid (CSF compared to the peripheral blood (PB. CASPR-2 antibodies strongly labeling axons of cerebellar granule neurons have recently been identified in sera from nine patients with otherwise unexplained progressive cerebellar ataxia with mild to severe cerebellar atrophy. Design This is a report of a single case. Methods The study methods used were neurologic examination, magnetic resonance imaging, fluorodeoxyglucose positron emisson tomography, lumbar puncture and multicolor flow-cytometry. Results A 23-year-old Caucasian male presented with a two-year history of a progressive cerebellar and brainstem syndrome. Magnetic resonance imaging (MRI showed pronounced cerebellar atrophy, especially of the medial parts of the hemispheres and the vermis. Cerebral fluorodeoxyglucose positron emission tomography (FDG-PET showed pronounced hypometabolism of the whole cerebellum. CASPR-2 antibodies were detected in the serum but not the CSF, and none of the staging and laboratory assessments revealed other causes of progressive cerebellar degeneration. Interestingly, flow-cytometry of the CSF as compared to the PB showed increased fractions of CD138+ plasma cells as well as human leukocyte antigen (HLA-DR+ CD8+ T cells suggesting that both B cells and CD8+ T cells were preferentially recruited to and activated within the CSF- (and putatively central nervous system (CNS- compartment. Conclusion We confirm the association of CASPR-2 serum antibodies with cerebellar ataxia and provide the first evidence for a combined humoral and cellular immune response in this novel antibody-associated inflammatory CNS disease.

  13. Electronic structure and magneto-optical Kerr spectra of an epitaxial Ni54.3Mn31.9Sn13.8 Heusler alloy film

    Science.gov (United States)

    Uba, L.; Bonda, A.; Uba, S.; Bekenov, L. V.; Antonov, V. N.

    2017-07-01

    In this joint experimental and ab initio study, we investigated the influence of chemical composition and martensitic phase transition on the electronic, magnetic, optical and magneto-optical properties of ferromagnetic shape-memory Ni-Mn-Sn alloys. Optical properties and polar magneto-optical Kerr effect (MOKE) spectra for Ni-Mn-Sn alloy film of composition Ni54.3Mn31.9Sn13.8 deposited epitaxially on MgO(0 0 1) substrate were measured over the photon energy range 0.8≤slant hν ≤slant 5.8 eV, and the complete set of optical conductivity tensor elements were determined. To explain the microscopic origin of the optical and magneto-optical spectra, extensive first-principles calculations were made, using the spin-polarized fully relativistic linear-muffin-tin-orbital method. The electronic, magnetic and magneto-optical properties of Ni-Mn-Sn Heusler alloys were investigated for the cubic austenitic and 4O orthorhombic martensitic phases, in stoichiometric and off-stoichiometric compositions. The MOKE properties of Ni-Mn-Sn systems are very sensitive to deviation from stoichiometry. It was shown that the ab initio calculations reproduce experimental spectra well, and help to explain the microscopic origin of Ni-Mn-Sn optical and magneto-optical responses. The interband transitions responsible for the prominent structures in the Ni-Mn-Sn MOKE spectra have been identified—they come from relatively narrow energy intervals at several well-defined vicinities of high-symmetry directions of the Brillouin zone. Significant modification of the MOKE spectra can be considered as a fingerprint of martensitic phase transition in Ni-Mn-Sn alloys.

  14. The interactions of 2,3,7,8-tetrachlorodibenzo-p-dioxin(TCDD) and 6-methyl-1,3,8-trichlorodibenzofuran (MCDF) in TCDD-induced porphyria

    Energy Technology Data Exchange (ETDEWEB)

    Yao, Cheng Catsby.

    1989-01-01

    Halogenated aryl hydrocarbon(HAH)-induced porphyria is caused by alteration of porphyrin metabolism and results in the accumulation of hepatic and urinary porphyrins. 2,3,7,8-Tetrachlorodibenzo-p-dioxin (75 {mu}/kg) caused significant increases of hepatic porphyrin levels in C57BL/6 male, female and ovariectomized female, and C57BL/10 male mice 3 weeks after treatment. In contrast, 6-methyl-1,3,8-trichlorodibenzofuran (MCDF) was inactive at a dose of 750 {mu}mol/kg. Cotreatment with MCDF (750 {mu}mol/kg) and 2,3,7,8-TCDD (75 {mu}g/kg) resulted in partial antagonism of 2,3,7,8-TCDD-induced porphyrin accumulation in female but not in male mice. In female C57BL/6 mice, 2,3,7,8-TCDD-induced porphyria was accompanied by the induction of hepatic microsomal aryl hydrocarbon hydroxylase (AHH) and ethoxyresorufin O-deethylase (EROD) activities and the inhibition of uroporphyrinogen decarboxylase (UROD) activity. MCDF (750 {mu}mol/kg) did not significantly affect these enzyme activities. In coadministration studies, MCDF partially antagonized 2,3,7,8-TCDD-induced hepatic porphyrin accumulation but did not affect the activities of hepatic AHH, EROD or UROD. These results demonstrate that the induction of the monooxygenase enzyme activities and the inhibition of UROD activity by 2,3,7,8-TCDD and the development of porphyria are not coordinately regulated in C57BL/6 female mice. In cultured chick embryo hepatocytes, 2,3,7,8-TCDD caused a significant increase in porphyrin levels and induced AHH and EROD activities. MCDF and Aroclor 1254 partially antagonized the 2,3,7,8-TCDD induced AHH and EROD activities but not the porphyrin accumulation.

  15. Low temperature ductile shear failure of Zr41.2Ti13.8Ni10Cu12.5Be22.5 and Cu50Zr35Ti8Hf5Ni2 bulk amorphous alloys

    NARCIS (Netherlands)

    Tabachnikova, E; Bengus, V.Z.; Miskuf, J; Csach, K; Johnson, W; Molokanov, VV; Ocelik, Vaclav; Eckert, J; Schlorb, H; Schultz, L

    2000-01-01

    Fractographic study of ductile shear failure under uniaxial compression of rod-like samples of the Zr41.2Ti13.8Ni10Cu12.5Be22.5 and Cu50Zr35Ti8Hf5Ni2 bulk amorphous alloys at temperatures of 300 and 77 K is presented. Although the mechanisms of shear deformation and fracture appeared the same as in

  16. MiR-9-5p, miR-675-5p and miR-138-5p Damages the Strontium and LRP5-Mediated Skeletal Cell Proliferation, Differentiation, and Adhesion.

    Science.gov (United States)

    Sun, Tianhao; Leung, Frankie; Lu, William W

    2016-02-15

    This study was designed to evaluate the effects of strontium on the expression levels of microRNAs (miRNAs) and to explore their effects on skeletal cell proliferation, differentiation, adhesion, and apoptosis. The targets of these miRNAs were also studied. Molecular cloning, cell proliferation assay, cell apoptosis assay, quantitative real-time PCR, and luciferase reporter assay were used. Strontium altered the expression levels of miRNAs in vitro and in vivo. miR-9-5p, miR-675-5p, and miR-138-5p impaired skeletal cell proliferation, cell differentiation and cell adhesion. miR-9-5p and miR-675-5p induced MC3T3-E1 cell apoptosis more specifically than miR-138-5p. miR-9-5p, miR-675-5p, and miR-138-5p targeted glycogen synthase kinase 3 β (GSK3β), ATPase Aminophospholipid Transporter Class I Type 8A Member 2 (ATP8A2), and Eukaryotic Translation Initiation Factor 4E Binding Protein 1 (EIF4EBP1), respectively. Low-density lipoprotein receptor-related protein 5 (LRP5) played a positive role in skeletal development. miR-9-5p, miR-675-5p, and miR-138-5p damage strontium and LRP5-mediated skeletal cell proliferation, differentiation, and adhesion, and induce cell apoptosis by targeting GSK3β, ATP8A2, and EIF4EBP1, respectively.

  17. miR-9-5p, miR-675-5p and miR-138-5p Damages the Strontium and LRP5-Mediated Skeletal Cell Proliferation, Differentiation, and Adhesion

    Directory of Open Access Journals (Sweden)

    Tianhao Sun

    2016-02-01

    Full Text Available This study was designed to evaluate the effects of strontium on the expression levels of microRNAs (miRNAs and to explore their effects on skeletal cell proliferation, differentiation, adhesion, and apoptosis. The targets of these miRNAs were also studied. Molecular cloning, cell proliferation assay, cell apoptosis assay, quantitative real-time PCR, and luciferase reporter assay were used. Strontium altered the expression levels of miRNAs in vitro and in vivo. miR-9-5p, miR-675-5p, and miR-138-5p impaired skeletal cell proliferation, cell differentiation and cell adhesion. miR-9-5p and miR-675-5p induced MC3T3-E1 cell apoptosis more specifically than miR-138-5p. miR-9-5p, miR-675-5p, and miR-138-5p targeted glycogen synthase kinase 3 β (GSK3β, ATPase Aminophospholipid Transporter Class I Type 8A Member 2 (ATP8A2, and Eukaryotic Translation Initiation Factor 4E Binding Protein 1 (EIF4EBP1, respectively. Low-density lipoprotein receptor-related protein 5 (LRP5 played a positive role in skeletal development. miR-9-5p, miR-675-5p, and miR-138-5p damage strontium and LRP5-mediated skeletal cell proliferation, differentiation, and adhesion, and induce cell apoptosis by targeting GSK3β, ATP8A2, and EIF4EBP1, respectively.

  18. Radiolesão vascular como efeito deletério da braquiterapia intra-arterial com dose elevada de Samário-153 em coelhos hipercolesterolêmicos Vascular radiolesion as a deleterious effect of high-dose-rate intraarterial brachytherapy with Samarium-153 in hypercholesterolemic rabbits

    Directory of Open Access Journals (Sweden)

    Dalton Bertolim Précoma

    2006-10-01

    Full Text Available OBJETIVO: Este estudo tem por objetivo avaliar as alterações vasculares morfológicas e morfométricas induzidas pela braquiterapia com Samário-153 (153 Sm em coelhos hipercolesterolêmicos, com doses elevadas. MÉTODOS: Foram analisados 43 coelhos hipercolesterolêmicos, brancos, da raça New Zealand, e o total de 86 artérias ilíacas submetidas a lesão por balão de angioplastia. Divididos em três grupos: dois (GI irradiados com as doses de 15Gy (n=14 e 60Gy (n=36 e um grupo controle (n=36. Foram realizadas avaliação histológica morfométrica e análise histológica qualitativa para análise tecidual. RESULTADOS: Foram observadas uma redução significativa da neoproliferação intimal (NPI no GI 15 Gy (pOBJECTIVE: This study was designed to evaluate vascular morphological and morphometric changes induced by brachytherapy with samarium-153 (Sm-153 at high doses in hypercholesterolemic rabbits. METHODS: Forty-three New Zealand White hypercholesterolemic rabbits were analyzed, and the total of 86 iliac arteries underwent balloon angioplasty injury. The rabbits were divided into three different groups: two irradiation groups (IG assigned to 15 Gy (n=14 and 60 Gy (n=36 irradiation doses, respectively, and a control group (n = 36. Histomorphometric and qualitative histological analyses were performed for tissue evaluation. RESULTS: Significant reductions were found in neointimal proliferation (NIP (p< 0.0001, media area (MA (p<0.0001 and percent stenosis (p<0.0001 in the 15-Gy IG, compared to the other groups. The 60-Gy IG had the higher rate of NIP, increase in media and vessel areas (VA and percent stenosis. The 60-Gy IG also showed the greatest number of xanthomatous cells (60-Gy IG: 86.11% and 15-Gy IG: 14.29%, p<0.0001 and the highest amount of hyaline amorphous tissue (60-Gy IG:58.33% and 15-Gy IG:0%, p=0.0001 and vascular proliferation (60-Gy IG:30.56% and 15-Gy IG:0%, p=0.0221. No statistically significant differences were found

  19. Metallic glass formation in highly undercooled Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 during containerless electrostatic levitation processing

    Science.gov (United States)

    Kim, Y. J.; Busch, R.; Johnson, W. L.; Rulison, A. J.; Rhim, W. K.

    1994-10-01

    Various sample sizes of Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 with masses up to 80 mg were undercooled below Tg (the glass transition temperature) while electrostatically levitated. The final solidification product of the sample was determined by x-ray diffraction to have an amorphous phase. Differential scanning calorimetry was used to confirm the absence of crystallinity in the processes sample. The amorphous phase could be formed only after heating the samples above the melting temperature for extended periods of time in order to break down and dissolve oxides or other contaminants which would otherwise initiate heterogeneous nucleation of crystals. Noncontact pyrometry was used to monitor the sample temperature throughout processing. The critical cooling rate required to avoid crystallization during solidification of the Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 alloy fell between 0.9 and 1.2 K/s.

  20. Establishment and antitumor effects of dasatinib and PKI-587 in BD-138T, a patient-derived muscle invasive bladder cancer preclinical platform with concomitant EGFR amplification and PTEN deletion.

    Science.gov (United States)

    Chang, Nakho; Lee, Hye Won; Lim, Joung Eun; Jeong, Da Eun; Song, Hye Jin; Kim, Sudong; Nam, Do-Hyun; Sung, Hyun Hwan; Jeong, Byong Chang; Seo, Seong Il; Jeon, Seong Soo; Lee, Hyun Moo; Choi, Han-Yong; Jeon, Hwang Gyun

    2016-08-09

    Muscle-invasive bladder cancer (MIBC) consists of a heterogeneous group of tumors with a high rate of metastasis and mortality. To facilitate the in-depth investigation and validation of tailored strategies for MIBC treatment, we have developed an integrated approach using advanced high-throughput drug screening and a clinically relevant patient-derived preclinical platform. We isolated patient-derived tumor cells (PDCs) from a rare MIBC case (BD-138T) that harbors concomitant epidermal growth factor receptor (EGFR) amplification and phosphatase and tensin homolog (PTEN) deletion. High-throughput in vitro drug screening demonstrated that dasatinib, a SRC inhibitor, and PKI-587, a dual PI3K/mTOR inhibitor, exhibited targeted anti-proliferative and pro-apoptotic effects against BD-138T PDCs. Using established patient-derived xenograft models that successfully retain the genomic and molecular characteristics of the parental tumor, we confirmed that these anti-tumor responses occurred through the inhibition of SRC and PI3K/AKT/mTOR signaling pathways. Taken together, these experimental results demonstrate that dasatinib and PKI-587 might serve as promising anticancer drug candidates for treating MIBC with combined EGFR gene amplification and PTEN deletion.

  1. Environmental Assessment for Central Power and Light Company`s proposed Military Highway-CFE tie 138/69-kV transmission line project Brownsville, Cameron County, Texas

    Energy Technology Data Exchange (ETDEWEB)

    1992-04-01

    Central Power and Light Company (CPL) intends to upgrade its existing transmission line ties with the Commision Federal de Electricidad (CFE) system in Mexico. CPL currently has a single 69-kilovolt (kV) transmission line in the Brownsville area which connects CPL`s system with the system of CFE. This existing line runs between the Brownsville Switching Station, located on Laredo Road in Brownsville, Cameron County, Texas, and an existing CFE 69-kV line at the Rusteberg Bend of the Rio Grande in Cameron County. Under current conditions of need, the existing 69-kV line does not possess sufficient capability to engage in appropriate power exchanges. Therefore, CPL is proposing to build a new line to link up with CFE. This proposed line would be a double-circuit line, which would (1) continue (on a slightly relocated route) the existing 69-kV tie from CPL`s Brownsville Switching Station to CFE`s facilities, and (2) add a 138-kV tie from the Military Highway Substation, located on Military Highway (US Highway 281), to CFE`s facilities. The proposed 138/69-kV line, which will be constructed and operated by CPL, will be built primarily on steel single-pole structures within an average 60-foot (ft) wide right-of-way (ROW). It will be approximately 6900--9200 ft (1.3--1.7 miles) in length, depending on the alternative route constructed.

  2. Cloning and characterization of a beta-1,4-mannanase 5C possessing a family 27 carbohydrate-binding module from a marine bacterium, Vibrio sp. strain MA-138.

    Science.gov (United States)

    Tanaka, Megumi; Umemoto, Yoshiaki; Okamura, Hidenori; Nakano, Daiichirou; Tamaru, Yutaka; Araki, Toshiyoshi

    2009-01-01

    The beta-1,4-mannanase 5C gene (man5C) of Vibrio sp. strain MA-138 was cloned and expressed in Escherichia coli. The man5C gene consisted of 2,010 bp nucleotides encoding a protein of 669 amino acids with a predicted molecular weight of 76,309. beta-1,4-Mannanase (Man5C) is a modular enzyme composed of a catalytic module belonging to glycoside hydrolase family 5, a linker region, and a putative carbohydrate-binding module (CBM) belonging to family 27. Recombinant Man5C exhibited maximal activity at 50 degrees C at pH 7.0, and it had a K(m) of 0.6 mg ml(-1) and a V(max) of 556.2 micromol min(-1) mumol(-1) for glucomannan. Binding studies revealed that the C-terminal putative CBM27 had the ability to bind soluble beta-mannans and contributed to increasing the rate of depolymerization by binding to the polymeric substrate. Man5C of Vibrio sp. MA-138 is the first non-extremophile enzyme to be identified as a beta-mannanase possessing CBM27.

  3. Experimental determination of a time-temperature-transformation diagram of the undercooled Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 alloy using the containerless electrostatic levitation processing technique

    Science.gov (United States)

    Kim, Y. J.; Busch, R.; Johnson, W. L.; Rulison, A. J.; Rhim, W. K.

    1996-02-01

    High temperature high vacuum electrostatic levitation was used to determine the complete time-temperature-transformation (TTT) diagram of the Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 bulk metallic glass forming alloy in the undercooled liquid state. This is the first report of experimental data on the crystallization kinetics of a metallic system covering the entire temperature range of the undercooled melt down to the glass transition temperature. The measured TTT diagram exhibits the expected ``C'' shape. Existing models that assume polymorphic crystallization cannot satisfactorily explain the experimentally obtained TTT diagram. This originates from the complex crystallization mechanisms that occur in this bulk glass-forming system, involving large composition fluctuations prior to crystallization as well as phase separation in the undercooled liquid state below 800 K.

  4. A new crystal form of human histidine triad nucleotide-binding protein 1 (hHINT1) in complex with adenosine 5′-monophosphate at 1.38 Å resolution

    Science.gov (United States)

    Dolot, Rafał; Ozga, Magdalena; Włodarczyk, Artur; Krakowiak, Agnieszka; Nawrot, Barbara

    2012-01-01

    Histidine triad nucleotide-binding protein 1 (HINT1) represents the most ancient and widespread branch of the histidine triad protein superfamily. HINT1 plays an important role in various biological processes and has been found in many species. Here, the structure of the human HINT1–adenosine 5′-monophosphate (AMP) complex at 1.38 Å resolution obtained from a new monoclinic crystal form is reported. The final structure has R cryst = 0.1207 (R free = 0.1615) and the model exhibits good stereochemical quality. Detailed analysis of the high-resolution data allowed the details of the protein structure to be updated in comparison to the previously published data. PMID:22869114

  5. A new crystal form of human histidine triad nucleotide-binding protein 1 (hHINT1) in complex with adenosine 5'-monophosphate at 1.38 Å resolution.

    Science.gov (United States)

    Dolot, Rafał; Ozga, Magdalena; Włodarczyk, Artur; Krakowiak, Agnieszka; Nawrot, Barbara

    2012-08-01

    Histidine triad nucleotide-binding protein 1 (HINT1) represents the most ancient and widespread branch of the histidine triad protein superfamily. HINT1 plays an important role in various biological processes and has been found in many species. Here, the structure of the human HINT1-adenosine 5'-monophosphate (AMP) complex at 1.38 Å resolution obtained from a new monoclinic crystal form is reported. The final structure has R(cryst) = 0.1207 (R(free) = 0.1615) and the model exhibits good stereochemical quality. Detailed analysis of the high-resolution data allowed the details of the protein structure to be updated in comparison to the previously published data.

  6. Altered levels of miR-21, miR-125b-2*, miR-138, miR-155, miR-184, and miR-205 in oral squamous cell carcinoma and association with clinicopathological characteristics.

    Science.gov (United States)

    Manikandan, Mayakannan; Deva Magendhra Rao, Arunagiri K; Rajkumar, Kottayasamy Seenivasagam; Rajaraman, Ramamurthy; Munirajan, Arasambattu K

    2015-11-01

    Previous studies have described the aberrantly expressed microRNAs (miRNAs) in oral squamous cell carcinoma (OSCC), and we reasoned that studying frequently deregulated candidate miRNAs in OSCC of Indian ethnicity could aid in better understanding of the genetic/environmental impact on the expression statuses of these miRNAs. Therefore, we evaluated the differential expression of six selected miRNAs namely hsa-miR-21, hsa-miR-125b2*, hsa-miR-138, hsa-miR-155, hsa-miR-184, and hsa-miR-205 in OSCC specimens of Indian ethnicity. Two-step Reverse transcriptase quantitative PCR using inventoried TaqMan single miRNA assays was employed to study the expression of the selected miRNAs in 42 OSCC tumors and eight adjacent normal specimens. The expression levels of the miRNAs were tested for any association with clinicopathological parameters. miR-21 was significantly elevated while miR-125b-2* was significantly downregulated in tumors compared to controls (P 184 were observed to be predominantly downregulated in the tumor samples. High levels of miR-155 were associated with the habit of chewing tobacco/betel quid. Our results corroborate the previous findings on the overexpression of mir-21 and downregulation of miR-138 in OSCC. As the expression of miR-184 is controversial in tongue/oral cancer, the downregulation may be specific to tumor anatomical localization. On the other hand, to the best of our knowledge, this is the first report to show the association of miR-155 with tobacco chewing and the downregulation of miR-125b-2* in OSCC. Computational predictions suggest that miR-125b-2* may have a role in alternative splicing. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  7. Citotoxic activity evaluation of essential oils and nanoemulsions of Drimys angustifolia and D. brasiliensis on human glioblastoma (U-138 MG and human bladder carcinoma (T24 cell lines in vitro

    Directory of Open Access Journals (Sweden)

    Madson R. F. Gomes

    2012-11-01

    Full Text Available The species Drimys angustifolia Miers and D. brasiliensis Miers, commonly known as "casca-de-anta", have in their leaves essential oils that can confer cytotoxic effects. In this study, we evaluated the citotoxic effects of the volatile oils from these two species. We also proposed a nanoemulsion formulation for each of the species and assessed the in vitro cytotoxicity on U-138 MG (human glioblastoma and T24 (human bladder carcinoma cell lines. The plant chemical composition was evaluated by gas chromatography coupled to mass spectrometer. Furthermore, the nanoemulsions were prepared and characterized. Our results showed that; bicyclogermacrene (19.6% and cyclocolorenone (18.2% were the most abundant for the D angustifolia oil and D brasiliensis oil, respectively. Both nanoemulsions, D angustifolia and D brasiliensis appeared macroscopically homogeneous and opalescent bluish liquids, with nanometric mean diameters of 168 nm for D brasiliensis and 181 nm for D angustifolia. The polydispersity indices were below 0.10, with an acid pH of 4.7-6.3, and negative zeta potentials about -34 mV. The results of transmission electron microscopy showed that droplets are present in the nanometer range. Only the D brasiliensis oil was efficient in reducing the cell viability of both U-138 MG (42.5%±7.0 and 67.8%±7.8 and T24 (33.2%±2.8, 60.3%±1.6 and 80.5%±8.8 cell lines, as assessed by MTT assay. Noteworthy, similar results were obtained with cell counting. Finally, D brasiliensis oil incubation caused an increase of annexin-V and propidium iodite population, according to evaluation by cytometry analysis, what is characteristic of late apoptosis. The results presented herein lead us to consider the potential therapeutic effects of the essential oils and nanoformulations as novel strategies to inhibit tumor growth.

  8. Citotoxic activity evaluation of essential oils and nanoemulsions of Drimys angustifolia and D. brasiliensis on human glioblastoma (U-138 MG and human bladder carcinoma (T24 cell lines in vitro

    Directory of Open Access Journals (Sweden)

    Madson R. F. Gomes

    2013-04-01

    Full Text Available The species Drimys angustifolia Miers and D. brasiliensis Miers, commonly known as "casca-de-anta", have in their leaves essential oils that can confer cytotoxic effects. In this study, we evaluated the citotoxic effects of the volatile oils from these two species. We also proposed a nanoemulsion formulation for each of the species and assessed the in vitro cytotoxicity on U-138 MG (human glioblastoma and T24 (human bladder carcinoma cell lines. The plant chemical composition was evaluated by gas chromatography coupled to mass spectrometer. Furthermore, the nanoemulsions were prepared and characterized. Our results showed that; bicyclogermacrene (19.6% and cyclocolorenone (18.2% were the most abundant for the D angustifolia oil and D brasiliensis oil, respectively. Both nanoemulsions, D angustifolia and D brasiliensis appeared macroscopically homogeneous and opalescent bluish liquids, with nanometric mean diameters of 168 nm for D brasiliensis and 181 nm for D angustifolia. The polydispersity indices were below 0.10, with an acid pH of 4.7-6.3, and negative zeta potentials about -34 mV. The results of transmission electron microscopy showed that droplets are present in the nanometer range. Only the D brasiliensis oil was efficient in reducing the cell viability of both U-138 MG (42.5%±7.0 and 67.8%±7.8 and T24 (33.2%±2.8, 60.3%±1.6 and 80.5%±8.8 cell lines, as assessed by MTT assay. Noteworthy, similar results were obtained with cell counting. Finally, D brasiliensis oil incubation caused an increase of annexin-V and propidium iodite population, according to evaluation by cytometry analysis, what is characteristic of late apoptosis. The results presented herein lead us to consider the potential therapeutic effects of the essential oils and nanoformulations as novel strategies to inhibit tumor growth.

  9. Optical characteristics of transparent samarium oxide thin films ...

    Indian Academy of Sciences (India)

    2016-10-07

    Oct 7, 2016 ... 1Department of Physics, Faculty of Science, Taif University, Taif 888, Saudi Arabia. 2Department of Physics, Faculty of Education, Ain Shams University, Roxy 11757, Cairo, Egypt. 3Materials Science Unit, Department of Chemistry, Faculty of Science, Tanta University, 31725 Tanta, Egypt. 4Department of ...

  10. Optical properties of lead–tellurite glasses doped with samarium ...

    Indian Academy of Sciences (India)

    The optical properties of a new family of Sm2O3–(40–)PbO–60TeO2 glasses are investigated. The optical absorption spectra were recorded at ... The refractive index, molar refraction and polarizability of oxide ions have been calculated by using Lorentz–Lorentz relations. The non-linear variations of the above optical ...

  11. Optical properties of lead–tellurite glasses doped with samarium ...

    Indian Academy of Sciences (India)

    Administrator

    Abstract. The optical properties of a new family of xSm2O3–(40–x)PbO–60TeO2 glasses are investigated. The optical absorption spectra were recorded at room temperature in the UV-visible region. From the absorption edge studies, the values of optical bandgap energies have been evaluated. The refractive index, molar ...

  12. Measurement of radiative lifetime in atomic samarium using ...

    Indian Academy of Sciences (India)

    2014-02-08

    Feb 8, 2014 ... In this paper, we report the investigations of lifetime measurement of odd-parity energy level 19009.52 cm. −1 .... introduced by an electronic delay generator between the two Q-switch pulses of Nd-YAG laser. The slope of the .... Our values of the lifetimes are free from the common systematic errors. Thus ...

  13. A novel samarium complex with interesting photoluminescence and ...

    African Journals Online (AJOL)

    The 4,4'-Hbipy moieties, isolated nitrates and [Sm(H2O)4(NO3)3] species are held together via hydrogen bonds and p…p interactions to form a 3-D supramolecular framework. Luminescent investigation reveals a strong emission in blue region. Optical absorption spectrum of 1 reveals the presence of an optical gap of 3.60 ...

  14. Lithium samarium polyphosphate, LiSm(PO34

    Directory of Open Access Journals (Sweden)

    Dan Zhao

    2010-02-01

    Full Text Available The mixed-metal rare-earth polyphosphate LiSm(PO34 consists of a three-dimensional framework in which zigzag [(PO3n]n− chains with a periodicity of four PO4 tetrahedra are connected through Li+ and Sm3+ ions (both with 2. symmetry.

  15. Sodium samarium tetrakis(polyphosphate, NaSm(PO34

    Directory of Open Access Journals (Sweden)

    Dan Zhao

    2010-07-01

    Full Text Available NaSm(PO34 has been prepared by solid state reactions. It belongs to type II of the structural family of MILnIII(PO34 compounds (MI = alkali metal and LnIII = rare earth metal and is composed of ∞(PO3n]n− polyphosphate chains with a repeating unit of four PO4 tetrahedra. The chains extend parallel to [100] and share O atoms with irregular SmO8 polyhedra, forming a three-dimensional framework which delimits tunnels occupied by Na+ cations in a distorted octahedral environment.

  16. Isotopic Ratios of Samarium by TIMS for Nuclear Forensic Application

    Energy Technology Data Exchange (ETDEWEB)

    Louis Jean, James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Inglis, Jeremy David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-08-08

    The isotopic ratio of Nd, Sm, and Gd can provide important information regarding fissile material (nuclear devices, reactors), neutron environment, and device yield. These studies require precise measurement of Sm isotope ratios, by either TIMS or MC-ICP-MS. There has been an increasing trend to measure smaller and smaller quantities of Sm bearing samples. In nuclear forensics 10-100 ng of Sm are needed for precise measurement. To measure sub-ng Sm samples using TIMS for nuclear forensic analysis.

  17. Synthesis of copper, silver, and samarium chalcogenides by mechanical alloying

    Energy Technology Data Exchange (ETDEWEB)

    Ohtani, T.; Maruyama, K.; Ohshima, K. [Okayama Univ. of Science (Japan). Lab. for Solid State Chemistry

    1997-03-01

    CuInX{sub 2} (X = S, Se, Te), Ag{sub 2}S, Ag{sub 2}Se, Ag{sub 3}Te{sub 2}, Ag{sub 1.9}Te, AgCuSe, Sm{sub 3}Se{sub 4}, Sm{sub 2}Se{sub 3}, and SmTe were synthesized by a mechanical alloying method, using a high-energy planetary ball mill. The compounds were obtained by milling mixtures of the elements with desired ratios in agate or Cu-Be vials for 60--180 min.

  18. Oriented growth of thin films of samarium oxide by MOCVD

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Thin films of Sm2O3 have been grown on Si(100) and fused quartz by low-pressure chemical va- pour deposition using an adducted β-diketonate precursor. The films on quartz are cubic, with no preferred orientation at lower growth temperatures (~ 550°C), while they grow with a strong (111) orientation as the.

  19. 150 KVA Samarium Cobalt VSCF Starter Generator Electrical System

    Science.gov (United States)

    1978-12-01

    considerable hand labor. Addition of a provision for suitable electrical connection by the SCR manufacturer wou;d be desirable for production runs. Predicted...licen- sing the holder or any other person or corporation, or conveying any rights or permission to manufacture , use, or sell any patented invent,’n...tesile strength to contain the magnets and pole pieces up through the overspeed rating of the rotor. The cho.;en process uses maraging steel as the

  20. Optical properties of samarium doped zinc–tellurite glasses

    Indian Academy of Sciences (India)

    Glasses with the composition, (Sm2O3)(ZnO)(40–)(TeO2)(60), were prepared by conventional melt quenching method. The density, molar volume, and optical energy band gap of these glasses have been measured. The refractive index, molar refraction and polarizability of oxide ion have been calculated by using ...

  1. Publications | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    December 2011 and February, 2013) (restricted access). Knowledge management is about identifying critical knowledge areas that makes a ''big difference or big change in target groups/trainees through ''…capturing and synthesizing new ...

  2. 33 CFR 138.20 - Definitions.

    Science.gov (United States)

    2010-07-01

    ....20 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE..., damages, environment, hazardous substance, liable, liability, navigable waters, natural resources..., facilities, or any combination thereof, resulting in the discharge or substantial threat of discharge of oil...

  3. 19__138 - 147_Hamidu_Groundwater

    African Journals Online (AJOL)

    pc

    2-Department of Geology, Faculty of Earth a. Correspondence author: ABSTRACT. The Sedimentary (Chad formation) and Ba investigated for groundwater suitability for using aquifer properties derived from pump method for single well tests. The mean valu capacity recorded for the area are 4.06×10. Boreholes yield ranges ...

  4. Reference: 138 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ishi et al. 2004 Dec. Proc. Natl. Acad. Sci. U.S.A. 101(49):17306-11. Protein phosphorylation/dephosphorylation are... major signaling events induced by osmotic stress in higher plants. Here, we showed that a SNF1-relat...ed protein kinase 2 (SnRK2), SRK2C, is an osmotic-stress-activated protein kinase...ants of SRK2C exhibited drought hypersensitivity in their roots, suggesting that SRK2C is a positive regulat...h CaMV35S promoter::SRK2C-GFP displayed higher overall drought tolerance than control plants. Whereas stomatal re

  5. 22 CFR 138.105 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... the Federal Acquisition Regulation (FAR), and any other acquisition contract for real or personal... tribes in that Act. (h) Influencing or attempting to influence means making, with the intent to influence...

  6. Publications | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Econometric analysis reveals that education level, age and gender of the household head, family size, land holding size, and access to information influence ... The network meeting in London was an opportunity for project leaders to explore shared research issues in understanding emerging impacts of open data.

  7. Hemispherical total emissivity and specific heat capacity of deeply undercooled Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 melts

    Science.gov (United States)

    Busch, R.; Kim, Y. J.; Johnson, W. L.; Rulison, A. J.; Rhim, W. K.; Isheim, D.

    1995-06-01

    High-temperature high-vacuum electrostatic levitation (HTHVESL) and differential scanning calorimetry (DSC) were combined to determine the hemispherical total emissivity ɛT, and the specific heat capacity cp, of the undercooled liquid and throughout the glass transition of the Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 bulk metallic glass forming alloy. The ratio of cp/ɛT as a function of undercooling was determining from radiative cooling curves measured in the HTHVESL. Using specific heat capacity data obtained by DSC investigations close to the glass transition and above the melting point, ɛT and cp were separated and the specific heat capacity of the whole undercooled liquid region was determined. Furthermore, the hemispherical total emissivity of the liquid was found to be about 0.22 at 980 K. On undercooling the liquid, the emissivity decreases to approximately 0.18 at about 670 K, where the undercooled liquid starts to freeze to a glass. No significant changes of the emissivity are observed as the alloy undergoes the glass transition.

  8. Atomic structure of Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10}Be{sub 22.5} bulk metallic glass alloy

    Energy Technology Data Exchange (ETDEWEB)

    Hui, X. [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China)], E-mail: huixd01@hotmail.com; Fang, H.Z.; Chen, G.L. [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China); Shang, S.L.; Wang, Y. [Department of Materials Science and Engineering, Pennsylvania State University, University Park, PA 16802 (United States); Qin, J.Y. [Key Laboratory of Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University - Southern Campus, Jinan 250061 (China); Liu, Z.K. [Department of Materials Science and Engineering, Pennsylvania State University, University Park, PA 16802 (United States)

    2009-01-15

    Ab initio molecular dynamics (AIMD) calculations were performed on the atomic configuration of Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10}Be{sub 22.5} bulk metallic glass. The local structures were characterized in terms of structure factors (SF), pair correlation functions (PCF), coordinate numbers, bond pairs and Voronoi polyhedra. The glass transition temperature, generalized PCF and SF predicated by AIMD are in good agreement with the experimental data. Icosahedral short-range orders (ISRO) are found to be the most dominant, in view of the presence of the majority of bond pairs with 1551, 1541 and 1431, and Voronoi polyhedra with <0,3,6,1>, <0,2,8,1>, <0,0,12,0> and <0,2,8,4>. Icosahedral medium range orders (IMROs) are formed from icosahedra via the linkage of vertex-, edge-, face- and intercross-shared atoms. The glass structure on the nanometer scale is accumulated by polyhedra through an efficient packing mode. It is suggested that the extraordinary glass-forming ability of this alloy is essentially attributable to the formation of ISRO and IMRO, and the dense packing of atoms.

  9. Current data on the background burden to the persistent organochlorine pollutants HCB, p,p'-DDE as well as PCB 138, PCB 153 and PCB 180 in plasma of the general population in Germany.

    Science.gov (United States)

    Schettgen, Thomas; Alt, Anne; Esser, Andre; Kraus, Thomas

    2015-06-01

    Despite their long-term ban, persistent organochlorine compounds like hexachlorobenzene (HCB), p,p'-dichlorodiphenylethylene (DDE) as well as polychlorinated biphenyls (PCBs) are still of environmental concern. For the evaluation of potential occupational or environmental exposures to these substances, it is essential to know the current background burden of the general population. As representative and up-to-date information is missing for Germany, we have analysed a large dataset generated in studies on potential exposure to lower chlorinated PCBs to fill this gap for the levels of HCB, DDE as well as PCB 138, PCB 153 and PCB 180. We have investigated n=2750 plasma samples of persons of the general population living in North Rhine-Westfalia and Hesse aged 6-65 years and sampled between September 2010 and March 2014. For evaluation of the age-dependent accumulation in the general population we have generated seven age groups in the collective. Our laboratory used a validated and quality controlled procedure using GC/MS for quantification of the organochlorine compounds in plasma (LOQ: 0.01μg/L). The median (95th percentile) levels for ∑ PCB 138+PCB 153+PCB 180 were 0.14 (0.73); 0.30 (0.82); 0.38 (0.88); 0.50 (1.14); 0.92; 1.58 (3.54) and 2.41 (4.82)μg/L plasma in the age groups 6-10 years (n=102), 11-17 years (n=499), 18-25 years (n=157), 26-35 years (n=710), 36-45 years (n=400), 46-55 years (n=525) and 56-65 years (n=357), respectively. Similarly, the median (95th percentile) levels of p,p'-DDE were 0.18 (1.24); 0.18 (0.74); 0.24 (0.85); 0.30 (1.20); 0.45 (1.74); 0.64 (3.25) and 0.94 (4.7)μg/L plasma. Finally, the median (95th percentile) of HCB in plasma in these age groups was 0.05 (0.10); 0.06 (0.11); 0.08 (0.15); 0.08 (0.15); 0.11 (0.22); 0.14 (0.42) and 0.20 (0.68)μg/L plasma. Our results prove an overall substantial reduction in the body burden to organochlorine compounds in Germany compared to earlier studies. However, 15% and 3.6% of the examined

  10. 49 CFR 571.138 - Standard No. 138; Tire pressure monitoring systems.

    Science.gov (United States)

    2010-10-01

    ... mph). For vehicles equipped with cruise control, cruise control is not to be engaged during testing... of control or response signals in the vehicle's tire pressure monitoring system. The vehicle's TPMS...

  11. The Fragmentation of Heavy Nuclei by 13.8 GeV/c Protons as a Contribution to the Study of the Interaction Mechanism and Nuclear Structure; Fragmentacion de nucleos pesados por protones de 13'8 GeV/c, como contribucion al estudio del mecanismo de interaccion y estructura nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Gil Perez, D.

    1967-07-01

    We present here an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs.

  12. Contribution to the study of samarium-151 excited levels; Contribution a l'etude des niveaux excites du samarium-151

    Energy Technology Data Exchange (ETDEWEB)

    Locard, P. [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Grenoble, 38 (France)

    1967-07-01

    The nucleus of {sup 151}Sm, which has 89 neutrons, happens to be on the lower edge of the deformed nuclei of region II. Therefore, the study of its levels is very interesting for the verification of the goodness of the collective models for deformed nuclei when the deformation is small (we introduce these models in the first chapter). {sup 151}Sm has often been studied, but the direct gamma spectrum measured with a lithium drift-germanium detector (chapter 3) shows many high energy transitions which did not appear in the previous level schemes. In order to settle these transitions, we have undertaken gamma-gamma coincidence spectra (as well as sum-coincidence spectra) experiments with a scintillation spectrometer designed in our laboratory (chapter 2). The investigation of the intensities of these coincidences leads us to modify the last proposed level schemes: we suppress the levels at 405,5 and 650 keV, we add levels at 245,6 - 306,6 - 522 - 952 and 962 keV. We have also verified the multipolarities of the main transitions and measured the half-lives of a few levels (chapter 3) (we find a half-life of 1.1 {+-} 0.5 nanosecond for the level at 167,7 keV). In chapter 4, we compare our results to the predictions of the models described in chapter 1. (author) [French] Le noyau de {sup 151}Sm, qui possede 89 neutrons, se trouve a la limite inferieure des noyaux deformes de la region II. L'etude de ses niveaux excites est donc d'un interet tout particulier pour la verification de la validite des differents modeles collectifs pour les noyaux deformes, lorsque la deformation est petite (nous introduisons ces modeles dans un premier chapitre). Le {sup 151}Sm a deja fait l'objet de nombreuses etudes, mais le spectre gamma direct fait avec une jonction de germanium compense au lithium (chapitre 3), nous a montre l'existence d'un grand nombre de transitions de hautes energies qui ne sont pas placees dans les schemas proposes jusqu'a ce jour. Pour preciser la place de ces transitions, nous avons donc entrepris des experiences de coincidences gamma-gamma (et de ''spectre de somme'') a l'aide d'un ensemble de spectrometrie a scintillation realise au laboratoire (chapitre 2). L'etude des intensites de ces coincidences (chapitre 3) nous amene a modifier le dernier schema propose: nous supprimons les niveaux a 405,5 et 650 keV, nous ajoutons des niveaux a 245,6 - 306,6 - 522 - 952 et 962 keV. Nous avons egalement verifie la multipolarite des principales transitions et mesure la duree de vie de certains des niveaux (chapitre 3) (nous trouvons une periode de 1,1 {+-} 0,5) nanoseconde pour le niveau a 167,7 keV). Le chapitre 4 est enfin consacre a la comparaison de nos resultats avec les predictions des differents modeles decrits au chapitre 1. (auteur)

  13. Resistance of HIV-1 reverse transcriptase against [2',5'-bis-O-(tert-butyldimethylsilyl)-3'-spiro-5''-(4''-amino-1'',2''- oxathiole-2'',2''-dioxide)] (TSAO) derivatives is determined by the mutation Glu138-->Lys on the p51 subunit.

    Science.gov (United States)

    Jonckheere, H; Taymans, J M; Balzarini, J; Velázquez, S; Camarasa, M J; Desmyter, J; De Clercq, E; Anné, J

    1994-10-14

    Determination of the three-dimensional structure of the human immunodeficiency virus type-1 (HIV-1) reverse transcriptase (RT) has indicated a totally different folding for the 51-kDa subunit (p51) than for the 66-kDa subunit (p66). The polymerase catalytic site is located on the p66 subunit. Moreover, the HIV-1-specific RT inhibitors, also designated as the non-nucleoside RT inhibitors (NNRTIs), select for amino acid mutations that afford resistance to these compounds and are clustered in the palm domain of the HIV-1 RT p66 subunit. This pocket is located in the vicinity of, but clearly distinct from, the polymerase active site. However, for the NNRTIs that belong to the class of the [2',5'-bis-O-(tert-butyldimethylsilyl)-3'-spiro-5''-(4''-amino-1'',2''- oxathiole- 2'',2''-dioxide)] (TSAO) derivatives, the resistance mutation is located at position Glu138. On the p66 subunit, this amino acid is distant from the binding site of the HIV-1-specific RT inhibitors. When the TSAO-specific resistance mutation Glu138-->Lys was introduced solely in the p51 subunit of the RT p66/p51 heterodimer, the enzyme proved completely resistant to TSAO-m3T but retained full sensitivity to TIBO R82150 and ddGTP. On the other hand, when the mutation was introduced only in the p66 subunit the enzyme remained equally sensitive to the inhibitory effects of TSAO-m3T, TIBO R82150, and ddGTP. Our data provide compelling evidence for a structural and functional role of the p51 subunit in the sensitivity and/or resistance of the enzyme to the NNRTIs.

  14. Dicty_cDB: VSK138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sq27g07.y1 Gm-c1046 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1046-2101 5' similar to WP:D1005...sad75f02.y1 Gm-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-6028 5' similar to TR:Q9XFY7...sc93f08.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-928 5' similar to WP:D1005.1...sm51c09.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1028-7433 5' similar to SW:ACLY_RAT...sk39d02.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1028-4540 5' similar to WP:D1005

  15. 1/38 GEBEURLIKHEDE EN DIE BEWYSLAS IN DIE DELIKTUELE ...

    African Journals Online (AJOL)

    tduplessis

    Gebeurlikhede1 in die deliktuele skadevergoedingsreg2 kan omskryf word as onsekere3 omstandighede4 van positiewe of negatiewe aard wat, onafhanklik van die verweerder se optrede5 en indien dit sou realiseer,6 waarskynlik7 'n persoon se gesondheid, inkomste, verdienvermoë, lewenskwaliteit, lewens- verwagting ...

  16. 29 CFR 452.138 - Application of other laws.

    Science.gov (United States)

    2010-07-01

    ..., 1959. H. Rept. No. 741, p. 17; S. Rept. No. 187, pp. 21-22, 101, 104. Hearings, House Comm. on Education and Labor, 86th Cong., 1st sess., pt. 1, p. 1611. See also Furniture Store Drivers Local 82 v...

  17. Publications | Page 138 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  18. What we do | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Breaking barriers to Internet access. Internet search engines are the most efficient method of acquiring information. This poses three problems in China: 1.3 billion people cannot read English; 16 million are visually impaired and cannot use traditional search engines; and only 163 million Chinese use the Internet, although ...

  19. Dicty_cDB: AFA138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CWPTGKINYFFYLHYIQFNFINFLMAKLKIIIYIVIIFCSSIQFSFGYEKAIASFYPPPG DLHPTTHNFWACNSVINQNGGFGPLECNNAGIYAIFSTANEIIDGNEYMLPLFYIG---...CWPTGKINYFFYLHYIQFNFINFLMAKLKIIIYIVIIFCSSIQFSFGYEKAIASFYPPPG DLHPTTHNFWACNSVINQNGGFGPLECNNAGIYAIFSTANEIIDGNEYMLPLFYIG---

  20. Computed tomographic features of lymphangioleiomyomatosis: Evaluation in 138 patients

    Energy Technology Data Exchange (ETDEWEB)

    Tobino, Kazunori, E-mail: tobino@juntendo.ac.jp [Department of Respiratory Medicine, Iizuka Hospital, 3-83 Yoshiomachi, Iizuka, Fukuoka 820-0018 (Japan); Division of Respiratory Medicine, Juntendo University Faculty of Medicine & Graduate School of Medicine, 2-1-1 Hongo, Bunkyo-Ku, Tokyo 113-8421 (Japan); The Study Group of Pneumothorax and Cystic Lung Diseases, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan); Johkoh, Takeshi [Department of Radiology, Kinki Central Hospital of Mutual Aid Association of Public School Teachers, Kurumazuka 3-1, Itami, Hyogo 664-0872 (Japan); Fujimoto, Kiminori [Department of Radiology, Kurume University School of Medicine and Center for Diagnostic Imaging, Kurume University Hospital, 67 Asahi-machi, Kurume, Fukuoka 830-0011 (Japan); Sakai, Fumikazu [Department of Diagnostic Radiology, Saitama International Medical Center, Saitama Medical University, 1397-1 Yamane, Hidaka, Saitama 350-1298 (Japan); Arakawa, Hiroaki [Department of Radiology, Dokkyo Medical University, 880 Kita-Kobayashi, Mibu, Tochigi 321-0293 (Japan); Kurihara, Masatoshi [The Study Group of Pneumothorax and Cystic Lung Diseases, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan); Pneumothorax Center, Nissan Tamagawa Hospital, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan); Kumasaka, Toshio [The Study Group of Pneumothorax and Cystic Lung Diseases, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan); Department of Pathology, Japanese Red Cross Medical Center, 4-1-22 Hiroo, Shibuya-Ku, Tokyo 150-0012 (Japan); Koike, Kengo; Takahashi, Kazuhisa [Division of Respiratory Medicine, Juntendo University Faculty of Medicine & Graduate School of Medicine, 2-1-1 Hongo, Bunkyo-Ku, Tokyo 113-8421 (Japan); Seyama, Kuniaki [Division of Respiratory Medicine, Juntendo University Faculty of Medicine & Graduate School of Medicine, 2-1-1 Hongo, Bunkyo-Ku, Tokyo 113-8421 (Japan); The Study Group of Pneumothorax and Cystic Lung Diseases, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan)

    2015-03-15

    Highlights: •In our series, the frequency of pulmonary nodules was higher than in the previous reports. •Our sporadic LAM patients had a lower frequency of renal AML than in that of previous reports. •LAM patients may have a high incidence of renal and hepatic cysts. •LAM cells may originate in the pelvis then spread via the axial lymphatic system. -- Abstract: Purpose: The aim was to characterize the computed tomographic (CT) findings from Japanese patients with lymphangioleiomyomatosis (LAM). Materials and methods: CT scans of the chest, abdomen, and pelvis from 124 patients with sporadic LAM (S-LAM, mean age, 37.4 years) and 14 patients with tuberous sclerosis complex (TSC)-LAM (mean age, 35.6 years) were analyzed. Results: Pulmonary nodules (18.8%) and hepatic angiomyolipoma (AML, 24.3%) were more common in our patients than those in previous reports. Compared with TSC-LAM, S-LAM group had a higher frequency of pulmonary nodules (28.6% vs 32.3%, P < 0.01) and lower frequencies of air-space consolidation (21.4% vs 2.4%, P < 0.01), pneumothorax (28.6% vs 8.1%, P = 0.02), pulmonary hilar lymphadenopathy (14.3% vs 0.8%, P < 0.01), renal AML (85.7% vs 17.4%, P < 0.01), hepatic AML (71.4% vs 17.4%, P < 0.01), and retrocrural lymphadenopathy (14.3% vs 1.4%, P = 0.04). Axial lymphatic abnormalities (i.e., thoracic duct dilatation, lymphadenopathy, and lymphangioleiomyoma) were most common in the pelvis and tended to decrease in incidence with increased distance from the pelvis. Conclusion: The incidence of some CT findings in Japanese patients differed from those in previous reports. Axial lymphatic abnormalities noted here suggest that the origin of LAM cells may be the pelvis.

  1. 138 PUSHING THE FRONTIERS OF EQUITY AS A MEANS FOR ...

    African Journals Online (AJOL)

    Fr. Ikenga

    For the first time we must be concerned as members of the human species with the condition of the natural and cultural heritage of our planet that we pass to future generations and with our own ability to enjoy the legacy from past generations…1. The concept of development aims at enlarging the opportunities people have ...

  2. What we do | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... waste produced by the mining industry. Failing to do so magnifies the problem. Morocco is not the only country that is facing this challenge. Unfortunately, the lack of adapted technologies and resources to reclaim land, in semi-arid countries, has been a major reason for inaction. Morocco, Canada, France. PROJECT ...

  3. Reverted austenite in PH 13-8 Mo maraging steels

    Energy Technology Data Exchange (ETDEWEB)

    Schnitzer, Ronald, E-mail: ronald.schnitzer@unileoben.ac.at [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Radis, Rene [Christian Doppler Laboratory for Early Stages of Precipitation, Vienna University of Technology, Favoritenstrasse 9-11, A-1040 Vienna (Austria); Institute for Materials Science and Welding, Graz University of Technology, Kopernikusgasse 24, A-8010 Graz (Austria); Noehrer, Matthias [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Schober, Michael [Department of Physical Metallurgy and Materials Testing, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Hochfellner, Rainer [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Zinner, Silvia [Boehler Edelstahl GmbH and Co KG, Mariazeller Strasse 25, A-8605 Kapfenberg (Austria); Povoden-Karadeniz, E.; Kozeschnik, Ernst [Christian Doppler Laboratory for Early Stages of Precipitation, Vienna University of Technology, Favoritenstrasse 9-11, A-1040 Vienna (Austria); Leitner, Harald [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Department of Physical Metallurgy and Materials Testing, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria)

    2010-07-01

    The mechanical properties of maraging steels are strongly influenced by the presence of reverted austenite. In this study, the morphology and chemical composition of reverted austenite in a corrosion resistant maraging steel was characterized using transmission electron microscopy (TEM) and atom probe tomography (APT). Two types of austenite, i.e. granular and elongated, are present after aging at 575 {sup o}C, whereby the content of the latter increases during aging. The investigations revealed that the austenite phase is enriched in Ni, which prevents the transformation to martensite during cooling. Inside and next to the austenitc areas, Mo and Cr-rich carbides, which form during the aging treatment, were found. Various aging treatments were performed to obtain the activation energy for the formation of reverted austenite. Additionally, the experimental data are compared with thermodynamic and kinetic simulations. Based on these results and the chemical composition changes of the phases, a model for the formation of reverted austenite is presented. It is concluded that precipitation of B2-ordered NiAl and formation of reverted austenite take place simultaneously during aging and that dissolution of precipitates is not essential for the initial formation of reverted austenite.

  4. GPCR sequence information: 001_005_138 [GRIPDB[Archive

    Lifescience Database Archive (English)

    Full Text Available MENITNISEFILMGFPTAPWLQILLFSIFFITYVFVLLENLVIILTVWVTGSLHKPMYYF LSTMSFLEAWYISVTVPKMLAGFLFRPNTISFLGCMTQLYFFMSLACTECVLLAAMAYDR...LNHFFCDVS PILKLACMNLSMAETVDFALAIVILIFPLSATVLSYGFIVSTVLQIPSATGQRKAFSTCA SHLTVVVIFYTAVIFMYVRPRAIASFNSN

  5. 32 CFR 719.138 - Fees of civilian witnesses.

    Science.gov (United States)

    2010-07-01

    ... board to redress injuries to property, or (5) Military or civil officer before whom a deposition is taken. The public voucher must be accompanied by a subpoena or invitational orders (Joint Travel... authorized by Joint Travel Regulations. (j) Supplemental construction of section. Nothing in this paragraph...

  6. Dicty_cDB: VHA138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ert in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.17 1 CR034434 |CR034434....1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...4 CR103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engine...ering clone MHPP142o16. 50 0.17 1 CR044130 |CR044130.1 Forward strand read from ins

  7. Dicty_cDB: SHC138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CR044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering... Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 5...neering clone MHPP142o16. 50 0.13 1 CR034434 |CR034434.1... clone MHPP186g09. 50 0.13 1 CR103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engi

  8. South of Sahara | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    South of Sahara. Sud du Sahara. Read more about Savoir émergent - suivi de la progression vers la société de l'information. Language French. Read more about Monitoring Progress Toward the Information Society : Digital Divide Index. Language English. Read more about Lake Naivasha Sustainability : Ecosystem ...

  9. 7 CFR 457.138 - Grape crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... have a share; (b) That are grown for wine, juice, raisins, or canning (if such grapes are put to... multiplying the number of tons of raisin production by 4.5. (ii) Grapes grown for wine, juice, raisins or... paid by usual marketing outlets for the area during the week in which the damaged grapes were valued...

  10. Dicty_cDB: CHC138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SIKDEKVAAKISDSDKSTIESETESVLKWLESNQTAEKDEYEDKMKALEAVVNPIMSKLY QEGGMPQGGGMPGGMSNDSPKSSNNKVDELD*rnfseenisik*is*kiis**nq*slli...SIKDEKVAAKISDSDKSTIESETESVLKWLESNQTAEKDEYEDKMKALEAVVNPIMSKLY QEGGMPQGGGMPGGMSNDSPKSSNNKVDELD*rnfseenisik*is*kiis**nq*slli

  11. Quadrupole collectivity in {sup 138,140,142}Xe

    Energy Technology Data Exchange (ETDEWEB)

    Henrich, Corinna; Kroell, Thorsten; Ilieva, Stoyanka [Institut fuer Kernphysik, TU Darmstadt (Germany); Collaboration: IS411 and EXILL-FATIMA-Collaboration

    2016-07-01

    The region around the doubly magic nucleus {sup 132}Sn is of special interest as both single-particle and mean-field approaches can be applied by theory. In order to gain further understanding on the nuclear structure in this region, a 'safe' Coulomb excitation experiment was carried out at REX-ISOLDE (CERN, Geneva) using the MINIBALL spectrometer (IS411 campaign). As only a small center-of-mass range on the particle detector was accessible, the sensitivity on the quadrupole moments of the first 2{sup +} and 4{sup +} state using just that data is relatively small. Therefore, additional information provided by the direct lifetime measurement at ILL (Grenoble, France) using the EXILL and FATIMA spectrometer was crucial for the analysis. The final results of the analysis along with a comparison to predictions of several theoretical models are presented.

  12. All projects related to | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-03-07

    Technology can be a crucial catalyst for improving people's lives in the developing world. End Date: March 7, 2017. Topic: INFORMATION TECHNOLOGY, RESEARCH CAPACITY, RESEARCH METHODS, METHODOLOGY, SOUTH ASIA, Evaluation. Region: North of Sahara, South of Sahara, Central Asia, Far East Asia, ...

  13. Dicty_cDB: VFJ138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ksrsmwwllvilnhwfn*rcslyciwnkkrfsfii*tkldrlfkiir *qwl--- ---nxiliiir*sxxxxirqsxixiiir*nxixcfinlwfsirxpir*pirpiprxxirs nlcxwssisxrf...wxwxrfrfrxrfrxrxclgxiwxxldr*kxmgxfmgxgwlxfyeqxxk xxxwxrnxgffpxcxxklkfyf*l Homology vs C

  14. Dicty_cDB: SSI138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YRGNIIQMFKQIVREEGWRGL YRGMGVNLLRVTPSCVITFTSYEYIKKFLSQNQNHF***yvgeldvmrwsamqcpksknn tkikkkkkrkkkk Translated ...KNKNKELGI VEIMIASSVSKIIASVVAYPHEVLRARSQDSSPDSPNRTYRGNIIQMFKQIVREEGWRGL YRGMGVNLLRVTPSCVITFTSYEYIKKFLSQNQNHF***yvgeldvmrwsamqcp

  15. Dicty_cDB: VHL138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AK150126_1( AK150126 |pid:none) Mus musculus bone marrow macrophag... 99 4e-20 BC066817_1( BC066817 |pid:none)...AK150101_1( AK150101 |pid:none) Mus musculus bone marrow macrophag... 97 2e-19 AK168195_1( AK168195 |pid:none)

  16. Dicty_cDB: AFK138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available diagnosing malaria and immune antigen for suppressing growth of plasmodium. 76 3...e-58 9 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  17. The "Cairo hoard" (1895) = CH VII A138

    DEFF Research Database (Denmark)

    Christiansen, Erik

    2010-01-01

    Based on his own handwritten list - partly also present coins in the Ashmolean - this is the first full publication of the hoard (actually two hoards mixed together) of 822 Alexandrian tetradrachms which Milne bought in Cairo in 1895.......Based on his own handwritten list - partly also present coins in the Ashmolean - this is the first full publication of the hoard (actually two hoards mixed together) of 822 Alexandrian tetradrachms which Milne bought in Cairo in 1895....

  18. 33 CFR 138.80 - Financial responsibility, how established.

    Science.gov (United States)

    2010-07-01

    ... must submit annual, current, and audited non-consolidated financial statements prepared in accordance... certificant, apart from any other affiliated entity, and identify the consolidated financial statement to...-insurance. By filing with the Director, NPFC, the financial statements specified in paragraph (b)(3)(i) of...

  19. What we do | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Brazil's coastal areas are threatened by organic and inorganic pollution stemming from population growth and industrialization. More specifically, pollution is suspected of jeopardizing the health of aquatic species in natural and commercial settings. When pollution affects the reproduction of species, the local economy is ...

  20. Dicty_cDB: VSF138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d_seedlings Descurainia sophia cDNA clone Ds01_15g02, mRNA sequence. 44 0.006 3 dna update 2003. 8.23 Homolo...genase mRNA, partial cds. 46 0.003 2 BU238367 |BU238367.1 Ds01_15g02_A Ds01_AAFC_ECORC_cold_stressed_Flixwee

  1. Dicty_cDB: VSD138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ti*tas*rairskwlsss*stlrl*w*k*w*sffqrr*yhynfrsk*srwlvariftnr* trflpi*frttivrklrypnnmlmvftniqilii*id*kk*NKIKCHNKLFPFVFLKKK-...ti*tas*rairskwlsss*stlrl*w*k*w*sffqrr*yhynfrsk*srwlvariftnr* trflpi*frttivrklrypnnmlmvftniqilii*id*kk*NKIKCHNKLFPFVFLKKK-...---ti*tas*rairskwlsss*stlrl*w*k*w*sffqrr*yhynfrsk*srwlvarift nr*trflpi*frttivrklrypnnmlmvftniqilii*xikknkik*nvtinyfh

  2. (abstract) Undercooling Studies of the Bulk Metallic Glass Forming Zr(sub 41.2)Ti(sub 13.8)Cu(sub 12.5)Ni(sub 10.0)Be(sub 22.5) Alloy During Containerless Electrostatic Levitation Processing

    Science.gov (United States)

    Kim, Y. J.; Busch, R.; Johnson, W. L.; Rulison, A. J.; Rhim, W. K.

    1995-01-01

    Bulk glass forming metallic alloys have long been desired for technological applications and for investigation into liquid undercooling, solidification processes, and thermophysical properties. A glass forming alloy Zr(sub 41.2)Ti(sub 13.8)Cu(sub 12.5)Ni(sub 10.0)Be(sub 22.5) was used to investigate the thermal treatments affecting undercooling and vitrification. The experiments were performed using the high temperature high vacuum electrostatic levitator at JPL. A sample approximately 3 mm in diameter was melted, superheated, undercooled, and solidified while levitated in high vacuum. The results show that when the sample was held above its melting temperature for a sufficient period of time to dissolve oxides and then cooled faster than a critical cooling rate, it undercooled to the glass transition temperature, T(sub g), and formed a glassy alloy. The required critical cooling rate for metallic glass formation was obtained to be between 0.9 K per second and 1.2 K per second for the 42.4 mg sample.

  3. Hemispherical total emissivity and specific heat capacity of deeply undercooled Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10.0}Be{sub 22.5} melts

    Energy Technology Data Exchange (ETDEWEB)

    Busch, R.; Kim, Y.J.; Johnson, W.L. [W. M. Keck Laboratory of Engineering Materials, California Institute of Technology, Pasadena, California 91125 (United States); Rulison, A.J.; Rhim, W.K. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, California 91109 (United States); Isheim, D. [Institut fuer Metallphysik der Universitaet Goettingen, Hospitalstrasse 3-7, 37073 Goettingen (Germany)

    1995-06-05

    High-temperature high-vacuum electrostatic levitation (HTHVESL) and differential scanning calorimetry (DSC) were combined to determine the hemispherical total emissivity {epsilon}{sub {ital T}}, and the specific heat capacity {ital c}{sub {ital p}}, of the undercooled liquid and throughout the glass transition of the Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10.0}Be{sub 22.5} bulk metallic glass forming alloy. The ratio of {ital c}{sub {ital p}}/{epsilon}{sub {ital T}} as a function of undercooling was determining from radiative cooling curves measured in the HTHVESL. Using specific heat capacity data obtained by DSC investigations close to the glass transition and above the melting point, {epsilon}{sub {ital T}} and {ital c}{sub {ital p}} were separated and the specific heat capacity of the whole undercooled liquid region was determined. Furthermore, the hemispherical total emissivity of the liquid was found to be about 0.22 at 980 K. On undercooling the liquid, the emissivity decreases to approximately 0.18 at about 670 K, where the undercooled liquid starts to freeze to a glass. No significant changes of the emissivity are observed as the alloy undergoes the glass transition. {copyright} {ital 1995} {ital American} {ital Institute} {ital of} {ital Physics}.

  4. A Novel β-Globin Chain Hemoglobin Variant, Hb Allentown [β137(H15)Val→Trp (GTG>TGG) HBB: c.412_413delinsTG, p.Val138Trp], Associated with Low Oxygen Saturation, Intermittent Aplastic Crises and Splenomegaly.

    Science.gov (United States)

    Collier, Anderson B; Coon, Lea M; Monteleone, Philip; Umaru, Samuel; Swanson, Kenneth C; Hoyer, James D; Oliveira, Jennifer L

    2016-01-01

    Hemoglobin (Hb) variants may be associated with low oxygen saturation and exacerbated episodes of anemia from common stressors such as viral infections. These attributes frequently cause increased clinical concern and unnecessary and expensive testing if not considered early in the evaluation of the patient. Some clinically significant Hb variants result in a normal Hb electrophoresis result, which can be method-dependent. Herein we describe a patient with low oxygen saturation and a history of hemolytic anemia who was subsequently found to carry a novel, unstable β-globin variant that we have named Hb Allentown [β137(H15)Val→Trp (GTG>TGG) HBB: c.412_413delinsTG, p.Val138Trp] for the place of identification of the variant. Hb Allentown is formed by a rare double nucleotide substitution within the same codon. Additionally, positive identification of rare Hb variants characterized by a single method is discouraged, as the Hb variant was misclassified as Hb S-South End or β6(A3)Glu→Val;β132(H10)Lys→Asn (HBB: c.[20A > T;399A > C]) by the initial laboratory.

  5. (abstract) Determination of the Specific Heat and Total Hemispherical Total Emissivity of the Highly Undercooled Zr(sub 41.2)Ti(sub 13.8)Cu(sub 12.5)Ni(sub 10.0)Be(sub 22.5) Alloy

    Science.gov (United States)

    Busch, R.; Kim, Y. J.; Johnson, W. L.; Rulison, A. J.; Rhim, W. K.

    1995-01-01

    High temperature high vacuum electrostatic levitation was combined with DSC experiments to determine the specific heat C(sub p) of the undercooled Zr(sub 41.2)Ti(sub 13.8)Cu(sub 12.5)Ni(sub 10.0)Be(sub 22.5) liquid as a function of temperature. The containerless approach made it possible to undercool the melt to the glass transition temperature without inducing nucleation. Because the cooling process was purely radiative, noncontact temperature measurement techniques could be used to determine the specific heat to total hemispherical emissivity ratio, C(sub p)/epsilon(sub t), for the undercooled liquid region. Using C(sub p) values which were independently obtained by DSC, epsilon(sub t) could be determined. With knowledge of C(sub p) of the undercooled liquid it was possible to determine other thermodynamic properties such as Gibbs free energy and entropy as a function of undercooling.

  6. One-step synthesis of samarium-doped ceria and its CO catalysis

    Indian Academy of Sciences (India)

    Administrator

    Key Laboratory for Special Functional Aggregate Materials of Education Ministry,. School of Chemistry and Chemical ... been flourishing since its excellent electric properties were discovered in the 1980s.1 At present SDC is ... absolute ethanol three times and dried in an electric oven at 60°C overnight, and then calcined at ...

  7. Trichloridotris{N-[phenyl(pyridin-2-ylmethylidene]hydroxylamine-κ2N,N′}samarium(III

    Directory of Open Access Journals (Sweden)

    Yahong Li

    2012-03-01

    Full Text Available The SmIII ion in the title compound, [SmCl3(C12H10N2O3], shows a coordination number of nine with a slightly distorted tricapped trigonal prismatic geometry based on a Cl3N6 donor set. The molecular structure is stabilized by three intramolecular O—H...Cl hydrogen bonds.

  8. Biological studies of samarium-153 bleomycin complex in human breast cancer murine xenografts for therapeutic applications

    Energy Technology Data Exchange (ETDEWEB)

    Bahrami-Samani, A. [Faculty of Nuclear Engineering and Physics, Amirkabir Univ. of Tech., Tehran (Iran); Ghannadi-Maragheh, M. [Faculty of Nuclear Engineering and Physics, Amirkabir Univ. of Tech., Tehran (Iran); Radiopharmaceutical Research and Development Lab. (RRDL), Nuclear Science and Technology Research Inst. (NSTRI), Tehran (Iran); Jalilian, A.R.; Mazidi, M. [Radiopharmaceutical Research and Development Lab. (RRDL), Nuclear Science and Technology Research Inst. (NSTRI), Tehran (Iran)

    2010-07-01

    In this work, a potential therapeutic DNA targeting agent, {sup 153}Sm-bleomycin complex ({sup 153}Sm-BLM), was developed and the tumor accumulation studies were performed using single photon emission computed tomography (SPECT) and scarification studies. {sup 153}Sm-BLM was prepared at optimized conditions (room temperature, 4-8 h, 0.1 mg bleomycin for 740-3700 MBq {sup 153}SmCl{sub 3}, radiochemical purity over 98%, HPLC, specific activity = 55 TBq/mmol). {sup 153}Sm-BLM was administered into human breast cancer murine xenografts and the biodistribution and imaging studies were performed up to 48 h. {sup 153}Sm-BLM demonstrated superior tumor accumulation properties in contrast with the other radiolabeled bleomycins with tumor:blood ratios of 41, 72 and 182 at 4, 24 and 48 h, respectively, and tumor:muscle ratios of 23, 33 and > 1490 at 4, 24 and 48 h, respectively, while administered intravenously. The SPECT images also demonstrated the obvious tumor uptake at the chest region of the breast-tumor bearing mice. These initial experiments demonstrate significant accumulation of {sup 153}Sm-BLM in tumor tissues. (orig.)

  9. Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

    CSIR Research Space (South Africa)

    Mandiwana, V

    2015-09-01

    Full Text Available .63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems...

  10. Nanostructured Samarium Doped Fluorapatites and Their Catalytic Activity towards Synthesis of 1,2,4-Triazoles

    National Research Council Canada - National Science Library

    Gangu, Kranthi Kumar; Maddila, Suresh; Maddila, Surya Narayana; Jonnalagadda, Sreekantha B

    2016-01-01

    ...) and their properties. The nanostructured Sm doped fluorapatites (Sm-FAp) were prepared by a co-precipitation method using four different amino acids, namely glutamic acid, aspartic acid, glycine and histidine...

  11. Samarium(III) picrate tetraethylene glycol complex: Photoluminescence study and active material in monolayer electroluminescent

    Energy Technology Data Exchange (ETDEWEB)

    Kusrini, Eny, E-mail: ekusrini@che.ui.ac.id [Department of Chemical Engineering, Faculty of Engineering, Universitas Indonesia, 16424 Depok (Indonesia); Saleh, Muhammad I. [School of Chemical Sciences, Universiti Sains Malaysia, 11800 Penang (Malaysia); Yulizar, Yoki [Department of Chemistry, Faculty of Mathematics and Natural Sciences, Universitas Indonesia, 16424 Depok (Indonesia); Za' aba, Noor K.; Abd. Majid, W.H. [Solid State Research Laboratory, Department of Physics, Universiti Malaya, 50603 Kuala Lumpur (Malaysia)

    2011-09-15

    A mononuclear Sm(III) complex involving Pic and EO4 (where Pic=picrate anion and EO4=tetraethylene glycol) has been studied. It shows a bright-orange emission when used as active material in a monolayer electroluminescent device of ITO/EO4-Sm-Pic/Al. The crystal structure of the complex consists of [Sm(Pic){sub 2}(H{sub 2}O)(EO4)]{sup +} cation and [Pic]{sup -} anion. The Sm(III) ion is coordinated with nine oxygen atoms from one EO4 ligand in a pentadentate mode, two Pic anions each in bidentate and monodentate modes, and one water molecule. Both the terminal alcohol groups of the acyclic EO4 ligand were involved in the O-H...O hydrogen bonding by infinite one-dimensional (1D) chain within a symmetry direction [0 1 0]. The photoluminescence (PL) spectrum of the thin film shows the typical spectral features of the Sm(III) ion ({sup 4}G{sub 5/2}{yields}{sup 6}H{sub 7/2} transitions). The root-mean-square (rms) of the roughness of thin film is 30.605 nm and indicates that the formation of the monolayer electroluminescent device is not uniform and retains a high crystallinity. Typical semiconductor current-voltage (I-V) property was also observed in this device with threshold and turn voltages of 2.8 and 6.2 V, respectively. The [Sm(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).H{sub 2}O complex can be applied as a luminescent center in OLED for bright-orange emission. - Highlights: > The [Sm(Pic){sub 2}(H{sub 2}O)(EO4)](Pic).H{sub 2}O complex is crystallized in triclinic with space group P-1. > The complex is applied as a emissive center in monolayer device structure of ITO/EO4-Sm-Pic/Al. > The photoluminescence spectrum of the crystalline and thin film shows a bright-orange emission. > The current-voltage property showed the turn on voltage of 6.2 V.

  12. Pulsed laser deposition and optical characterizations of the magnetic samarium orthoferrite

    Energy Technology Data Exchange (ETDEWEB)

    Berini, Bruno, E-mail: bruno.berini@uvsq.fr [Groupe d' Etude de la Matiere Condensee (GEMAC), CNRS, Universite de Versailles St. Quentin, 45, Av. des Etats-Unis, 78035 Versailles Cedex (France); Mistrik, Jan [Institute of Applied Physics and Mathematics, Faculty of Chemical Technology, University of Pardubice, Studentska 84, 532 10 Pardubice (Czech Republic); Dumont, Yves; Popova, Elena; Fouchet, Arnaud; Scola, Joseph; Keller, Niels [Groupe d' Etude de la Matiere Condensee (GEMAC), CNRS, Universite de Versailles St. Quentin, 45, Av. des Etats-Unis, 78035 Versailles Cedex (France)

    2012-01-01

    Pulsed Laser Deposition of magnetically ordered polycrystalline SmFeO{sub 3} films has been optimized onto SiO{sub 2} glass substrates as function of substrate temperature, oxygen pressure and pulsed laser fluency. Using a KrF excimer laser, crystallization temperature is found to be about 1048 K for a weak fluency of only 1.7 J cm{sup -2}. We show that this growth temperature can be reduced using higher fluency and that it is possible to obtain a film texturation along the c axis by reducing the oxygen pressure at given temperature and fluency. In a second part, we focus on the SmFeO{sub 3} optical constants determined by in situ ellipsometry using a stacking model and the Cauchy dispersion relation for SmFeO{sub 3} layer. We show a good correlation between the transmission and reflection calculated from these data and measured by ex situ spectrophotometry in the visible range.

  13. Nanostructured Samarium Doped Fluorapatites and Their Catalytic Activity towards Synthesis of 1,2,4-Triazoles

    Directory of Open Access Journals (Sweden)

    Kranthi Kumar Gangu

    2016-09-01

    Full Text Available An investigation was conducted into the influence of the amino acids as organic modifiers in the facile synthesis of metal incorporated fluorapatites (FAp and their properties. The nanostructured Sm doped fluorapatites (Sm-FAp were prepared by a co-precipitation method using four different amino acids, namely glutamic acid, aspartic acid, glycine and histidine. The materials were characterized by various techniques including X-ray diffraction (XRD, Fourier transform infra-red spectroscopy (FT-IR, field emission scanning electron microscopy (FE-SEM, energy-dispersive X-ray spectroscopy (EDX, high resolution transmission electron microscopy (HR-TEM, N2-adsorption/desorption isotherm, temperature programmed desorption (TPD and fluorescence spectrophotometry. Under similar conditions, Sm-FAp prepared using different amino acids exhibited distinctly different morphological structures, surface area and pore properties. Their activity as catalysts was assessed and Sm-FAp/Glycine displayed excellent efficiency in the synthesis of 1,2,4-triazole catalyzing the reaction between 2-nitrobenzaldehyde and thiosemicarbazide with exceptional selectivity and 98% yield in a short time interval (10 min. The study provides an insight into the role of organic modifiers as controllers of nucleation, growth and aggregation which significantly influence the nature and activity of the catalytic sites on Sm-FAp. Sm-FAp could also have potential as photoactive material.

  14. Body composition analysis by DEXA by using dynamically changing samarium filtration

    DEFF Research Database (Denmark)

    Gotfredsen, Arne; Baeksgaard, L; Hilsted, J

    1997-01-01

    , which depends on the current-absorber thickness. With this system we found a good agreement (r = 0.99) between reference and measured amounts of tissue or fat percentages in a plastic phantom and in smaller (approximately 0.5-4 kg) and larger (approximately 5-20 kg) piles of tissue (ox muscle and lard......). Scans of six healthy volunteers covered with combinations of beef and lard (approximately 5-15 kg) showed a good agreement (r = 0.99) between reference and DEXA values of added soft tissue mass and fat percentage. We conclude that the DEXA method (and, in particular, the Norland XR-36 using dynamic...

  15. Synthesis, thermal and photoluminescent properties of ZnSe- based oxyfluoride glasses doped with samarium

    Science.gov (United States)

    Kostova, I.; Okada, G.; Pashova, T.; Tonchev, D.; Kasap, S.

    2014-12-01

    Rare earth (RE) doped glasses and glass ceramic materials have recently received considerable attention because of their potential or realized applications as X-ray intensifying screens, phosphors, detectors, waveguides, lasers etc. [1]. In this work, we present a new RE doped ZnO-ZnSe-SrF2-P2O5-B2O3-Sm2O3-SmF3 (ZSPB) glass system synthesized by melt quenching technique. The resulting glasses were visually fully transparent and stable with glass the transition temperatures around 530°C. The thermal properties of this glass system were characterized by Modulated Differential Scanning Calorimetry (MDSC) measurements before and after annealing at 650°C. We have characterized these glasses by Raman spectroscopy and photoluminescence (PL) measurements over the UV-VIS range using light emitting diodes (LED) and laser diodes (LD) excitation sources. We have also irradiated thermally treated and non-treated glass samples by X-rays and have studied the resulting PL. We discuss the results in terms of previously reported models for Sm-doped Zn-borophosphate oxide, oxyfluoride and oxyselenide glasses.

  16. Laser-Induced Luminescence Study of Samarium(III) Thiodiglycolate Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Dong Yong; Lee, Eil Hee [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kimura, Takaumi [Japan Atomic Energy Research Institute, Ibaraki-ken (Japan)

    2003-09-15

    The hydration number of Sm(III) has been obtained by using the difference in the decay rate constants in H{sub 2}O and D{sub 2}O solutions. In general, k{sub obs}(H{sub 2}O) >> k{sub obs}(D{sub 2}O), k{sub obs}(D{sub 2}O) ≅ constant, and ligands are not as effective in causing non-radiative de-excitation of the excited state. For Sm(III), a relationship has been proposed in which the hydration number is related directly to the decay rate constant in H{sub 2}O. If there is no contribution from the ligand to the de-excitation of the luminescence excited state, the hydration of Sm(III) in the different complexes can be obtained directly from the values of k{sub obs} measured in H{sub 2}O. The number and the geometric distribution of solvent molecules around a metal ion in solution are an important factor in the structural and chemical behavior of cation. Indeed, such information has been utilized to design novel ionophores and receptors. However, there have been few studies of hydration structure for lanthanides. The fact that many f-element salts which have relatively large lattice energies are fairly soluble in water is a reflection of the strength of the interactions between the metal cations and water molecules.

  17. Oxygen Fugacity of the Martian Mantle from Pigeonite/Melt Partitioning of Samarium, Europium and Gadolinium

    Science.gov (United States)

    Musselwhite, S.; Jones, J. H.; Shearer, C.

    2004-01-01

    This study is part of an ongoing effort to calibrate the pyroxene/melt Eu oxybarometer for conditions relevant to the martian meteorites. There is fairly good agreement between a determinations using equilibria between Fe-Ti oxides and the estimates from Eu anomalies in shergottite augites in tenns of which meteorites are more or less oxidized. The Eu calibration was for angrite composition pyroxenes which are rather extreme. However, application of a calibration for martian composition augites 113 does not significantly reduce the discrepancy between the two methods. One possible reason for this discrepancy is that augites are non-liquidus. The use of pigeonite rather than augite as the oxy-barometer phase is considered. We have conducted experiments on martian composition pigeonite/melt REE partitioning as a function of fO2.

  18. Doping controlled spin reorientation in dysprosium-samarium orthoferrite single crystals

    Science.gov (United States)

    Cao, Shixun; Zhao, Weiyao; Kang, Baojuan; Zhang, Jincang; Ren, Wei

    2015-03-01

    As one of the most important phase transitions, spin reorientation (SR) in rare earth transition metal oxides draws much attention of emerging materials technologies. The origin of SR is the competition between different spin configurations which possess different free energy. We report the control of spin reorientation (SR) transition in perovskite rare earth orthoferrite Dy1-xSmxFeO3, a whole family of single crystals grown by optical floating zone method from x =0 to 1. Temperature dependence of the magnetizations under zero-field-cooling (ZFC) and field-cooling (FC) processes are studied. We have found a remarkable linear change of SR transition temperature in Sm-rich samples for x>0.2, which covers an extremely wide temperature range including room temperature. The a-axis magnetization curves under FCC process bifurcate from and then jump down to that of warming process (ZFC and FCW curves) in single crystals when x =0.5-0.9, suggesting complicated 4f-3d electron interactions among Dy3+-Sm3+, Dy3+-Fe3+, and Sm3+-Fe3+ sublattices of diverse magnetic configurations for materials physics and design. The magnetic properties and the doping effect on SR transition temperature in these single crystals might be useful in the spintronics device application. This work is supported by the National Key Basic Research Program of China (Grant No. 2015CB921600), and the National Natural Science Foundation of China (NSFC, Nos. 51372149, 50932003, 11274222).

  19. Synthesis, crystal structure and luminescent properties of a new samarium-fluorescein metal-organic framework

    Science.gov (United States)

    Thomas, Jesty; Ambili, K. S.

    2015-10-01

    A new metal-organic framework with empirical formula C43H30NO12Sm was solvothermally synthesized using SmCl3, fluorescein and N, N-Dimethyl formamide (DMF) and characterized by single crystal X-ray diffraction, powder X-ray diffraction, infrared spectroscopy, UV-Visible spectroscopy, scanning electron microscopy, optical microscopy, photoluminescence spectroscopy, CHN elemental analysis and thermogravimetric analysis. Single crystal X-ray diffraction revealed that the crystal structure belongs to the triclinic system, P-1 space group with a = 12.113 (6) Å, b = 12.1734 (7) Å, c = 13.2760(8) Å, α = 67.930(3)⁰, β = 87.779(3)⁰, γ = 77.603(3)⁰ and V = 1769.71 (17) Å3. The photoluminescence spectrum showed emission peaks at 550 nm, 600 nm and 647 nm due to the characteristic transitions 4G5/2 to 6H5/2, 4G5/2 to 6H7/2 and 4G5/2 to 6H9/2 respectively, when excited at 398 nm.

  20. High-temperature heat capacity of samarium and erbium titanates with pyrochlore structure

    Science.gov (United States)

    Denisova, L. T.; Chumilina, L. G.; Denisov, V. M.; Ryabov, V. V.

    2017-12-01

    Titanates Sm2Ti2O7 and Er2Ti2O7 with pyrochlore structure have been prepared by solid-phase synthesis in air from stoichiometric Sm2O3 (Er2O3)-TiO2 mixtures sequentially at 1673 and 1773 K. Hightemperature heat capacity of the oxide compounds has been determined by differential scanning calorimetry. Their thermodynamic properties have been calculated from experimental temperature dependence C p = f( T).

  1. Fluorescence enhancement of samarium (III) perchlorate by 1,10-phenanthroline on Phenylnaphthoylmethyl sulfoxide complex and luminescence mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Li, Wen-Xian, E-mail: nmglwx@163.com; Feng, Shu-Yan; Liu, Yu; Zhang, Jing; Xin, Xiao-Dong; Ao, Bo-Yang; Li, Ying-Jie

    2013-11-15

    A novel ligand, Phenylnaphthoylmethyl sulfoxide, was synthesized by a new method. Its novel binary complex, SmL{sub 5}·(ClO{sub 4}){sub 3}·2H{sub 2}O, and the ternary complex, SmL{sub 4}·L′(ClO{sub 4}){sub 3}·2H{sub 2}O, had been synthesized (using Phenylnaphthoylmethyl sulfoxide as the first ligand L, 1,10-phenanthroline as the second ligand L′). The complexes were characterized by element analysis, coordination titration, molar conductivity, IR, TG-DSC, {sup 1}HNMR and UV spectra. Their fluorescence emission mechanism, fluorescence intensities and phosphorescence spectra of the two ligands were also investigated by comparison. Fluorescent spectra illustrated that the ternary rare-earth complex presented stronger fluorescence intensity than the binary rare-earth complex in such material. The strongest characteristic fluorescence emission intensity of the ternary system was 1.81 times as strong as that of the binary system. By the analysis of fluorescence and phosphorescence spectra, it was found that the Phenylnaphthoylmethyl sulfoxide and phen had the advantage to absorb and transfer energy to Sm (III) ions effectively, and then the complexes emitted the characteristic fluorescence of Sm (III) ions. The phosphorescence spectra and fluorescence lifetime of the complexes were also measured. -- Highlights: • A novel ligand, Phenylnaphthoylmethyl sulfoxide, has been synthesized. • Its novel ternary complex and the binary complex have been synthesized. • The fluorescence emission intensity of ternary rare earth complex exhibit obvious enhancement. • The fluorescence emission mechanism and phosphorescence spectra are also investigated.

  2. Polypropylene oil as fuel for solid oxide fuel cell with samarium doped-ceria (SDC)-carbonate as electrolyte

    Science.gov (United States)

    Syahputra, R. J. E.; Rahmawati, F.; Prameswari, A. P.; Saktian, R.

    2017-03-01

    The research focusses on converting polypropylene oil as pyrolysis product of polypropylene plastic into an electricity. The converter was a direct liquid fuel-solid oxide fuel cell (SOFC) with cerium oxide based material as electrolyte. The polypropylene vapor flowed into fuel cell, in the anode side and undergo oxidation reaction, meanwhile, the Oxygen in atmosphere reduced into oxygen ion at cathode. The fuel cell test was conducted at 400 - 600 °C. According to GC-MS analysis, the polypropylene oil consist of C8 to C27 hydrocarbon chain. The XRD analysis result shows that Na2CO3 did not change the crystal structure of SDC even increases the electrical conductivity. The maximum power density is 0.079 mW.cm-2 at 773 K. The open circuite voltage is 0.77 volt. Chemical stability test by analysing the single cell at before and after fuel cell test found that ionic migration occured during fuel cell operation. It is supported by the change of elemental composition in the point position of electrolyte and at the electrolyte-electrode interface

  3. A distribution pattern of cadmium, gadolinium and samarium in Phaseolus vulgaris (L) plants as assessed by dynamic neutron radiography

    Science.gov (United States)

    Kőrösi, Ferenc; Balaskó, Márton; Sváb, Erzsébet

    1999-11-01

    The qualitative and semi-quantitative distributions, presumably apoplast transport patterns for the Gd, Sm and Cd were investigated in the primordial leaf tissues of the bean using dynamic neutron radiography. According to the applied 3D, 2D images and the pixel count distribution histograms of the considered gray levels, peculiar distribution patterns were postulated for the elements. Main and lateral vascular systems for Gd, the cell walls as well as intercellular spaces for Sm and the main leaf vein for Cd assumed to be the apoplast transport spaces and volumes.

  4. Ab initio calculation of the migration free energy of oxygen diffusion in pure and samarium-doped ceria

    Science.gov (United States)

    Koettgen, Julius; Schmidt, Peter C.; Bučko, Tomáš; Martin, Manfred

    2018-01-01

    We have studied the free energy migration barriers Δ F‡ for oxygen diffusion in pure ceria and Sm-doped ceria for the temperatures 300, 700, and 1000 K. We used the density functional theory in the generalized gradient approximation and an additional Hubbard U parameter for the Ce 4 f electronic states. We compare the results for the free energy deduced from three different methods. First, a static harmonic approach is applied in which the temperature dependent vibrational contributions to energy and entropy are deduced from the phonon frequencies of supercells with a fixed volume. Second, a static quasiharmonic approach is used in which a part of the anharmonicity effect is introduced via an implicit dependence of the harmonic frequencies on the thermally expanding cell volume. Third, the free energy barriers are calculated using metadynamics and molecular dynamics in which anharmonicity effects are naturally taken into account. The three methods examined in this study lead to distinctly different results. According to the harmonic approximation, the migration free energy difference Δ F‡ increases with increasing temperature due to an increasing entropic contribution. According to the quasiharmonic approximation, the migration free energy is independent of temperature. Finally, molecular dynamics predicts a thermally induced increase in the migration free energy. We conclude that temperature dependent experimental lattice constants cancel out the increasing entropic contribution with increasing temperature in the static quasiharmonic approach. The full consideration of anharmonicity effects in the metadynamics method again leads to a temperature dependent migration free energy.

  5. Studies on the preparation and stability of samarium-153 propylene diamine tetramethylene phosphonate (PDTMP) complex as a bone seeker

    Energy Technology Data Exchange (ETDEWEB)

    Majali, M.A. E-mail: mythili@magnum.barc.ernet.in; Mathakar, A.R.; Shimpi, H.H.; Banerjee, Sharmila; Samuel, Grace

    2000-12-15

    Propylene diamine tetra methylene phosphonate (PDTMP) was synthesised by modifying a method reported for the synthesis of EDTMP. Complexation of the synthesised phosphonate ligand with {sup 153}Sm was carried out by varying the experimental parameters and the complex was radiochemically characterized. Biodistribution studies showed that the uptake by bone in rats was 2% per g of bone, which was retained up to 48 h. The uptake by other organs was insignificant, except by the liver which showed a slightly higher absorption.

  6. Crystal structure of a samarium(III nitrate chain cross-linked by a bis-carbamoylmethylphosphine oxide ligand

    Directory of Open Access Journals (Sweden)

    Julie A. Stoscup

    2014-10-01

    Full Text Available In the title compound poly[aquabis(μ-nitrato-κ4O,O′:O,O′′tetrakis(nitrato-κ2O,O′{μ4-tetraethyl [(ethane-1,2-diylbis(azanediylbis(2-oxoethane-2,1-diyl]diphosphonate-κ2O,O′}disamarium(III], [Sm2(NO36(C14H30N2O8P2(H2O]n, a 12-coordinate SmIII and a nine-coordinate SmIII cation are alternately linked via shared bis-bidentate nitrate anions into a corrugated chain extending parallel to the a axis. The nine-coordinate SmIII atom of this chain is also chelated by a bidentate, yet flexible, carbamoylmethylphoshine oxide (CMPO ligand and bears one water molecule. This water molecule is hydrogen bonded to nitrate groups bonded to the 12-coordinate SmIII cation. The CMPO ligand, which lies about an inversion center, links neighboring chains along the c axis, forming sheets parallel to the ac plane. Hydrogen bonds between the amide NH group and metal-bound nitrate anions are also present in these sheets. The sheets are packed along the b axis through only van der Waals interactions.

  7. Structure, reactivity, electronic configuration and magnetism of samarium atomic layers deposited on Si(0 0 1) by molecular beam epitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Gheorghe, Nicoleta G.; Lungu, George A.; Husanu, Marius A.; Costescu, Ruxandra M.; Macovei, Dan [National Institute of Materials Physics, Atomistilor 105 b, 077125 Magurele-Ilfov (Romania); Teodorescu, Cristian M., E-mail: teodorescu@infim.ro [National Institute of Materials Physics, Atomistilor 105 b, 077125 Magurele-Ilfov (Romania)

    2013-02-15

    The surface structure, interface reactivity, electron configuration and magnetic properties of Sm layers deposited on Si(0 0 1) at various temperatures are investigated by low-energy electron diffraction (LEED), X-ray photoelectron spectroscopy (XPS), X-ray absorption spectroscopy (XAS) and magneto-optical Kerr effect (MOKE). It is found that metal Sm is present on samples prepared at low temperature, with an interface layer containing SmSi{sub 2} and Sm{sub 4}Si{sub 3}. When samples are prepared at high temperature, much less metal Sm is found, with an increasing amount of SmSi{sub 2}. Room temperature ferromagnetism is observed for all prepared layers, with a decrease of the saturation magnetization when samples are prepared at high temperature. It is found that ferromagnetism implies mostly a compound with approximate stoichiometry Sm{sub 4}Si{sub 3}. Also, the decrease in the intensity of the XAS 2p{sub 3/2} → 3d white lines with the corresponding increasing amount of SmSi{sub 2} may be explained by assuming a higher occupancy of Sm 5d orbitals (5d{sup 2} configuration), most probably due to hybridation effects.

  8. Calculation and comparison of xenon and samarium reactivities of the HEU, LEU core in the low power research reactor.

    Science.gov (United States)

    Dawahra, S; Khattab, K; Saba, G

    2015-07-01

    Comparative studies for the conversion of the fuel from HEU to LEU in the Miniature Neutron Source Reactor (MNSR) have been performed using the MCNP4C and GETERA codes. The precise calculations of (135)Xe and (149)Sm concentrations and reactivities were carried out and compared during the MNSR operation time and after shutdown for the existing HEU fuel (UAl4-Al, 90% enriched) and the potential LEU fuels (U3Si2-Al, U3Si-Al, U9Mo-Al, 19.75% enriched and UO2, 12.6% enriched) in this paper using the MCNP4C and GETERA codes. It was found that the (135)Xe and (149)Sm reactivities did not reach their equilibrium reactivities during the daily operating time of the reactor. The (149)Sm reactivities could be neglected compared to (135)Xe reactivities during the reactor operating time and after shutdown. The calculations for the UAl4-Al produced the highest (135)Xe reactivity in all the studied fuel group during the reactor operation (0.39 mk) and after the reactor shutdown (0.735 mk), It followed by U3Si-Al (0.34 mk, 0.653 mk), U3Si2-Al (0.33 mk, 0.634 mk), U9Mo-Al (0.3 mk, 0.568 mk) and UO2 (0.24 mk, 0.448 mk) fuels, respectively. Finally, the results showed that the UO2 was the best candidate for fuel conversion to LEU in the MNSR since it gave the lowest (135)Xe reactivity during the reactor operation and after shutdown. Copyright © 2015 Elsevier Ltd. All rights reserved.

  9. Development of samarium [{sup 32}P] phosphate colloid for radiosynoviorthesis applications: Preparation, biological and preliminary clinical studies experience

    Energy Technology Data Exchange (ETDEWEB)

    Prabhakar, G. [Radiopharmaceuticals Programme, Board of Radiation and Isotope Technology (BRIT), BARC Vashi Complex, Sector-20, Navi Mumbai 400 705 (India)], E-mail: gantipk47@rediffmail.com; Sachdev, Satbir S.; Umamaheswari, S.; Sivaprasad, N.; Bhatia, Manohar H. [Radiopharmaceuticals Programme, Board of Radiation and Isotope Technology (BRIT), BARC Vashi Complex, Sector-20, Navi Mumbai 400 705 (India); Chaudhari, Pradip R. [Laboratory Nuclear Medicine Services, BARC, Mumbai 400 012 (India); Solav, Srikant V. [Spect Lab, Nuclear Medicine Services, Opposite Dinanath Mangeshkar Hospital, Pune 411004 (India)

    2007-12-15

    A new therapeutic radio colloid for radiosynoviorthesis (RS) applications is reported. The method of preparation involves the reaction of SmCl{sub 3} carrier with carrier added [{sup 32}P]H{sub 3}PO{sub 4} in the presence of gelatin. The pure colloid was recovered by dialysis purification leading to radiochemical yield of around 90%. The radiochemical purity of the pure colloid formulated in isotonic saline was over 98%, for the usage period of 14 days, as assessed by paper chromatography. Ninety percent of colloid particles were in the size of 1-10 {mu}m as evident from the laser diffraction particle size analysis, ideally suitable for the intended end use. Animal studies revealed complete retention of the radio colloid in the rabbit knee joint. The results of clinical trials in humans are satisfactory and encouraging, satisfactory retention of the colloid in the knee joint and negligible leakage into the systemic circulation.

  10. Microstructural characterization of PH 13-8 Mo maraging steels; Mikrostrukturelle Charakterisierung von PH 13-8 Mo Maraging-Staehlen

    Energy Technology Data Exchange (ETDEWEB)

    Schnitzer, Ronald; Hochfellner, Rainer; Noehrer, Matthias [Christian Doppler Lab. for Early Stages of Precipitation, Leoben (Austria); Schober, Michael; Clemens, Helmut [Dept. Metallkunde und Werkstoffpruefung, Montanuniversitaet Leoben (Austria); Zinner, Silvia [Boehler Edelstahl GmbH und Co. KG, Kapfenberg (Austria); Leitner, Harald [Christian Doppler Lab. for Early Stages of Precipitation, Leoben (Austria); Dept. Metallkunde und Werkstoffpruefung, Montanuniversitaet Leoben (Austria)

    2009-10-15

    Maraging steels are characterized by an excellent combination of high strength coupled with an acceptable level of ductility. Its microstructure consists of a martensitic matrix with intermetallic precipitates and a low amount of austenite, the latter varying according to heat treatment and the composition of the alloy. In this paper methods and processes for comprehensively characterizing the microstructure of maraging steels are set out. Apart from the prior austenite grain size, the martensite and the intermetallic phases these also relate to the reverted austenite formed during heat treatment. In addition to the description of the growth of austenite grains, with the aid of the law of isothermal grain growth, high-resolution methods such as electron back-scattered diffraction (EBSD), transmission electron microscopy (TEM) and atom probe tomography (APT) are employed. (orig.)

  11. Registration of PR1146-138 yellow dry bean germplasm line

    Science.gov (United States)

    The yellow bean (Phaseolus vulgaris L.) is an important market class in Haiti. However, there have been no previous attempts to genetically improve this seed type for the Caribbean. Landrace varieties of yellow beans in Haiti are susceptible to Bean golden yellow mosaic virus (BGYMV) and bean common...

  12. Development of the yellow common bean germplasm PR1146-138

    Science.gov (United States)

    The yellow bean (Phaseolus vulgaris L.) is an important market class in Haiti. There have been, however, no previous attempts to genetically improve this seed type for the Caribbean. Landrace varieties of yellow beans in Haiti are susceptible to Bean golden yellow mosaic virus (BGYMV) and bean commo...

  13. Hanford Engineer Works technical progress letter No. 138, February 16--22, [1947

    Energy Technology Data Exchange (ETDEWEB)

    Greninger, A.B.

    1947-02-27

    This technical progress letter contains reports from six Technical Department divisions at the Hanford Engineer Works for February 16 through February 22, 1947. The six reporting divisions are: 100 Areas, 300 Area, 200 Areas, Chemical Development, Laboratories, and Statistical Studies. (JL)

  14. PS1-38: Catalyzing Innovation at the Front Lines of Health Care

    Science.gov (United States)

    Tuzzio, Leah; Schaefer, Judith; McCulloch, David; Greene, Sarah M.; Bennett, Susan; Clark, Adele; Austin, Brian

    2010-01-01

    Background/Aims: To find new ways for Group Health, its research center and its community foundation to work together, we pilot tested the Partnership for Innovation, a grant program to encourage and seed organization wide innovation. Innovation is defined as new ideas or approaches that have the potential to add value and change the way the organization works. The program gives staff funding to develop, implement, and evaluate innovations within the healthcare system. Evaluations assess the effect of the innovations in terms of costs, patient satisfaction, organizational readiness, and other aspects. These results inform decisions about adopting the innovation organization wide. Methods: We disseminated an initial call for proposals to medical center leaders, and developed a two-step selection process in which we first reviewed brief concept proposals for their innovativeness, likely effectiveness, impact, feasibility, congruence with strategic priorities, and overlap with other efforts. We next invited selected applicants to expand their proposals for review by the program’s steering committee. In step three, the Partnership program itself was refined and improved through Plan-Do- Check-Act cycles after each of the two funding rounds in 2008. Results: We received 19 proposals in 2008 (12 in the first round). Funded proposal topics included nasal flu vaccine for children, an online chronic disease self-management program, infectious disease management for long-term care facilities, and enhancing medication safety for patients with complex medication regimens. The first round of four pilots are currently underway and the second round of two funded pilots will begin in 2009. Viable but unfunded proposals were rerouted to other departments to encourage discussion about whether the idea could be developed through other channels. Conclusions: Offering a pilot grant program to frontline staff may enhance engagement, empowerment, and creativity. Evaluating the pilot programs is an essential component of this initiative, both to improve the pilots themselves, and the innovation program as a whole. The partners found the collaboration promising and worth continued funding in 2009.

  15. Ce que nous faisons | Page 138 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet(s): Climate change, WEATHER FORECASTS, FORECASTING TECHNIQUES, ADAPTATION TO CHANGE, SMALLHOLDERS. Région(s): Africa, South of Sahara, Zambia, Zimbabwe. Programme(s): Changements climatiques. Ce projet vise à améliorer les mesures incitatives et les possibilités qui s'offrent aux ...

  16. Ce que nous faisons | Page 138 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Institut pour la connectivité dans les Amériques (ICA) - phase II. Sujet(s): Société De L'information, Technologie De L'information, Réseaux De Télécommunications, Démocratisation. Région(s): Amériques. Le potentiel des technologies de l'information et de la communication à titre d'outils pouvant servir au développement ...

  17. A Critical Assessment of The Minimum Age Convention 138 of 1973 ...

    African Journals Online (AJOL)

    NWUuser

    with 65,1 million, and Latin America and the Caribbean with 14,1 million.10 In terms of relative extent ... 5.6 percent, and 6.7 percent in Latin America are exposed to hazards.13 Between the period of 2004 and 2008 the ...... geography, the multiplicity of ethnic groups, languages and systems of socialisation and education.

  18. 138 Etude de la variabilité agromorphologique de quarante-cinq ...

    African Journals Online (AJOL)

    ITRAD

    Résumé. Le niébé est la seconde légumineuse de rente après l'arachide au Tchad mais les cultivars locaux ne sont pas valorisés et le risque de leur disparition est réel. L'objectif de ce travail, est d'étudier la variabilité agromorphologique de quarante-cinq cultivars et sa structuration sur la base de dix-huit descripteurs. Les.

  19. 9 CFR 3.138 - Primary conveyances (motor vehicle, rail, air, and marine).

    Science.gov (United States)

    2010-01-01

    ..., Care, Treatment, and Transportation of Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters... transporting live animals shall be designed and constructed to protect the health, and ensure the safety and...

  20. Onychomycosis in the elderly. A 2-year retrospective study of 138 cases

    Directory of Open Access Journals (Sweden)

    J. Araiza-Santibáñez

    2016-01-01

    Conclusions: Approximately 9 out of 10 nail disorders in the elderly were onychomycosis; many of these patients may present with comorbidities such as hypertension or diabetes mellitus, which often complicate treatment outcomes, affecting quality of life. Elderly patients should receive adequate health education and monitoring. This will improve their quality of life.

  1. 138 Caractérisation physico-chimique et microbiologique du mulet ...

    African Journals Online (AJOL)

    SETNORD

    contamination fécale sont de 0,74 102 et 3,66 ufc/g respectivement pour les coliformes totaux et fécaux. La flore fongique est de 1,70 103 ufc/g. Cependant, aucun germe pathogène n'a été détecté dans les produits analysés. Mots-clés : Imraguen, mulet jaune, Lekhlia, qualité, Mauritanie. Abstract. Physicochemical and ...

  2. 138th International School of Physics "Enrico Fermi" : Unfolding the Matter of Nuclei

    CERN Document Server

    Ricci, R A

    1998-01-01

    The nucleus and its constituents are a challenging problem. The lectures collected in this book present a broad and comprehensive review of the current knowledge about nuclei.They cover topics such as searching for signatures of the quarks in nuclei with electromagnetic probes and, at much higher energies, for signatures of the quark-gluon plasma in ultrarelativistic nuclear collisions. The attempts to obtain new nuclei in the laboratory are also discussed, as well as the central role played by nuclear physics in the development of weak interactions. Progress in all these areas rests on a deeper theoretical handling of the nuclear and nucleon’s structure. The latter can also be addressed by relying on numerical solutions of QCD on a discrete space-time lattice. The advancement of computational capabilities has spurred a growing interest in this approach. Finally, the book deals with different paths toward solving non-perturbative QCD.

  3. PCB138, but not PCB153 and PCB180, acts as a weak antiandrogen in vitro

    DEFF Research Database (Denmark)

    Vinggaard, A.M.; Bonefeld-Jørgensen, Eva Cecilie

    2000-01-01

    The polychlorinated biphenyls (PCBs) constitute a group of persistent environmental chemicals including 209 possible congeners exhibiting a variety of chlorine substitution patterns. Due to their lipophilic nature and resistance toward biotransformation, PCBs accumulate in the food chain and all ...

  4. 75 FR 45096 - Foreign-Trade Zone 138 - Columbus, Ohio Area, Application for Reorganization under Alternative...

    Science.gov (United States)

    2010-08-02

    ... context of the Board's standard 2,000-acre activation limit for a general-purpose zone project. The... - includes certain acreage within the Rickenbacker International Airport and Air Industrial Park, Alum Creek...; Site 2 (136 acres) -- Gateway Business Park, McClain Road, Lima, Allen County; Site 3 (42 acres...

  5. 33 CFR 157.138 - Crude Oil Washing Operations and Equipment Manual.

    Science.gov (United States)

    2010-07-01

    ... tank. (6) The design oxygen content of the gas or mixture of gases that is supplied by the inert gas... VESSELS CARRYING OIL IN BULK Crude Oil Washing (COW) System on Tank Vessels Design, Equipment, and... inspection of the COW system during COW operations. (5) Design characteristic information of the COW system...

  6. FCJ-138 This is not a Bit-Pipe: A Political Economy of the Substrate Network

    Directory of Open Access Journals (Sweden)

    Rachel O’Dwyer

    2012-07-01

    Full Text Available Critiquing ‘free culture’ as a utopian gesture that fails to engage with the material circuits of cognitive capitalism, this paper proposes a political economy attendant to the circulation of capital at all layers of the communications network. Applying the newly invigorated theories of ‘rent’ to the shifting commons/property dialectics of the information economy, we explore the role of network infrastructure in the extraction of surplus. How is surplus from the digital commons channelled through a material substrate? How is network infrastructure transforming in response to the fluid and fluctuating dynamics of cognitive capitalism? Finally, what possibilities for political engagement and material exploit are emerging?

  7. 138 the quest to find the true age of the Universe and the Theory of Everything

    CERN Document Server

    Gribbin, John

    2017-01-01

    A celebrated astronomer makes a powerful case for the harmony between two of physics' most important and seemingly contradictory theories The twentieth century gave us two great theories of physics. The general theory of relativity describes the behavior of very large things, and quantum theory the behavior of very small things. In this landmark book, John Gribbin--one of the best-known science writers of the past thirty years--presents his own version of the Holy Grail of physics, the search that has been going on for decades to find a unified "Theory of Everything" that combines these ideas into one mathematical package, a single equation that could be printed on a T-shirt, containing the answer to life, the Universe, and everything. With his inimitable mixture of science, history, and biography, Gribbin shows how--despite skepticism among many physicists--these two great theories are very compatible, and point to a deep truth about the nature of our existence. The answer lies, intriguingly, with the age o...

  8. Sud du Sahara | Page 138 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Despite the success of research and development activities in integrating crop and livestock production, few West African communities are adopting these ... areas of sub-Saharan, particularly East Africa, are vulnerable to the long-term consequences of climate change and the short-term increase in climate variability.

  9. Bu11.cnem.s<>¢.sihiop.,3(2).135-138 (19391

    African Journals Online (AJOL)

    Birkhauser Verlag, Basel und Stuttgart, pp. 860 (1976). W. Karrer, E. Ch-erbuliez and C.H. Eugster, "Konstitution und Vorkommen der organischen Pflanzenstoffe, Ergaenzungsband 1", Birkhauser Verlag,. Basel und Stuttgart. pp. 243 (19'?'i'). W. Karrer, E. Cherbuliez and C.H. Eugster, "K0118-titutifiil und Vorkommen.

  10. Down-regulation of human cytomegalovirus UL138, a novel latency ...

    Indian Academy of Sciences (India)

    2013-07-12

    Jul 12, 2013 ... (Takara, Dalian, China). The recombinant products were then transformed into E. coli to produce a pool which should contain specific sequences of putative target mRNAs that hcmv-miR-. UL36 can bind to. Fifty-seven clones were randomly selected. Corresponding products inserted into the plasmids were ...

  11. : tous les projets | Page 138 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Région: Bangladesh, Japan. Programme: Employment and Growth. Financement total : CA$ 584,200.00. Évolution des marchés du travail au Bangladesh - interaction entre croissance et inclusion dans un pays à faible revenu. Projet. Le Bangladesh, dont l'économie et la population sont en croissance, a surtout réussi à ...

  12. A Critical Assessment of The Minimum Age Convention 138 of 1973 ...

    African Journals Online (AJOL)

    NWUuser

    school. Social protection instruments can serve to prevent vulnerable households from having to resort to child labour. He alleges36 that the most important thing should be ... school and are most likely not able to read and write. Written ..... children in schools and institutions of learning is, however, critical if children are to.

  13. 75 FR 29722 - Foreign-Trade Zone 138-Columbus, OH Area; Site Renumbering Notice

    Science.gov (United States)

    2010-05-27

    ... purposes. (Note: Sites 7 through 11 have expired and those numbers will not be reused.) Under this revision...; and, Site 19 (1 acre, expires 9/1/2010)--located at 330 Oak Street, Columbus. For further information...

  14. Yeast Interacting Proteins Database: YKL186C, YPL138C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available essential nuclear protein; Mex67p and Mtr2p form a mRNA export complex which binds to RNA Rows with this bait...essential nuclear protein; Mex67p and Mtr2p form a mRNA export complex which binds to RNA Rows with this bait

  15. Syndecan-1 (CD138) contributes to prostate cancer progression by stabilizing tumour-initiating cells.

    Science.gov (United States)

    Shimada, Keiji; Anai, Satoshi; Fujii, Tomomi; Tanaka, Nobumichi; Fujimoto, Kiyohide; Konishi, Noboru

    2013-12-01

    Increasing evidence suggests that tumour-initiating cells (TICs) contribute to the development of prostate cancer. Here, we identified syndecan-1 as a key molecule maintaining the stability of prostate cancer TICs. Holoclones harbouring the biological properties of stemness were derived from single-cell cultures of the PC3 human prostate cancer cell line. These holoclones over-expressed syndecan-1, but showed reduced expression of NADPH oxidase (NOX) and synthesis of hydrogen peroxide and oxygen radicals. Stable RNA-mediated silencing of syndecan-1 gene expression up-regulated NOX-dependent generation of reactive oxygen species and reduced the survival of holoclones in vitro. Syndecan-1 down-regulation also strongly reduced the number of CD133(+)/CD44(+) primitive cancer cells and tumour growth in vivo. Interestingly, syndecan-1 gene knockdown significantly enhanced the tumour-suppressive effects of docetaxel by inhibiting the docetaxel-induced increase in CD133(+)/CD44(+) cells in vivo. In the transgenic adenocarcinoma of the mouse prostate (TRAMP) mouse model of prostate cancer, early intervention with a syndecan-1 inhibitor (OGT2115) or syndecan-1 RNAi reduced the incidence of adenocarcinoma and the number of c-kit(+)/CD44(+) cells in cancer foci. Finally, we found that syndecan-1 immunopositivity in prostate cancer cells was significantly associated with biochemical recurrence after radical prostatectomy. Taken together, our results show that syndecan-1 contributes to prostatic carcinogenesis by maintaining TICs and may be a target molecule for therapy. Copyright © 2013 Pathological Society of Great Britain and Ireland. Published by John Wiley & Sons, Ltd.

  16. Die kontekstuele funksie van Hebreërs 13:8 | van Zyl | HTS ...

    African Journals Online (AJOL)

    This article attempts to address this deficiency. It is proposed that verse 8 plays the following role in Chapter 13: It supports the teaching and life of the spiritual leaders, counteracts false teachings, provides stability for the readers' pilgrimage in this life, and serves as the Christological basis of the community's worship.

  17. Die kontekstuele funksie van Hebreërs 13:8

    African Journals Online (AJOL)

    29 Jul 2015 ... daar nie formele aanwysings in vers 8 (of v. 9) is (bv 'n γάρ, οὖν, ὥστε, ens) wat 'n aanduiding gee van hoe hierdie vers met sy konteks skakel nie. Verder pas vers 8 met die eerste oogopslag ook nie inhoudelik by verse 7 en 9 nie. Die leser moet gevolglik sy eie afleidings uit die argument van Hebreërs 13 ...

  18. Significant decrease in yield under future climate conditions: Stability and production of 138 spring barley accessions

    DEFF Research Database (Denmark)

    Ingvordsen, Cathrine Heinz; Backes, Gunter; Lyngkjær, Michael Foged

    2015-01-01

    to a two-factor treat-ment of combined elevated temperature (+5◦C day/night) and [CO2] (700 ppm), as well as single-factortreatments of elevated temperature (+5◦C day/night), [CO2] (700 ppm), and [O3] (100–150 ppb). Thecontrol treatment was equivalent to present average South Scandinavian climate...

  19. Page 1 138 S. V. PUNTAMBEKAR AND R. M. BERI The resinol has ...

    Indian Academy of Sciences (India)

    yº Tetrahydro laccol Diacetyl tetra hydrolacco,. Phenyl isocyanate N | N. A Acetylation Oxidation N. 2^ \\ W Benzoylation. Cat H.1804N2 Cash400s C17Has COOH \\. (III) (II) (VI) Cat Has04. Diphenyl laccol urathene Diacetyl laccol Stearic acid (VIII). N Dibenzyl tetrahydro Iaccol. Oxidation and hydrolysis. OH. OH. (IV). 2COOH.

  20. 32 CFR 536.138 - Claims not payable under the Foreign Claims Act.

    Science.gov (United States)

    2010-07-01

    ... death arising incident to service, or pursuant to combined military operations. Combined military operations include exercises and United Nations and North Atlantic Treaty Association (NATO) peacekeeping and...

  1. 29 CFR 784.138 - Perishable state of the aquatic product as affecting exemption.

    Science.gov (United States)

    2010-07-01

    ... with the performance of exempt operations on the aquatic forms of animal and vegetable life mentioned... 29 Labor 3 2010-07-01 2010-07-01 false Perishable state of the aquatic product as affecting... PROVISIONS OF THE FAIR LABOR STANDARDS ACT APPLICABLE TO FISHING AND OPERATIONS ON AQUATIC PRODUCTS...

  2. أثر العلماء في الحياة الرسمية والاجتماعية في عهد الإمارة الأموية (138 هـ-316 هـ (755 م-928م

    Directory of Open Access Journals (Sweden)

    شخوم سعدي

    2010-03-01

    Full Text Available بدأت تظهر أولى الملامح الاستقلالية عن المشرق من الناحية الثقافية والعلمية، بتأسيس الدولة الأموية بالأندلس، ويذهب بعض الباحثين إلى أنّ الروابط التي كانت تربط الأندلس بالخلافة الأموية كانت قد انقطعت قبل ذلك في عهد واليها الصميل بن حاتم (129 هـ-138هـ(746م-755م الذي كان له نفوذ كبير جعله يتحكم في عزل الولاة واختيارهم ولهذا لم يكن لسقوط الدولة الأموية أثر مباشر يذكر على الولاية واستقرار الحكم بها، وتتضح هذه الاستقلالية في الجانب الديني فقد بدأ الأندلسيون يتجهون شيئا فشيئا من الأوزاعية إلى المالكية رغم أنّ المذهب السائد بالمشرق هو الحنفي، وهكذا وبمرور الوقت أصبح المذهب المالكي هو المذهب الرسمي للدولة الأندلسية، فكان فقهاء الجماعة من أتباع الإمام مالك يدرؤون أية محاولة للانحياز عنه، وفي ميدان الأدب والشعر عرف هذا الجانب نشاطا واضحا. حيث بدأت الأندلس تعرف جيلا جديدا من الشعراء أكثر تفرعا للشعر من غيره، وقد تعرض ابن حيان لهؤلاء وامتلأ المقتبس بشعرهم ومواقفهم، وفي الميادين العلمية الأخرى بدأت الأندلس تعرف جيلا جديدا من العلماء أكثر طموحا وبذلا للجهد العلمي وبذلك بدأ يغلب الجانب العلمي والثقافي على الأندلس أكثر من أي فترة سابقة وبدأت تظهر خصائص جديدة للحياة العلمية في هذه الفترة.

  3. Tetrakis(μ-propanoato-κ2O:O′bis[(1,10-phenanthroline-κ2N,N′(propanoato-κ2O,O′samarium(III

    Directory of Open Access Journals (Sweden)

    Chun-Xiang Wang

    2008-01-01

    Full Text Available The title complex, [Sm2(C3H5O26(C12H8N22], is a dinuclear centrosymmetric molecule, in which two crystallographically equivalent Sm atoms, separated by 3.9502 (2 Å, are bridged by four propanoate anions. Each Sm atom is coordinated by two N atoms from one chelating phenanthroline ligand and seven carboxylate O atoms from five propanoate anions, to form a distorted tricapped trigonal prism.

  4. Processing of composites based on NiO, samarium-doped ceria and carbonates (NiO-SDCC as anode support for solid oxide fuel cells

    Directory of Open Access Journals (Sweden)

    Lily Siong Mahmud

    2017-09-01

    Full Text Available NiO-SDCC composites consisting of NiO mixed with Sm-doped ceria (SDC and carbonates (Li2CO3 and Na2CO3 were sintered at different temperatures and reduced at 550 °C. The influence of reduction on structure of the NiO-SDCC anode support for solid oxide fuel cells (SOFCs was investigated. Raman spectra of the NiO-SDCC samples sintered at 500, 600 and 700 °C showed that after reducing at 550 °C NiO was reduced to Ni. In addition, SDC and carbonates (Li2CO3 and Na2CO3 did not undergo chemical transformation after reduction and were still detected in the samples. However, no Raman modes of carbonates were identified in the NiO-SDCC pellet sintered at 1000 °C and reduced at 550 °C. It is suspected that carbonates were decomposed at high sintering temperature and eliminated due to the reaction between the CO32– and hydrogen ions during reduction in humidified gases at 550 °C. The carbonate decomposition increased porosity in the Ni-SDCC pellets and consequently caused formation of brittle and fragile structure unappropriated for SOFC application. Because of that composite NiO-SDC samples without carbonates were also analysed to determine the factors affecting the crack formation. In addition, it was shown that the different reduction temperatures also influenced the microstructure and porosity of the pellets. Thus, it was observed that Ni-SDC pellet reduced at 800 °C has higher electrical conductivity of well-connected microstructures and sufficient porosity than the pellet reduced at 550 °C.

  5. The single cell of low temperature solid oxide fuel cell with sodium carbonate-SDC (samarium-doped ceria) as electrolyte and biodiesel as fuel

    Science.gov (United States)

    Rahmawati, F.; Nuryanto, A.; Nugrahaningtyas, K. D.

    2016-02-01

    In this research NSDC (composite of Na2CO3-SDC) was prepared by the sol-gel method to produce NSDC1 and also by the ceramic method to produce NSDC2. The prepared NSDC then were analyzed by XRD embedded with Le Bail refinement to study the change of characteristic peaks, their crystal structure, and their cell parameters. Meanwhile, the measurement of impedance was conducted to study the electrical conductivity of the prepared materials. A single cell was prepared by coating NSDC-L (a composite of NSDC with Li0.2Ni0.7Cu0.1O2) on both surfaces of NSDC. The NSDC-L was used as anode and cathode. The ionic conductivity of NSDC1 and NSDC2 at 400 oC are 4.1109 x 10-2 S.cm-1 and 1.6231 x 10-2 S.cm-1, respectively. Both electrolytes have ionic conductivity higher than 1 x 10-4 S.cm-1, therefore, can be categorized as good electrolyte [1]. However, the NSDC1 shows electrodeelectrolyte conduction. It indicates the existence of electronic migration from electrolyte- electrode or vice versa. Those may cause a short circuit during fuel cell operation and will reduce the fuel cell performance fastly. The single cell tests were conducted at 300, 400, 500 and 600 °C. The single fuel cell with NSDC1 and NSDC2 as electrolyte show maximum power density at 400 °C with the power density of 3.736 x 10-2 mW.cm-2 and 2.245 x 10-2 mW.cm-2, respectively.

  6. Samarium-neodymium chronology and rubidium-strontium systematics of an Allende calcium-aluminum-rich inclusion with implications for 146Sm half-life

    Science.gov (United States)

    Marks, N. E.; Borg, L. E.; Hutcheon, I. D.; Jacobsen, B.; Clayton, R. N.

    2014-11-01

    Calcium-aluminum-rich inclusions (CAIs) are primitive objects that formed within the protoplanetary disk surrounding the young Sun. Recent Pb-Pb chronologic studies have demonstrated that CAIs are the oldest solar system solids, crystallizing 4567 Ma ago (Amelin et al., 2002; Connelly et al., 2012). The isotope systematics of CAIs therefore provide critical insight into the earliest history of the Solar System. Although Sm-Nd and Rb-Sr geochronometers are highly effective tools for investigating cosmochemical evolution in the early Solar System, previous studies of CAIs have revealed evidence for isotopically disturbed systems. Here we report new age data for Allende CAI Al3S4 derived from both the long-lived (147Sm-143Nd) and short-lived (146Sm-142Nd) isotopic systems. The 147Sm-143Nd chronometer yields an age of 4560 ± 34 Ma that is concordant with 207Pb-206Pb ages for CAIs and indicates that the Sm-Nd system was not significantly disturbed by secondary alteration or nucleosynthetic processes. The slope of the 146Sm-142Nd isochron defines the Solar System initial 146Sm/144Sm of 0.00828 ± 0.00044. This value is significantly different from the value of 0.0094 determined by Kinoshita et al. (2012). Ages recalculated from all published 146Sm-142Nd isochron data using the traditional 103 Ma half-life and the initial 146Sm/144Sm value determined here closely match Pb-Pb and 147Sm-143Nd ages determined on the same samples. In contrast, ages recalculated using the 68 Ma half-life determined by Kinoshita et al. (2012) and either of the initial 146Sm/144Sm values are often anomalously old. This is particularly true for the youngest samples with 146Sm-142Nd isochron ages that are most sensitive to the choice of 146Sm half-life used in the age calculation. In contrast to the Sm-Nd isotope system, the Rb-Sr system is affected by alteration but yields an apparent isochron with a slope corresponding to a much younger age of 4247 ± 110 Ma. Although the Rb-Sr system in CAIs appears to be disturbed, the initial 87Sr/86Sr value determined from the isochron is 0.698942 ± 0.000008, and closely approximates estimates of the initial Solar System value. Although this isochron may be a mixing line, it might also record alteration on the Allende parent body in which Rb was added to the Al3S4 CAI that was initially largely devoid of Rb.

  7. Anthropogenic dissolved and colloid/nanoparticle-bound samarium, lanthanum and gadolinium in the Rhine River and the impending destruction of the natural rare earth element distribution in rivers

    Science.gov (United States)

    Kulaksız, Serkan; Bau, Michael

    2013-01-01

    The strong increase in the consumption of rare earth elements (REE) in high-tech products and processes is accompanied by increasing amounts of REE released into the environment. Following the first report of Gd contamination of the hydrosphere in 1996, anthropogenic Gd originating from contrast agents has now been reported worldwide from river and estuarine waters, coastal seawater, groundwater and tap water. Recently, microcontamination with La, that is derived from a point source where catalysts for petroleum refining are produced, has been detected in the Rhine River in Germany and the Netherlands. Here we report the occurrence of yet another REE microcontamination of river water: in addition to anthropogenic Gd and La, the Rhine River now also shows significant amounts of anthropogenic Sm. The anthropogenic Sm, which enters the Rhine River north of Worms, Germany, with the same industrial wastewater that carries the anthropogenic La, can be traced through the Middle and Lower Rhine to the Netherlands. At Leverkusen, Germany, some 250 km downstream from the point source at Worms, anthropogenic Sm still contributes up to 87% of the total dissolved Sm concentration of the Rhine River. Results from ultrafiltration suggest that while the anthropogenic Gd is not particle-reactive and hence exclusively present in the truly dissolved REE pool (Worms get close to and well-above, respectively, the levels at which ecotoxicological effects have been documented. Because of the increasing use of REE and other formerly "exotic" trace elements in high-tech applications, these critical metals have now become emerging contaminants that should be monitored, and it appears that studies of their biogeochemical behavior in natural freshwaters might soon no longer be possible.

  8. Ultra-Sensitive Nano Optical Sensor Samarium-Doxycycline Doped in Sol Gel Matrix for Assessment of Glucose Oxidase Activity in Diabetics Disease.

    Science.gov (United States)

    Tharwat, Marwa M; Attia, M S; Alghamdi, M S; Mahros, Amr M

    2017-07-11

    A low cost and very sensitive method for the determination of the activity of glucose oxidase enzyme in different diabetics serum samples was developed. The method based on the assessment of the H2O2 concentration produced from the reaction of the glucose oxidase (GOx) enzyme with glucose as substrate in the serum of diabetics patients by nano optical sensor Sm-doxycycline doped in sol gel matrix. H2O2 enhances the luminescence intensity of all bands of the nano Sm-doxycycline complex [Sm-(DC)2](+) doped in sol-gel matrix, especially the 645 nm band at λex = 400 nm and pH 7.0 in water. The influence of the different analytical parameters that affect the luminescence intensity of the nano optical sensor, e.g. pH, H2O2 concentration and foreign ions concentrations were studied. The remarkable enhancement of the luminescence intensity of nano optical sensor [Sm-(DC)2](+) complex in water at 645 nm by the addition of various concentrations of H2O2 was successfully used as an optical sensor for the assessment of the activity of the glucose oxidase enzyme in different diabetics serum samples. The calibration plot was achieved over the activity range 0.1-240 U/L with a correlation coefficient of 0.999 and a detection limit of 0.05 U/L.

  9. Effect of Mg doping and sintering temperature on structural and morphological properties of samarium-doped ceria for IT-SOFC electrolyte

    Science.gov (United States)

    Ahmad, Syed Ismail; Mohammed, Tasneem; Bahafi, Amal; Suresh, Madireddy Buchi

    2017-06-01

    Samples of Sm and Mg co-doped ceria electrolyte of Ce1- x Sm x- y Mg y O2- δ ( x = 0.2; y = 0.00, 0.05, 0.1, 0.15, and 0.175) were synthesized by sol-gel process. The prepared samples were sintered at 1100 and 1400 °C for 4 h. The bulk densities were measured by Archimedes method. XRD measurements indicate that the synthesized samples were in single-phase cubic fluorite structure (space group Fm3m). The cell parameters decrease with the concentration of Mg, and 2 θ values slightly shift towards right. The particle sizes obtained were between 7.14 and 17.44 nm. The sintered sample achieved 95% of theoretical density. FTIR spectra of samples sintered at 1400 °C indicates weak interactions between 3550-3400 cm-1 and 1600-1300 cm-1 are attributed to O-H stretching modes and strong bonds 850-450 cm-1 are assigned to characteristic Ce-O vibrations. The surface morphology and chemical composition were analyzed by SEM and EDS, SEM micrographs show spherical faceted grains, and the samples were crack free, dense material with some pores on surface which are inconsistent with density results. The average grain size obtained was 0.5 μm. Particle size obtained by TEM was in agreement with that obtained by XRD. The high-density ceria co-doped ceramic can be used as electrolyte in SOFC.

  10. Synthesis, spectroscopic, thermal and antimicrobial studies of neodymium(III) and samarium(III) complexes derived from tetradentate ligands containing N and S donor atoms

    Science.gov (United States)

    Ain, Qurratul; Pandey, S. K.; Pandey, O. P.; Sengupta, S. K.

    2015-04-01

    Trivalent lanthanide complexes of the type [Ln(L)Cl(H2O)2] (where Ln = Nd(III) or Sm(III) and LH2 = Schiff bases derived by the condensation of 3-(phenyl/substitutedphenyl)-4-amino-5-mercapto-1,2,4-triazole with diacetyl/benzil) have been synthesized by the reactions of anhydrous lanthanide(III) chloride with Schiff bases in methanol. The structures of the complexes have been proposed on the basis of elemental analysis, electrical conductance, magnetic moment, spectroscopic measurements (IR, 1H, 13C NMR and UV-vis spectra) and X-ray diffraction studies. The spectral data reveal that the Schiff base ligands behave as dibasic tetradentate chelating agents having coordination sites at two thiol sulfur atoms and two azomethine nitrogen atoms. The presence of coordinated water in metal complexes was confirmed by thermal and IR data of the complexes. All the Schiff bases and their metal complexes have also been screened for their antibacterial activity against Bacillus subtilis, Staphylococcus aureus and antifungal activities against Aspergillus niger, Curvularia pallescens and Colletotrichum capsici.

  11. Logarithmic temperature dependence of samarium ion valence in the heavy-fermion S mxL a1 -xO s4S b12

    Science.gov (United States)

    Fushiya, Kengo; Miyazaki, Ryoichi; Higashinaka, Ryuji; Yamada, Akira; Mizumaki, Masaichiro; Tsutsui, Satoshi; Nitta, Kiyofumi; Uruga, Tomoya; Suemitsu, Bunya; Sato, Hideyuki; Aoki, Yuji

    2015-08-01

    We have measured x-ray absorption spectra at the Sm L3 edge to investigate the Sm-ion valence of (S mxL a1 -x) O s4S b12 , in which field-insensitive heavy-fermion behavior appears at low temperatures for x =1 . It has been found that the Sm-ion valance shifts to 2 + with La ion substitution; from v =+2.78 (x =1 ) to v =+2.73 (x =0.2 ) at 10 K. For all x investigated, its temperature dependence shows a logT behavior, indicating that the valence change is caused by "an unconventional Kondo effect" associated with Sm 4 f -electron charge degrees of freedom. Almost x independence of "the associated Kondo temperature" (T˜K=56 ±10 K ) indicates that the Kondo effect has a local nature, attributable to the cage structure of the filled skutterudite.

  12. Rare earth elements in the aragonitic shell of freshwater mussel Corbicula fluminea and the bioavailability of anthropogenic lanthanum, samarium and gadolinium in river water

    Energy Technology Data Exchange (ETDEWEB)

    Merschel, Gila, E-mail: g.merschel@jacobs-university.de; Bau, Michael

    2015-11-15

    High-technology metals — such as the rare earth elements (REE) — have become emerging contaminants in the hydrosphere, yet little is known about their bioavailability. The Rhine River and the Weser River in Germany are two prime examples of rivers that are subjected to anthropogenic REE input. While both rivers carry significant loads of anthropogenic Gd, originating from contrast agents used for magnetic resonance imaging, the Rhine River also carries large amounts of anthropogenic La and lately Sm which are discharged into the river from an industrial point source. Here, we assess the bioavailability of these anthropogenic microcontaminants in these rivers by analyzing the aragonitic shells of the freshwater bivalve Corbicula fluminea. Concentrations of purely geogenic REE in shells of comparable size cover a wide range of about one order of magnitude between different sampling sites. At a given sampling site, geogenic REE concentrations depend on shell size, i.e. mussel age. Although both rivers show large positive Gd anomalies in their dissolved loads, no anomalous enrichment of Gd relative to the geogenic REE can be observed in any of the analyzed shells. This indicates that the speciations of geogenic and anthropogenic Gd in the river water differ from each other and that the geogenic, but not the anthropogenic Gd is incorporated into the shells. In contrast, all shells sampled at sites downstream of the industrial point source of anthropogenic La and Sm in the Rhine River show positive La and Sm anomalies, revealing that these anthropogenic REE are bioavailable. Only little is known about the effects of long-term exposure to dissolved REE and their general ecotoxicity, but considering that anthropogenic Gd and even La have already been identified in German tap water and that anthropogenic La and Sm are bioavailable, this should be monitored and investigated further. - Highlights: • Corbicula fluminea shells are bioarchives of dissolved geogenic REE in rivers. • Anthropogenic La and Sm in the Rhine River are bioavailable, hence incorporated. • Anthropogenic Gd from contrast agents is not incorporated, i.e. not bioavailable. • REE concentrations in Corbicula shells decrease with increasing size, i.e. age.

  13. Mechanically induced strong red emission in samarium ions doped piezoelectric semiconductor CaZnOS for dynamic pressure sensing and imaging

    Science.gov (United States)

    Wang, Wei; Peng, Dengfeng; Zhang, Hanlu; Yang, Xiaohong; Pan, Caofeng

    2017-07-01

    Piezoelectric semiconductor with optical, electrical and mechanical multifunctions has great potential applications in future optoelectronic devices. The rich properties and applications mainly encompass the intrinsic structures and their coupling effects. Here, we report that lanthanide ions doped piezoelectric semiconductor CaZnOS:Sm3+ showing strong red emission induced by dynamic mechanical stress. Under moderate mechanical load, the doped piezoelectric semiconductor exhibits strong visible red emission to the naked eyes even under the day light. A flexible dynamic pressure sensor device is fabricated based on the prepared CaZnOS:Sm3+ powders. The mechanical-induced emission properties of the device are investigated by the optical fiber spectrometer. The linear characteristic emissions are attributed to the 4G5/2→6H5/2 (566 nm), 4G5/2→6H7/2 (580-632 nm), 4G5/2→6H9/2 (653-673 nm) and 4G5/2→6H11/2 (712-735 nm) f-f transitions of Sm3+ ions. The integral emission intensity is proportional to the value of applied pressure. By using the linear relationship between integrated emission intensity and the dynamic pressure, the real-time pressure distribution is visualized and recorded. Our results highlight that the incorporation of lanthanide luminescent ions into piezoelectric semiconductors as smart materials could be applied into the flexible mechanical-optical sensor device without additional auxiliary power, which has great potential for promising applications such as mapping of personalized handwriting, smart display, and human machine interface.

  14. Investigation of oxidative coupling of methane over bismuth oxychloride, samarium chloride, or manganese chloride supported on lithium carbonate-magnesia systems

    Energy Technology Data Exchange (ETDEWEB)

    Khan, A.Z.; Ruckenstein, E. (State Univ. of New York, Buffalo, NY (United States))

    1992-11-01

    The magnesia-supported bismuth oxychloride with lithium carbonate present is significantly more effective and stable with time-on-stream than the unsupported or supported systems free of Li[sub 2]CO[sub 3] in the oxidative coupling of methane at 750[degrees]C, P[sub CH[sub 4

  15. Rare earth elements in the aragonitic shell of freshwater mussel Corbicula fluminea and the bioavailability of anthropogenic lanthanum, samarium and gadolinium in river water.

    Science.gov (United States)

    Merschel, Gila; Bau, Michael

    2015-11-15

    High-technology metals - such as the rare earth elements (REE) - have become emerging contaminants in the hydrosphere, yet little is known about their bioavailability. The Rhine River and the Weser River in Germany are two prime examples of rivers that are subjected to anthropogenic REE input. While both rivers carry significant loads of anthropogenic Gd, originating from contrast agents used for magnetic resonance imaging, the Rhine River also carries large amounts of anthropogenic La and lately Sm which are discharged into the river from an industrial point source. Here, we assess the bioavailability of these anthropogenic microcontaminants in these rivers by analyzing the aragonitic shells of the freshwater bivalve Corbicula fluminea. Concentrations of purely geogenic REE in shells of comparable size cover a wide range of about one order of magnitude between different sampling sites. At a given sampling site, geogenic REE concentrations depend on shell size, i.e. mussel age. Although both rivers show large positive Gd anomalies in their dissolved loads, no anomalous enrichment of Gd relative to the geogenic REE can be observed in any of the analyzed shells. This indicates that the speciations of geogenic and anthropogenic Gd in the river water differ from each other and that the geogenic, but not the anthropogenic Gd is incorporated into the shells. In contrast, all shells sampled at sites downstream of the industrial point source of anthropogenic La and Sm in the Rhine River show positive La and Sm anomalies, revealing that these anthropogenic REE are bioavailable. Only little is known about the effects of long-term exposure to dissolved REE and their general ecotoxicity, but considering that anthropogenic Gd and even La have already been identified in German tap water and that anthropogenic La and Sm are bioavailable, this should be monitored and investigated further. Copyright © 2015 Elsevier B.V. All rights reserved.

  16. Samario-153-Lexidronam (EDTMP) en el tratamiento de las metástasis óseas Samarium-153-Lexidronam (EDTMP) for the management of bone metastases

    OpenAIRE

    F. Torre; C. Gómez-Vega; A. Callejo; J. Genolla

    2004-01-01

    Las metástasis óseas son una complicación frecuente en pacientes neoplásicos, en este sentido, el tejido óseo ocupa el tercer lugar de todos los órganos y sistemas con metástasis después del pulmón e hígado. Aproximadamente un 75% de los enfermos con metástasis óseas sufrirán dolor, siendo estas la causa más frecuente de dolor en pacientes con cáncer. El dolor óseo aumenta con los movimientos y a la presión, limitando la autonomía del enfermo y su calidad de vida. El tratamiento incluye vario...

  17. Morphology and orientation of β-BaB{sub 2}O{sub 4} crystals patterned by laser in the inside of samarium barium borate glass

    Energy Technology Data Exchange (ETDEWEB)

    Nishii, Akihito; Shinozaki, Kenji; Honma, Tsuyoshi; Komatsu, Takayuki, E-mail: komatsu@mst.nagaokaut.ac.jp

    2015-01-15

    Nonlinear optical β-BaB{sub 2}O{sub 4} crystal lines (β-BBO) were patterned in the inside of 8Sm{sub 2}O{sub 3}–42BaO–50B{sub 2}O{sub 3} glass by irradiations of continuous-wave Yb:YVO{sub 4} lasers with a wavelength of 1080 nm (power: P=0.8–1.0 W, scanning speed: S=0.2–2.5 μm/s), in which the laser focal position was moved gradually from the surface to the inside. The morphology, size, and orientation of β-BBO crystals were examined from polarization optical microscope and birefringence imaging observations. It was demonstrated that c-axis oriented β-BBO crystals with long lengths (e.g., 20 mm) were patterned in the inside of the glass. The morphology of β-BBO in the cross-section of lines was a rectangular shape with rounded corners, and the volume of β-BBO formed increased with increasing laser power and with decreasing laser scanning speed. The maximum depth in the inside from the surface for β-BBO patterning increased with increasing laser power, e.g., D{sub max}∼100 μm at P=0.8 W, D{sub max}∼170 μm at P=0.9 W, and D{sub max}∼200 μm at P=1 W. The present study proposes that the laser-induced crystallization opens a new door for applied engineering in glassy solids. - Graphical abstract: This figure shows the POM photographs for β-BaB{sub 2}O{sub 4} crystal lines patterned by cw Yb:YVO{sub 4} fiber laser irradiations with a laser power of P=0.8 W and a laser scanning speed S=2 μm/s in the glass. The laser focal point was moved gradually from the surface into the inside. The results shown in Fig. 1 demonstrate that it is possible to pattern highly oriented β-BaB{sub 2}O{sub 4} crystals even in the inside of glasses. - Highlights: • β-BaB{sub 2}O{sub 4} crystal lines were patterned in the inside of a glass by lasers. • Laser focal position was moved gradually from the surface to the inside. • Birefringence imaging was observed. • Morphology, size, and orientation of crystals were clarified. • Crystal lines with long lengths (e.g., 20 mm) were patterned at the depth of 200 μm.

  18. 10 CFR Appendix C to Part 20 - Quantities 1 of Licensed Material Requiring Labeling

    Science.gov (United States)

    2010-01-01

    ... Samarium-151 10 Samarium-153 100 Samarium-155 1,000 Samarium-156 1,000 Europium-145 100 Europium-146 100 Europium-147 100 Europium-148 10 Europium-149 100 Europium-150 (12.62h) 100 Europium-150 (34.2y) 1 Europium-152m 100 Europium-152 1 Europium-154 1 Europium-155 10 Europium-156 100 Europium-157 100 Europium-158 1...

  19. An experiment using neutron activation analysis and a rare earth element to mark cotton plants and two insects that feed on them

    Energy Technology Data Exchange (ETDEWEB)

    Showler, Allan T. [USDA-ARS IFNRRU, Kika de la Garza Subtropical Agricultural Research Center, 2413 East Highway 83, Weslaco, TX 78596 (United States)]. E-mail: ashowler@weslaco.ars.usda.gov; James, William D. [Elemental Analysis Laboratory, 3144 Texas A and M University, College Station, TX 77843-3144 (United States); Armstrong, John S. [USDA-ARS BIRU, Kika de la Garza Subtropical Agricultural Research Center, 2413 East Highway 83, Weslaco, TX 78596 (United States); Westbrook, John K. [USDA-ARS APMRU, 2771 F and B Road, College Station, TX 77845-4966 (United States)

    2006-08-15

    Studies on insect dispersal and other behaviors can benefit from using markers that will not alter flight and fitness. Rare earth elements, such as samarium (Sm), have been used as ingested markers of some insects and detected using neutron activation analysis (NAA). In this study, samarium nitrate hexahydrate was mixed into artificial diet for boll weevils, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), at different dosages and in water used to irrigate cotton, Gossypium hirsutum L. Samarium was detected in adult boll weevils fed on the samarium-labeled diet, but not after 5 or 10 days of being switched to non-labeled diet, even if the insects were given labeled diet for as long as 7 consecutive days. Introduced in irrigation water, 1% samarium (m/m) was detectable in cotton squares and leaf tissue. However, boll weevil adults fed samarium-labeled squares did not retain detectable levels of samarium, nor did boll weevil adults reared to adulthood from samarium-labeled squares. Fourth instar beet armyworms, Spodoptera exigua (Huebner) (Noctuidae: Lepidoptera), fed on samarium-labeled cotton leaves obtained enough samarium for NAA detection, but adult moths reared from them did not have detectable amounts of samarium. Although samarium can be useful as a marker when insects are presented with a continuous pulse of the label, elements that are assimilated by the insect would be more useful if a continuous infusion of the marker cannot be provided.

  20. SU-E-J-138: On the Ion Beam Range and Dose Verification in Hadron Therapy Using Sound Waves

    Energy Technology Data Exchange (ETDEWEB)

    Fourkal, E [Fox Chase Cancer Center, Philadelphia, PA (United States); Allegheny General Hospital, Pittsburgh, PA (United States); Veltchev, I [Fox Chase Cancer Center, Philadelphia, PA (United States); Gayou, O [Allegheny General Hospital, Pittsburgh, PA (United States); Nahirnyak, V [Bukovinian State Medical University, Chernivtsi (Ukraine)

    2015-06-15

    Purpose: Accurate range verification is of great importance to fully exploit the potential benefits of ion beam therapies. Current research efforts on this topic include the use of PET imaging of induced activity, detection of emerging prompt gamma rays or secondary particles. It has also been suggested recently to detect the ultrasound waves emitted through the ion energy absorption process. The energy absorbed in a medium is dissipated as heat, followed by thermal expansion that leads to generation of acoustic waves. By using an array of ultrasound transducers the precise spatial location of the Bragg peak can be obtained. The shape and intensity of the emitted ultrasound pulse depend on several variables including the absorbed energy and the pulse length. The main objective of this work is to understand how the ultrasound wave amplitude and shape depend on the initial ion energy and intensity. This would help guide future experiments in ionoacoustic imaging. Methods: The absorbed energy density for protons and carbon ions of different energy and field sizes were obtained using Fluka Monte Carlo code. Subsequently, the system of coupled equations for temperature and pressure is solved for different ion pulse intensities and lengths to obtain the pressure wave shape, amplitude and spectral distribution. Results: The proposed calculations show that the excited pressure wave amplitude is proportional to the absorbed energy density and for longer ion pulses inversely proportional to the ion pulse duration. It is also shown that the resulting ionoacoustic pressure distribution depends on both ion pulse duration and time between the pulses. Conclusion: The Bragg peak localization using ionoacoustic signal may eventually lead to the development of an alternative imaging method with sub-millimeter resolution. It may also open a way for in-vivo dose verification from the measured acoustic signal.

  1. SU-F-J-138: An Extension of PCA-Based Respiratory Deformation Modeling Via Multi-Linear Decomposition

    Energy Technology Data Exchange (ETDEWEB)

    Iliopoulos, AS; Sun, X [Duke University, Durham, North Carolina (United States); Pitsianis, N [Aristotle University of Thessaloniki (Greece); Duke University, Durham, North Carolina (United States); Yin, FF; Ren, L

    2016-06-15

    Purpose: To address and lift the limited degree of freedom (DoF) of globally bilinear motion components such as those based on principal components analysis (PCA), for encoding and modeling volumetric deformation motion. Methods: We provide a systematic approach to obtaining a multi-linear decomposition (MLD) and associated motion model from deformation vector field (DVF) data. We had previously introduced MLD for capturing multi-way relationships between DVF variables, without being restricted by the bilinear component format of PCA-based models. PCA-based modeling is commonly used for encoding patient-specific deformation as per planning 4D-CT images, and aiding on-board motion estimation during radiotherapy. However, the bilinear space-time decomposition inherently limits the DoF of such models by the small number of respiratory phases. While this limit is not reached in model studies using analytical or digital phantoms with low-rank motion, it compromises modeling power in the presence of relative motion, asymmetries and hysteresis, etc, which are often observed in patient data. Specifically, a low-DoF model will spuriously couple incoherent motion components, compromising its adaptability to on-board deformation changes. By the multi-linear format of extracted motion components, MLD-based models can encode higher-DoF deformation structure. Results: We conduct mathematical and experimental comparisons between PCA- and MLD-based models. A set of temporally-sampled analytical trajectories provides a synthetic, high-rank DVF; trajectories correspond to respiratory and cardiac motion factors, including different relative frequencies and spatial variations. Additionally, a digital XCAT phantom is used to simulate a lung lesion deforming incoherently with respect to the body, which adheres to a simple respiratory trend. In both cases, coupling of incoherent motion components due to a low model DoF is clearly demonstrated. Conclusion: Multi-linear decomposition can enable decoupling of distinct motion factors in high-rank DVF measurements. This may improve motion model expressiveness and adaptability to on-board deformation, aiding model-based image reconstruction for target verification. NIH Grant No. R01-184173.

  2. Working Paper 138 - Economic Policy and Institutional Factors in the Development of Domestic Bond Markets in the CFA Zone

    OpenAIRE

    Cédric Achille Mbeng Mezui

    2011-01-01

    L'objectif principal de ce papier est de mettre en évidence le rôle de la politique économique et des facteurs institutionnels dans le développement des marchés obligataires en monnaie locale dans les pays de la zone Franc CFA. Nous constatons d’une part que ces pays ne remplissent pas la plupart des préconditions macroéconomiques et microéconomiques, d’autre part que l’état actuel des facteurs institutionnels est un frein au développement de leurs marchés. L’analyse économétrique par la méth...

  3. Complex biallelic IGH rearrangements in IgM-expressing Z-138 cell line : Involvement of downstream immunoglobulin class switch recombination

    NARCIS (Netherlands)

    Guikema, JEJ; Fenton, JAL; de Boer, C; Kleiverda, K; Brink, AATP; Raap, AK; Estrov, Z; Schuuring, E; Kluin, PM

    Chromosomal translocations involving the immunoglobulin (Ig) receptor loci usually disrupt and silence these loci. On the basis of observations in follicular lymphoma (FL) with downstream Ig heavy chain (IGH) class switch recombination (CSR), we hypothesized that downstream CSR-mediated chromosomal

  4. 40 CFR 49.138 - Rule for the registration of air pollution sources and the reporting of emissions.

    Science.gov (United States)

    2010-07-01

    ... residential buildings with four or fewer dwelling units; (4) Air conditioning units used for human comfort...) Ventilating units used for human comfort that do not exhaust air pollutants into the atmosphere from any... heat input capacity of less than 400,000 British thermal units (Btu) per hour; (7) Cooking of food...

  5. 76 FR 19744 - Final Tropic to Hatch 138 kV Transmission Line Project Environmental Impact Statement and...

    Science.gov (United States)

    2011-04-08

    ... School and Institutional Trust Lands Administration; and potentially the National Park Service, Bryce..., potential Bryce Canyon National Park issuance of a special park permit for a right-of-way, and Utah School... approximate three and three-quarter mile path through an area currently designated as Primitive Zone in the...

  6. Influence of reverted austenite on static and dynamic mechanical properties of a PH 13-8 Mo maraging steel

    Energy Technology Data Exchange (ETDEWEB)

    Schnitzer, Ronald, E-mail: ronald.schnitzer@unileoben.ac.at [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Zickler, Gerald A. [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Lach, Erhardt [ISL, French-German Research Institute of Saint-Louis, P.O. Box 70034, F-68301 Saint-Louis (France); Clemens, Helmut [Department of Physical Metallurgy and Materials Testing, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Zinner, Silvia [Boehler Edelstahl GmbH and Co KG, Mariazeller Strasse 25, A-8605 Kapfenberg (Austria); Lippmann, Thomas [GKSS Research Center Geesthacht, Max-Planck-Strasse 1, D-21502 Geesthacht (Germany); Leitner, Harald [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Department of Physical Metallurgy and Materials Testing, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria)

    2010-03-25

    Maraging steels are martensitic hardenable steels exhibiting an excellent combination of high strength and adequate toughness. Beside the intermetallic precipitates, reverted austenite, formed during aging, is a decisive microstructural constituent. Static tensile tests showed a pronounced influence of its phase fraction on mechanical properties. Reverted austenite also exhibits a distinctive effect on dynamic properties which were investigated on a split-Hopkinson-pressure-bar. However, reverted austenite is not mechanically stable during external loading and transforms back to martensite. This behavior was investigated by in situ X-ray diffraction using synchrotron radiation. Here, a decreasing phase fraction of austenite with increasing strain was observed. Furthermore, a change of the stability of revered austenite with aging time was noticed.

  7. Research and Development of 2-frequency (110/138 GHz FADIS for JT-60SA ECHCD system

    Directory of Open Access Journals (Sweden)

    Idei H.

    2015-01-01

    Full Text Available A FAst DIrectional Switch (FADIS of 2-frequency (2-ƒ gyrotron system for the JT-60SA project is being developed under collaboration between Japan Atomic Energy Agency (JAEA and Kyushu University. At first, the frequency drift and dip in the gyrotron operation were measured to consider which kind of FADIS is preferred for application in the Electron Cyclotron Heating and Current Drive (ECHCD system for the JT- 60SA. Various types of the FADIS have been considered. A square corrugated waveguide diplexer system with double resonant rings was considered as one of the most attractive FADIS systems for stable high-power and long-pulse operations in the 2-ƒ JT-60SA ECHCD system.

  8. InP nanowire array solar cells achieving 13.8% efficiency by exceeding the ray optics limit

    National Research Council Canada - National Science Library

    Wallentin, Jesper; Anttu, Nicklas; Asoli, Damir; Huffman, Maria; Aberg, Ingvar; Magnusson, Martin H; Siefer, Gerald; Fuss-Kailuweit, Peter; Dimroth, Frank; Witzigmann, Bernd; Xu, H Q; Samuelson, Lars; Deppert, Knut; Borgström, Magnus T

    2013-01-01

    .... We fabricated a variety of millimeter-sized arrays of p-type/intrinsic/n-type (p-i-n) doped InP nanowires and found that the nanowire diameter and the length of the top n-segment were critical for cell performance...

  9. 75 FR 54921 - Withdrawal of Regulatory Guides 1.38, 1.94, and 1.116

    Science.gov (United States)

    2010-09-09

    ....38 endorses the American Society of Mechanical Engineers (ASME) American National Standard Institute... endorses the ASME/ANSI Standard N45.2.5-- 1974, ``Supplementary Quality Assurance Requirements for... ASME/ANSI Standard N45.2--1975, ``Supplementary Quality Assurance Requirements for Installation...

  10. Pierre Bourdieu. Sobre la televisión : Editorial Anagrama, Barcelona, 1997, 138 págs.

    OpenAIRE

    Agüero, Luciana; Ferrandi, María Laura

    1999-01-01

    Este libro consta de dos conferencias televisadas dadas por Pierre Bourdieu en el Collège de France en 1996 y retransmitidas por París Première en el mismo año. En los anexos, aparecen dos artículos que presentan de forma más rigurosa los temas desarrollados en las conferencias. Bourdieu enmarca este trabajo Sobre la Televisión en su teoría social, en la que sustituye la noción hueca de sociedad por las de campo y espacio social que no consiste en una totalidad única integrada sino que, más b...

  11. Danish singles have a twofold risk of acute coronary syndrome: data from a cohort of 138 290 persons

    DEFF Research Database (Denmark)

    Nielsen, Kirsten Melgaard; Færgeman, Ole; Larsen, Mogens Lytken

    2006-01-01

    STUDY OBJECTIVE: Atherosclerosis of the coronary and other arteries is an important health problem in virtually all countries of the world, and thus there is a persisting need for the development of preventive programmes including population risk group identification. The aim of the study......-69 years. Information on population members' individual age, sex, social background, and eventual death was obtained from Danish Population Registers. SETTING: University hospital. PATIENTS: The study prospectively identified 646 victims of ACS from 1 April 2000 to 31 March 2002. MAIN RESULTS: Based......, but they accounted for 34.3% and 62.4% of ACS patients dying within 30 days. CONCLUSIONS: Single living is associated with an increased risk of ACS. Thus, risk groups identified by use of information on their age and family structure may be targets for future more focused and cost effective preventive strategies...

  12. Laboratory analysis of naturally aged silicone rubber polymer insulators from contaminated environments, 138 to 765 kV

    Energy Technology Data Exchange (ETDEWEB)

    Hill, R.J. [Reliable Power Products, Franklin Park, IL (United States)

    1994-12-31

    Silicone rubber housed non-ceramic insulators were studied after field aging in various service environments for periods of from 7 years to more than 10 years. The condition of the aged silicone rubber was compared to that of new material, focusing on the characteristics of hydrophobicity recovery and contaminant encapsulation by low molecular weight polymer. The field aged materials are shown to exhibit hydrophobicity characteristics comparable to those of new, unaged silicone rubber.

  13. Gross karyotypic and phenotypic alterations among different progenies of the Candida glabrata CBS138/ATCC2001 reference strain

    NARCIS (Netherlands)

    Bader, O.; Schwarz, A.; Kraneveld, E.A.; Tangwattanchuleeporn, M.; Schmidt, P.; Jacobsen, M.D.; Gross, U.; de Groot, P.J.W.; Weig, M.

    2012-01-01

    Genomic plasticity is a mechanism for adaptation to environmental cues such as host responses and antifungal drug pressure in many fungi including the human pathogenic yeast Candida glabrata. In this study we evaluated the phenotypic and genotypic stability of the world-wide used C. glabrata

  14. Quantification of bone marrow plasma cell infiltration in multiple myeloma : Usefulness of bone marrow aspirate clot with CD138 immunohistochemistry

    NARCIS (Netherlands)

    Matsue, Kosei; Matsue, Yuya; Kumata, Kaoru; Usui, Yoshiaki; Suehara, Yasuhito; Fukumoto, Kota; Fujisawa, Manabu; Narita, Kentaro; Takeuchi, Masami

    Accurate quantification of plasma cells (PCs) in bone marrow (BM) is critical for diagnosis and assessment of treatment response in patients with multiple myeloma (MM). We compared the % of BM PC quantified by 250 cell differential count on May–Giemsa-stained BM smears, by counting 500 – 2500 cells

  15. Estimating the incidence of the acute coronary syndrome: data from a Danish cohort of 138 290 persons

    DEFF Research Database (Denmark)

    Nielsen, Kirsten Melgaard; Foldspang, Anders; Larsen, Mogens Lytken

    2007-01-01

    BACKGROUND: Estimates of incidence are crucial to the planning of public health measures, but most studies of incidence of, for example, acute myocardial infarction (MI) are troubled by methodological problems such as; (i) selection biases of the patients being included for study, (ii) lack...

  16. Obtention of Samarium and Gadolinium concentrates by solvent extraction using mono-2-ethylhexyl ester of 2-ethylhexyl phosphonic acid; Obtencao de concentrados de samario e gadolinio via extracao por solventes com o ester mono-2-etilhexil do acido 2-etilhexilfosfonico

    Energy Technology Data Exchange (ETDEWEB)

    Miranda Junior, Pedro

    1996-07-01

    The rare earth chlorides solution employed in this study, which is constituted by medium and heavy fractions, is derived from monazite processing accomplished by NUCLEMON-Mineroquimica (SP). This solution shows an acidity about 1.18 M and 189 g/L of rare earth oxides, containing as main constituents: Sm(34.55%), Gd(23.85%), Dy (6.82%), and Y (24.45%). It was used, as organic phase, 2-ethylhexyl phosphonic acid, mono-2-ethylhexylester diluted to 1 M in isododecane. (author)

  17. Poly(dl)lactic acid/polyglycolic acid/iron and poly(dl)lactic acid/polyglycolic acid/samarium cobalt composites for use as a delivery mechanism for magnetically directed chondrogenesis

    Science.gov (United States)

    Oppermann, Dean Alan

    Magnetically directed chondrogenesis (MDC) is a fundamental approach to articular cartilage repair. In MDC a magnet is implanted into the subchondral trabecular bone underlying a cartilage defect and used to attract chondrocytes, magnetically tagged with Fe nanoparticles, to the defect site. Pilot studies by Halpern, Crimp and Grande, using solid neodymium (Nd) magnets, indicated optimistic results by producing a hyaline-like articular cartilage after 8 weeks implantation. Since solid Nd magnets introduce long-term biocompatibility issues, the focus of this dissertation was to develop P(dl)A/PGA/Fe and P(dl)A/PGA/SmCo 5 implants for use in MDC. The effect of implant porosity, implant composition and magnetic material (Fe or SmCo5) on the initial and degraded magnetic properties were evaluated. The biocompatibility of P(dl)A/PGA/Fe implants were investigated by implantation into New Zealand white rabbits for 8 weeks. The effect of hydrogen peroxide (H2O2) and ethylene oxide (EO) sterilization techniques on the molecular weight and chemical structure of P(dl)A/PGA polymers were evaluated using gel permeation chromatography and Fourier transform infrared spectroscopy. The effect of implant morphology, size and number on the von Mises stress in the trabecular bone surrounding the implant was evaluated using a finite element model. In general, SmCo5 implants resulted in higher magnetic fields initially and after 8 weeks of degradation than comparable Fe implants. Increases in magnetic field strength were achieved by increasing the volume fraction of magnetic material and by increasing the PGA concentration. The magnetic field strength degradation rate decreased with increases in volume fraction of magnetic material and increases in PLA concentration. Implantation studies indicated that 50/50 P(dl)A/PGA were more bioactive than 75/25 P(dl)A/PGA with an increased cellular response that is specific to bone growth. The compressive strength and elastic modulus of porous implants were comparable to trabecular bone, and the compressive strength and elastic modulus of solid implants was higher than trabecular bone but less than cortical bone. Finite element modeling showed that the implantation of solid and porous P(dl)A/PGA/Fe implants did not significantly increase the von Mises stress concentration adjacent to the implant. The von Mises stress surrounding porous implants was higher than the solid implants which predicts faster bone remodeling. Comparing single implants to multiple implants indicated a significant decrease in von Mises stress between the implants. This would predict bone resorption in that area. H2O2 sterilization resulted in a gradual decrease in the molecular weight of P(dl)A/PGA polymers that was a result of hydrolytic scission of the ester bonds present between the individual monomers. The polymers were less affected by EO sterilization with only the 75/25 P(dl)A/PGA, indicating a decrease in molecular weight. From these results, it was concluded that solid 50/50 P(dl)A/PGA/SmCo 5 implants that span the entire width of the cartilage defect should be used to optimize the attraction potential and bioactivity of the implant. Also ethylene oxide, which caused less premature implant degradation, should be used for sterilization.

  18. Fabrication of a new samarium(III) ion-selective electrode based on 3-{l_brace}[2-oxo-1(2h)-acenaphthylenyliden]amino{r_brace}-2-thioxo -1,3-thiazolidin-4-one

    Energy Technology Data Exchange (ETDEWEB)

    Zamani, Hassan Ali [Islamic Azad University, Quchan (Iran, islamic Republic of). Quchan Branch. Dept. of Chemistry]. E-mail: haszamani@yahoo.com; Ganjali, Mohammad Reza [Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of). Endocrine and Metabolism Research Center; Adib, Mehdi [University of Tehran, Tehran (Iran, Islamic Republic of). Faculty of Chemistry. Center of Excellence in Electrochemistry

    2007-07-01

    This paper introduces the development of an original PVC membrane electrode, based on 3-{l_brace}[2-oxo-1(2H)-acenaphthylenyliden]amino{r_brace}-2-thioxo-1,3-thiazolidin-4-one (ATTO) which has revealed to be a suitable carrier for Sm{sup 3+} ions. The resulting data illustrated that the electrode shows a Nernstian slope of 19.3 {+-} 0.6 mV per decade for Sm{sup 3+} ions over a broad working concentration range of 1.0 X 10{sup -6} to 1.0 X 10{sup -1} mol L{sup -1}. The lower detection limit was found to be equal to (5.5{+-} 0.3) X 10{sup -7} mol L{sup -}'1 in the pH range of 3.5-7.5, and the response time was very short ({approx}10 s). The potentiometric sensor displayed good selectivities for a number of cations such as alkali, alkaline earth, transition and heavy metal ions. (author)

  19. BASIC RESEARCH ON THE SEPARATION OF SCANDIUM YTTRIUM, AND THE RARE EARTHS BY SOLVENT EXTRACTION.

    Science.gov (United States)

    RARE EARTH ELEMENTS, * SOLVENT EXTRACTION ), (*CHELATE COMPOUNDS, RARE EARTH ELEMENTS), PURIFICATION, ATOMIC SPECTROSCOPY, SCANDIUM, YTTRIUM, PRASEODYMIUM, SAMARIUM, EUROPIUM, GADOLINIUM, TERBIUM, FLUORINE COMPOUNDS, KETONES

  20. The Biopolitics of Lifestyle: Foucault, Ethics and Healthy Choices : Christopher Mayes, 2016, Routledge (Oxford and New York, 978-1-138-93386-6, 156 pp.).

    Science.gov (United States)

    Cooper, Andrew

    2017-03-01

    Unlike many recent studies on the notion of lifestyle, Christopher Mayes' The Biopolitics of Lifestyle balances theoretical rigour with empirical investigation to problematize the use of lifestyle in public health strategies. Not only does Mayes' book expose the unjustified emphasis on individual autonomy undergirding neoliberal strategies of governance and contemporary ethical theory, it also marks a significant step forward in enhancing our understanding of one of Foucault's most underappreciated concepts, the dispositif. In clearly framing the import of Foucaultian analysis and placing it against the backdrop of the obesity epidemic, Mayes continues his contributions towards a productive space wherein practitioners, social theorists, and ethicists can genuinely and self-reflectively exchange knowledges in order to respond to living issues of ethical import.

  1. Towards Understanding Life Cycle Saving Of Boundedly Rational Agents : A Model With Feasibility Goals - Replaced by CentER Discussion Paper 2010-138

    NARCIS (Netherlands)

    Binswanger, J.

    2008-01-01

    This paper develops a new life cycle model that aims to describe the savings and asset allocation decisions of boundedly rational agents. The paper’s main theoretical contribution is the provision of a simple, tractable and parsimonious framework within which agents make forward looking decisions in

  2. An assessment of the most reliable method to estimate the sagittal alignment of the cervical spine: analysis of a prospective cohort of 138 cases

    NARCIS (Netherlands)

    Donk, R.D.; Fehlings, M.G.; Verhagen, W.I.; Arnts, H.; Groenewoud, H.; Verbeek, A.L.M.; Bartels, R.H.M.A.

    2017-01-01

    OBJECTIVE Although there is increasing recognition of the importance of cervical spinal sagittal balance, there is a lack of consensus as to the optimal method to accurately assess the cervical sagittal alignment. Cervical alignment is important for surgical decision making. Sagittal balance of the

  3. Magnetic Moments of Coulomb Excited $2^{+}_{1}$ States for Radioactive Beams of $^{132,134,136}$Te and $^{138}$Xe Isotopes at REX-ISOLDE

    CERN Multimedia

    Kroell, T; Leske, J

    2002-01-01

    Magnetic moments are an indispensable source of information on the microscopic structure of atomic nuclei. It results from the fundamental difference of the spin $g$ factors of protons and neutrons, in $sign$ and $magnitude$, $\\textit{g}_{s}(\\pi)$ = +5.586 and $g_s(\

  4. The effect of calcium ions on adhesion and competitive exclusion of Lactobacillus ssp. and E. coli O138

    DEFF Research Database (Denmark)

    Larsen, Nadja; Nissen, Peter; Willats, William G.T.

    2007-01-01

    The adhesion abilities of 11 strains of Lactobacillus were determined in vitro using the IPEC-J2 cell line as a model system. Bacteria cultures included the probiotic strains L. rhamnosus GG, L. reuteri ATCC 55730, L. johnsonii NCC 533 and L. reuteri DSM 12246, and new isolates of Lactobacillus ssp....... Adhesion was quantified by scintillation counting of radiolabelled bound bacteria. The highest adhesion of 38%, was determined for L. reuteri DSM 12246 followed by L. plantarum Q47 with an adhesion level of 24%. Other strains showed moderate to low binding of less than 16%. Competitive adhesion experiments...... on IPEC-J2 cells demonstrated that strongly adhesive strains, as L. reuteri DSM 12246 and L. plantarum Q47, significantly reduced the attachment of the less adhesive strains, such as L. rhamnosus GG and L. johnsonii NCC 533, both under condition of co-incubation and in displacement assays, indicating...

  5. National and regional estimates of term and preterm babies born small for gestational age in 138 low-income and middle-income countries in 2010

    DEFF Research Database (Denmark)

    Lee, Anne C C; Katz, Joanne; Blencowe, Hannah

    2013-01-01

    BACKGROUND: National estimates for the numbers of babies born small for gestational age and the comorbidity with preterm birth are unavailable. We aimed to estimate the prevalence of term and preterm babies born small for gestational age (term-SGA and preterm-SGA), and the relation to low birthwe...... to increase survival and reduce disability, stunting, and non-communicable diseases. FUNDING: Bill & Melinda Gates Foundation by a grant to the US Fund for UNICEF to support the activities of the Child Health Epidemiology Reference Group (CHERG)....

  6. Promotion of cone production on field-grown grafts of eastern white pine by gibberellin a4/7 injection. Forest research report No. 138

    Energy Technology Data Exchange (ETDEWEB)

    Ho, R.H.

    1996-11-01

    Because of the periodicity, fecundity, and asynchronsation in white pine pollen- and seed-cone production, methods need to be developed to produce both pollen and seed cones, thereby shortening the breeding cycle in advanced generation breeding. This paper presents a study designed to examine previous research on gibberellin treatments for pollen-cone production. Experiments were conducted on a breeding orchard of eastern white pine in Ontario, using clones of 6- or 11-year-old grafts in each of three treatment periods (May-June, June-August, and August-September 1994). Data were collected the following year when pollen and seed cones had emerged from the bud scales. Results presented include comparison of pollen cone and seed cone production between treated and untreated control grafts, and the differences in production among the three treatment periods.

  7. Level of athlete satisfaction and group cohesion in adult indoor soccer teams. DOI: 10.5007/1980-0037.2011v13n2p138

    Directory of Open Access Journals (Sweden)

    José Roberto Andrade do Nascimento Junior

    2011-03-01

    Full Text Available This descriptive study investigated the levels of athlete satisfaction and group cohesion in adult indoor soccer teams. Fifty-eight male athletes of the Parana indoor soccer. Championship participated in the study. The Athlete Satisfaction Questionnaire and the Group Environment Questionnaire were used for assessment. The Kolmogorov-Smirnov test, Cronbach’s alpha, Spearman’s correlation coefficient, Manova, and the post hoc Scheffe test were used for data analysis (p < 0.05. The results showed that teams with higher levels of athlete satisfaction had higher perception of group cohesion. Teams with low levels of personal satisfaction had lower perception of group cohesion. Comparison of the teams showed differences in three dimensions of satisfaction (training-education, team performance, and strategy and in all dimensions of cohesion. The more satisfied the athletes were with the instruction of the coach, personal treatment and strategies, the more cohesive were the teams for the task. It was concluded that the level of athlete satisfaction plays a key role in the perception of cohesion in sport teams, with a predominance of aspects related to the group-task dimensions over social-group dimensions.

  8. Level of athlete satisfaction and group cohesion in adult indoor soccer teams. DOI: 10.5007/1980-0037.2011v13n2p138

    Directory of Open Access Journals (Sweden)

    José Roberto Andrade do Nascimento Junior

    2011-02-01

    Full Text Available This descriptive study investigated the levels of athlete satisfaction and group cohesion in adult indoor soccer teams. Fifty-eight male athletes of the Parana indoor soccer. Championship participated in the study. The Athlete Satisfaction Questionnaire and the Group Environment Questionnaire were used for assessment. The Kolmogorov-Smirnov test, Cronbach’s alpha, Spearman’s correlation coefficient, Manova, and the post hoc Scheffe test were used for data analysis (p < 0.05. The results showed that teams with higher levels of athlete satisfaction had higher perception of group cohesion. Teams with low levels of personal satisfaction had lower perception of group cohesion. Comparison of the teams showed differences in three dimensions of satisfaction (training-education, team performance, and strategy and in all dimensions of cohesion. The more satisfied the athletes were with the instruction of the coach, personal treatment and strategies, the more cohesive were the teams for the task. It was concluded that the level of athlete satisfaction plays a key role in the perception of cohesion in sport teams, with a predominance of aspects related to the group-task dimensions over social-group dimensions.

  9. SU-E-T-138: Automated Chart Review Module Including Cross-Vendor Data Transfer Verification Developed for IHE-RO Initiative

    Energy Technology Data Exchange (ETDEWEB)

    Brewer, M; Gordon, C [Franciscan St Margaret Health, Hammond, IN (United States); Tien, C [Community Hospital, Munster, IN (United States)

    2015-06-15

    Purpose: To follow the Integrating Healthcare Enterprise - Radiation Oncology (IHE-RO) initiative of proper cross-vendor technology integration, an automated chart checker (ACC) was developed. ACC compares extracted data from an approved patient plan in the Eclipse treatment planning system (TPS) against data existing in the Mosaiq treatment management system (TMS). ACC automatically analyzes these parameters using built-in quality checklists to provide further aid in chart review. Methods: Eclipse TPS data are obtained using Eclipse scripting API (ESAPI) while Mosaiq TMS data are obtained from a radiotherapy-treatment-planning (RTP) file. Using this information, ACC identifies TPS-TMS discrepancies in 18 primary beam parameters including MU, energy, jaw positions, gantry angle, table angle, accessories, and bolus for up to 31 beams. Next, approximately 40 items from traditional quality checklists are evaluated such as prescription consistency, DRR graticule placement, plan approval status, global max dose, and dose tracking coefficients. Parameters were artificially modified to determine if ACC would detect an error in data transfer and to test each component of quality checklists. Results: Using ESAPI scripting and RTP file-processing, ACC was able to properly aggregate data from TPS and TMS for up to 31 beams. Errors were artificially introduced into each plan parameter, and ACC was able to successfully detect all of them within seconds. Next, ACC was able to successfully detect mistakes in the chart by identifying deviations with its quality checklists, within seconds. Conclusion: ACC effectively addresses the potential issue of faulty cross-vendor data transfer, as described by IHE-RO. In addition, ACC was also able to detect deviations from its built-in quality checklists. ACC is already an invaluable tool for efficient and standardized chart review and will continue to improve as its incorporated checklists become more comprehensive.

  10. Isolation and Screening of Thermophilic Bacilli from Compost for Electrotransformation and Fermentation: Characterization of Bacillus smithii ET 138 as a New Biocatalyst

    NARCIS (Netherlands)

    Bosma, E.F.; Weijer, van de A.H.P.; Daas, M.J.A.; Oost, van der J.; Vos, de W.M.; Kranenburg, van R.

    2015-01-01

    Thermophilic bacteria are regarded as attractive production organisms for cost-efficient conversion of renewable resources to green chemicals, but their genetic accessibility is a major bottleneck in developing them into versatile platform organisms. In this study, we aimed to isolate thermophilic,

  11. A multiepitope of XBP1, CD138 and CS1 peptides induces myeloma-specific cytotoxic T lymphocytes in T cells of smoldering myeloma patients.

    Science.gov (United States)

    Bae, J; Prabhala, R; Voskertchian, A; Brown, A; Maguire, C; Richardson, P; Dranoff, G; Anderson, K C; Munshi, N C

    2015-01-01

    We evaluated a cocktail of HLA-A2-specific peptides including heteroclitic XBP1 US184-192 (YISPWILAV), heteroclitic XBP1 SP367-375 (YLFPQLISV), native CD138260-268 (GLVGLIFAV) and native CS1239-247 (SLFVLGLFL), for their ability to elicit multipeptide-specific cytotoxic T lymphocytes (MP-CTLs) using T cells from smoldering multiple myeloma (SMM) patients. Our results demonstrate that MP-CTLs generated from SMM patients' T cells show effective anti-MM responses including CD137 (4-1BB) upregulation, CTL proliferation, interferon-γ production and degranulation (CD107a) in an HLA-A2-restricted and peptide-specific manner. Phenotypically, we observed increased total CD3(+)CD8(+) T cells (>80%) and cellular activation (CD69(+)) within the memory SMM MP-CTL (CD45RO(+)/CD3(+)CD8(+)) subset after repeated multipeptide stimulation. Importantly, SMM patients could be categorized into distinct groups by their level of MP-CTL expansion and antitumor activity. In high responders, the effector memory (CCR7(-)CD45RO(+)/CD3(+)CD8(+)) T-cell subset was enriched, whereas the remaining responders' CTL contained a higher frequency of the terminal effector (CCR7(-)CD45RO(-)/CD3(+)CD8(+)) subset. These results suggest that this multipeptide cocktail has the potential to induce effective and durable memory MP-CTL in SMM patients. Therefore, our findings provide the rationale for clinical evaluation of a therapeutic vaccine to prevent or delay progression of SMM to active disease.

  12. Pituitary Adenylate Cyclase Activating Peptide (1-38 and its analog (Acetyl-[Ala15, Ala20] PACAP 38-polyamide reverse methacholine airway hyperresponsiveness in rats

    Directory of Open Access Journals (Sweden)

    Mounira Tlili

    2015-09-01

    Full Text Available The aim of this study was to investigate both functionally and structurally bronchodilator effects of Pituitary adenylate cyclase activating peptide (PACAP38 and acetyl-[Ala15, Ala20] PACAP38-polyamide, a potent PACAP38 analog, in rats challenged by methacholine (MeCh. Male Wistar rats were divided randomly into five groups. Groups 1 and 2 inhaled respectively aerosols of saline or increasing doses of MeCh (0.5, 1, 2.12, 4.25, 8.5, 17, 34 and 68mg/L. The other groups received terbutaline (Terb (250 µg/rat (10-6 M, PACAP38 (50 µg/rat (0.1 mM or PACAP38 analog (50 µg/rat associated to MeCh from the dose of 4.25 mg/L. Total lung resistances (RL were recorded before and 2 min after MeCh administration by pneumomultitest equipment. MeCh administration induced a significant and a dose-dependent increase (p<0.05 of RL compared to control rats. Terb, PACAP38 and PACAP38 analog reversed significantly the MeCh-induced bronchial constriction, smooth muscle (SM layer thickness and bronchial lumen mucus abundance. PACAP38 analog prevents effectively bronchial smooth muscle layer thickness, mucus hypersecretion and lumen decrease. Therefore, it may constitute a potent therapeutic bronchodilator.

  13. Assessment of Non-Traditional Isotopic Ratios by Mass Spectrometry for Analysis of Nuclear Activities

    Science.gov (United States)

    2016-03-01

    distinguish between commercial nuclear reactor fuel cycles, fuel cycles for weapons grade plutonium , and products from nuclear weapons explosions. Methods will...Isotopic ratios will be calculated for radionuclides produced in commercial nuclear reactor fuel cycles, fuel cycles for weapons grade plutonium , and... chemistry for analysis of samarium. The chemical form of samarium required for analysis varies for different mass spectrometry techniques

  14. Diferenciação precoce entre distrofia muscular de duchenne e de becker estudo clínico, laboratorial, eletrofisiológico, histoquímico e imuno-histoquímico de 138 casos: clinical, laboratory, electrophysiologic, histochemical and immunohistochemical study of 138 cases

    Directory of Open Access Journals (Sweden)

    Lineu C. Werneck

    1992-12-01

    Full Text Available Foram estudados por análise estatística 194 parâmetros clínicos, laboratoriais, eletrofisiológicos, histoquímicos e imuno-histoquímicos de 112 casos de distrofia muscular de Duchenne (DMD e de 26 casos de distrofia muscular de Becker (DMB. Houve diferença significante (p < 0,05 entre as duas doenças com respeito a época de início de diversos sintomas, dados do exame neurológico e alterações específicas na biópsia muscular. A biópsia muscular (BM isolada foi diagnóstica em 52,7% dos casos de DMD e em 69,2% dos de DMB. Por imunofluorescência (60 casos a distrofina estava ausente em 87% dos casos de DMD e apresentava falhas focais em todos os casos de DMB. A BM foi concordante com a imunofluorescência para distrofina em 82,6% dos casos de DMD e 71,4% dos de DMB. São feitos comentários a respeito dos dados encontrados e os da literatura, bem como sobre a dificuldade diagnóstica para diferenciação precoce das duas entidades.

  15. The Critical Technologies Project Executive Summary

    Science.gov (United States)

    1981-01-01

    Materials with the Not covered Chalcopyrite Structure 7.8.23 Rare Earth- Transition Metal Permanent Not covered I Magnets (exanple: samarium cobalt and... Transition Metal Permanent - Magnets (example: samarium cobalt I and substituted samarium cobalt) New 7.8.24 Gadolinium Gallium Garnet (GGG) - - and...III T i mm~ 1.W 8 Chwn..cal Poesse Maclw Tools 1110 1129. 1131 133 1142 0 F -~, oO 16.qm P c Metals 1145, 1203, 1236 4203 1365 00, awm.wq *4 1303 1311

  16. sup 8 sup 9 Sr and sup 1 sup 5 sup 3 Sm-EDTMP therapy of disseminated skeletal metastasis

    CERN Document Server

    Zhang Jun Ning; Zhu Shou Peng

    2001-01-01

    A retrospective analysis was performed on 72 patients with disseminated skeletal metastasis to evaluate the effect of strontium-89 or samarium-153 EDTMP therapy. There existed 87.88% of clinical response, 12.12% of no response in the group treated with strontium-89 as compared with 90.24% of clinical response, 9.76% no response in one treated with samarium-153 EDTMP; and there were no correlation between the treatment results and the amounts of isotopes administrated. The results suggest that strontium-89 or samarium-153 EDTMP therapy is a method of first choice in the palliative treatment for disseminated skeletal metastasis

  17. General Information about Osteosarcoma and Malignant Fibrous Histiocytoma of Bone

    Science.gov (United States)

    ... providers who are experts in treating cancer in children. Treatment for osteosarcoma or malignant fibrous histiocytoma may cause side effects. Four types of standard treatment are used: Surgery Chemotherapy Radiation therapy Samarium New types of treatment are ...

  18. Treatment Option Overview (Osteosarcoma and Malignant Fibrous Histiocytoma of Bone)

    Science.gov (United States)

    ... providers who are experts in treating cancer in children. Treatment for osteosarcoma or malignant fibrous histiocytoma may cause side effects. Four types of standard treatment are used: Surgery Chemotherapy Radiation therapy Samarium New types of treatment are ...

  19. Maximum Permissible Concentrations and Negligible Concentrations for Rare Earth Elements (REEs)

    NARCIS (Netherlands)

    Sneller FEC; Kalf DF; Weltje L; Wezel AP van; CSR

    2000-01-01

    In dit rapport worden maximaal toelaatbare risiconiveaus (MTR) en verwaarloosbare risiconiveaus (VR) afgeleid voor zeldzame aardmetalen (ZAM). De geselecteerde ZAMs zijn Yttrium (Y), Lanthanum (La), Cerium (Ce), Praseodymium (Pr), Neodymium (Nd), Samarium (Sm), Gadolinium (Gd), en Dysprosium

  20. Bulletin of the Chemical Society of Ethiopia - Vol 31, No 3 (2017)

    African Journals Online (AJOL)

    A novel samarium complex with interesting photoluminescence and semiconductive properties · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D. W. Zhang, W. T. Chen, Y. F.Wang, 435-444 ...

  1. Specialty Metals: DOD Dissemination of National Security Waiver Information Could Enhance Awareness and Compliance with Restrictions

    Science.gov (United States)

    2014-10-01

    Restrictions Why GAO Did This Study Specialty metals—such as titanium, certain steel alloys , and samarium- cobalt alloy magnets—are essential to DOD...highly magnetic, lightweight, corrosion resistant, or having high durability. Among these metals are samarium- cobalt alloy magnets used to make radar...the following elements: aluminum, chromium , cobalt , columbium, molybdenum, nickel, titanium, tungsten, or vanadium. Specialty metals were added

  2. Criteríos generales sobre necesidad, diseño, administración y construcción de la linea de transmisión a 138 kv. Daule peripa - chone

    OpenAIRE

    Ruiz Maldonado, Isabel; Sarmiento Martinez, Pomerio; Salomon F., Leo

    2009-01-01

    Manabí es por muchas razones la tercera provincia en importancia del país, una provincia que ha través de las ultimas décadas experimenta un crecimiento sostenido en su producción, lamentablemente este crecimiento no ha incrementado el déficit de energía que padece durante muchos años y en el sector eléctrico los planes de expansión del CONELEC en el área de la Transmisión no contemplan la tan necesaria unión al Sistema Nacional Interconectado a nivel de 230 Kv. El ultimo proyecto desarrol...

  3. Trends and mortality effects of vitamin A deficiency in children in 138 low-income and middle-income countries between 1991 and 2013: a pooled analysis of population-based surveys.

    Science.gov (United States)

    Stevens, Gretchen A; Bennett, James E; Hennocq, Quentin; Lu, Yuan; De-Regil, Luz Maria; Rogers, Lisa; Danaei, Goodarz; Li, Guangquan; White, Richard A; Flaxman, Seth R; Oehrle, Sean-Patrick; Finucane, Mariel M; Guerrero, Ramiro; Bhutta, Zulfiqar A; Then-Paulino, Amarilis; Fawzi, Wafaie; Black, Robert E; Ezzati, Majid

    2015-09-01

    Vitamin A deficiency is a risk factor for blindness and for mortality from measles and diarrhoea in children aged 6-59 months. We aimed to estimate trends in the prevalence of vitamin A deficiency between 1991 and 2013 and its mortality burden in low-income and middle-income countries. We collated 134 population-representative data sources from 83 countries with measured serum retinol concentration data. We used a Bayesian hierarchical model to estimate the prevalence of vitamin A deficiency, defined as a serum retinol concentration lower than 0·70 μmol/L. We estimated the relative risks (RRs) for the effects of vitamin A deficiency on mortality from measles and diarrhoea by pooling effect sizes from randomised trials of vitamin A supplementation. We used information about prevalences of deficiency, RRs, and number of cause-specific child deaths to estimate deaths attributable to vitamin A deficiency. All analyses included a systematic quantification of uncertainty. In 1991, 39% (95% credible interval 27-52) of children aged 6-59 months in low-income and middle-income countries were vitamin A deficient. In 2013, the prevalence of deficiency was 29% (17-42; posterior probability [PP] of being a true decline=0·81). Vitamin A deficiency significantly declined in east and southeast Asia and Oceania from 42% (19-70) to 6% (1-16; PP>0·99); a decline in Latin America and the Caribbean from 21% (11-33) to 11% (4-23; PP=0·89) also occurred. In 2013, the prevalence of deficiency was highest in sub-Saharan Africa (48%; 25-75) and south Asia (44%; 13-79). 94 500 (54 200-146 800) deaths from diarrhoea and 11 200 (4300-20 500) deaths from measles were attributable to vitamin A deficiency in 2013, which accounted for 1·7% (1·0-2·6) of all deaths in children younger than 5 years in low-income and middle-income countries. More than 95% of these deaths occurred in sub-Saharan Africa and south Asia. Vitamin A deficiency remains prevalent in south Asia and sub-Saharan Africa. Deaths attributable to this deficiency have decreased over time worldwide, and have been almost eliminated in regions other than south Asia and sub-Saharan Africa. This new evidence for both prevalence and absolute burden of vitamin A deficiency should be used to reconsider, and possibly revise, the list of priority countries for high-dose vitamin A supplementation such that a country's priority status takes into account both the prevalence of deficiency and the expected mortality benefits of supplementation. Bill & Melinda Gates Foundation, Grand Challenges Canada, UK Medical Research Council. © 2015 World Health Organization; licensee Elsevier. This is an Open Access article published without any waiver of WHO's privileges and immunities under international law, convention, or agreement. This Article should not be reproduced for use in association with the promotion of commercial products, services, or any legal entity. There should be no suggestion that WHO endorses any specific organisation or products. The use of the WHO logo is not permitted. This notice should be preserved along with the Article's original URL.

  4. SU-E-J-138: An IGRT QA Device for Measuring with Tenths-Millimeter Accuracy KV and MV Isocenter Congruence, Couch Travel and Laser Alignment of Accelerators Used for SRS and SBRT

    Energy Technology Data Exchange (ETDEWEB)

    Brezovich, I; Popple, R; Duan, J; Huang, M; Benhabib, S; Shen, S; Cardan, R; Wu, X [University of Alabama Birmingham, Birmingham, AL (United States)

    2014-06-01

    Purpose: To develop a practical device having sufficient accuracy for daily QA tests of accelerators used for SRS and SBRT. Methods: The UAB (Universal Alignment Ball) consists of a 6.35 mm (1/4 inch) diameter tungsten sphere located concentrically within a 25.4 mm (1 inch) diameter acrylic plastic (PMMA) sphere. The spheres are embedded in polystyrene foam, which, in turn, is surrounded by a cylindrical PMMA shell. The UAB is placed on the couch and aligned with wall lasers according to marks that have known positions in relation to the center of the spheres. Using planar and cone beam images the couch is shifted till the surface of the PMMA sphere matches Eclipse-generated circular contours. Anterior and lateral MV images taken with small MLC openings allow measurement of distance between kV and MV isocenter, laser and MLC alignment. Measurements were taken over a one-month period. Results: Artifacts from the tungsten sphere were confined within the PMMA sphere and did not affect cone beam localization of the sphere boundary, allowing 0.1 mm precise alignment with a computer-generated circle centered at kV isocenter. In tests extending over a one-month period, the distance between kV and MV isocenters along the vertical, longitudinal and lateral directions was 0.125 +/−0.06, 0.19 +/−0.08, and 0.02 +/−0.08 mm, respectively. Laser misalignment along these directions was 0.34 +/- 0.15, 0.74 +/−0.29, and 0.49 +/−0.22 mm. Automated couch shifts moved the spheres to within 0.1 mm of the selected position. The center of a 1cmx1cm MLC-defined field remained within +/−0.2 mm of the tungsten sphere center as the gantry was rotated. Conclusion: The UAB is practical for daily end-to-end QA tests of accelerator alignment. It provides tenths-mm accuracy for measuring agreement of kV and MV isocenters, couch motions, gantry flex and laser alignment.

  5. Monitoring of the incorporation of I-138 by inhalation in facilities of metabolic treatment; Vigilancia de la incorporacion de I{sub 1}31 por inhalacion en las instalaciones de tratamientos de metabolicos

    Energy Technology Data Exchange (ETDEWEB)

    Baquero, R.; Anton, D.; Miguel, D. de

    2013-07-01

    The measure of thyroid activity with a surface contamination meter allows you to rule out or confirm the presence of iodine in the thyroid of the nursing staff. You have these teams in all Nuclear Medicine facilities, which can be used with simplicity immediately. To carry out these measures is necessary to have a background environment in which are carried out low, so as the limit of detection got enable check low levels to determine. (Author)

  6. Reflection for Nursing Life: Principles, Process and Practice McKinnon John Reflection for Nursing Life: Principles, Process and Practice 138pp £5.99 Routledge 9781138757599 1138787590 [Formula: see text].

    Science.gov (United States)

    2016-09-30

    The author of this book has considered the process of reflection from his point of view as a nurse. He guides readers through the development of the skills needed for reflection and presents theoretical frameworks to show how the process is academically supported.

  7. Impact on health-related quality of life of a switch from enfuvirtide to raltegravir among multidrug-resistant HIV-1-infected patients: a randomized open-label trial (EASIER-ANRS 138).

    Science.gov (United States)

    Boulet, Thomas; Pavie, Juliette; Charreau, Isabelle; Braun, Joséphine; Reynes, Jacques; Morlat, Philippe; Piroth, Lionel; Spire, Bruno; Molina, Jean-Michel; Aboulker, Jean-Pierre

    2010-01-01

    among multidrug-resistant HIV-1-infected patients, enfuvirtide has demonstrated sustained efficacy, but long-term use is inconvenient due to twice-daily subcutaneous injections which often induce injection-site reactions. We investigated whether a switch from enfuvirtide to raltegravir, an orally available HIV-integrase inhibitor, may improve health-related quality of life (HRQoL). 170 multidrug-resistant HIV-1-infected patients who were receiving enfuvirtide-based regimens were randomised to the maintenance of enfuvirtide or the switch to raltegravir at day 0. At week 24, all patients received raltegravir up to week 48. HRQoL was assessed at baseline and weeks 24 and 48 using a self-report MOS-HIV questionnaire. HRQoL scores were compared between arms using analysis of covariance (ANCOVA) models. at week 24, least-squares means changes from baseline for the maintenance and the substitution arms were -5.3 and +5.8 (P = .001) for the pain score, -4.7 and +4.8 (P = .02) for the social functioning score, and -1.3 and +2.0 (P = .003) for the physical summary score, respectively. among multidrug-resistant HIV-1-infected patients, a switch from enfuvirtide to raltegravir resulted in statistically significant improvements in multiple HRQoL dimensions over 24 weeks in comparison to the maintenance under enfuvirtide.

  8. Comment on "On a class of exact solutions of the equations of motion of a second grade fluid" by C. Fetecau and J. Zierep (Acta Mech. 150, 135-138, 2001)

    CERN Document Server

    Christov, Ivan C; 10.1007/s00707-010-0300-2

    2010-01-01

    In a 2001 article, Fetecau and Zierep [1] considered Stokes' first problem for a second grade (SG) fluid, unaware that it had already been solved (correctly) by Puri [2] in 1984. These authors used the Fourier sine transform to obtain, what they believed to be, the exact solution of the resulting initial-boundary-value problem (IBVP). Unfortunately, due to their incorrect computation of the distributional derivative of the Heaviside function, an omission of a critical term in the subsidiary equation occurred, an elementary mistake (gracefully explained in [3]) apparently not uncommon in the literature. Therefore, the solution given in [1] is, generally speaking, incorrect.

  9. «Its Maṭla‘ and Ḫarja are Twofold in Function»: Form and Content in Ibn Quzmān’s «Zajal 59» and «138» / "Maṭla‘ y Ḫarja tienen doble función": forma y contenido en los zéjeles «59» and «138» de Ibn Quzmān

    Directory of Open Access Journals (Sweden)

    James T. Monroe

    2011-04-01

    Full Text Available SUMMARY. This article begins (1 by briefly contrasting the goals of those treatises on rhetoric and poetics composed in Greek, Latin and Arabic during the Ancient and Medieval periods, on the one hand, with the goals of modern, post-Romantic literary criticism, on the other, in order to highlight the fact that pre-modern treatises had, as their main purpose, that of teaching students how to write, and of correcting their mistakes when they did so. As such they were largely prescriptive, and cannot be of much use for the purposes of modern literary criticism, which is largely descriptive and interpretative in its approach. Despite this obvious fact, pre-modern methods have often been misapplied, in modern times, to the study of Arabic poetry. (2 The article proceeds to discuss the role and function of the ‘initial refrain’ or maṭla‘ as well as the ‘exit’ or ḫarja in Andalusī-Arabic strophic poetry, pointing out that the function of those two elements is essentially a musical one, and stems from an oral tradition. (3 and 4 Thereafter, the article analyses two zajal poems by the renowned twelfthcentury Andalusī-Arab poet Ibn Quzmān. These two poems exhibit an unusual trait: each one makes use of a single, identical text, that is repeated verbatim at the beginning and end of the poem, both as its maṭla‘ and as its ḫarja. It is suggested that this external thematic parallelism framing the poem encloses an internal patterning based on ring composition, an organizational technique of which the poet may well have been consciously aware. (5 The form this patterning takes, however, points to certain ambiguities and contradictions, inviting the reader to interpret the text by penetrating beyond its surface meaning, in order to arrive at its deeper layers of significance. This technique of «allegorical» interpretation is, in turn, based on methods of Qur’ānic interpretation introduced by the Mu‘tazilī school of Islamic theologians, and which had heavily influenced literary authors long before the time of Ibn Quzmān. (6 Finally, it is concluded that, in this instance, the tension between the surface and hidden meaning of the text is a means of allowing the author to adopt a critical stance toward the society in which he lives. RESUMEN. Este artículo comienza por contrastar brevemente los objetivos de aquellos tratados de poesía y retórica compuestos en griego, latín y árabe durante la Antigüedad y el periodo medieval, por un lado, con los objetivos de la crítica literaria moderna y post-romántica, por otro, para subrayar el hecho de que los tratados premodernos tenían como propósito principal aquel de enseñar a los estudiantes cómo escribir, y corregir sus errores. Como tal, eran mayoritariamente prescriptivos, y no pueden ser de gran utilidad para el propósito de la crítica literaria moderna, que es ampliamente descriptiva e interpretativa en su enfoque. A pesar de este hecho obvio, en la actualidad se han aplicado erróneamente métodos premodernos en el estudio de la poesía árabe. Este artículo prosigue discutiendo el papel y la función del ‘estribillo inicial’ o maṭla‘ así como la ‘salida’ o jarŷa en la poesía estrófica arábigo-andalusí, señalando que la función de estos dos elementos es esencialmente musical, pues surge de la tradición oral. A partir de aquí, el artículo analiza dos zéjeles del ilustre poeta arábigo-andalusí Ibn Quzmān. Estos poemas muestran un rasgo inusual: cada uno se vale de un único e idéntico texto, que se repite textualmente al comienzo y al final del poema, ambos como su maṭla‘ y como su jarŷa. Se sugiere, por tanto, que este paralelismo temático que enmarca el poema encierra un patrón interno basado en la composición circular, una técnica organizativa de la cual el poeta bien podría haber sido consciente. La forma que toma este patrón, no obstante, presenta ciertas ambigüedades y contradicciones, invitando al lector a interpretar el texto introduciéndose más allá de la superficie de su significado, para alcanzar las capas más profundas de su mensaje. Esta técnica de interpretación alegórica está, asimismo, basada en los métodos de interpretación del Alcorán introducidos por la escuela Mu‘tazilī de teólogos islámicos, que había influido a diversos autores mucho antes del tiempo de Ibn Quzmān. Finalmente, se concluye que, en este caso, la tensión entre la superficie y el significado oculto del texto permite al autor adoptar una postura crítica ante la sociedad en la que vive.

  10. Development of a methodology for the separation of europium and samarium from a mixture of rare earth oxides by electroreduction/ precipitation; Desenvolvimento de uma metodologia para a separacao de samario e europio a partir de mistura de oxidos de terras raras por reducao eletroquimica/precipitacao

    Energy Technology Data Exchange (ETDEWEB)

    Chepcanoff, Vera

    2006-07-01

    The rare earths (RE) were first used in 1903, when Welsbach developed a lighter that is still used today. Nowadays, the RE are employed in many different fields, as in the production of super-alloys , as catalysts for petroleum industry, in the manufacture of non-ferrous alloys, color television tubes, x-ray screens, special glasses, ceramics, computer industries, nuclear medicine, lasers, pigments, etc., moving, in the last decade , a market of US$ 2 billions per year. Due to their similar properties, the RE elements are very difficult to separate, requiring complex processes, what make the products very expensive. Elements like Eu and Sm, which contents in the minerals are low (0.05% and 2.0%, respectively, in monazite) are extremely expensive, but their field of application justifies the research for looking for other processes, more simple and/or more effective. Trivalent state is a characteristic of all RE, but some of them presents oxidation state +2, like Ce, Eu, Sm and Yb. In the case of Eu and Sm, the focus of the present work, the divalent state is achieved by electro-reduction in the potentials -0.65 and -1.55 (SCE), respectively. This makes possible the separation of these elements from the other rare earths and from each other. Thus, making use of this characteristic, a process for the individual separation of Eu and Sm in (NH{sub 4}){sub 2}SO{sub 4} solution by electro-reduction/precipitation is proposed, where Sm is first separated from the solution as sulfate, and Eu, that remains in the solution, is precipitated after the decrease of temperature and potential applied. The process developed from a synthetic Eu and Sm solution was applied to a mixture of semi-heavy RE oxide, produced at IPEN-CNEN/SP, obtaining the separation of Sm. This product was analyzed by spectrophotometry, showing high purity. (author)

  11. Tetrakis[μ-2-(3,4-dimethoxyphenylacetato]-κ4O:O′;κ3O,O′:O;κ3O:O,O′-bis{[2-(3,4-dimethoxyphenylacetato-κ2O,O′](1,10-phenanthroline-κ2N,N′samarium(III}

    Directory of Open Access Journals (Sweden)

    Jia-Lu Liu

    2010-11-01

    Full Text Available In the centrosymmetric dinuclear title complex, [Sm2(C10H11O46(C12H8N22], the SmIII ion is nine-coordinated by seven O atoms of five 2-(3,4-dimethoxyphenylacetate (DMPA ligands and two N atoms of one bis-chelating 1,10-phenanthroline (phen ligand, forming a distorted tricapped trigonal-prismatic environment. The DMPA ligands coordinate in bis-chelate, bridging and bridging tridentate modes. An intramolecular C—H...O hydrogen bond occurs. Intermolecular C—H...O interactions are also present in the crystal.

  12. ORF Alignment: NC_006908 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TKHAFGIRTS Sbjct: 1 ... LATVVGNIFPVKDLKDGVFSENMLGEGIYIEPLENKFYAPVSGILETVFPTKHAFGIRTS 60 ... Query: 138 ESSKKASTML...TSGKVTLE 155 ... ESSKKASTMLTSGKVTLE Sbjct: 121 ESSKKASTMLTSGKVTLE 138

  13. Preparation, and Luminescence Properties of SiO2@Sm(MABA-Siphen Core-Shell Structure Nanometer Composite

    Directory of Open Access Journals (Sweden)

    Feng Li-Na

    2018-01-01

    Full Text Available A novel ternary samarium complex was prepared using HOOCC6H4N(CONH(CH23Si- (OCH2CH332 (MABA-Si as first ligand, and phen as second ligand. The corresponding SiO2@Sm(MABA-Siphen core-shell structure nanometer composite was synthesized as well, and the silica spheres was the core, and the ternary samarium complex was the shell layer. The ternary samarium complex has been characterized by element analysis, molar conductivity and IR spectra. The results show that the chemical formula of the complex is Sm(MABA-Si(phen2(ClO43·2H2O. The fluorescent spectra illustrat that the luminescence properties of the samarium complex are superior. The core-shell structure of SiO2@Sm(MABA-Siphen nanometer composite is characterized by SEM, TEM and IR spectra. The SiO2@Sm(MABA-Siphen core-shell structure composites exhibit stronger emission intensity than the ternary samarium complex. The fluorescence lifetime of the complex and core-shell structure composite is measured as well.

  14. Laboratory calibration and field testing of the Chemcatcher-Metal for trace levels of rare earth elements in estuarine waters.

    Science.gov (United States)

    Petersen, Jördis; Pröfrock, Daniel; Paschke, Albrecht; Broekaert, Jose A C; Prange, Andreas

    2015-10-01

    Little knowledge is available about water concentrations of rare earth elements (REEs) in the marine environment. The direct measurement of REEs in coastal waters is a challenging task due to their ultra-low concentrations as well as the high salt content in the water samples. To quantify these elements at environmental concentrations (pg L(-1) to low ng L(-1)) in coastal waters, current analytical techniques are generally expensive and time consuming, and require complex chemical preconcentration procedures. Therefore, an integrative passive sampler was tested as a more economic alternative sampling approach for REE analysis. We used a Chemcatcher-Metal passive sampler consisting of a 3M Empore Chelating Disk as the receiving phase, as well as a cellulose acetate membrane as the diffusion-limiting layer. The effect of water turbulence and temperature on the uptake rates of REEs was analyzed during 14-day calibration experiments by a flow-through exposure tank system. The sampling rates were in the range of 0.42 mL h(-1) (13 °C; 0.25 m s(-1)) to 4.01 mL h(-1) (13 °C; 1 m s(-1)). Similar results were obtained for the different REEs under investigation. The water turbulence was the most important influence on uptake. The uptake rates were appropriate to ascertain time-weighted average concentrations of REEs during a field experiment in the Elbe Estuary near Cuxhaven Harbor (exposure time 4 weeks). REE concentrations were determined to be in the range 0.2 to 13.8 ng L(-1), where the highest concentrations were found for neodymium and samarium. In comparison, most of the spot samples measured along the Chemcatcher samples had REE concentrations below the limit of detection, in particular due to necessary dilution to minimize the analytical problems that arise with the high salt content in marine water samples. This study was among the first efforts to measure REE levels in the field using a passive sampling approach. Our results suggest that passive samplers could be

  15. Udvikling af materialer til brintpermeable membraner

    DEFF Research Database (Denmark)

    Bentzer, Henrik Karnøe

    Due to global warming as well as other factors, it is necessary to find alternatives to the current consumption of fossil fuels. Oxide materials with high protonic conductivity can potentially find application within many different technological fields in a society that is based on renewable energy...... doped samarium titanate, lanthanum magnesium titanate and strontium cerate doped with yttrium and nickel. Concentration cell measurements were used to estimate transport numbers for protons and oxide ions in yttrium doped strontium cerate and calcium doped samarium titanate. Furthermore, the voltage...

  16. {6,6′-Dimethoxy-2,2′-[ethane-1,2-diylbis(nitrilomethylidyne]diphenolato-1κ4O1,O1′,O6,O6′:2κ4O1,N,N′,O1′}(ethanol-1κO-μ-nitrato-1:2κ2O:O′-dinitrato-1κ4O,O′-samarium(IIIzinc(II

    Directory of Open Access Journals (Sweden)

    Qiang Huang

    2009-10-01

    Full Text Available In the title heteronuclear ZnII–SmIII complex, [SmZn(C18H18N2O4(NO33(CH3CH2OH], with the hexadentate Schiff base compartmental ligand N,N′-bis(3-methoxysalicylideneethylenediamine (H2L, the SmIII and ZnII ions are triply bridged by two phenolate O atoms from the Schiff base ligand and one nitrate anion. The five-coordinate ZnII ion is in a square-pyramidal geometry formed by the donor centers of two imine N atoms, two phenolate O atoms and one of the bridging nitrate O atoms. The SmIII center is in a ten-fold coordination of O atoms, involving the phenolate O atoms, two methoxy O atoms, one ethanol O atom, and two O atoms from two nitrate anions and one from the bridging nitrate anion. In the crystal, intermolecular O—H...O and C—H...O interactions generate a layer structure extending parallel to (101.

  17. Performance Characterization of a Novel Plasma Thruster to Provide a Revolutionary Operationally Responsive Space Capability with Micro- and Nano-Satellites

    Science.gov (United States)

    2011-03-24

    Einstein Spontaneous Emission Rate Coefficient Electrical Utilization Efficiency Electron Electron Density...0.135 Tesla samarium cobalt (SmCo) permanent magnet from Electron Energy Corp. in Landisville, PA. Encapsulating the assembly is a simple aluminum...unlike some well-developed technologies, such as solid fueled rocket motors , an electric propulsion system could simultaneously contribute to all three

  18. Xe-135 and Sm-149 Isotopic Evolution Analysis Xesamo code; Analisis de la Evolucion Isotopica del Xe-135 y Sm-149. Programa Xesamo

    Energy Technology Data Exchange (ETDEWEB)

    Caro, R.; Gallego, J.; Martinez Fanegas, R.

    1977-07-01

    In this report the time evolution analysis of the nuclides concentration Xe-135 and Sm-149 as a function of the neutron flux is carried out. The neutron flux may be any function of time. It is analyzed as well the reactivity changes associated with the xenon and samarium concentration variations. (Author) 5 refs.

  19. Thermoluminescence characteristics of Sm doped NaYF4 crystals

    Indian Academy of Sciences (India)

    2006-06-28

    Jun 28, 2006 ... temperature peaks also vary in relation to the Sm3+ con- centration in NaYF4. This indicates a probable change in the trap structure of NaYF4 with the doping concentration of samarium impurity. This observation is in conformity with the earlier studies (Narasimha Reddy et al 1987;. Gopal Reddy et al 1988; ...

  20. Multiplet effects in the electronic structure of light rare-earth metals

    NARCIS (Netherlands)

    Lebegue, S.; Svane, A.; Katsnelson, M.I.; Lichtenstein, A.I.; Eriksson, O.

    2006-01-01

    The excited-state properties of the light rare-earth elemental metals praseodymium, neodymium, and samarium are studied within the Hubbard-I formalism. This method describes the multiplets of the rare-earth f shell by an exact diagonalization of the two-body part of the Hamiltonian. Subsequently,

  1. Structural, dielectric and electrical properties of Sm-modified Pb ...

    Indian Academy of Sciences (India)

    It is observed that. the dielectric permittivity () and loss tangent (tan ) are dependent on frequency,; the temperature of dielectric permittivity maximum shifts toward lower temperature side with the increase of samarium ion (Sm+3) concentration at the Pb sites, and; observed and calculated -values of XRD patterns show ...

  2. Ironless-armature brushless motor

    Science.gov (United States)

    Fisher, R. L.

    1977-01-01

    Device uses 12-pole samarium cobalt permanent-magnet rotor and three Hall-effect sensors for commutation. In prototype motor, torque constant (3-phase delta) is 65 oz-in/amp; electrical time constant (L/R) is 0.2 x 0.001 sec, and armature resistance is 20 ohms.

  3. Measurement of total angular momentum values of high-lying even ...

    Indian Academy of Sciences (India)

    Measurement of total angular momentum values of high-lying even-parity atomic states of samarium by spectrally resolved laser-induced fluorescence technique. A K PULHANI∗, M L SHAH, G P GUPTA and B M SURI. Laser and Plasma Technology Division, Bhabha Atomic Research Centre,. Mumbai 400 085, India.

  4. Measurement of total angular momentum values of high-lying even ...

    Indian Academy of Sciences (India)

    Spectrally resolved laser-induced fluorescence technique was used to uniquely assign total angular momentum () values to high-lying even-parity energy levels of atomic samarium. Unique value assignment was done for seven energy levels in the energy region 34,800–36,200 cm-1 , recently observed and reported in ...

  5. X-Ray studies reveal lanthanide binding sites at the A/B5 interface of E. coli heat labile enterotoxin

    NARCIS (Netherlands)

    Sixma, Titia K.; Terwisscha van Scheltinga, Anke C.; Kalk, Kor H.; Zhou, Kangjing; Wartna, Ellen S.; Hol, Wim G.J.

    1992-01-01

    The crystal structure determination of heat labile enterotoxin (LT) bound to two different lanthanide ions, erbium and samarium, revealed two distinct ion binding sites in the interface of the A subunit and the B pentamer of the toxin. One of the interface sites is conserved in the very similar

  6. X-RAY STUDIES REVEAL LANTHANIDE BINDING-SITES AT THE A/B5 INTERFACE OF ESCHERICHIA-COLI HEAT LABILE ENTEROTOXIN

    NARCIS (Netherlands)

    SIXMA, TK; VANSCHELTINGA, ACT; KALK, KH; WARTNA, ES; HOL, WGJ

    1992-01-01

    The crystal structure determination of heat labile enterotoxin (LT) bound to two different lanthanide ions, erbium and samarium, revealed two distinct ion binding sites in the interface of the A subunit and the B pentamer of the toxin. One of the interface sites is conserved in the very similar

  7. Author Details

    African Journals Online (AJOL)

    Prasad, T.N.V.K.. Vol 12, No 2 (2003) - Articles Pyroelectric Ferroelectric and Resistivity Studies on Samarium Modified Barium Strontium Sodium Niobate Ceramics Abstract. ISSN: 1019-1593. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...

  8. Thermoluminescent coactivated rare earth oxyhalide phosphors and X-ray image converters utilizing said phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Rabatin, J.G.

    1984-11-06

    Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light.

  9. Interactions between exogenous rare earth elements and phosphorus leaching in packed soil columns

    Science.gov (United States)

    Rare earth elements (REEs) increasingly used in agriculture as an amendment for crop growth may help to lessen environmental losses of phosphorus (P) from heavily fertilized soils. The vertical transport characteristics of P and REEs, lanthanum (La), neodymium (Nd), samarium (Sm), and cerium (Ce), w...

  10. Simplified syntheses of the water-soluble chiral shift reagents Sm-(R)-pdta and Sm-(S)-pdta

    Czech Academy of Sciences Publication Activity Database

    Hrubá, L.; Buděšínský, Miloš; Pícha, Jan; Jiráček, Jiří; Vaněk, Václav

    2013-01-01

    Roč. 54, č. 47 (2013), s. 6296-6297 ISSN 0040-4039 Institutional support: RVO:61388963 Keywords : NMR * chiral shift reagents * Sm-pdta * PDTA * samarium * 1,2-diaminopropane Subject RIV: CC - Organic Chemistry Impact factor: 2.391, year: 2013

  11. Perovskite catalysts for oxidative coupling

    Science.gov (United States)

    Campbell, Kenneth D.

    1991-01-01

    Perovskites of the structure A.sub.2 B.sub.2 C.sub.3 O.sub.10 are useful as catalysts for the oxidative coupling of lower alkane to heavier hydrocarbons. A is alkali metal; B is lanthanide or lanthanum, cerium, neodymium, samarium, praseodymium, gadolinium or dysprosium; and C is titanium.

  12. Lanthanide(III) complexes with tridentate Schiff base ligand ...

    African Journals Online (AJOL)

    The tridentate N4-type Schiff base was synthesized from the condensation reaction of 2-hydrazinopyridine and pyridine-2-carbaldehyde. Neodymium and Samarium complexes were isolated when the corresponding nitrate salt was added to the solution of the ligand. The isolated compounds were characterized by ...

  13. Author Details

    African Journals Online (AJOL)

    T. Chen, W. Vol 31, No 3 (2017) - Articles A novel samarium complex with interesting photoluminescence and semiconductive properties. Abstract PDF. ISSN: 1726-801X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...

  14. Interação, interatividade e humor no rádio: estudo de caso sobre o programa Graffite veiculado pela rádio 98 FM de Belo Horizonte http://dx.doi.org/10.15601/1983-7631/rt.v6n11p122-138

    Directory of Open Access Journals (Sweden)

    Luciano Andrade Ribeiro

    2013-11-01

    Full Text Available Os recursos interativos têm proporcionado aos meios de comunicação possibilidades para realizar uma nova forma de programação, a fim de atender as exigências dos receptores que não querem mais somente receber conteúdo, mas também querem participar e sugerir seus próprios conteúdos. Além disso, o uso de recursos humorísticos é cada vez mais frequente nas mídias tradicionais com o objetivo de atrair a atenção do público. Diante dessa realidade, este artigo busca identificar recursos de interação, interatividade e humor utilizados em um programa radiofônico através de um estudo de caso sobre o Programa Graffite, veiculado pela rádio 98 FM de Belo Horizonte.

  15. Risk Profile May Affect Search Process but Not Results. A review of: McKibbon, K. Ann, Douglas B. Fridsma, and Rebecca S. Crowley. “How Primary Care Physicians’ Attitudes Toward Risk and Uncertainty Affect Their Use of Electronic Information Resources.” Journal of the Medical Library Association 95.2 (2007: 138‐46, e49‐50. 10 Nov. 2007 .

    Directory of Open Access Journals (Sweden)

    Gale G. Hannigan

    2007-12-01

    Full Text Available Objective – To compare the use, in terms of process and outcomes, of electronic information resources by primary care physicians with different risk profiles and comfort with uncertainty.Design – Survey, and observation using “think‐aloud” method.Setting – Physicians’ offices.Subjects – Canadian and U.S. primary carephysicians who report seeing patients in clinic settings.Methods – Volunteers were recruited from personal contacts and the list of physicianswho rate current studies for the McMaster Online Rating of Evidence (MORE project. Physicians completed the Pearson scale to measure attitude toward risk and the Gerrity scale to measure comfort with uncertainty, and those who scored at the extremes of each of these two scales were included in the study (n=25, resulting in four groups (risk‐seeking, risk‐avoiding, uncertainty‐stressed, uncertainty unstressed. One researcher observed each of these physicians in their offices for an hour during which they completed questionnaires about their computer skills and familiarity with resources, answered multiple‐choice clinical questions, and indicated level of certainty with regard to those answers (scale of 0 to 100%. Physicians also chose two of the clinical questions to answer using their own resources. The think‐aloud method was employed, and transcripts were coded and analyzed.Main results – The study analysis included two comparisons: risk‐seeking (11 subjects versus risk‐avoiding (11 subjects physicians,and uncertainty‐stressed (11 subjects versus uncertainty‐unstressed (10 subjects physicians. Most physicians were included in both sets of analyses. The researchers found no association of risk attitude and uncertainty stress with computer skills nor with familiarity and use of specific information resources (Internet, MEDLINE, PIER, Clinical Evidence, and UpToDate. No differences were found for the following outcomes: time spent searching, answers correct before searching, answers correct after searching, and certainty of answer if answer is right, certainty of answer if answer is wrong. There was a statistically significant association of participants’ indicating certainty for answers that were correct versus those that were not correct (pConclusion – Based on a small sample, it appears that primary care physicians who are risk‐seeking and/or less stressed by uncertainty have the same (poor search results as their more risk‐averse and stressed‐by‐uncertainty colleagues although their search processes may differ.

  16. الحياة السياسية في الأندلس (95-138هـ/714-755م Political life in Andalusia

    Directory of Open Access Journals (Sweden)

    Dr. FirasSalimHayawi أ.د.فراس سليم حياوي

    2016-10-01

    Full Text Available The Arab history Andalusian is part of the Arab-Muslim history, cherish the Arab nation and the title by other nations, because of its especially in the hearts of her sons niche, because they were a link between East and West, and cultural bridge however, and a dam stopped the advance of AlbrberhTeutons and Normans in the direction of Morocco the main islands in the Mediterranean, has witnessed the history of Muslims in Andalusia years of victory, and years of refraction.

  17. Production of sup 5 sup 5 Co via the sup 5 sup 4 Fe(d, n)-process and excitation functions of sup 5 sup 4 Fe(d, t) sup 5 sup 3 Fe and sup 5 sup 4 Fe(d, alpha) sup 5 sup 2 sup m Mn reactions from threshold up to 13.8 MeV

    CERN Document Server

    Zaman, M R; Qaim, S M

    2003-01-01

    For production of the medically interesting beta; sup + -emitter sup 5 sup 5 Co (T sup 1 sup / sup 2 = 17.6 h) via the sup 5 sup 4 Fe(d, n)-reaction, 91.6% enriched sup 5 sup 4 Fe sub 2 O sub 3 , mixed with Al powder, was pressed to a pellet which could be irradiated with 14 MeV deuterons at 4 mu A in a water-cooled target system. A separation method was developed which led to > 99.9% pure sup 5 sup 5 Co and allowed a recovery of the enriched target material. For a target thickness of E sub d = 12.6 -> 5 MeV, the experimental thick target yield of sup 5 sup 5 Co after chemical separation amounted to about 13 MBq/mu A.h, which is about 60% of the theoretical value. In a 3 h irradiation at 4 mu A, the batch yield of sup 5 sup 5 Co achieved was 160 MBq (4.3 mCi). An 8 h irradiation could lead to a batch yield of about 400 MBq. The sup 5 sup 4 Fe(d, n) reaction leads to the highest purity sup 5 sup 5 Co but it is essential that the isotopic enrichment of the target is not less than 90%. In addition to the product...

  18. Elizabeth Wager. GETTING RESEARCH PUBLISHED – An A to Z of Publication Strategy, Third Edition. Boca Raton, New York, London: CRC Press, Taylor & Francis Group, LLC, 2015. 188 pages; ISBN-13:978-1-78523-138-4 (Paperback - CAT# K28669

    Directory of Open Access Journals (Sweden)

    Doncho Donev

    2016-02-01

    CONCLUSION: The book is intended to help all authors, young and old, novice and experienced, to plan their research and publications effectively and prepare manuscripts for journals and other publications, increasing the likelihood that their work will be published. Providing essential information on publishing strategy and process, the book should be extremely useful to everyone who wants to publish research results.

  19. There is a Significant Relationship Between Computer Attitudes and Library Anxiety Among African American Graduate Students. A review of: Jiao, Qun G., and Anthony J. Onwuegbuzie. “The Impact of Information Technology on Library Anxiety: The Role of Computer Attitudes.” Information Technology & Libraries 23.4 (Dec. 2004: 138 ‐44.

    Directory of Open Access Journals (Sweden)

    Gill Needham

    2007-03-01

    Full Text Available Objective – To investigate whether African American students’ computer attitudes predict levels of library anxiety. Design – A user study in which two instruments were administered to a group of graduate students to measure computer attitudes and library anxiety. Setting – The College of Education at an historically black college and university in the United States of America. Subjects – Ninety ‐four, predominantly female, African American graduate students, ranging in age from 22 ‐62 years old, and enrolled in either a statistics or a measurement course. Methods – Two instruments, the Computer Attitude Scale (CAS and the Library Anxiety Scale (LAS were administered to all the study participants. The Computer Anxiety Scale contains forty Likert ‐type items that assess individuals’ attitudes toward computers and their use. It includes four scales which can be administered separately: 1. Anxiety or fear of computers 2. Confidence in the ability to use computers 3. Liking or enjoying working with computers 4. Computer usefulnessThe LAS contains forty ‐three, 5 ‐point, Likert ‐format items that assess levels of library anxiety experienced by college students. It also has five subscales as follows: 1. Barriers with staff 2. Affective barriers 3. Comfort with the library 4. Knowledge of the library 5. Mechanical barriers Main results – There were twenty correlations between the library anxiety subscale scores and the computer attitude subscale scores. Four of these correlations were statistically significant. Liking or enjoying working with computers was statistically significantly linked to affective barriers, comfort with the library, and knowledge of the library. There was also a statistically significant association between an attitude of computer usefulness and knowledge of the library. Conclusion – These findings suggest that in this group of students there is a medium to strong relationship between computer attitudes and library anxiety.

  20. The effect of rare-earth filtration on organ doses in intraoral radiography

    Energy Technology Data Exchange (ETDEWEB)

    Asako, Satoshi; Satoh, Kenji; Furumoto, Keiichi (Nippon Dental Univ., Tokyo (Japan))

    1994-08-01

    Filters of rare-earth elements such as lanthanum (La, Z=57), samarium (Sm, Z=62), gadolinium (Gd, Z=64) and erbium (Er, Z=68) are frequently used in radiography for the purpose of reducing the patient dose by eliminating low-energy and high-energy X-rays which are not involved in imaging. It is useful to evaluate the dose reduction achieved by these rare-earth filters in terms of organ dose, and the effective dose equivalent, which is used for evaluating carcinogenic risks and hereditary effects of X-ray irradiation, for the purpose of optimizing the radiographic technique and radiation protection. Therefore, we calculated the organ dose and effective dose equivalent during intraoral radiography of the maxillary incisor region by simulation using samarium or erbium, typical rare-earth elements, in filtration. We evaluated the effects of these metals in dose reduction. When samarium or erbium, 0.1 mm thick, was used in added filtration at tube voltage of 60, 70, 80 and 90 kV, the time required for radiography almost doubled, respectively. The organ dose at each tube voltage was the largest in the parathyroid and thyroid glands, followed by bone surfaces and the optic lenses, skin, red bone marrow and salivary glands, larynx, and brain, in that order. The organ dose at sites other than the larynx and brain decreased as the quality of the incident X-ray beam was hardened. When samarium or erbium was added at each voltage, the effective dose equivalent was reduced by about 20% to 45%. Erbium was more effective than samarium in reducing the effective dose equivalent, and either of the two elements decreased its effectiveness with an increase in tube voltage. (author) 43 refs.

  1. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VLAREVARRMDERLDYIRIEPKRILDLGCGTGADFGGLGRRYPKAMRI 60 ... Query: 138 ADPLPALREMHRVLETDGLLMFSSLGPDTLKELRAALPDTHGTRVHRFID...MHDLGDALVA 197 ... ADPLPALREMHRVLETDGLLMFSSLGPDTLKELRAALPDTHGTRVHRFIDMHDLGDALVA Sbjct: 121 ADPLPALREMHRVLETDGLLMFSSLGPDTLKELRAALPDTHGTRVHRFIDMHDLGDALVA 180 ...

  2. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TATAPQSFGFYSKGCFAGGVAIPMDGPTWQVMRPSRNRRWGHPAMIALIEKLSRDADAD 138 ... PTATAP...QSFGFYSKGCFAGGVAIPMDGPTWQVMRPSRNRRWGHPAMIALIEKLSRDADAD Sbjct: 1 ... PTATAPQSFGFYSKGCFAGGVAIPMDGPTWQVMRPSRNRRWGHPAM

  3. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 138 ... Query: 4 ... IATFDTSRGPIVVELYPEKAPLTVANFVNLARRGFYNGLSFHRVIA...DFMIQXXXXXXXXX 63 ... IATFDTSRGPIVVELYPEKAPLTVANFVNLARRGFYNGLSFHRVIADFMIQ ... Sbjct: 1 ... IATFDTS

  4. Phase equilibria in a ternary fullerenol-d(C60(OH)22-24)-SmCl3-H2O system at 25°C

    Science.gov (United States)

    Yur'ev, G. O.; Keskinov, V. A.; Semenov, K. N.; Charykov, N. A.

    2017-05-01

    The solubility in a ternary fullerenol-d (C60(OH)22-24)-SmCl3-H2O system at 25°C is studied via isothermal saturation in ampules. The solubility diagram is shown to be a simple eutonic one that consists of two branches corresponding to the crystallization of fullerenol-d (C60(OH)22-24 · 30H2O) and samarium(III) chloride SmCl3 · 6H2O crystallohydrates and contains one nonvariant eutonic point corresponding to saturation with both crystallohydrates. The long branch of C60(OH)22-24 · 30H2O crystallization shows the effect of fullerenol-d salting out of saturated solutions; in contrast, the short branch of SmCl3 · 6H2O crystallization shows the pronounced salting-in effect of samarium(III) chloride.

  5. Alkaline and alkaline earth metal phosphate halides and phosphors

    Science.gov (United States)

    Lyons, Robert Joseph; Setlur, Anant Achyut; Cleaver, Robert John

    2012-11-13

    Compounds, phosphor materials and apparatus related to nacaphite family of materials are presented. Potassium and rubidium based nacaphite family compounds and phosphors designed by doping divalent rare earth elements in the sites of alkaline earth metals in the nacaphite material families are descried. An apparatus comprising the phosphors based on the nacaphite family materials are presented herein. The compounds presented is of formula A.sub.2B.sub.1-yR.sub.yPO.sub.4X where the elements A, B, R, X and suffix y are defined such that A is potassium, rubidium, or a combination of potassium and rubidium and B is calcium, strontium, barium, or a combination of any of calcium, strontium and barium. X is fluorine, chlorine, or a combination of fluorine and chlorine, R is europium, samarium, ytterbium, or a combination of any of europium, samarium, and ytterbium, and y ranges from 0 to about 0.1.

  6. Reductive trapping of [(OC){sub 5}W-W(CO){sub 5}]{sup 2-} in a mixed-valent Sm{sup II/III} calix[4]pyrrolide sandwich

    Energy Technology Data Exchange (ETDEWEB)

    Deacon, Glen B.; Guo, Zhifang [School of Chemistry, Monash University, VIC (Australia); Junk, Peter C.; Wang, Jun [College of Science and Engineering, James Cook University, Townsville, QLD (Australia)

    2017-07-10

    Reduction of tungsten hexacarbonyl by the divalent samarium(II) complex [Sm{sub 2}(N{sub 4}Et{sub 8})(thf){sub 4}] ((N{sub 4}Et{sub 8}){sup 4-}=meso-octaethylcalix[4]pyrrolide) in toluene at ambient temperature gave the remarkable heteronuclear mixed-valent samarium(II/III)/tungsten complex [{(thf)_2Sm"I"I(N_4Et_8)Sm"I"I"I(thf)}{sub 2}{(μ-OC)_2W_2(CO)_8}], which features the trapping of a rare [W{sub 2}(CO){sub 10}]{sup 2-} anion with an unsupported W-W bond. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. Preparation and dosimetry of radiotherapeutic particles for arthropaties; Preparacion y dosimetria de particulas radioterapeuticas para artropatias

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez Z, M.A. [Departamento de Medicina Nuclear, Instituto Nacional de Pediatria (Mexico); Ferro F, G. [Departamento de Materiales Radiactivos, Instituto nacional de Investigaciones Nucleares, Salazar, Estado de Mexico C.P. 52045 (Mexico); Rivera M, T.; Azorin N, J. [Departamento de Fisica, UAM Iztapalapa, Mexico D.F. (Mexico)

    1999-07-01

    It was developed a new formulation of macro aggregates of Samarium 153 ({sup 153} Sm-MH) for the arthropaties treatment. The radio pharmaceutic was prepared by reaction of Samarium 153 chloride (SmCl{sub 3}) in aqueous environment with sodium boron hydride in NaOH 0.5 N. The microscopic analysis shown that the particles have an average size of 4% m (range 1-14 {mu} m). The velocity of sedimentation was 0.008 cm/min with high stability in vitro in human serum. The biological studies in healthy rabbits, shown that the complex is retained inside the articulation still eight days after of the administration of the radiopharmaceutical. Likewise, it is presented the data of absorbed dose in the different target organs, which was determined by thermoluminescent dosimetry (TLD) through the use of a REMCAL phantom (radiation equivalent manikin calibration). (Author)

  8. Ion-exchange separation of the rare earth elements by means of solution of ammonium phthalate and chloride

    Energy Technology Data Exchange (ETDEWEB)

    Hubicki, W.; Ozga, W. (Uniwersytet Marii Curie-Sklodowskiej, Lublin (Poland))

    1976-01-01

    A new method of ion exchange separation of lanthanons by the use of equimolar solution of ammonium phthalate and ammonium chloride as an eluent was elaborated. This method allows to separate light lanthanons and to obtain concentrate of samarium and heavy lanthanons. 99.99% Y/sub 2/O/sub 3/ was obtained from non-neodymium concentration with 47.4% efficiency. The influence of change in concentration and pH of eluent on the effectiveness of separation was examined. It was found that an increase in concentration of eluent and pH leads to quick separation of yttrium from samarium and heavy lanthanons. However, the efficiency of pure Y/sub 2/O/sub 3/ decreases distinctly.

  9. Large directional optical anisotropy in multiferroic ferroborate

    Science.gov (United States)

    Kuzmenko, A. M.; Dziom, V.; Shuvaev, A.; Pimenov, Anna; Schiebl, M.; Mukhin, A. A.; Ivanov, V. Yu.; Gudim, I. A.; Bezmaternykh, L. N.; Pimenov, A.

    2015-11-01

    One of the most fascinating and counterintuitive recent effects in multiferroics is directional anisotropy, the asymmetry of light propagation with respect to the direction of propagation. In such case the absorption in a material can be different for opposite directions. Besides absorption, different velocities of light for different directions of propagation may be also expected, which is termed directional birefringence. In this work, we demonstrate large directional anisotropy in multiferroic samarium ferroborate. The effect is observed for linear polarization of light in the range of millimeter wavelengths, and it survives down to low frequencies. The dispersion and absorption close to the electromagnon resonance can be controlled by external magnetic field and are fully suppressed in one direction. By changing the geometry of the external field, samarium ferroborate shows giant optical activity, which makes this material a universal tool for optical control: with a magnetic field as an external parameter it allows switching between two functionalities: polarization rotation and directional anisotropy.

  10. Ionic liquid technology for recovery and separation of rare earths

    OpenAIRE

    Binnemans, Koen

    2015-01-01

    End-of-life neodymium-iron-boron and samarium-cobalt permanent magnets, fluorescent lamps and metal hydride batteries are valuable secondary resources of rare earths. These resources are characterised by relatively small volumes, but high concentrations of rare earths [1]. On the other hand, industrial process residues such as bauxite residue (red mud) and phosphogypsum contain low concentrations of rare earths, but are available in huge volumes [2]. Recovery of rare earths from end-of-life c...

  11. Ternary rare earth-lanthanide sulfides

    Science.gov (United States)

    Takeshita, Takuo; Gschneidner, Jr., Karl A.; Beaudry, Bernard J.

    1987-01-06

    A new ternary rare earth sulfur compound having the formula: La.sub.3-x M.sub.x S.sub.4 where M is a rare earth element selected from the group europium, samarium and ytterbium and x=0.15 to 0.8. The compound has good high-temperature thermoelectric properties and exhibits long-term structural stability up to 1000.degree. C.

  12. Structural and physical properties of Sm doped magnesium zinc ...

    Indian Academy of Sciences (India)

    2017-09-22

    Sep 22, 2017 ... Abstract. Samarium (Sm3+) doped magnesium zinc sulfophosphate glass system of composition (60–x)P2O5–20MgO–. 20ZnSO4–xSm2O3 (x = 0.0, 0.5, 1.0, 1.5 and 2.0 mol%) were synthesized using melt-quenching technique. The structure and physical properties of prepared glass samples were ...

  13. Structural aspects of displacive transformations: what can optical microscopy contribute? Dehydration of Sm2(C2O4)3·10H2O as a case study.

    Science.gov (United States)

    Matvienko, Alexander A; Maslennikov, Daniel V; Zakharov, Boris A; Sidelnikov, Anatoly A; Chizhik, Stanislav A; Boldyreva, Elena V

    2017-09-01

    For martensitic transformations the macroscopic crystal strain is directly related to the corresponding structural rearrangement at the microscopic level. In situ optical microscopy observations of the interface migration and the change in crystal shape during a displacive single crystal to single crystal transformation can contribute significantly to understanding the mechanism of the process at the atomic scale. This is illustrated for the dehydration of samarium oxalate decahydrate in a study combining optical microscopy and single-crystal X-ray diffraction.

  14. The growth and reactivity of the {Sm}/{Si(100)} interface

    Science.gov (United States)

    Onsgaard, J.; Christiansen, M.; Ørskov, F.; Godowski, P. J.

    1991-05-01

    The growth of the {Sm}/{Si(100)} interface is described and discussed in the context of the increasing experimental insight into lanthanide/semiconductor interfaces. Silicide formation takes place in the 1 to 5 monolayers coverage region. Different ordered structures, dependent on the initial coverage and temperature treatment, are observed. Oxygen adsorption and binding is strongly promoted, both when Sm is present at the surface and when oxygen reacts with a samarium-suicide film.

  15. Installation of electric generators on turbine engines

    Science.gov (United States)

    Demel, H. F.

    1983-01-01

    The installation of generators on turbine aircraft is discussed. Emphasis is placed on the use of the samarium cobalt generator. Potential advantages of an electric secondary power system at the engine level are listed. The integrated generator and the externally mounted generator are discussed. It is concluded that the integrated generator is best used in turbojet and low bypass ratio engines where there is no easy way of placing generators externally without influencing frontal areas.

  16. Fabrication of Material and Devices for Very High Density Information Storage.

    Science.gov (United States)

    1986-11-24

    crystal bismuth doped garnets , having properties equivalent to IPE grown materials,,’., onto gadolinium gallium garnet substrates. There was speculation... LPE onto0 (111)-.""’’ oriented calcium-, magnesium- or zirconium-substituted gadolinium, samarium or neodymium gallium /’’’ garnet substrates. Garnet ...properties of LPE garnetmusesit favor garnets a s a t arting poiut. ref og Vmagnetic and m g e-optical po et s o a- , pae d m u , alu inu-%, li

  17. Macrocyclic aminophosphonic acid complexes, their preparation, formulations and use; Fremgangsmaate for fremstilling av et makrocyklisk aminofosfonsyrekompleks eller et fysiologisk akseptabelt salt derav

    Energy Technology Data Exchange (ETDEWEB)

    Simon, J.; Wilson, D.A.; Garlich, J.R.; Troutner, D.E.

    1997-01-13

    Particle emitting radionuclides, e.g. Samarium-153, have been complexed with certain macrocyclic aminophosphonic acids wherein the nitrogen and phosphorus are interconnected by an alkylene group or substituted alkylene group. A composition is now disclosed which comprises a complex having a macrocyclic aminophosphonic acid, containing 1,4,7,10-tetraazycyclododecane as the macrocyclic moiety, or a physiologically, acceptable salt thereof, wherein the nitrogen and phosphorus are interconnected by an alkylene or substituted alkylene radical. 10 tabs.

  18. Effect of Flake Thickness on Coercivity of Nanocrystalline SmCo5 Bulk Prepared from Anisotropic Nanoflake Powder (Postprint)

    Science.gov (United States)

    2016-08-23

    flake thickness. 15. SUBJECT TERMS rare earth magnets , samarium cobalt magnets , permanent magnets 16. SECURITY CLASSIFICATION OF: 17...nanoflakes have attractive magnetic properties ; coercivity of up to 21 kOe and maximum energy product of up to 22 MGOe.9 Thus, the nanoflake powders...less reported on correlation between nanoflake morphology and final properties of the SmCo5 bulk magnets . In this study, we prepared SmCo5 nanoflakes

  19. Cross sections of deuteron induced reactions on $^{nat}$Sm for production of the therapeutic radionuclide $^{145}$Sm and $^{153}$Sm

    OpenAIRE

    Tárkányi, F.; Hermanne, A.; Takács, S.; Ditrói, F.; Csikai, J.; Ignatyuk, A. V.

    2014-01-01

    At present, targeted radiotherapy (TR) is acknowledged to have great potential in oncology. A large list of interesting radionuclides is identified, including several radioisotopes of lanthanides, amongst them $^{145}$Sm and $^{153}$Sm. In this work the possibility of their production at a cyclotron was investigated using a deuteron beam and a samarium target. The excitation functions of the $^{nat}$Sm(d,x)$^{145153}$Sm reactions were determined for deuteron energies up to 50 MeV using the st...

  20. THE ZOOCARTOGRAPHIC APPROACH TO ANURAN ECOLOGY In ...

    African Journals Online (AJOL)

    Matandellas. 12,8. Zebedela. 12,7. MarandeUas. 12,8 (10,1). Twinthorns. 13,0. 13,8. ,Salisbury. 13,8. Sinoia. 13,8. Salisbury. \\3,8. Salisbury. 13,7. Sinoia. \\3,7. Sinola. 13,7. Sinoia. 13,8. Salisbury. \\3,8. Salisbury. \\3,8. Salisbury. 13,4. Fort Victoria. 13,8. Salisbury. 13,8. Salisbury. 13,7. Sinoia. 13,9. Louis Trichardt. Between.

  1. Gclust Server: 183670 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available HSA_4885635 Cluster Sequences - 138 NP_005416.1 transition protein 2 (during histone to protamine replacement)...length 138 Representative annotation NP_005416.1 transition protein 2 (during histone to protamine replacement)

  2. Gene : CBRC-PHAM-01-1762 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available n-dz1 protein [Volvox carteri f. nagariensis] 1e-138 85% MYKAILHSSRCSLRTLTSTAVPHLPSPVSTEPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPQPPPTPPPPPPPP...QPPPPPPPPPPPPPSPPPTPSPPPPSPPTPPPPPPPPPPPPPPPPPPPPPPTPPPPPPPPPTPPPPPPPPPPPPPPPPPPPPPQPPPTPPPPPSPPPPPPPPPPPPPP...PPPPTPPPTPPPPPPPPTPPLPPPPPLQPPPTPPPPPPPPSPPPPPPPPPPPQAAPMSWLS ...

  3. ORF Alignment: NC_002932 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SVERGPLEVTIGTGMVIPGFDRALLDMEPGQKKTVNIP Sbjct: 1 ... KKGDKVLVHYTGTYDDGTVFDSSVERGPLEVTIGTGMVIPGFDRALLDMEPGQKKTVNIP 60 ... Query: 125 HPMA...GLDLNFELELVEIL 142 ... HPMAGLDLNFELELVEIL Sbjct: 121 HPMAGLDLNFELELVEIL 138

  4. Gclust Server: 252 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available transferase/ transferase, transferring glycosyl groups 138 1.00e-90 57.14 0.0 4.0 0.0 0.0 0.0 Show 252...transferase/ transferase, transferring glycosyl groups Number of Sequences 138 Homologs 138 Clustering

  5. AcEST: DK951191 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nhydrase (Fragment) OS=Gossypiu... 138 2e-31 tr|Q43231|Q43231_UROPA Carbonic anhydrase 1 OS=Urochloa panicoi...d... 138 2e-31 tr|Q43230|Q43230_UROPA Carbonic anhydrase 2 OS=Urochloa panicoid... 138 2e-31 tr|B6TLF0|B6TLF

  6. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC138 (Link to dictyBase) - - - Contig-U15456-1 VFC138P (Link... to Original site) VFC138F 411 VFC138Z 440 VFC138P 851 - - Show VFC138 Library VF (Link to library) Clone ID VFC138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...ducing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostelium discoideum mRNA for cathepsin D.... 815 0.0 4 AJ243946 |AJ243946.1 Dictyostelium discoideum ctsD gene for cathepsin D, exons 1 to 2. 815 0.0 5

  7. A statistical analysis of the initial biodistribution of {sup 153}Sm-EDTMP in a canine

    Energy Technology Data Exchange (ETDEWEB)

    Galiano, Eduardo [Department of Physics, Laurentian University, Ramsey Lake Road, Sudbury, Ont., P3E 2C6 (Canada)]. E-mail: egalianoriveros@laurentian.ca; Stradiotto, Marco [Department of Physics, Laurentian University, Ramsey Lake Road, Sudbury, Ont., P3E 2C6 (Canada)

    2005-07-01

    {sup 153}Sm (t{sub 1/2}=46h) emits a 103keV gamma photon and two medium-energy beta particles. Five mCi of Samarium-153 ethylenediaminetetramethylenephosphonic acid ({sup 153}Sm-EDTMP) were administered to a clinically normal dog and whole body scans were obtained at 15min, 2h, and 24h post-injection (PI). Regions of interest (ROIs) were drawn representing abdomen, knee, rib, vertebral bodies, bladder, kidney, and liver, in each image. For each ROI, the mean intensity and standard deviation were computed, and a histogram was created. Clinically significant increased uptakes were found in liver and kidney.

  8. Coprecipitation experiment with Sm hydroxide using a multitracer produced by nuclear spallation reaction: A tool for chemical studies with superheavy elements.

    Science.gov (United States)

    Kasamatsu, Yoshitaka; Yokokita, Takuya; Toyomura, Keigo; Shigekawa, Yudai; Haba, Hiromitsu; Kanaya, Jumpei; Huang, Minghui; Ezaki, Yutaka; Yoshimura, Takashi; Morita, Kosuke; Shinohara, Atsushi

    2016-12-01

    To establish a new methodology for superheavy element chemistry, the coprecipitation behaviors of 34 elements with samarium hydroxide were investigated using multitracer produced by a spallation of Ta. The chemical reactions were rapidly equilibrated within 10s for many elements. In addition, these elements exhibited individual coprecipitation behaviors, and the behaviors were qualitatively related to their hydroxide precipitation behaviors. It was demonstrated that the ammine and hydroxide complex formations of superheavy elements could be investigated using the established method. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Radiological response of lanthanum guiding seeds in brachytherapy implants; Resposta radiologica de sementes guia de lantanio em implantes braquiterapicos

    Energy Technology Data Exchange (ETDEWEB)

    Silva, L.S.R.; Machado, E.D.P., E-mail: lais26@globo.com [Centro Federal de Educacao Tecnologica de Minas Gerais, Belo Horizonte, MG (Brazil). Departamento de Engenharia de Materiais; Campos, T.P.R. [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Departamento de Engenharia Nuclear; Roberto, W.S. [Centro Federal de Educacao Tecnologica de Minas Gerais, Belo Horizonte, MG (Brazil). Departamento de Fisica e Matematica

    2013-08-15

    Ceramic seeds with La-139 incorporated were synthesized to be used as radiological guides in brachytherapy implants. The synthesis was performed based on the sol-gel method. The seeds were subjected to characterization by Scanning Electron Microscopy, X-ray diffraction and Energy-Dispersive X-ray Spectroscopy. Furthermore, the contrast from a radiographic film was evaluated to lanthanum, samarium and holmium seeds. Radiological response on a phantom at different depths with lanthanum seeds and metal seeds was also investigated. Based on the values of contrast, the synthesized lanthanum seeds can be considered efficient as radiological guides when implanted together with pure Ho-165 and Sm-152 seeds. (author)

  10. Understanding the photoluminescence characteristics of Eu{sup 3+}-doped double-perovskite by electronic structure calculation

    Energy Technology Data Exchange (ETDEWEB)

    Ghosh, Binita [St. Paul’s Cathedral Mission College, 33/1Raja Rammohan Roy Road, Kolkata 700009 (India); Halder, Saswata; Sinha, T. P. [Department of Physics, Bose Institute, 93/1 Acharya Prafulla Chandra Road, Kolkata 700009 (India); Das, Sayantani [Department of Physics, University of Calcutta, 92 Acharya Prafulla Chandra Road, Kolkata 700009 (India)

    2016-05-23

    Europium-doped luminescent barium samarium tantalum oxide Ba{sub 2}SmTaO{sub 6} (BST) has been investigated by first-principles calculation, and the crystal structure, electronic structure, and optical properties of pure BST and Eu-doped BST have been examined and compared. Based on the calculated results, the luminescence properties and mechanism of Eu-doped BST has been discussed. In the case of Eu-doped BST, there is an impurity energy band at the Fermi level, which is formed by seven spin up energy levels of Eu and act as the luminescent centre, which is evident from the band structure calculations.

  11. Geochronology and structuring of the Ceara State: Borborema Province northwestern part, NE Brazil; Geocronologia e estruturacao do estado do Ceara: NW da provincia Borborema, NE, Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Fetter, A.; Van Schmus, W.R. [Kansas Univ., Lawrence, KS (United States). Dept. of Geology; Santos, Ticiano J. Saraiva dos [UNESP, Rio Claro, SP (Brazil). Inst. de Geociencias e Ciencias Exatas; Arthaud, M.; Nogueira Neto, J. [Ceara Univ., Fortaleza, CE (Brazil). Dept. de Geologia

    1997-12-31

    The work confirms that the geochronological new data U/Pb in zircon and Samarium/Neodymium from the Ceara State furnished a refined chronology of the geological activity in the NW part of the Borborema Province, indicating an evolutive history since 2,78 Ga and 532 Ma. Furthermore, these data facilitated the different crust domain outlines in the region, putting age maximum limits in the pre-brasilianas supracrusts rocks deposition, and evidencing the epoch and duration of the Brasiliano magmatism and metamorphism in the northwest part of the State

  12. Structural aspects of displacive transformations: what can optical microscopy contribute? Dehydration of Sm2(C2O43·10H2O as a case study

    Directory of Open Access Journals (Sweden)

    Alexander A. Matvienko

    2017-09-01

    Full Text Available For martensitic transformations the macroscopic crystal strain is directly related to the corresponding structural rearrangement at the microscopic level. In situ optical microscopy observations of the interface migration and the change in crystal shape during a displacive single crystal to single crystal transformation can contribute significantly to understanding the mechanism of the process at the atomic scale. This is illustrated for the dehydration of samarium oxalate decahydrate in a study combining optical microscopy and single-crystal X-ray diffraction.

  13. Synthesis and application of a new fluorous-tagged ammonia equivalent

    DEFF Research Database (Denmark)

    Nielsen, Simon Dalsgaard; Smith, Garrick; Begtrup, Mikael

    2010-01-01

    A novel fluorous-tagged ammonia equivalent has been developed. It is based on a nitrogen-oxygen bond, which can be cleaved in a traceless manner by a molybdenum complex or samarium diiodide. The application in the synthesis of ureas, amides, sulfonamides, and carbamates is described. The scope of...... of the fluorous N--O linker is exemplified by the synthesis of itopride, a drug used for the treatment of functional dyspepsia. Itopride was synthesized with the aid of fluorous purification methods and the product was isolated in good overall yield, with high purity....

  14. Synthesis and application of a new fluorous-tagged ammonia equivalent.

    Science.gov (United States)

    Nielsen, Simon D; Smith, Garrick; Begtrup, Mikael; Kristensen, Jesper L

    2010-04-19

    A novel fluorous-tagged ammonia equivalent has been developed. It is based on a nitrogen-oxygen bond, which can be cleaved in a traceless manner by a molybdenum complex or samarium diiodide. The application in the synthesis of ureas, amides, sulfonamides, and carbamates is described. The scope of the fluorous N-O linker is exemplified by the synthesis of itopride, a drug used for the treatment of functional dyspepsia. Itopride was synthesized with the aid of fluorous purification methods and the product was isolated in good overall yield, with high purity. Copyright © 2010 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Jaderné kolektivní stupně volnosti a Skyrme funkcionál

    OpenAIRE

    Božík, Daniel

    2010-01-01

    Title: Energy functional theories in nuclear physics Author: Daniel Božík Department: Institute of Particle and Nuclear Physics of Charles University Supervisor: prof. RNDr. Jan Kvasil, DrSc. Supervisor's e-mail address: Abstract: In the present work we study the giant resonances of the chain of even-even samarium nuclei 144−154 Sm. The numerical calculations are provided by a chain of numer- ical codes. Mean field is calculated by the HFB method for the Skyrme d...

  16. Geochronology Intermediary Laboratory implantation at the Rio Grande do Norte Federal University: the dating of the Serrinha Granitoid (RN) and the correlate Brasiliana extensional deformation; Implantacao do Laboratorio Intermediario de Geocronologia na UFRN: a datacao do granitoide de Serrinha (RN) e da deformacao extensional brasiliana correlata

    Energy Technology Data Exchange (ETDEWEB)

    Macedo, Maria Helena F.; Sa, Emanuel F. Jardim de; Souza, Zorano S. [Pernambuco Univ., Recife, PE (Brazil). Nucleo de Pesquisa em Geodinamica e Geofisica; Mendes, Franklin S. [Pernambuco Univ., Recife, PE (Brazil). Curso de Quimica; Ramalho, Karlos A.C. [Pernambuco Univ., Recife, PE (Brazil). Curso de Geologia

    1997-12-31

    The article describes the activities developed by the Geochronology Intermediary Laboratory at the Federal University of the Rio Grande do Norte, a Brazilian university, where there were the preoccupation of establishing strategies for a geochronological development. It relates the Rubidium-Strontium (Rb/Sr) and Samarium-Neodymium (Sm/Nd) methods, describing the analysis realized in these methodologies. Afterward, it presents the geological and petrographic situation of the Granitoide de Serrinha, located at Rio Grande do Norte State, Brazil and its geochronological data 8 refs., 2 figs.

  17. ACR-ASTRO practice guideline for the performance of therapy with unsealed radiopharmaceutical sources.

    Science.gov (United States)

    Henkin, Robert E; Del Rowe, John D; Grigsby, Perry W; Hartford, Alan C; Jadvar, Hossein; Macklis, Roger M; Parker, J Anthony; Wong, Jeffrey Y C; Rosenthal, Seth A

    2011-08-01

    This guideline is intended to guide appropriately trained and licensed physicians performing therapy with unsealed radiopharmaceutical sources. Adherence to this guideline should help to maximize the efficacious use of these procedures, maintain safe conditions, and ensure compliance with applicable regulations. The topics dealt with in this guideline include indications for the use of iodine-131, both for the treatment of hyperthyroidism and thyroid carcinoma. In addition, indications for other less common procedures include those for the use of phosphorous-32 in its liquid and colloidal forms, strontium-89, samarium-153, and the use of Y-90 antibodies.

  18. Accumulation of rare earth elements by siderophore-forming Arthrobacter luteolus isolated from rare earth environment of Chavara, India.

    Science.gov (United States)

    Emmanuel, E S Challaraj; Ananthi, T; Anandkumar, B; Maruthamuthu, S

    2012-03-01

    In this study, Arthrobacter luteolus, isolated from rare earth environment of Chavara (Quilon district, Kerala, India), were found to produce catechol-type siderophores. The bacterial strain accumulated rare earth elements such as samarium and scandium. The siderophores may play a role in the accumulation of rare earth elements. Catecholate siderophore and low-molecular-weight organic acids were found to be present in experiments with Arthrobacter luteolus. The influence of siderophore on the accumulation of rare earth elements by bacteria has been extensively discussed.

  19. Synthesis of 2-(9,10-Dihydro-9,10-propanoanthracen-9-yl-N-methylethanamine via a [4+2] Cycloaddition

    Directory of Open Access Journals (Sweden)

    Usama Karama

    2010-06-01

    Full Text Available The synthesis of the tetracyclic molecule 2-(9,10-dihydro-9,10-propano-anthracen-9-yl-N-methylethanamine(2as a homologue of the antidepressant 1-(9,10-dihydro-9,10-ethanoanthracen-9-yl-N-methylmethaneamine (1 was described. The key intermediate 9-(prop-2-en-1-yl-9,10-dihydro-9,10-propanoanthracen-12-one (7was successfully synthesized via a [4+2] cycloaddition of α-bromoacrolein and 9-allyl-anthracene, followed by ring expansion and samarium diiodide deoxygenation.

  20. Synthesis of 2-(9,10-dihydro-9,10-propanoanthracen-9-yl)-N-methylethanaminevia a [4+2] cycloaddition.

    Science.gov (United States)

    Karama, Usama; Al-Saidey, Adel; Al-Othman, Zeid; Almansour, Abdel Rahman

    2010-06-09

    The synthesis of the tetracyclic molecule 2-(9,10-dihydro-9,10-propano-anthracen-9-yl)-N-methylethanamine (2) as a homologue of the antidepressant 1-(9,10-dihydro-9,10-ethanoanthracen-9-yl)-N-methylmethaneamine (1) was described. The key intermediate 9-(prop-2-en-1-yl)-9,10-dihydro-9,10-propanoanthracen-12-one (7) was successfully synthesized via a [4+2] cycloaddition of alpha-bromoacrolein and 9-allyl-anthracene, followed by ring expansion and samarium diiodide deoxygenation.