Basis for developing samarium AMS for fuel cycle analysis

International Nuclear Information System (INIS)

Buchholz, Bruce A.; Biegalski, Steven R.; Whitney, Scott M.; Tumey, Scott J.; Jordan Weaver, C.

2010-01-01

Modeling of nuclear reactor fuel burnup indicates that the production of samarium isotopes can vary significantly with reactor type and fuel cycle. The isotopic concentrations of 146 Sm, 149 Sm, and 151 Sm are potential signatures of fuel reprocessing, if analytical techniques can overcome the inherent challenges of lanthanide chemistry, isobaric interferences, and mass/charge interferences. We review the current limitations in measurement of the target samarium isotopes and describe potential approaches for developing Sm-AMS. AMS sample form and preparation chemistry will be discussed as well as possible spectrometer operating conditions.

4f and 5d magnetism in samarium

International Nuclear Information System (INIS)

Stunault, A.; Bernhoeft, N.; Vettier, C.; Dumesnil, K.; Dufour, C.

2001-01-01

We report on resonant magnetic X-ray scattering studies of a samarium epitaxial film at the samarium L 3 edge. We observe one quadrupolar resonance below the edge, reflecting the polarization of the 4f electrons, and two dipolar resonances above the edge, related to the polarization of the 5d band. We demonstrate, by following the thermal evolution of resonant magnetic intensities of both types, that the polarization of the 4f and 5d electrons present exactly the same temperature dependence, even very close to the ordering temperature, in agreement with the RKKY model for long-range magnetic order in rare earths

Studies on ultrasonic velocity and electrical conductivity of samarium soaps in non-aqueous medium

International Nuclear Information System (INIS)

Mehrotra, K.N.; Chauhan, M.; Shukla, R.K.

1990-01-01

The ultrasonic velocity of solutions of samarium soaps in non-aqueous medium has been measured at a constant temperature and the results have been used to evaluate the various acoustic parameters. The pre-micellar association and the formation of micelles in samarium soap solutions have been determined by conductometric measurements. The molar conductance at infinite dilution, degree of ionisation and ionisation constant have been evaluated. The results show that samarium soaps behave as weak electrolyte in dilute solutions. (Authors)

Diffusion of samarium into cobalt in the reduction-diffusion process

International Nuclear Information System (INIS)

Freitas Nogueira, P. de; Neto, F.B.; Landgraf, F.J.G.

1998-01-01

The presence of metallic cobalt in samarium-cobalt powders is a major cause for low magnetic properties in magnets. This paper intends to investigate the effect of time and temperature in the microstructure of powders produced by reduction-diffusion. This process, developed for the production of rare earth-transition metal alloys, consists on the reduction of the rare earth oxide with metallic calcium (or calcium hydride) and its subsequent diffusion into the cobalt particle. In the present work, a mixture of samarium oxide, cobalt powder and metallic calcium was heated to 1100 or 1200 C for 2 or 4 hours in a tubular furnace under one atmosphere of purified argon. The material thereof obtained, a sintered mass is disintegrated by aqueous crepitation. The powder was evaluated in terms of its chemical composition, its samarium yield and the intermetallic compounds present. The samarium, oxygen and calcium content of the powders produced were adequate for magnet production. However, despite the massive formation of the SmCo 5 compound after 2 hours at 1100 C, final homogeneity is attained only after 4 hours at 1200 C, with the presence of SmCo 5 and Sm 2 Co 7 and the absence of the Sm 5 Co 19 compound. Also, metallic cobalt and Sm 2 Co 17 were observed in the materials produced after 2 hours at 1100 or 1200 C. (orig.)

Nonlinear Faraday rotation in samarium vapor

International Nuclear Information System (INIS)

Barkov, L.M.; Melik-Pashaev, D.A.; Zolotorev, M.S.

1988-01-01

Experiments on nonlinear magnetic optical (Faraday) rotation on resonance transitions of atomic samarium are described. Measurements were carried out on transitions with different angular momenta of upper and lower states: 1→0, 0→1 and 1→1. Qualitative explanations of observed phenomena are given

Plasma sprayed samarium--cobalt permanent magnets

International Nuclear Information System (INIS)

Willson, M.C.; Janowiecki, R.J.

1975-01-01

Samarium--Co permanent magnets were fabricated by arc plasma spraying. This process involves the injection of relatively coarse powder particles into a high temperature gas for melting and spraying onto a substrate. The technique is being investigated as an economical method for fabricating Co--rare earth magnets for advanced traveling wave tubes and cross-field amplifiers. Plasma spraying permits deposition of material at high rates over large areas with optional direct bonding to the substrate, and offers the ability to fabricate magnets in a variety of shapes and sizes. Isotropic magnets were produced with high coercivity and good reproducibility in magnetic properties. Post-spray thermal treatments were used to enhance the magnetic properties of sprayed deposits. Samarium--Co magnets, sprayed from Sm-rich powder and subjected to post-spray heat treatment, displayed energy products in excess of 9 million G-Oe and coercive forces of approximately 6000 Oe. Bar magnet arrays were constructed by depositing magnets on ceramic substrates

Magnetoresistance of samarium in the 4.2-300 K range

International Nuclear Information System (INIS)

Trubitsyn, V.A.; Shalashov, V.F.

1980-01-01

Electric conductivity, transverse and longitudinal magnetoresistance of polycrystalline samarium with the purity of 99.9% in the 4.2-300 K temperature range and in magnetic fields up to 50 ke, are measured. The constituent of specific electric conductivity caused by spin disorder is 30.7 μOhmxcm, m*/m=2.6, the exchange parameter is G=3.1 eVxA 3 . Both transverse and longitudinal magnetoresistance are positive at 4.2 K; and the increase of temperature reveals a number of anomalies, evidently conditioned by the alteration of samarium magnetic structure

Conductometric investigations on samarium soaps

International Nuclear Information System (INIS)

Mehrotra, K.N.; Chauhan, Mithlesh; Shukla, R.K.

1989-01-01

The critical micelle concentration (CMC), degree of dissociation and dissociation constant of samarium soaps (valerate, caproate, caprylate and caprate) in a mixture of 60 per cent benzene and 40 per cent methanol were determined by using conductometric measurements. The soaps behaved as simple electrolyte in dilute solutions and the CMC was found to decrease with increasing chainlength of the fatty acid constituent of the soap. (author). 7 refs., 2 tabs

Optical isotope shifts for unstable samarium isotopes

International Nuclear Information System (INIS)

Eastham, D.A.; Walker, P.M.; Griffith, J.A.R.; Evans, D.E.; Grant, I.S.; England, J.G.; Fawcett, M.J.

1984-01-01

Using a tunable dye laser beam intersecting a thermal atomic beam, optical isotope shifts and hyperfine splittings have been measured for the four unstable samarium isotopes between 144 Sm and 154 Sm, covering the well known transition region from spherical to deformed shapes. (orig.)

The samarium Grignard reaction. In situ formation and reactions of primary and secondary alkylsamarium(III) reagents

Energy Technology Data Exchange (ETDEWEB)

Curran, D.P.; Totleben, M.J. [Univ. of Pittsburgh, PA (United States)

1992-07-15

This work shows that primary and secondary radicals are rapidly reduced in THF/HMPA to form primary- and secondary-alkylsamarium reagents. The primary- and secondary-radicals can be formed either by direct SmI{sup 2} reductions of primary- and secondary-halides or by a previous rapid radical cyclization. The samarium reagents have moderate stability in solution, and they react with a variety of typical electrophiles, including aldehydes and ketones. The work further shows that organosamarium intermediates can be involved in the traditional samarium Barbier reaction of aldehydes and ketones conducted in THF/HMPA. A new procedure called the {open_quotes}samarium Grignard{close_quotes} method is introduced, and it is suggested that this new procedure will have considerably more scope and generality than the samarium Barbier reaction. 37 refs., 4 tabs.

Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

Energy Technology Data Exchange (ETDEWEB)

Shaorong Liu; Jian Meng (Beijing Research Institute of Chemical Engineering and Metallurgy (China)); Wenhua Liu (General Research Institute for Non-Ferrous Metals (China))

1992-08-24

When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs.

Fluorimetric determination of samarium(III) and europium(III) in neodymium oxide by separation with a resin column

International Nuclear Information System (INIS)

Shaorong Liu; Jian Meng; Wenhua Liu

1992-01-01

When thenoyltrifluoroacetone-phenanthroline-Triton X-100 is used to determine samarium(III) and europium(III) fluorimetrically, only a limited amount of neodymium(III) can be tolerated. By using an on- line separation which can partially separate neodymium(III) from samarium(III), a practical and convenient method was developed to detect samarium(III) at concentrations >0.05% and europium(III) at concentrations >0.005% in neodymium oxide. (author). 7 refs.; 4 figs.; 3 tabs

ppt level detection of samarium(III) with a coated graphite sensor based on an antibiotic.

Science.gov (United States)

Ganjali, Mohammad Reza; Rezapour, Morteza; Pourjavid, Mohammad Reza; Haghgoo, Soheila

2004-07-01

N-[2-[4-[[[(Cyclohexylamino)carbonyl]amino]sulfonyl]phenyl]ethyl]-5-methyl pyrazine carboxamide (glipizid) was explored as an electro-active material for preparing a polymeric membrane-based sensor selective to samarium ions. The membrane incorporated 30% poly(vinyl chloride) (PVC), 53% benzyl acetate (BA), 11% glipizid and 6% sodium tetraphenyl borate. When coated on the surface of a graphite electrode, it exhibits Nernstian responses in the concentration range of 1.0 x 10(-5) to 1.0 x 10(-10) M, with a detection limit of 8.0 x 10(-11)M samarium. The electrode shows high selectivity towards samarium over several cations (alkali, alkaline earth, transition and heavy metal ions), and specially lanthanide ions. The proposed sensor has a very short response time (pH range for at least ten weeks. It was used as an indicator electrode in potentiometric titration of Sm(III) ions with an EDTA solution, and for determination of samarium in binary and ternary mixtures.

Adsorption and the initial stages of samarium condensation on iridium coated by graphite monolayer

International Nuclear Information System (INIS)

Abdullaev, R.M.; Tontegode, A.Ya.; Yusifov, F.K.

1978-01-01

Adsorption and the initial stages of vacuum samarium condensation on iridium coated by graphite monolayer (valent-saturated neutral substrate) were studied by the thermodesorption mass-spectrometry and thermoemission methods, and were compared with samarium adsorption and condensation on iridium. Desorption heat of samarium atoms with thin coating of Ir-C, equal to E approximately 1.9 eV has been determined. For desorption with Ir E is approximately 6 eV. Such a great difference in desorption heats is connected with the reduction of covalent constituent of adsorption bond in a neutral substrate. Samarium on Ir-C is found to be condensated in two states: loosely bound and tightly bound which sharply differ in properties. The tightly bound state is characterized by abnormally low vapour pressure. Possible nature of this state is discussed. Double effect on the condensation of the substrate valent saturation is noted. On the one hand, the reduction of the particle bond with the substrate decreases their concentration on the surface, preventing condensation. On the other hand, the release of the valent eloctrons of adatous brings about strong lateral interaction between them, which in its turn, promotes condensation during eased migration on the neutral substrate

Solar nebula heterogeneity in p-process samarium and neodymium isotopes.

Science.gov (United States)

Andreasen, Rasmus; Sharma, Mukul

2006-11-03

Bulk carbonaceous chondrites display a deficit of approximately 100 parts per million (ppm) in 144Sm with respect to other meteorites and terrestrial standards, leading to a decrease in their 142Nd/144Nd ratios by approximately 11 ppm. The data require that samarium and neodymium isotopes produced by the p process associated with photodisintegration reactions in supernovae were heterogeneously distributed in the solar nebula. Other samarium and neodymium isotopes produced by rapid neutron capture (r process) in supernovae and by slow neutron capture (s process) in red giants were homogeneously distributed. The supernovae sources supplying the p- and r-process nuclides to the solar nebula were thus disconnected or only weakly connected.

Crystallization of Yttrium and Samarium Aluminosilicate Glasses

OpenAIRE

Lago, Diana Carolina; Prado, Miguel Oscar

2016-01-01

Aluminosilicate glasses containing samarium and yttrium (SmAS and YAS glasses) exhibit high glass transition temperatures, corrosion resistance, and glass stability on heating which make them useful for technological applications. Yttrium aluminosilicate glass microspheres are currently being used for internal selective radiotherapy of liver cancer. During the preparation process, crystallization needs to be totally or partially avoided depending on the final application. Thus knowing the cry...

Determination of 0.01–0.1% of samarium in 40–100 mg of lead chloride

NARCIS (Netherlands)

Agterdenbos, J.; Jütte, B.A.H.G.; Schuring, J.

1971-01-01

A method is described for the determination of 5–25 μg of samarium in about 40 mg of lead chloride, based on the removal of the lead by electrolysis and determination of the samarium by extraction with PAN and measurement of the extinction of the complex at 552 nm.

Synthesis and structure of unprecedented samarium complex with bulky bis-iminopyrrolyl ligand via intramolecular C=N bond activation

Energy Technology Data Exchange (ETDEWEB)

Das, Suman; Anga, Srinivas; Harinath, Adimulam; Panda, Tarun K. [Department of Chemistry, Indian Institute of Technology, Hyderabad (India); Pada Nayek, Hari [Department of Applied Chemistry, Indian Institute of Technology, (ISM) Dhanbad, Jharkhand (India)

2017-12-29

An unprecedentate samarium complex of the molecular composition [{κ"3-{(Ph_2CH)N=CH}{sub 2}C{sub 4}H{sub 2}N}{κ"3-{(Ph_2CHN=CH)(Ph_2CHNCH)C_4H_2N}Sm}{sub 2}] (2), which was isolated by the reaction of a potassium salt of 2,5-bis{N-(diphenylmethyl)-iminomethyl}pyrrolyl ligand [K(THF){sub 2}{(Ph_2CH)N=CH}{sub 2}C{sub 4}H{sub 2}N] (1) with anhydrous samarium diiodide in THF at 60 C through the in situ reduction of imine bond is presented. The homoleptic samarium complex [[κ{sup 3}-{(Ph_2CH)-N=CH}{sub 2}C{sub 4}H{sub 2}N]{sub 3}Sm] (3) can also be obtained from the reaction of compound 1 with anhydrous samarium triiodide (SmI{sub 3}) in THF at 60 C. The molecular structures of complexes 2 and 3 were established by single-crystal X-ray diffraction analysis. The molecular structure of complex 2 reveals the formation of a C-C bond in the 2,5-bis{N-(diphenylmethyl)iminomethyl}pyrrole ligand moiety (Ph{sub 2}Py{sup -}). However, complex 3 is a homoleptic samarium complex of three bis-iminopyrrolyl ligands. In complex 2, the samarium ion adopts an octahedral arrangement, whereas in complex 3, a distorted three face-centered trigonal prismatic mode of nine coordination is observed around the metal ion. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Effect of samarium in corrosion and microstructure of Al-5Zn-0.5Cu as low driving voltage sacrificial anode

Science.gov (United States)

Pratesa, Yudha; Ferdian, Deni; Ramadhan, Fajar Yusya; Maulana, Bramuda

2018-05-01

Sacrificial Anode Low voltage is the latest generation of the sacrificial anode that can prevent the occurrence of Hydrogen Cracking (HIC) due to overprotection. The Al-5n-0.5Cu alloy showed the potential to be developed as the new sacrificial anode. However, the main problem is copper made Al2Cu intermetallic in grain boundary. Samarium is added to modify the shape of the intermetallic to make it finer and make the corrosion uniform. Several characterizations were conducted to analyze the effect of Samarium. Scanning electron microscope (SEM) and Energy dispersive spectroscopy was used to analyzed the microstructure of the alloy. Metallography preparation was prepared for SEM analysis. Corrosion behavior was characterized by cyclic polarization in 3.5% NaCl solution. The results show samarium can change the shape of intermetallic and refine the grains. In addition, samarium makes better pitting resistance and exhibits a tendency for uniform corrosion. It is indicated by the loop reduction (ΔEpit-prot). Current density increased as an effect of samarium addition from 6x10-5 Ampere (Al-5Zn-0.5Cu) to 2.5x10-4 Ampere (Al-5Zn-0.5Cu-0.5Sm). Steel potential protection increased after addition of samarium which is an indication the possibility of Al-Zn-Cu-Sm to be used as low voltage sacrificial anode.

Ultrasonic and viscosimetric studies of samarium laurate in benzene-dimethylsulfoxide mixtures

International Nuclear Information System (INIS)

Mehrotra, K.N.; Anis, M.

1995-01-01

Ultrasonic and viscosity measurements of samarium laurate in benzene-DMSO mixtures of different compositions (7:3 and 1:1 V/V) have been used to determine the critical micelle concentration (CMC), soap-solvent interaction, and various acoustic parameters of the system. The values of critical micelle concentration increase with increasing amount of DMSO in the solvent mixtures. The viscosity results have been explained on the basis of equations proposed by Einstein, Vand. Moulik, and Jones-Dole. The values of CMC for samarium laurate obtained from the viscosity measurements are in agreement with the results obtained from ultrasonic measurements. The results show that the soap molecules do not aggregate appreciably below CMC there is a marked change in the aggregation behaviour at CMC. (author)

Behavior of Samarium III during the sorption process; Comportamiento del Samario-III durante el proceso de sorcion

Energy Technology Data Exchange (ETDEWEB)

Ordonez R, E.; Garcia G, N.; Garcia R, G. [ININ, Carr. Mexico-Toluca Km 36.5, Salazar, Estado de Mexico (Mexico)]. e-mail: edo@nuclear.inin.mx

2004-07-01

In this work the results of the behavior of samarium in solution are presented, in front of a fine powder of zirconium silicate (zircon). For that which is necessary to characterize the zircon, studying the crystallinity, the morphology, the surface area and the isoelectric point. The behavior of samarium in solution is studied by means of the elaboration of isotherm of sorption, using the technique by lots. One observes that to pH values of nearer to the isoelectric point (pH = 7.23) the process of sorption of the samarium begins, reaching a maximum to near pH at 9. The technique of luminescence is used to determine the concentration of the sipped samarium (phosphorescence) and also to make the speciation of the species formed in the surface of the zircon (phosphorescence). The results can be extrapolated with the plutonium when making the modeling of the migration of alpha emitting coming from the repositories of radioactive waste since both they have similar chemical properties (they are homologous). (Author)

Inductively coupled plasma optical emission spectrometry analysis of lanthanum, samarium and gadolinium oxides for rare earths impurities

International Nuclear Information System (INIS)

Reino, L.C.P.; Lordello, A.R.

1990-09-01

An inductively coupled plasma optical emission spectrometry method is described for the determination of Sm, Eu, La, Gd, Dy, Pr, Ho, Nd, Tb and Y in purified oxides of lanthanum, samarium and gadolinium. The method enables a simple, precise and readily available determination. Dissolution of the samples is achieved with diluted hydrochloric acid (1:1). The solutions are diluted to volume for a concentration of 1mg/ml. The lowest determination limit is 0,01% for most elements and 0,05 or 0,1% for a few rare earths in samarium and gadolinium matrices. Lanthanum, Samarium and Gadolinium concentrates with purity grade of 99,9%, 99,6% and 99,8%, respectively, can be analysed by this procedure. (author)

Pemisahan Unsur Samarium dan Yttrium dari Mineral Tanah Jarang dengan Teknik Membran Cair Berpendukung (Supported Liquid Membrane

Directory of Open Access Journals (Sweden)

Amri Amin

2009-06-01

Full Text Available he increasing use of rare earth elements in high technology industries needs to be supported by developmental work for the separation of elements. The research objective is fiercely attracting and challenging considering the similarity of bath physical and chemical properties among these elements. The rate separation of samarium and yttrium elements using supported liquid membrane has been studied. Polytetrafluoroethylene (PTFE with pore size of 0.45 µm has been used as the membrane and di(2-ethylhexyl phosphate (D2EHP in hexane has been used as a carrier and nitric acid solution has been used as receiving phase. Result of experiments showed that the best separation rate of samarium and yttrium elements could be obtained at feeding phase of pH 3.0, di(2-ethylhexyl phosphate (D2EHP concentration of 0.3 M, agitation rate of 700 rpm, agitation time of 2 hours, and nitric acid and its solution concentrations of 1.0 M and 0.1 M, respectively. At this condition, separation rates of samarium and yttrium were 64.4 and 67.6%, respectively.   Keywords: liquid membrane, rare earth elements, samarium, yttrium

Preparation and examination of properties of samarium-153-EDTMP complex

International Nuclear Information System (INIS)

Nowak, M.; Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W.; Licinska, I.

1995-01-01

Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of 153 Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, β - -decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of 153 Sm-EDTMP chelate were examined in a broad range of samarium concentration and 153 Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of 153 Sm-EDTMP chelate as compared with molecules of ''free''EDTMP. The results of biodistribution of 153 Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of 153 Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs

Expedient Method for Samarium(II) Iodide Preparation Utilizing a Flow Approach

Czech Academy of Sciences Publication Activity Database

Voltrová, Svatava; Šrogl, Jiří

2013-01-01

Roč. 24, č. 3 (2013), s. 394-396 ISSN 0936-5214 R&D Projects: GA MŠk LH12013 Institutional support: RVO:61388963 Keywords : flow * samarium * iodide * reduction Subject RIV: CC - Organic Chemistry Impact factor: 2.463, year: 2013

Optical properties of zinc–vanadium glasses doped with samarium ...

Indian Academy of Sciences (India)

Abstract. Zinc–vanadium glasses doped with samarium oxide having the chemical composition Sm2O3(x). ZnO(40−x)V2O5(60)(where x = 0·1–0·5 mol%) were prepared by melt quenching method. The density of these glasses was measured by Archimedes method; the corresponding molar volumes have also been ...

X-ray spectrum in the range (6-12) A emitted by laser-produced plasma of samarium

International Nuclear Information System (INIS)

Louzon, Einat; Henis, Zohar; Levi, Izhak; Hurvitz, Gilad; Ehrlich, Yosi; Fraenkel, Moshe; Maman, Shlomo; Mandelbaum, Pinchas

2009-01-01

A detailed analysis of the x-ray spectrum emitted by laser-produced plasma of samarium (6-12 A) is presented, using ab initio calculations with the HULLAC relativistic code and isoelectronic considerations. Resonance 3d-nf (n=4 to 7), 3p-4d, 3d-4p, and 3p-4s transitions in Ni samarium ions and in neighboring ionization states (from Mn to Zn ions) were identified. The experiment results show changes in the fine details of the plasma spectrum for different laser intensities.

Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

Energy Technology Data Exchange (ETDEWEB)

Mendes, B.M., E-mail: bmm@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Mendes, T.M.; Campos, T.P.R., E-mail: campos@nuclear.ufmg.b [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

2011-07-01

Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

Synthesis of samarium binding bleomycin - a possible NCT radiosensitizer

International Nuclear Information System (INIS)

Mendes, B.M.; Mendes, T.M.; Campos, T.P.R.

2011-01-01

Bleomycin (BLM) is a drug that has attractive features for the development of a new radiopharmaceutical, particularly with regard to neutron capture therapy (NCT) sensitized by Sm-149. It has the ability to chelate many metal ions. In vitro studies have shown that up to 78% of BLM present in a cell is accumulated inside the nucleus or in the nuclear membrane. In addition, this drug has higher affinity for tumor tissues than for normal tissues. Radioactive isotopes carried by this antibiotic would be taken preferentially to one important cellular targets DNA. Besides, BLM displays intrinsic anti-tumor activity - it is a chemotherapic antibiotic clinically used against some cancers. This study aimed to obtain bleomycin molecules bound to samarium (BLM-Sm) for NCT studies in vitro and in vivo. The binding technique employed in this work has great simplicity and low cost. Thin layer chromatography, high performance liquid chromatography, fast protein liquid chromatography and analysis by ICP-AES were applied to verify the binding molecule. ICP-AES results showed the presence of samarium in the sample peaks related to BLM-Sm. However, efficiency and stability of this bond needs to be investigated. (author)

Influence of pretreatment temperature cycling on the radiating defect formation in silicon doped by samarium

International Nuclear Information System (INIS)

Abdurakhmanov, K.P.; Nazyrov, D.E.

2006-01-01

Full text: The raise of thermal and radiation stability as it is known, is one of actual problems of physics semiconductors. Recently it is established, that the rare-earth elements (REE) raise a stability of silicon to exterior action. In this connection the investigation of silicon doped REE by samarium and influence on its properties of heat treatments and radiation exposure is important. In sectional operation the outcomes of investigations of influence of samarium on thermal (600 degree C are reduced; 600 deg. + 900 deg. C; 900 deg. C; 900 deg. C + 600 deg. C; 1100 deg. C; 600 deg. C + 900 deg. C + 1100 deg. C; 900 deg. C + 600 deg. C + 1100 deg. C) thermal defect formation and radiation defect formation (exposure of γ-quanta 60 Co) both in beforehand wrought, and in thermally unfinished samples. After each cycle of heat treatments samples cool fast (throwing off in oil) or slowly (together with the furnace). Doping n-silicon REE by gadolinium and samarium was carried out during cultivation. The concentration of gadolinium and samarium in silicon, on sectional of a neutron-activation analysis was equaled 10 14 - 10 18 cm -3 . As control is model monocrystal silicon such as KEP-15/50. Para-meters of deep levels originating in control and doped REE samples, both past heat treatment or temperature cycling, and irradiated by the γ-quanta are defined by methods of a capacity spectroscopy: DLTS and IRC. The obtained outcomes have shown, that in irradiated with the γ-quanta 60 Co deep levels samples are formed with energies: E C -0,17 eV, E C -0,32 eV, EC-0,41 eV. Thus the parameters of deep levels vary depending on requirements of prestress heat treatment. For example heat treatment at 600 deg. C essentially increments a velocity of introduction of and centre (deep level of E C -0,17 eV), in comparison with a velocity of introduction of this level in samples with prestress heat treatment at 900 deg. C. In samples n-Si doped by samarium effectiveness of formation

Sorption of samarium in iron (II) and (III) phosphates in aqueous systems

International Nuclear Information System (INIS)

Diaz F, J.C.

2006-01-01

The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

33 CFR 138.40 - Forms.

Science.gov (United States)

2010-07-01

...) § 138.40 Forms. All forms referred to in this subpart may be obtained from NPFC by requesting them in writing at the address given in § 138.45(a) or by clicking on the Forms link at the NPFC E-COFR Web site... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Forms. 138.40 Section 138.40...

Impact of educational strategies in positioning Samarium-153 EDTMP as a treatment for metastatic bone pain

International Nuclear Information System (INIS)

Seminario, C.; Morales, R.; Castro, M.; Cano, R.A.; Mendoza, G.

2005-01-01

To educate is a difficult task but its results make efforts worthwhile. Many patients in Peru suffer from intractable bone pain due to metastases. Since 1993 radionuclides were used to palliate bone pain due to metastases in Peru. First, with the help of the IAEA, Peru participated in a clinical trial using Phosphorus 32 and Strontium 89. Then, efforts were performed to produce Samarium 153 EDMTP locally, which was achieved in 1995. Nevertheless, years passed and Samarium use did not increase proportionally to the needs of people with cancer and bone pain, mainly the poor. Educational strategies have been proven useful for delivering solutions to many health problems in other diseases and also in cancer. Health education makes patients and their relatives assume responsible care of their problems. The purpose of this work was to increase Samarium EDTMP use as palliative treatment in patients with bone pain due to metastases, using educational strategies as means to change attitudes towards this health problem. In September 2003, a task group conducted studies in order to apply several methods to achieve the goal of increasing Samarium EDTMP use. Educational strategies employed were performed to provide verbal and written information to patients, physicians, medical students, residents, pain specialists, oncologists and neurologists, as well as general public. Verbal information included radio interviews, television spots and a phone number (in charge of two secretaries, prepared for answering and if not possible, a physician was in charge of attending patient consultation), e-mail and a web page for consultation. Written material was delivered to several newspapers, including clinical use of Samarium, possibilities of being elected for treatment, benefits and risks and a photography of the product. Politics of the institution producing Samarium changed, in order to achieve minimum cost of the product and it was delivered to all publics at the lowest cost for a year

Lanthanum (samarium) nitrate-4-aminoantipyrine nitrate-water systems

International Nuclear Information System (INIS)

Starikova, L.I.; Zhuravlev, E.F.

1985-01-01

Using the isothermal method of cross-sections at 50 deg C systems lanthanum nitrate-4-aminoantipyrine nitrate-water (1), samarium nitrate-4-aminoantipyrine nitrate-water (2), are studied. Isotherms of system 1 consist of two crystallization branches of initial salt components. In system 2 formation of congruently soluble compounds of the composition Sm(No) 3 ) 3 xC 11 H 13 ON 3 xHNO 3 is established. Analytical, X-ray phase and thermogravimetric analysis of the isolated binary salt are carried out

Collective effects in even-mass samarium isotopes by polarized-proton scattering

NARCIS (Netherlands)

Petit, R.M.A.L.; Hall, van P.J.; Klein, S.S.; Moonen, W.H.L.; Nijgh, G.J.; Overveld, van C.W.A.M.; Poppema, O.J.

1993-01-01

The even-mass samarium isotopes 148,...,152Sm have been investigated by polarized proton scattering at 20.4 MeV beam energy. The data have been analysed with an 'extended' optical model, where the intensities of the first maxima of the main inelastic channels are fitted in a coupled-channels

Synthesis of samarium, europium and ytterbium acetylenides

International Nuclear Information System (INIS)

Bochkarev, M.N.; Fedorova, E.A.; Glushkova, N.V.; Protchenko, A.V.; Druzhkov , O.N.; Khorshev, S.Ya.

1995-01-01

Ethynyl complexes of samarium, europium and ytterbium were prepared by interaction of naphthalinides of metals with acetylene in tetrahydrofuran. The compounds are isolated in the form of dark-coloured pyrophore powders. Data of magnetic measurements suggest that in the course of the reaction Sm(2) is oxidized completely to Sm(3), Yb(2) transforms into Yb(3) partially, whereas europium preserves its initial bivalent state. Hydrolysis of the compounds prepared provides acetylene, ethylene, ethane and hydrogen which indicates the presence of acethylenide Ln 2 C 2 and hydride LnH groupings (Ln = Sm, Eu, Yb). 9 refs., 2 tabs

Sorption-desorption of samarium in Febex bentonite

International Nuclear Information System (INIS)

Ramirez-Guinart, O.; Rigol, A.; Vidal, M.; Fernandez-Poyatos, P.; Alba, M. D.

2012-01-01

Document available in extended abstract form only. The chemical and physical nature of the clay is a key issue in the design of engineered barriers. The FEBEX bentonite is one of the clays candidates to be used in engineered barriers in deep geology repositories (DGR). Here, its performance was tested with respect to the sorption-desorption of samarium, which is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in high level radioactive waste in the form of the radioactive isotope 151 Sm. FEBEX bentonite was used in this study. This is a di-octahedral smectite, with isomorphic substitutions in tetrahedral and octahedral sheets. Its theoretical cation exchange capacity value is 1500 meq kg -1 . Sorption isotherms were obtained for Sm in the range of initial concentrations of 0.01 and 9 meq l -1 . Tests were carried out in deionized water and in a medium simulating the composition of interstitial water. Sorption tests were performed equilibrating 30 ml of the Sm solution with 0.2 g of clay. After a contact time of 24 hours, supernatants were decanted off after centrifugation. The quantification of the concentration of Sm in the initial and final solutions allowed us to quantify the Sm equilibrium concentration (C eq ), the fraction sorbed in the FEBEX bentonite (C sorb ) and to derive the sorption K d data. Desorption tests were applied to determine the desorption K d and the percentage of Sm reversibly sorbed. Desorption tests were performed with the bentonite residue from the sorption step, under the same experimental conditions, but without Sm. Powder X-ray diffractograms were obtained from 3 to 70 deg. 2θ with a step of 0.05 deg. and a counting time of 3 s. The crystalline phases were identified using the computer program X'Pert HighScore. The morphology of the samples was analyzed by SEM at 20 kV. An EDX system was fitted to the SEM equipment to perform chemical analyses of the samples using a Si/Li detector

Laser spectroscopy of atomic samarium

International Nuclear Information System (INIS)

Barkov, L.M.; Melik-Pashaev, D.A.; Zolotorev, M.S.

1988-01-01

Samarium spectrum was studied with a purpose to find transitions to be used in experiments on parity nonconservation. Macaluso-Corbino effect - Faraday rotation near resonance was used for the search and study of spectral lines. We have identified previously unknown energy levels belonging to the 4f 5 6s 2 5 D term: 15914.55(3) cm -4 (J=1), 17864.29(3) cm -4 (J=2), 20195.76(3) cm -4 (J=3). M1-transitions to these levels from the levels of the ground 4f 5 6s 2 7 F term were observed. There are several peculiarities of these transitions which are due to the fact that they occut within an inner 4f 5 -shell, particularly, a very small presuure broadening by inert gases. 44 refs.; 17 figs.; 7 tabs

Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study

International Nuclear Information System (INIS)

Lucas H, J.

2016-01-01

In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

Removal of trivalent samarium from aqueous solutions by activated biochar derived from cactus fibres

Institute of Scientific and Technical Information of China (English)

Loukia Hadjittofi; Styliana Charalambous; Ioannis Pashalidis

2016-01-01

The efficiency of activated biochar fibres obtained fromOpuntia Ficus Indica regarding the sorption of trivalent samarium (Sm(III)) from aqueous solutions was investigated by batch experiments. The effect of various physicochemical parameters (e.g. pH, initial metal concentration, ionic strength, temperature and contact time) on the Sm(III) adsorption was studied and the surface species were characterized by FTIR spectroscopy prior to and after the lanthanide sorption. The experimental results showed that the acti-vated biochar fibres possessed extraordinary sorption capacity for Sm(III) in acidic solutions (qmax=90 g/kg, pH 3.0) and near neutral solutions (qmax=350 g/kg, pH 6.5). This was attributed to the formation of samarium complexes with the surface carboxylic moieties, available in high density on the lamellar structures of the bio-sorbent.

Pressure and irradiation effects on transport properties of samarium compounds with instable valence

International Nuclear Information System (INIS)

Morillo, J.

1981-01-01

Electron transport properties in samarium compounds with instable valence are studied in this thesis: from SmS in its integer valence phases at common pressure to SmB 6 compound IV at common pressure through SmSsub(1-x)Psub(x) (x 6 is presented [fr

Graphite furnace atomic absorption spectrometry with a tantalum boat for the determination of yttrium, samarium, and dysprosium in a mish metal

International Nuclear Information System (INIS)

Daidoji, Hidehiro; Tamura, Shohei

1982-01-01

The determination of yttrium, samarium, and dysprodium by means of graphite-furnace atomic absorption spectrometry (AAS) was studied by a tantalum boat inserted into a graphite tube atomizer. These elements could not be determined by the use of a commercial graphite tube, In the atomization from a tantalum boat, better analytical sensitivities and negligible memory effects for these rare earths are obtained. The analytical sensitivities of yttrium, samarium, and dysprodium with the tantalum boat were 0.60 ng, 0.86 ng, and 0.17 ng respectively. This method was applied for the determination of yttrium, samarium, and dysprosium in a mish metal. The measurements were performed with slightly acidified solutions (0.01 mol dm 3 HCI or HNO 3 ). The sensitivities and the precisions for these elements decreased with increasing acid concentration. An enhancement in the sensitivities of yttrium and dysprosium upon the addition of a large excess of lanthanum, neodymium, and praseodymium salts were observed. The yttrium, samarium, and dysprosium in a mish metal were determined with both analytical curves of standard solutions containing an excess of lanthanum, cerium, and neodymium ions and of the standard addition. The precisions for this work were in the 3 - 9.3% range. (author)

Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

Science.gov (United States)

Liu, Peng; Wang, Yunjiao; Wang, Xue; Yang, Chao; Yi, Yanfeng

2012-11-01

Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm2O3 nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm2O3) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm2O3 composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm2O3 composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm2O3 composite at a current density of 20 mA cm-2 in a 1.0 M NaNO3 electrolyte solution, a maximum discharge capacity of 771 F g-1 was achieved in a half-cell setup configuration for the PPy/Sm2O3 composites electrode with the potential application to electrode materials for electrochemical capacitors.

Peculiarities of electronic, phonon and magnon subsystems of lanthanum and samarium tetraborides

Energy Technology Data Exchange (ETDEWEB)

Novikov, V.V., E-mail: vvnovikov@mail.ru; Mitroshenkov, N.V.; Matovnikov, A.V.

2015-10-15

Experimental research was carried out to study the temperature dependences of heat capacity C{sub p}(T = 2–300 K), lattice parameters a(T), and ≿(T), (5–300 K) of lanthanum and samarium tetraborides. A comparison with data obtained previously for LuB{sub 4} reveals the peculiar influence of lanthanide contraction and the rare-earths mass on the thermodynamic properties of rare earth tetraborides at low and high temperatures. Sharp anomalies were found in the heat capacity and thermal expansion for SmB{sub 4} at T{sub N} = 25.1 K, conditioned by the phase transition into antiferromagnetic state. The more poorly defined heat capacity anomaly around 7 K is referred to the quadrupole orbital fluctuation of the atomic magnetic moments for Sm{sup 3+} ions. The electronic, lattice, and magnetic contributions to the heat capacity and thermal expansion of samarium tetraboride were defined. Our approach makes it possible to adequately approximate the lattice components of heat capacity and thermal expansion by combining the Debye and Einstein contributions, which are based on the joint analysis of calorimetric and X-ray data. The influence of the frustration of the atomic magnetic moment system for Sm{sup 3+} ions on the thermodynamic characteristics of the samarium tetraboride magnetic phase transition was revealed. - Highlights: • The heat capacity and lattice parameters for LaB{sub 4} and SmB{sub 4} were determined at 2–300 K. • The anomalies of C{sub p}(T), a(T), c(T) for SmB{sub 4} due to the phase transition are revealed. • The lattice contributions to the thermal properties of LaB{sub 4} and SmB{sub 4} are analyzed.

Ekstraksi Pemisahan Neodimium dari Samarium, Itrium dan Praseodimium Memakai Tri Butil Fosfat

Directory of Open Access Journals (Sweden)

Maria Veronica Purwani

2017-05-01

Full Text Available The extraction of Nd(OH3 (neodymium hydroxide concentrate containing Y (yttrium, Sm (samarium and Pr (praseodymium as product of monazite processed has been done. The purpose of this study is to determine the separation of Nd from Y, Pr and Nd Sm in Nd concentrate. The aqueous phase was concentrated Nd (OH3 in HNO3 and extractant while organic phase was Tri Butyl Phosphate (TBP in kerosene. Parameters studied were pH and concentration feed, concentration of TBP in kerosene, extraction time and stirring speed. The result showed that the optimization of separation extraction neodymium from samarium, yttrium and praseodymium in Nd(OH3 concentrated with TBP, obtained the optimum condition of pH = 0.2, concentration of feed 100 g /L, concentration of TBP in kerosene 5%, extraction time 15 minutes and stirring speed 150 rpm. With the conditions, Separation Factor (SF obtained for Nd-Y, Nd-Pr, Nd-Sm are 2.242, 4.811, 4.002 respectively, while D and extraction efficiency of Nd are 0.236 and 19.07%.

Australian manufacture of QuadrametTM (Samarium-153 EDTMP)

International Nuclear Information System (INIS)

Wood, N.R.; Whitwell, J.

1997-01-01

Quadramet T (Samarium-153 EDTMP) has been shown overseas to be potentially useful in the palliation of painful osteoblastic skeletal metastases and has been approved this year for general marketing in the USA. Australian Radioisotopes (ARI) has licensed this product from the Australian patent holders, Dow Chemical. Within the facilities of ARI, a hot cell has been dedicated to this product and fitted out to manufacture it weekly on a cycle related to the operating cycle of the Australian reactor HIFAR. Due to neutron flux limitations of HIFAR, the local formulation has an elemental Samarium content up to 200μg/mL whereas the overseas formulation has a level of 20-46μg/mL. All other specifications of the two products are essentially the same. In 1995 and 1996 a small clinical trial with 19 patients was held which demonstrated that the pharmacokinetic behaviour was also essentially the same by measuring blood clearance rates and skeletal uptake dynamics. Soft tissue uptake was also qualitatively determined. The ARI version is now the subject of an application for general marketing within Australia. Some useful characteristics of this agent are: almost complete excretion or fixation in the skeleton within 6 hours, rapid onset of clinical effect, applicability in most cases where an abnormal diagnostic bone scan correlates with painful sites, dosage can be tailored to individual patient uptake due to easy dose measurement and retreatment is quite possible. The use of this class of agents in pain palliation continues to increase. Australian manufacture of Quadramet TM provides a further option in the management of these difficult cases

Dicty_cDB: VHE138 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

Polypyrrole-coated samarium oxide nanobelts: fabrication, characterization, and application in supercapacitors

Energy Technology Data Exchange (ETDEWEB)

Liu Peng, E-mail: pliu@lzu.edu.cn; Wang Yunjiao; Wang Xue; Yang Chao; Yi Yanfeng [College of Chemistry and Chemical Engineering, Lanzhou University, Key Laboratory of Nonferrous Metal Chemistry and Resources Utilization of Gansu Province and State Key Laboratory of Applied Organic Chemistry (China)

2012-11-15

Polypyrrole-coated samarium oxide nanobelts were synthesized by the in situ chemical oxidative surface polymerization technique based on the self-assembly of pyrrole on the surface of the amine-functionalized Sm{sub 2}O{sub 3} nanobelts. The morphologies of the polypyrrole/samarium oxide (PPy/Sm{sub 2}O{sub 3}) nanocomposites were characterized using transmission electron microscope. The UV-vis absorbance of these samples was also investigated, and the remarkable enhancement was clearly observed. The electrochemical behaviors of the PPy/Sm{sub 2}O{sub 3} composites were investigated by cyclic voltammetry, electrochemical impedance spectroscopy, and galvanostatic charge-discharge. The results indicated that the PPy/Sm{sub 2}O{sub 3} composite electrode was fully reversible and achieved a very fast Faradaic reaction. After being corrected into the weight percentage of the PPy/Sm{sub 2}O{sub 3} composite at a current density of 20 mA cm{sup -2} in a 1.0 M NaNO{sub 3} electrolyte solution, a maximum discharge capacity of 771 F g{sup -1} was achieved in a half-cell setup configuration for the PPy/Sm{sub 2}O{sub 3} composites electrode with the potential application to electrode materials for electrochemical capacitors.

Production of SmCo5 alloy by calciothermic reduction of samarium oxide

International Nuclear Information System (INIS)

Krishnan, T.S.; Gupta, C.K.

1988-01-01

Among the established permanent magnets, SmCo 5 magnet occupies the foremost position as it offers a unique combination of high energy product, coercivity and curie temperature. The SmCo 5 magnets are thus extensively used for high field applications. These are also best suited for use in environments where high demagnetizing field and high temperature are operative. Also, for applications where high performance and miniaturization are the over-riding considerations, the choice again falls on SmCo 5 magnets. The main deterrent to the widespread use of SmCo 5 magnet is its high cost. Both samarium and cobalt metals are high priced, and the magnets prepared from their directly melted alloy are thus naturally very expensive. An alternate process involving calcium reduction of their oxide intermediates has, therefore, been studied and the alloy prepared by this process has been evaluated and found satisfactory for magnet production. The process essentially involves compaction of the charge mix containing samarium oxide, cobalt oxide (or metal) and calcium metal and reduction of the charge compact at 1000-1300 degrees C in hydrogen atmosphere, followed by water and acid leaching, drying and classification

Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

CSIR Research Space (South Africa)

Mandiwana, V

2015-09-01

Full Text Available the biodistribution of poly(D,L-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([(sup153)Sm]Sm(sub2)O(sub3)) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear...

Synthesis of Samarium Cobalt Nanoblades

Energy Technology Data Exchange (ETDEWEB)

Darren M. Steele

2010-08-25

As new portable particle acceleration technologies become feasible the need for small high performance permanent magnets becomes critical. With particle accelerating cavities of a few microns, the photonic crystal fiber (PCF) candidate demands magnets of comparable size. To address this need, samarium cobalt (SmCo) nanoblades were attempted to be synthesized using the polyol process. Since it is preferable to have blades of 1-2 {micro}m in length, key parameters affecting size and morphology including method of stirring, reaction temperature, reaction time and addition of hydroxide were examined. Nanoparticles consisting of 70-200 nm spherical clusters with a 3-5 nm polyvinylpyrrolidone (PVP) coating were synthesized at 285 C and found to be ferromagnetic. Nanoblades of 25nm in length were observed at the surface of the nanoclusters and appeared to suggest agglomeration was occurring even with PVP employed. Morphology and size were characterized using a transmission electron microscope (TEM). Powder X-Ray Diffraction (XRD) analysis was conducted to determine composition but no supportive evidence for any particular SmCo phase has yet been observed.

Neutron Capture and Transmission Measurements and Resonance Parameter Analysis of Samarium

International Nuclear Information System (INIS)

Leinweber, G.; Burke, J.A.; Knox, H.D.; Drindak, N.J.; Mesh, D.W.; Haines, W.T.; Ballad, R.V.; Block, R.C.; Slovacek, R.E.; Werner, C.J.; Trbovich, M.J.; Barry, D.P.; Sato, T.

2001-01-01

The purpose of the present work is to accurately measure the neutron cross sections of samarium. The most significant isotope is 149 Sm, which has a large neutron absorption cross section at thermal energies and is a 235 U fission product with a 1% yield. Its cross sections are thus of concern to reactor neutronics. Neutron capture and transmission measurements were performed by the time-of-flight technique at the Rensselaer Polytechnic institute (RPI) LINAC facility using metallic and liquid Sm samples. The capture measurements were made at the 25 meter flight station with a multiplicity-type capture detector, and the transmission total cross-section measurements were performed at 15- and 25-meter flight stations with 6 Li glass scintillation detectors. Resonance parameters were determined by a combined analysis of six experiments (three capture and three transmission) using the multi-level R-matrix Bayesian code SAMMY version M2. The significant features of this work are as follows. Dilute samples of samarium nitrate in deuterated water (D 2 O) were prepared to measure the strong resonances at 0.1 and 8 eV without saturation. Disk-shaped spectroscopic quartz cells were obtained with parallel inner surfaces to provide a uniform thickness of solution. The diluent feature of the SAMMY program was used to analyze these data. The SAMMY program also includes multiple scattering corrections to capture yield data and resolution functions specific to the RPI facility. Resonance parameters for all stable isotopes of samarium were deduced for all resonances up to 30 eV. Thermal capture cross-section and capture resonance integral calculations were made using the resultant resonance parameters and were compared to results obtained using resonance parameters from ENDF/B-VI updated through release 3. Extending the definition of the capture resonance integral to include the strong 0.1 eV resonance in 149 Sm, present measurements agree within estimated uncertainties with En

Identification of the lines in the L emission spectrum of cerium and samarium

International Nuclear Information System (INIS)

Shrivastava, B.D.; Singh, D.

1992-01-01

The occurrence of a line at 2.1556 A in the L emission spectrum of cerium and two lines at 1.6679 and 1.8379 A in the L emission spectrum of samarium, reported many years ago, has remained a puzzle. These have now been identified as EXAFS minima occurring at the L absorption edges of the respective elements. (author)

7 CFR 800.138 - Conflict of interest.

Science.gov (United States)

2010-01-01

... 7 Agriculture 7 2010-01-01 2010-01-01 false Conflict of interest. 800.138 Section 800.138 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD... Inspection Services § 800.138 Conflict of interest. Official personnel cannot perform or participate in...

Samarium-153-EDTMP in the metastatic bone pain treatment

International Nuclear Information System (INIS)

Lins Filho, M.L.M.; Santos, A.O.; Nappi, A.P.B.; Meirelles, M.B.; Arouca, P.T.; Ramos, C.D.; Etchebehere, E.C.S.C.; Teixeira, L.C.; Netto Junior, N.R.; D'Ancona Cal; Camargo, E.E.

1997-01-01

Full text: Bone metastasis is the most reason of pain in prostate and mammary cancer patients. The Samarium-153-EDTMP has been showed as an alternative to the treatment of the metastasis bone pain. With the objective to evaluate the use of the Sm-153-EDTMP as a systemic therapy for the metastasis bone pain, 30 patients (19 male, 11 female, average age of 64,5 years) were studied. 19 patients with prostate cancer and 11 with mammary cancer. All the patients presented previous bone scintiscanning with multiple metastasis; interruption of the chemotherapy or radiotherapy for two or more weeks and leukocyte count higher than 2,000 leukocytes/mm 3 and platelets higher than 80,000/mm 3 . The patients were classified previously to the radioisotope therapy, as far the intensity of the pain in a scale from 0 to 10 is concerned. All the patients received 37 MBq/kg (1m Ci/kg) of weight of Sm-153-EDTMP by venous via. The evaluation 6 weeks after the therapy showed complete or partial pain relief in 22 patients (73,3%). Complete or partial pain relief has been obtained in 91,0% (10 in 11) of the patients with mammary cancer and in 62,2% (12 in 19) of the patients with prostate cancer. Transitory leukopenia (lower than 2,000 leukocytes/mm 3 ) and platelet count (lower than 80,000/mm 3 ) occurred in 33,3% of the patients. 8 patients (26,7%) did not responded to the therapy. The therapy with Samarium-153-EDTMP is a simple, safe and efficient method in the treatment of the bone pain caused by metastasis

Dependence of samarium-soil interaction on samarium concentration: Implications for environmental risk assessment.

Science.gov (United States)

Ramírez-Guinart, Oriol; Salaberria, Aitor; Vidal, Miquel; Rigol, Anna

2018-03-01

The sorption and desorption behaviour of samarium (Sm), an emerging contaminant, was examined in soil samples at varying Sm concentrations. The obtained sorption and desorption parameters revealed that soil possessed a high Sm retention capacity (sorption was higher than 99% and desorption lower than 2%) at low Sm concentrations, whereas at high Sm concentrations, the sorption-desorption behaviour varied among the soil samples tested. The fractionation of the Sm sorbed in soils, obtained by sequential extractions, allowed to suggest the soil properties (pH and organic matter solubility) and phases (organic matter, carbonates and clay minerals) governing the Sm-soil interaction. The sorption models constructed in the present work along with the sorption behaviour of Sm explained in terms of soil main characteristics will allow properly assessing the Sm-soil interaction depending on the contamination scenario under study. Moreover, the sorption and desorption K d values of radiosamarium in soils were strongly correlated with those of stable Sm at low concentrations (r = 0.98); indicating that the mobility of Sm radioisotopes and, thus, the risk of radioactive Sm contamination can be predicted using data from low concentrations of stable Sm. Copyright © 2017 Elsevier Ltd. All rights reserved.

Thermomechanical behavior of Fe-Mn-Si-Cr-Ni shape memory alloys modified with samarium

International Nuclear Information System (INIS)

Shakoor, R.A.; Khalid, F. Ahmad

2009-01-01

The deformation and training behavior of Fe-14Mn-3Si-10Cr-5Ni (wt.%) shape memory alloys containing samarium addition has been studied in the iron-based shape memory alloys. It is noticed that thermomechanical treatment (training) has significant influence on proof stress, critical stress and shape memory behavior of the alloys. The improvement in shape memory behavior can be attributed to the decrease in the proof stress and critical stress which facilitates the formation of ε (hcp martensite). It is also observed that alloy 2 containing samarium undergoes less softening as compared to alloy 1 with training which inhibits the formation of α (bcc martensite) and thus enhances the shape memory behavior. The excessive thermomechanical treatment with increase in the training cycle has led to the formation of α (bcc martensite) along with ε (hcp martensite) in the alloy 1 which appeared to have decline in the shape memory effect. This has been demonstrated by the examination of microstructure and identification of α (bcc martensite) martensite in the alloy 1 as compared to alloy 2

29 CFR 102.138 - Definition of meeting.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Definition of meeting. 102.138 Section 102.138 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Open Meetings § 102.138 Definition of meeting. For purposes of this subpart, meeting shall mean the deliberations of...

32 CFR 935.138 - Motor bus operation.

Science.gov (United States)

2010-07-01

... 32 National Defense 6 2010-07-01 2010-07-01 false Motor bus operation. 935.138 Section 935.138 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE TERRITORIAL AND INSULAR REGULATIONS WAKE ISLAND CODE Motor Vehicle Code § 935.138 Motor bus operation. Each person operating a motor...

6 CFR 13.8 - Service of Complaint.

Science.gov (United States)

2010-01-01

... 6 Domestic Security 1 2010-01-01 2010-01-01 false Service of Complaint. 13.8 Section 13.8 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.8 Service of Complaint. (a) Service of a Complaint must be Made by certified or registered mail or by...

Effective visible light-active nitrogen and samarium co-doped BiVO4 for the degradation of organic pollutants

International Nuclear Information System (INIS)

Wang, Min; Niu, Chao; Liu, Jun; Wang, Qianwu; Yang, Changxiu; Zheng, Haoyan

2015-01-01

Nitrogen and samarium co-doped BiVO 4 (N–xSm–BiVO 4 ) nanoparticles were synthesized using a sol–gel method with a corn stem template. The physicochemical properties of the resultant N–xSm–BiVO 4 particles were characterized using various methods: XPS, XRD, SEM, BET, and UV–Vis DRS analyses. The visible-light photocatalytic activity was successfully demonstrated by degrading a model dye, namely, methyl orange. The dopant content was optimized, and the nitrogen and samarium co-doped BiVO 4 extended the light absorption spectrum toward the visible region, significantly enhancing the photodegradation of the model dye. The Sm and N co-doped BiVO 4 exhibited the highest photocatalytic activity compared to materials with a single dopant or no dopant. The significantly enhanced photocatalytic activity of the N–Sm co-doped BiVO 4 under visible-light irradiation can be attributed to the synergistic effects of the nitrogen and samarium. - Highlights: • The N–Sm codoped BiVO 4 were synthesized using a sol–gel method with a corn stem template. • The N and Sm codoped BiVO 4 has excellent photocatalytic activity of methyl orange degradation. • The maximum activity was observed when the molar ratio of Sm/Bi was 1.0. • The high photocatalytic activity was caused by the synergistic effects between N doping and Sm doping

Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

International Nuclear Information System (INIS)

Castrillejo, Y.; Fernandez, P.; Medina, J.; Hernandez, P.; Barrado, E.

2011-01-01

This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) ↔ Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al 3 Sm and Al 2 Sm.

Electrochemical extraction of samarium from molten chlorides in pyrochemical processes

Energy Technology Data Exchange (ETDEWEB)

Castrillejo, Y., E-mail: ycastril@qa.uva.es [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Fernandez, P. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Medina, J. [Dept Fisica Materia Condensada Cristalografia y Mineralogia, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain); Hernandez, P. [Centro de Investigaciones Quimicas, Universidad Autonoma del Estado de Hidalgo, Carr. Pachuca-Tulancingo Km. 4.5, C.P. 42076 Pachuca, Hidalgo (Mexico); Barrado, E. [QUIANE/Dept Quimica Analitica, F. de Ciencias, Universidad de Valladolid, Prado de la Magdalena s/n, 47005 Valladolid (Spain)

2011-10-01

This work concerns the electrochemical extraction of samarium from molten chlorides. In this way, the electrochemical behaviour of samarium ions has been investigated in the eutectic LiCl-KCl at the surface of tungsten, aluminium and aluminium coated tungsten electrodes. On a W inert electrode the electro-reduction of Sm(III) takes place in only one soluble-soluble electrochemical step Sm(III)/Sm(II). The electrochemical system Sm(II)/Sm(0) has not been observed within the electrochemical window, because of the prior reduction of Li(I) ions from the solvent, which inhibits the electro-extraction of Sm species from the salt on such a substrate. Sm metal in contact with the melt react to give Li(0) according to the reaction: Sm(0) + 2Li(I) {r_reversible} Sm(II) + 2Li(0). On the contrary, on reactive Al electrodes the electrochemical system Sm(II)/Sm(0) was observed within the electroactive range. The potential shift of the redox couple is caused by the decrease of Sm activity in the metal phase due to the formation of Sm-Al alloys at the interface. The formation mechanism of the intermetallic compounds was studied in a melt containing: (i) both Sm(III) and Al(III) ions, using W and Al coated tungsten electrodes, and (ii) Sm(III) ions using an Al electrode. Analysis of the samples after potentiostatic electrolysis by X-ray diffraction and scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), allowed the identification of Al{sub 3}Sm and Al{sub 2}Sm.

Resonances of coherent population trapping in samarium vapours

International Nuclear Information System (INIS)

Kolachevsky, Nikolai N; Akimov, A V; Kiselev, N A; Papchenko, A A; Sorokin, Vadim N; Kanorskii, S I

2001-01-01

Resonances of coherent population trapping were detected in atomic vapours of the rare-earth element samarium. The coherent population trapping was produced by two external-cavity diode lasers (672 and 686 nm) in a Λ-system formed by the three levels of 154 Sm: the 4f 6 6s 2 ( 7 F 0 ) ground state, the first fine-structure 4f 6 6s 2 ( 7 F 1 ) sublevel of the ground state and the 4f 6 ( 7 F)6s6p( 3 P o ) 9 F o 1 upper level. The dependence of the spectral shapes and resonance contrasts on the polarisation of the laser beams and the direction of the applied magnetic field was studied. The obtained results were analysed. (nonlinear optical phenomena)

The systems lanthanum (cerium, samarium) nitrate-tetramethyl-ammonium nitrate-water

International Nuclear Information System (INIS)

Zhuravlev, E.F.; Khisaeva, D.A.; Semenova, Eh.B.

1984-01-01

The method of cross sections at 25 and 50 deg C has been applied to study solubility in the systems lanthanum nitrate-tetramethyl ammonium nitrate-water (1), cesium (3) nitrate-tetramethyl ammonium nitrate-water (2) and samarium nitrate-tetramethyl ammonium nitrate-water (3). Crystallization fields of congruently dissolving compounds with 1:3 ratio of salt components (in system 1) and 1:2 ratio (in systems 2 and 3) are found in the systems. New solid phases are separated preparatively and subjected to chemical, differential thermal and IR spectroscopic analyses. Compositions of formed compounds are compared with the compositions known for nitrates of other representatives of light lanthanides

Statistical nuclear properties and synthesis of 138La

Directory of Open Access Journals (Sweden)

Kheswa B. V.

2015-01-01

Full Text Available The synthesis of the neutron deficient 138La nucleus has been a puzzle for a long time. It has not been clear whether it is produced through photodisintegration processes or neutrino induced reactions due to unavailability of experimental data for nuclear level densities and γ strength functions of 138,139La nuclei. In the present work these nuclear properties have been measured and are used to investigate the synthesis of 138La. The results support the neutrino interactions as a dominant production process for 138La.

The systems cerium(3) (samarium) nitrate-quinoline nitrate-water

International Nuclear Information System (INIS)

Khisaeva, D.A.; Zhuravlev, E.F.; Semenova, Eh.B.

1982-01-01

Using the method of cross sections at 25 and 50 deg C the solubility in the systems cerium (3) nitrate-quinoline nitrate-water and samarium nitrate-quinoline nitrate-water has been studied. It is established that in the systems during chemical interaction of components congruently melting compounds of the composition: Ce(NO 3 ) 2 x2[C 9 H 7 NxHNO 3 ]x6H 2 O and Sm(NO 3 ) 3 x2[C 9 H 7 NxHNO 3 ]x2H 2 O are formed. New solid phases are separated preparatively and are subjected to chemical, differential thermal and IR spectroscopic analyses. The investigation results are compared with similar ones for nitrates of other representatives of lanthanide group

Body composition analysis by DEXA by using dynamically changing samarium filtration

DEFF Research Database (Denmark)

Gotfredsen, Arne; Baeksgaard, L; Hilsted, J

1997-01-01

Dual-energy X-ray absorptiometry (DEXA) has a high accuracy for body composition analysis but is influenced by beam hardening and other error sources in the extremes of measurement. To compensate for beam hardening, the Norland XR-36 introduces a dynamically changing samarium filtration system......). Scans of six healthy volunteers covered with combinations of beef and lard (approximately 5-15 kg) showed a good agreement (r = 0.99) between reference and DEXA values of added soft tissue mass and fat percentage. We conclude that the DEXA method (and, in particular, the Norland XR-36 using dynamic...

Effective visible light-active nitrogen and samarium co-doped BiVO{sub 4} for the degradation of organic pollutants

Energy Technology Data Exchange (ETDEWEB)

Wang, Min; Niu, Chao [College of Environmental and Chemical Engineering, Shenyang Ligong University, Shenyang 110165 (China); Liu, Jun, E-mail: minwang62@msn.com [Shenyang Military General Hospital, Shenyang 110016 (China); Wang, Qianwu; Yang, Changxiu; Zheng, Haoyan [College of Environmental and Chemical Engineering, Shenyang Ligong University, Shenyang 110165 (China)

2015-11-05

Nitrogen and samarium co-doped BiVO{sub 4} (N–xSm–BiVO{sub 4}) nanoparticles were synthesized using a sol–gel method with a corn stem template. The physicochemical properties of the resultant N–xSm–BiVO{sub 4} particles were characterized using various methods: XPS, XRD, SEM, BET, and UV–Vis DRS analyses. The visible-light photocatalytic activity was successfully demonstrated by degrading a model dye, namely, methyl orange. The dopant content was optimized, and the nitrogen and samarium co-doped BiVO{sub 4} extended the light absorption spectrum toward the visible region, significantly enhancing the photodegradation of the model dye. The Sm and N co-doped BiVO{sub 4} exhibited the highest photocatalytic activity compared to materials with a single dopant or no dopant. The significantly enhanced photocatalytic activity of the N–Sm co-doped BiVO{sub 4} under visible-light irradiation can be attributed to the synergistic effects of the nitrogen and samarium. - Highlights: • The N–Sm codoped BiVO{sub 4} were synthesized using a sol–gel method with a corn stem template. • The N and Sm codoped BiVO{sub 4} has excellent photocatalytic activity of methyl orange degradation. • The maximum activity was observed when the molar ratio of Sm/Bi was 1.0. • The high photocatalytic activity was caused by the synergistic effects between N doping and Sm doping.

Ferrites Ni0,5Zn0,5Fe2O4 doped with samarium: structural analysis, morphological and electromagnetic

International Nuclear Information System (INIS)

Costa, A.C.F.M.; Diniz, A.P.; Viana, K.M.S.; Cornejo, D.R.; Kiminami, R.H.G.A.

2010-01-01

This paper proposes to investigate the sintering at 1200 deg C/2h of Ni 0.5 Zn 0.5 Fe 2-x Sm x O 4 ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

33 CFR 138.150 - Service of process.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Service of process. 138.150... Pollution (Vessels) § 138.150 Service of process. (a) When executing the forms required by this subpart... as its agent for service of process for purposes of this subpart and for receipt of notices of...

Determination of micro amounts of samarium and europium by analogue derivative spectrophotometry

International Nuclear Information System (INIS)

Ishii, H.; Satoh, K.

1982-01-01

Derivative spectrophotometry using the analogue differentiation circuit was applied to the determination of samarium and europium at ppm levels. By measuring the second or the fourth derivative spectra of the characteristic absorption bands of both the rare earth ions around 400 nm, they can be determined directly and selectively in the presence of large amounts of most other rare earths without any prior separation. Further, aptly selecting conditions for the measurement of the derivative spectra, the simultaneous determination of both the rare earth elements was feasible. The principle and the characteristics of analogue derivative spectrophotometry are also described. (orig.) [de

Particle-hole states in 138Ba

International Nuclear Information System (INIS)

Bondarenko, V.A.; Khitrov, V.A.; Popov, Yu.P.; Brant, S.; Paar, V.; Simicic, L.

1995-01-01

The thermal-neutron-capture gamma rays and γγ-coincidences were measured by means of Ge detectors. Using primary and secondary (n, γ) data, the level scheme of 138 Ba was established with 63 levels up to an excitation energy of 5 MeV. The level energies and (d, p) transfer data were compared with model predictions of the interacting boson-fermion-fermion model. As shown, this model provides a basic understanding of the neutron particle-hole states of 138 Ba in the energy range of 3.5-5.0 MeV. ((orig.))

New reduced variant in gadolinium and samarium monoxide thin films

Energy Technology Data Exchange (ETDEWEB)

Bist, B M.S.; Kumar, J; Srivastava, O N [Banaras Hindu Univ. (India). Dept. of Physics

1977-01-01

A new reduced phase has been observed in the thin films of gadolinium and samarium monoxides. This phase results on imparting an annealing treatment to the monoxides and is formed as a result of the creation and ordering of vacancies in the oxygen sublattice. The new phase has been analysed to possess a rhombohedral unit cell with lattice parameters a/sub R/ = a/sub 0/ square root of (3/2) and c/sub R/ = a/sub 0/ square root of 3 (based on hexagonal axes, a/sub 0/ being the lattice parameter of the fundamental zinc blende type unit cell of the monoxide). Based on the proposed structure, the new phase can be assigned the solid state chemical formula RO/sub x/ where R = Gd, Sm and x = 0.66.

Enhanced electron-lattice coupling under uniaxial stress in layered double hydroxides intercalated with samarium complexes

International Nuclear Information System (INIS)

Park, Ta-Ryeong

2004-01-01

We have applied uniaxial stress to samarium complexes by intercalating them into the gallery of a layered material and by using a diamond-anvil cell at 28 K. Although uniaxial stress reduces symmetry and removes degeneracy, the overall number of photoluminescence (PL) peaks evidently decreased with the application of uniaxial stress. This contradictory observation is explained by an increased electron-lattice coupling strength under uniaxial stress. This behavior is also confirmed by time-resolved PL data.

22 CFR 138.300 - Professional and technical services.

Science.gov (United States)

2010-04-01

... and analysis directly applying any professional or technical discipline. For example, drafting or a... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professional and technical services. 138.300... Activities by Other Than Own Employees § 138.300 Professional and technical services. (a) The prohibition on...

Phase Composition of Samarium Niobate and Tantalate Thin Films Prepared by Sol-Gel Method

Science.gov (United States)

Bruncková, H.; Medvecký, Ľ.; Múdra, E.; Kovalčiková, A.; Ďurišin, J.; Šebek, M.; Girman, V.

2017-12-01

Samarium niobate SmNbO4 (SNO) and tantalate SmTaO4 (STO) thin films ( 100 nm) were prepared by sol-gel/spin-coating process on alumina substrates with PZT interlayer and annealing at 1000°C. The precursors of films were synthesized using Nb or Ta tartrate complexes. The improvement of the crystallinity of monoclinic M'-SmTaO4 phase via heating was observed through the coexistence of small amounts of tetragonal T-SmTa7O19 phase in STO precursor at 1000°C. The XRD results of SNO and STO films confirmed monoclinic M-SmNbO4 and M'-SmTaO4 phases, respectively, with traces of orthorhombic O-SmNbO4 (in SNO). In STO film, the single monoclinic M'-SmTaO4 phase was revealed. The surface morphology and topography of thin films were investigated by SEM and AFM analysis. STO film was smoother with roughness 3.2 nm in comparison with SNO (6.3 nm). In the microstructure of SNO film, small spherical ( 50 nm) and larger cuboidal particles ( 100 nm) of the SmNbO4 phase were observed. In STO, compact clusters composed of fine spherical SmTaO4 particles ( 20-50 nm) were found. Effect of samarium can contribute to the formation different polymorphs of these films for the application to environmental electrolytic thin film devices.

Evaluation of samarium-153 and holmium-166-EDTMP in the normal baboon model

Energy Technology Data Exchange (ETDEWEB)

Louw, W.K.A.; Dormehl, I.C.; Rensburg, A.J. van; Hugo, N.; Alberts, A.S.; Forsyth, O.E.; Beverley, G.; Sweetlove, M.A.; Marais, J.; Loetter, M.G.; Aswegen, A. van

1996-11-01

Bone-seeking radiopharmaceuticals such as ethylenediaminetetramethylene phosphonate (EDTMP) complexes of samarium-153 and holmium-166 are receiving considerable attention for therapeutic treatment of bone metastases. In this study, using the baboon experimental model, multicompartmental analysis revealed that with regard to pharmacokinetics, biodistribution, and skeletal localisation, {sup 166}Ho-EDTMP was significantly inferior to {sup 153}Sm-EDTMP and {sup 99m}Tc-MDP. A more suitable {sup 166}Ho-bone-seeking agent should thus be sought for closer similarity to {sup 153}Sm-EDTMP to exploit fully the therapeutic potential of its shorter half-life and more energetic beta radiation.

Performance analysis of samarium cobalt P.M. synchronous motor fed from PWM inverters

International Nuclear Information System (INIS)

Rahman, M.A.; Choudhury, M.A.

1985-01-01

This paper presents an analysis and performance of samarium cobalt permanent magnet (P.M.) synchronous motors fed from two types of voltage source pulse width modulated (PWM) inverters. The analysis and test results on the steady state performance of a P.M. motor fed from PWM inverters are presented. PWM inverters are used in variable voltage variable frequency applications to avoid a double conversion process of ordinary inverters. In drives, they are used for voltage and speed regulation of motors. Use of modulation technique in inverters also allow to eliminate or minimize selected harmonics from the inverter output voltage

JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

International Nuclear Information System (INIS)

Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu

2010-01-01

Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

22 CFR 138.205 - Professional and technical services.

Science.gov (United States)

2010-04-01

..., drafting of a legal document accompanying a bid or proposal by a lawyer is allowable. Similarly, technical... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professional and technical services. 138.205... Activities by Own Employees § 138.205 Professional and technical services. (a) The prohibition on the use of...

Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues

International Nuclear Information System (INIS)

Garcia G, N.

2006-01-01

Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH PCN ) and density of surface sites (D s ). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

Optical properties and electronic transitions of zinc oxide, ferric oxide, cerium oxide, and samarium oxide in the ultraviolet and extreme ultraviolet

DEFF Research Database (Denmark)

Pauly, N; Yubero, F; Espinós, J P

2017-01-01

Optical properties and electronic transitions of four oxides, namely zinc oxide, ferric oxide, cerium oxide, and samarium oxide, are determined in the ultraviolet and extreme ultraviolet by reflection electron energy loss spectroscopy using primary electron energies in the range 0.3-2.0 ke...

Magnetic behavior study of samarium nitride using density functional theory

Science.gov (United States)

Som, Narayan N.; Mankad, Venu H.; Dabhi, Shweta D.; Patel, Anjali; Jha, Prafulla K.

2018-02-01

In this work, the state-of-art density functional theory is employed to study the structural, electronic and magnetic properties of samarium nitride (SmN). We have performed calculation for both ferromagnetic and antiferromagnetic states in rock-salt phase. The calculated results of optimized lattice parameter and magnetic moment agree well with the available experimental and theoretical values. From energy band diagram and electronic density of states, we observe a half-metallic behaviour in FM phase of rock salt SmN in while metallicity in AFM I and AFM III phases. We present and discuss our current understanding of the possible half-metallicity together with the magnetic ordering in SmN. The calculated phonon dispersion curves shows dynamical stability of the considered structures. The phonon density of states and Eliashberg functional have also been analysed to understand the superconductivity in SmN.

Myelotoxicity of Samarium Sm153 lexidronam in patients with painful bony metastases

International Nuclear Information System (INIS)

Ben Ghachem, T.; Mhiri, A.; Slim, I.; Bahloul, A.; Yeddes, I.; Elbez, I.; Meddeb, I.; Ben Slimene, M.F.

2015-01-01

Full text of publication follows. Introduction: the management of bone pain includes analgesia, radiation, hormones, radiofrequency (RF) ablation, chemotherapy, and surgery. Bone pain palliation therapy with radiopharmaceuticals is a cost-effective systemic therapy to relieve pain from skeletal metastases with a consequent decrease in morbidity and an improvement in quality of life. The aim of our study is to evaluate the effect of myelotoxicity of samarium lexidronam (Sm 153 ) in patients with painful bony metastasis. Methods: we reviewed 116 patients aged from 14 to 87 years old, 91 males (78%) and 25 females (22%), having received 1 to 4 treatments of Sm 153 (37 MBq/kg) for painful bony metastases from different primitive tumors: 67 cases of prostate cancer (57.7%), 22 cases of breast cancer (18.9%), 10 cases of pulmonary cancer (8.6%) and others in 14.6% of cases. Clinical follow-up was available for 159 treatments, consisting on blood count each week over at least two months, in order to evaluate myelotoxicity according to WHO classification. Results: no patients had grade 4 toxicity after its cures. A grade 2-3 myelotoxicity was observed after 52 treatments (34%) during the second week and after 50 treatments (32.6%) during the fourth week with a satisfactory reversibility. At 10 weeks of treatment, myelotoxicity was reclassified from 0 to 2 for 139 cures (90,8%). Moreover, we found that prior treatment with radiotherapy or chemotherapy did not affect the rates of myelotoxicity. Conclusion: multiple treatments with samarium Sm 153 lexidronam had no significant effect on myelotoxicity. Patients with bone predominant metastatic disease may survive for extended periods of time and may safely be treated with multiple modalities of therapy. (authors)

Preparation and biological behaviour of samarium-153-hydroxyapatite particles for radiation synovectomy

International Nuclear Information System (INIS)

Agrueelles, M.G.; Luppi Berlanga, I.S.; Torres, E.A.; Rutty Sola, G.A.; Rimoldi, G.

1998-01-01

The preparation and labelling procedures of 153 Sm-hydroxyapatite ( 153 Sm-HA) are described in this paper. Hydroxyapatite (HA) was prepared and studied as a radiosynovectomy agent. HA particles were prepared from the reaction of calcium nitrate and ammonia phosphate at high pH Samarium-153 labelling was done in two steps with citric acid. A serie of experimental conditions, such as specific activity, citric acid mass, radioactive solution volume, in-vitro stability, have been carried out. Radiolabelling efficiency was greater than 95%. In vitro studies showed high stability (≥99%). Animal studies showed a good retention in the synovium, with a very low extra-articular leakage over 6 days after administration. (author)

Silencing of microRNA-138-5p promotes IL-1β-induced cartilage degradation in human chondrocytes by targeting FOXC1: miR-138 promotes cartilage degradation.

Science.gov (United States)

Yuan, Y; Zhang, G Q; Chai, W; Ni, M; Xu, C; Chen, J Y

2016-10-01

Osteoarthritis (OA) is characterised by articular cartilage degradation. MicroRNAs (miRNAs) have been identified in the development of OA. The purpose of our study was to explore the functional role and underlying mechanism of miR-138-5p in interleukin-1 beta (IL-1β)-induced extracellular matrix (ECM) degradation of OA cartilage. Human articular cartilage was obtained from patients with and without OA, and chondrocytes were isolated and stimulated by IL-1β. The expression levels of miR-138-5p in cartilage and chondrocytes were both determined. After transfection with miR-138-5p mimics, allele-specific oligonucleotide (ASO)-miR-138-5p, or their negative controls, the messenger RNA (mRNA) levels of aggrecan (ACAN), collagen type II and alpha 1 (COL2A1), the protein levels of glycosaminoglycans (GAGs), and both the mRNA and protein levels of matrix metalloproteinase (MMP)-13 were evaluated. Luciferase reporter assay, quantitative real-time polymerase chain reaction (qRT-PCR), and Western blot were performed to explore whether Forkhead Box C1 (FOCX1) was a target of miR-138-5p. Further, we co-transfected OA chondrocytes with miR-138-5p mimics and pcDNA3.1 (+)-FOXC1 and then stimulated with IL-1β to determine whether miR-138-5p-mediated IL-1β-induced cartilage matrix degradation resulted from targeting FOXC1. MiR-138-5p was significantly increased in OA cartilage and in chondrocytes in response to IL-1β-stimulation. Overexpression of miR-138-5p significantly increased the IL-1β-induced downregulation of COL2A1, ACAN, and GAGs, and increased the IL-1β-induced over expression of MMP-13.We found that FOXC1 is directly regulated by miR-138-5p. Additionally, co-transfection with miR-138-5p mimics and pcDNA3.1 (+)-FOXC1 resulted in higher levels of COL2A1, ACAN, and GAGs, but lower levels of MMP-13. miR-138-5p promotes IL-1β-induced cartilage degradation in human chondrocytes, possibly by targeting FOXC1.Cite this article: Y. Yuan, G. Q. Zhang, W. Chai,M. Ni, C. Xu, J

33 CFR 138.20 - Definitions.

Science.gov (United States)

2010-07-01

... financial responsibility referred to in § 138.10(a): claim, claimant, damages, discharge, exclusive economic... POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION FINANCIAL RESPONSIBILITY FOR WATER POLLUTION (VESSELS) AND OPA 90 LIMITS OF LIABILITY (VESSELS AND DEEPWATER PORTS) Financial Responsibility for Water...

7 CFR 400.138 - Procedures for salary offset; methods of collection.

Science.gov (United States)

2010-01-01

... 7 Agriculture 6 2010-01-01 2010-01-01 false Procedures for salary offset; methods of collection. 400.138 Section 400.138 Agriculture Regulations of the Department of Agriculture (Continued) FEDERAL... Management-Regulations for the 1986 and Succeeding Crop Years § 400.138 Procedures for salary offset; methods...

Fabrication of a PVC membrane samarium(III) sensor based on N,N′,N″-tris(4-pyridyl)trimesic amide as a selectophore

International Nuclear Information System (INIS)

Zamani, Hassan Ali; Naghavi-Reyabbi, Fatemeh; Faridbod, Farnoush; Mohammadhosseini, Majid; Ganjali, Mohammad Reza; Tadjarodi, Azadeh; Rad, Maryam

2013-01-01

A new ion-selective electrode for Sm 3+ ion is described based on the incorporation of N,N′,N″-tris(4-pyridyl)trimesic amide (TPTA) in a poly(vinylchloride) (PVC) matrix. The membrane sensor comprises nitrobenzene (NB) as a plasticizer, and oleic acid (OA) as an anionic additive. The sensor with the optimized composition shows a Nernstian potential response of 19.8 ± 0.5 mV decade −1 over a wide concentration range of 1.0 × 10 −2 and 1 × 10 −6 mol L −1 , with a lower detection limit of 4.7 × 10 −7 mol L −1 and satisfactor applicable pH range of 3.6–9.2. Having a short response time of less than 10 s and a very good selectivity towards the Sm 3+ over a wide variety of interfering cations (e.g. alkali, alkaline earth, transition and heavy metal ions) the sensor seemed to be a promising analytical tool for determination of the Sm 3+ . Hence, it was used as an indicator electrode in the potentiometric titration of samarium ion with EDTA. It was also applied to the direct samarium recovery in binary mixtures. - Highlights: ► A new Sm 3+ -PVC membrane sensor is introduced for determination of Sm 3+ ions in the solutions. ► N,N′,N″-tris(4-pyridyl)trimesic amide was used as a suitable selectophore for samarium sensor. ► Detection limit of the sensor is 4.7 × 10 −7 mol L −1 with a short response time of less than 10 s.

Optical and physical properties of samarium doped lithium diborate glasses

Science.gov (United States)

Hanumantharaju, N.; Sardarpasha, K. R.; Gowda, V. C. Veeranna

2018-05-01

Sm3+ doped lithium di-borate glasses with composition 30Li2O-60B2O3-(10-x) PbO, (where 0 molar volume with samarium ion content indicates the openness of the glass structure. The gradual increase in average separation of boron-boron atoms with VmB clearly indicates deterioration of borate glass network, which in turn leads to decrease in the oxygen packing density. The replacements of Sm2O3 for PbO depolymerise the chain structure and that would increase the concentration of non-bridging oxygens. The marginal increase of optical band gap energy after 1.0 mol.% of Sm2O3 is explained by considering the structural modification in lead-borate. The influence of Sm3+ ion on physical and optical properties in lithium-lead-borate glasses is investigated and the results were discussed in view of the structure of borate glass network.

7 CFR 1956.138 - Processing.

Science.gov (United States)

2010-01-01

... Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) DEBT SETTLEMENT Debt Settlement-Community and Business Programs § 1956.138 Processing... this subpart. (d) Appeal rights. In accordance with Subpart B of Part 1900 of this chapter, the debtor...

Preparation and examination of properties of samarium-153-EDTMP complex; Otrzymywanie chelatu kwasu etylenodiaminotetrametylenofosfonowego (EDTMP) z samarem-153 i badanie jego wlasciwosci

Energy Technology Data Exchange (ETDEWEB)

Nowak, M. [Institute of Atomic Energy, Otwock-Swierk (Poland); Garnuszek, P.; Lukasiewicz, A.; Wozniak, I.; Zulczyk, W. [Osrodek Badawczo-Rozwojowy Izotopow, Otwock-Swierk (Poland); Licinska, I. [Instytut Lekow, Warsaw (Poland)

1995-12-31

Preparation and properties of ethylenediaminetetramethylenephosphonic acid (EDTMP) as well as some properties of {sup 153}Sm-EDTMP chelate have been examined. The chelate formed by samarium-153 (46.3 h, {beta}{sup -}-decay) with EDTMP exhibits high bone uptake and can be used for treatment of disseminated, painful skeletal metastases. The purity and stability of solutions of {sup 153}Sm-EDTMP chelate were examined in a broad range of samarium concentration and {sup 153}Sm specific activity. The complex under study was examined by radio-TLC, -electrophoresis and radio-HPLC. The results obtained suggest the small size of molecules of {sup 153}Sm-EDTMP chelate as compared with molecules of ``free``EDTMP. The results of biodistribution of {sup 153}Sm-EDTMP determined in rats indicate the quick blood clearance, high deposition of radioactivity in bone and quick excretion of radioactivity into urine. No specific uptake of {sup 153}Sm-EDTMP in extra-skeletal organs was found. (author). 42 refs, 13 figs, 22 tabs.

Absolute densities in exoplanetary systems. Photodynamical modelling of Kepler-138.

Science.gov (United States)

Almenara, J. M.; Díaz, R. F.; Dorn, C.; Bonfils, X.; Udry, S.

2018-04-01

In favourable conditions, the density of transiting planets in multiple systems can be determined from photometry data alone. Dynamical information can be extracted from light curves, providing modelling is done self-consistently, i.e. using a photodynamical model, which simulates the individual photometric observations instead of the more generally used transit times. We apply this methodology to the Kepler-138 planetary system. The derived planetary bulk densities are a factor of two more precise than previous determinations, and we find a discrepancy in the stellar bulk density with respect to a previous study. This leads, in turn, to a discrepancy in the determination of masses and radii of the star and the planets. In particular, we find that interior planet, Kepler-138 b, has a size in between Mars and the Earth. Given our mass and density estimates, we characterize the planetary interiors using a generalized Bayesian inference model. This model allows us to quantify for interior degeneracy and calculate confidence regions of interior parameters such as thicknesses of the core, the mantle, and ocean and gas layers. We find that Kepler-138 b and Kepler-138 d have significantly thick volatile layers, and that the gas layer of Kepler-138 b is likely enriched. On the other hand, Kepler-138 c can be purely rocky.

29 CFR 780.138 - Application of the general principles.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false Application of the general principles. 780.138 Section 780.138 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR... principles. Some examples will serve to illustrate the above principles. Employees of a fruit grower who dry...

Potentiometric study of samarium oxides formation from its chloride in a molten eutectic mixture of sodium and cesium chlorides

International Nuclear Information System (INIS)

Smolenskij, V.V.; Bove, A.L.; Del'mukhamedov, R.D.; Borodina, N.P.; Gavrilov, A.G.

1997-01-01

Interaction of trivalent samarium cations with oxide-ions in NaCl-2CsCl melt at 973 K has been studied by potentiometric method using electrochemical cell with two platinum-oxygen electrodes with a solid electrolyte membrane. The mechanism of the interaction and composition of the reaction products, depending on the medium oxyacidity, have been considered. Certain thermodynamic characteristics of the process have been calculated

Structural phase transition and electronic properties in samarium chalcogenides

Energy Technology Data Exchange (ETDEWEB)

Panwar, Y. S., E-mail: yspanwar2011@gmail.com [Department of Physics, Govt. New Science College Dewas-455001 (India); Aynyas, Mahendra [Department of Physics, C.S.A. Govt. P.G. College, Sehore, 466001 (India); Pataiya, J.; Sanyal, Sankar P. [Department of Physics, Barkatullah University, Bhopal, 462026 (India)

2016-05-06

The electronic structure and high pressure properties of samarium monochalcogenides SmS, SmSe and SmTe have been reported by using tight binding linear muffin-tin-orbital (TB-LMTO) method within the local density approximation (LDA). The total energy as a function of volume is evaluated. It is found that these monochalcogenides are stable in NaCl-type structure under ambient pressure. We predict a structural phase transition from NaCl-type (B{sub 1}-phase) structure to CsCl-type (B{sub 2}-type) structure for these compounds. Phase transition pressures were found to be 1.7, 4.4 and 6.6 GPa, for SmS, SmSe and SmTe respectively. Apart from this, the lattice parameter (a{sub 0}), bulk modulus (B{sub 0}), band structure (BS) and density of states (DOS) are calculated. From energy band diagram we observed that these compounds exhibit metallic character. The calculated values of equilibrium lattice parameter and phase transition pressure are in general good agreement with available data.

Flow Cytometry Assessment of In Vitro Generated CD138+ Human Plasma Cells

Directory of Open Access Journals (Sweden)

Rayelle Itoua Maïga

2014-01-01

Full Text Available The in vitro CD40-CD154 interaction promotes human B lymphocytes differentiation into plasma cells. Currently, CD138 is the hallmark marker enabling the detection of human plasma cells, both in vitro and in vivo; its presence can be monitored by flow cytometry using a specific antibody. We have developed a culture system allowing for the differentiation of memory B lymphocytes. In order to detect the newly formed plasma cells, we have compared their staining using five anti-CD138 monoclonal antibodies (mAbs. As a reference, we also tested human cell lines, peripheral blood mononuclear cells, and bone marrow samples. The five anti-CD138 mAbs stained RPMI-8226 cells (>98% with variable stain index (SI. The highest SI was obtained with B-A38 mAb while the lowest SI was obtained with DL-101 and 1D4 mAbs. However, the anti-CD138 mAbs were not showing equivalent CD138+ cells frequencies within the generated plasma cells. B-A38, B-B4, and MI-15 were similar (15–25% while DL-101 mAb stained a higher proportion of CD138-positive cells (38–42%. DL-101 and B-A38 mAbs stained similar populations in bone marrow samples but differed in their capacity to bind to CD138high and CD138lo cell lines. In conclusion, such cellular fluctuations suggest heterogeneity in human plasma cell populations and/or in CD138 molecules.

Sorption of samarium in iron (II) and (III) phosphates in aqueous systems; Sorcion de samario en fosfatos de hierro (II) y (III) en sistemas acuosos

Energy Technology Data Exchange (ETDEWEB)

Diaz F, J C

2006-07-01

The radioactive residues that are stored in the radioactive confinements its need to stay isolated of the environment while the radioactivity levels be noxious. An important mechanism by which the radioactive residues can to reach the environment, it is the migration of these through the underground water. That it makes necessary the investigation of reactive materials that interacting with those radionuclides and that its are able to remove them from the watery resources. The synthesis and characterization of materials that can be useful in Environmental Chemistry are very important because its characteristics are exposed and its behavior in chemical phenomena as the sorption watery medium is necessary to use it in the environmental protection. In this work it was carried out the sorption study of the samarium III ion in the iron (II) and (III) phosphate; obtaining the sorption isotherms in function of pH, of the phosphate mass and of the concentration of the samarium ion using UV-visible spectroscopy to determine the removal percentage. The developed experiments show that as much the ferrous phosphate as the ferric phosphate present a great affinity by the samarium III, for what it use like reactive material in contention walls can be very viable because it sorption capacity has overcome 90% to pH values similar to those of the underground and also mentioning that the form to obtain these materials is very economic and simple. (Author)

Separation of lanthanum from samarium on solid aluminum electrode in LiCl-KCl eutectic melts

International Nuclear Information System (INIS)

De-Bin Ji; Mi-Lin Zhang; Xing Li; Xiao-Yan Jing; Wei Han; Yong-De Yan; Yun Xue; Zhi-Jian Zhang; Harbin Engineering University, Harbin

2015-01-01

This paper presents an electrochemical study on the separation of lanthanum from samarium on aluminum electrode at 773 K. The results from different electrochemical methods showed that Sm(III) and La(III) formed Al-Sm and Al-La intermetallic compounds on an aluminum electrode at electrode potential around -1.67 and -1.46 V, respectively. The electrochemical separation of lanthanum was carried out in LiCl-KCl-LaCl 3 -SmCl 3 melts on solid aluminum electrodes at 773 K by potentiostatic electrolysis at -1.45 V for 40 h and the separation efficiency was 99.1 %. (author)

Structural and luminescence properties of samarium doped lead alumino borate glasses

Science.gov (United States)

Mohan, Shaweta; Kaur, Simranpreet; Singh, D. P.; Kaur, Puneet

2017-11-01

The study reports the effect of samarium concentration on the physical, structural and spectroscopic characteristics of samarium doped lead alumino borate glasses having composition 20PbO-(10-x)Al2O3-70B2O3-xSm2O3; x = 0.1, 0.5, 1.0 and 2.0 mol %. The glasses were fabricated by conventional melt-quenching technique and then characterized by XRD, FTIR, optical absorption and fluorescence spectra. X-ray diffraction studies confirmed the amorphous nature of the prepared glasses. FTIR spectra indicate the presence of BO3, BO4, AlO6 and a few other structural groups. Various physical properties such as density, molar volume, refractive index, rare earth ion concentration, boron-boron distance and polarizability etc. were determined using conventional methods and standard formulae. The Judd-Ofelt theory was applied on the optical absorption spectra of the glasses to evaluate the three phenomenological intensity parameters Ω2, Ω4 and Ω6. The value of Ω2 was found to be highest for glass with 1 mol% Sm2O3 and attributed to the asymmetry of the ligand field at the rare earth ion site and the rare earth oxygen (Sm-O) covalency. The calculated intensity parameters and fluorescence spectra were further used to predict the radiative transition probability (A), radiative lifetime (τR), branching ratio (βR), peak wavelength (λp), effective line widths (Δλeff) and stimulated emission cross-section (σ) for the characteristic 4G5/2 → 6H5/2, 6H7/2 and 6H9/2 transitions of the Sm3+ ion. Concentration quenching was observed for 2 mol% concentration of Sm2O3 and ascribed to energy transfer through various cross-relaxation channels between Sm3+ ions. Reasonably high values of branching ratios and stimulated emission cross-section for the prepared glasses points towards their utility in the development of visible lasers emitting in the reddish-orange spectral region. However, the glass with 1 mol% Sm2O3 was found to show better radiative properties.

MicroRNA-138 regulates osteogenic differentiation of human stromal (mesenchymal) stem cells in vivo

Science.gov (United States)

Eskildsen, Tilde; Taipaleenmäki, Hanna; Stenvang, Jan; Abdallah, Basem M.; Ditzel, Nicholas; Nossent, Anne Yael; Bak, Mads; Kauppinen, Sakari; Kassem, Moustapha

2011-01-01

Elucidating the molecular mechanisms that regulate human stromal (mesenchymal) stem cell (hMSC) differentiation into osteogenic lineage is important for the development of anabolic therapies for treatment of osteoporosis. MicroRNAs (miRNAs) are short, noncoding RNAs that act as key regulators of diverse biological processes by mediating translational repression or mRNA degradation of their target genes. Here, we show that miRNA-138 (miR-138) modulates osteogenic differentiation of hMSCs. miRNA array profiling and further validation by quantitative RT-PCR (qRT-PCR) revealed that miR-138 was down-regulated during osteoblast differentiation of hMSCs. Overexpression of miR-138 inhibited osteoblast differentiation of hMSCs in vitro, whereas inhibition of miR-138 function by antimiR-138 promoted expression of osteoblast-specific genes, alkaline phosphatase (ALP) activity, and matrix mineralization. Furthermore, overexpression of miR-138 reduced ectopic bone formation in vivo by 85%, and conversely, in vivo bone formation was enhanced by 60% when miR-138 was antagonized. Target prediction analysis and experimental validation by luciferase 3′ UTR reporter assay confirmed focal adhesion kinase, a kinase playing a central role in promoting osteoblast differentiation, as a bona fide target of miR-138. We show that miR-138 attenuates bone formation in vivo, at least in part by inhibiting the focal adhesion kinase signaling pathway. Our findings suggest that pharmacological inhibition of miR-138 by antimiR-138 could represent a therapeutic strategy for enhancing bone formation in vivo. PMID:21444814

Europium and samarium doped calcium sulfide thin films grown by PLD

International Nuclear Information System (INIS)

Christoulakis, S.; Suchea, M; Katsarakis, N.; Koudoumas, E

2007-01-01

Europium and samarium doped calcium sulfide thin films (CaS:Eu,Sm) with different thickness were prepared by the pulsed laser deposition technique using sintered targets. A typical homemade deposition chamber and XeCl excimer laser (308 nm) were employed and the films were deposited in helium atmosphere onto silicon and corning glass substrates. Structural investigations carried out by X-ray diffraction and atomic force microscopy showed a strong influence of the deposition parameters on the film properties. The films grown had an amorphous or polycrystalline structure depending on growth temperature and the number of pulses used, the same parameters affecting the film roughness, the grain shape and dimensions, the film thickness and the optical transmittance. This work indicates that pulsed laser deposition can be a suitable technique for the preparation of CaS:Eu,Sm thin films, the film characteristics being controlled by the growth conditions

The dynamics of the laser-induced metal-semiconductor phase transition of samarium sulfide (SmS)

International Nuclear Information System (INIS)

Kaempfer, Tino

2009-01-01

The present thesis is dedicated to the experimental study of the metal-semiconductor phase transition of samarium sulfide (SmS): Temperature- and time-resolved experiments on the characterization of the phase transition of mixed-valence SmS samples (M-SmS) are presented. The measurement of the dynamics of the laser-induced phase transition pursues via time-resolved ultrashort-time microscopy and by X-ray diffraction with sub-picosecond time resolution. The electronic and structural processes, which follow an excitation of M-SmS with infrared femtosecond laser pulses, are physically interpreted on the base of the results obtained in this thesis and model imaginations. [de

Samarium (III Selective Membrane Sensor Based on Tin (IV Boratophosphate

Directory of Open Access Journals (Sweden)

Ashok S. K. Kumar

2004-08-01

Full Text Available Abstract: A number of Sm (III selective membranes of varying compositions using tin (IV boratophosphate as electroactive material were prepared. Polyvinyl chloride, polystyrene and epoxy resin were used as binding materials. Membrane having composition of 40% exchanger and 60% epoxy resin exhibited best performance. This membrane worked well over a wide concentration range of 1x10-5M to 1x10-1 M of samarium ions with a Super-Nernstian slope of 40 mV/decade. It has a fast response time of less than 10 seconds and can be used for at least six months without any considerable divergence in potentials. The proposed sensor revealed good selectivities with respect to alkali, alkaline earth, some transition and rare earth metal ions and can be used in the pH range of 4.0-10.0. It was used as an indicator electrode in the potentiometric titration of Sm (III ions against EDTA. Effect of internal solution was studied and the electrode was successfully used in non-aqueous media, too.

RNF138 joins the HR team

DEFF Research Database (Denmark)

Bekker-Jensen, Simon; Mailand, Niels

2015-01-01

Two studies show that the E3 ubiquitin ligase RNF138 is recruited to DNA double-strand break sites, where it ubiquitylates key repair factors to promote DNA-end resection and homologous recombination. These findings add insights into the multilayered regulatory mechanisms underlying DNA double-st...

Complete genome sequence of an attenuated Sparfloxacin resistant Streptococcus agalactiae strain 138spar

Science.gov (United States)

Through selection of resistance to sparfloxacin, an attenuated Streptococcus agalactiae strain 138spar was obtained from its virulent parent strain S. agalactiae 138P. The full genome of S. agalactiae 138spar is 1,838,126 bp. The availability of this genome will allow comparative genomics to identi...

Cysteine 138 mutation in HIV-1 Nef from patients with delayed disease progression

DEFF Research Database (Denmark)

Tolstrup, Martin; Laursen, Alex Lund; Gerstoft, J.

2006-01-01

on the delayed disease status. However, the results demonstrate a high incidence of a single amino acid polymorphism (cysteine 138) in HIV-1 Nef. The allelic frequency of cysteine 138 between the delayed disease progression group and the progressor group was found to be statistically significant (P = 0.......0139). The phylogeny of isolates was investigated and the variants harbouring the cysteine 138 mutation clustered independently. CONCLUSION: The present study describes a viral genetic polymorphism related to AIDS disease progression. The polymorphism (cysteine 138) has previously been reported to confer decreased...... viral replication (Premkumar DR, et al. AIDS Res Hum Retroviruses 1996; 12(4): 337-45). A sequence database search for comparative mutations revealed a high frequency of cysteine 138 in patients with reported SP AIDS...

Determination of trace amounts of rare earth elements in samarium, terbium and disprosium oxides by graphite furnace atomic-absorption spectrometry

International Nuclear Information System (INIS)

Dantas, E.S.K.

1990-01-01

A graphite furnace atomic-absorption spectrometry method for the determination of neodymium, europium, terbium, dysprosium and yttrium at trace level in samarium oxide; of samarium, europium, dysprosium, holmium, erbium and yttrium in terbium oxide and of europium, terbium, holmium, erbium and yttrium in dysprosium oxide was established. The best pyrolysis and atomization temperatures were determined for each lanthanide considered. Calibration curves were obtained for the pure elements, for binary mixtures formed by the matrix and each of the lanthanides studied and, finally, for the complex mixtures constituted by the matrix and all the other lanthanide of the group under scrutiny. This study has been carried out to examine the interference of the presence of one lanthanide on the behaviour of the other, since a lack of linearity on the calibration curves has been observed in some cases. Detection and determination limits have been determined as well. The detection limits encountered were within the range 0.002 to 0.3% for different elements. The precision of the method expressed as the relative standard deviation was calculated for each element present in each of the matrices studied. The conclusion arrived at is that the method can be applied for determining the above mentioned lanthanides present in the matrices studied with purity up to 99.50%. (author)

Synthesis of samarium complexes with the derivative binder of Schiff Quinolinic base. Characterization and photophysical study; Sintesis de complejos de samario con el ligante derivado de base de Schiff Quinolinica. Caracterizacion y estudio fotofisico

Energy Technology Data Exchange (ETDEWEB)

Lucas H, J.

2016-07-01

In this work we determined the metal: binder stoichiometry of the species formed during the UV/Vis spectrophotometric titration of the derivative binder of Schiff quinolinic base, L1 with the samarium nitrate pentahydrate in methanol. Statistical analysis of the data allowed proposing the metal: binder stoichiometry for the synthesis of the complexes which was one mole of samarium salt by 2.5 moles of binder and thus favor the formation of complexes with 1M: 1L and 1M: 2L stoichiometries. They were synthesized in aqueous-organic medium (water-ethanol), isolated and purified two complexes with stoichiometry 1 Sm: 1 L1, complex 1 and 1 Sm: 2 L1, complex 2. The overall yield of the reaction was 76%. The characterization of the formed complexes was performed by visible ultraviolet spectrometry (UV/Vis), nuclear magnetic resonance, X-ray photoelectron spectroscopy (XP S), thermal gravimetric analysis with differential scanning calorimetry (TGA/DSC), and radial distribution function. These complexes were studied by fluorescence and emission phosphorescence at variable temperature. Spectroscopic techniques used in both solution and solid demonstrated the formation and stability of these complexes. In addition XP S indicated that in both complexes the samarium retains its oxidation state 3+. Luminescence studies indicated that there is intra-binding charge transfer which decreases the transfer of light energy from the binder to the samarium. Based on the experimental results, L1 binder molecules and complexes 1 and 2 were modeled that demonstrated the proposed Nc for each complex, as well as allowed to visualize the structural arrangement of the molecules, complexes and binder. (Author)

Fabrication of a PVC membrane samarium(III) sensor based on N,N Prime ,N Double-Prime -tris(4-pyridyl)trimesic amide as a selectophore

Energy Technology Data Exchange (ETDEWEB)

Zamani, Hassan Ali, E-mail: haszamani@yahoo.com [Department of Applied Chemistry, Mashhad Branch, Islamic Azad University, Mashhad (Iran, Islamic Republic of); Naghavi-Reyabbi, Fatemeh [Resident of General Surgery, Endoscopic and Minimaly Invasive Surgery Research Center, Ghaem Hospital, Faculty of Medicine, Mashhad University of Medical Sciences, Mashhad (Iran, Islamic Republic of); Faridbod, Farnoush [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Mohammadhosseini, Majid [Department of Chemistry, Faculty of Basic Sciences, Shahrood Branch, Islamic Azad University, Shahrood (Iran, Islamic Republic of); Ganjali, Mohammad Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Tadjarodi, Azadeh; Rad, Maryam [Department of Chemistry, Iran University of Science and Technology, Tehran (Iran, Islamic Republic of)

2013-03-01

A new ion-selective electrode for Sm{sup 3+} ion is described based on the incorporation of N,N Prime ,N Double-Prime -tris(4-pyridyl)trimesic amide (TPTA) in a poly(vinylchloride) (PVC) matrix. The membrane sensor comprises nitrobenzene (NB) as a plasticizer, and oleic acid (OA) as an anionic additive. The sensor with the optimized composition shows a Nernstian potential response of 19.8 {+-} 0.5 mV decade{sup -1} over a wide concentration range of 1.0 Multiplication-Sign 10{sup -2} and 1 Multiplication-Sign 10{sup -6} mol L{sup -1}, with a lower detection limit of 4.7 Multiplication-Sign 10{sup -7} mol L{sup -1} and satisfactor applicable pH range of 3.6-9.2. Having a short response time of less than 10 s and a very good selectivity towards the Sm{sup 3+} over a wide variety of interfering cations (e.g. alkali, alkaline earth, transition and heavy metal ions) the sensor seemed to be a promising analytical tool for determination of the Sm{sup 3+}. Hence, it was used as an indicator electrode in the potentiometric titration of samarium ion with EDTA. It was also applied to the direct samarium recovery in binary mixtures. - Highlights: Black-Right-Pointing-Pointer A new Sm{sup 3+}-PVC membrane sensor is introduced for determination of Sm{sup 3+} ions in the solutions. Black-Right-Pointing-Pointer N,N Prime ,N Double-Prime -tris(4-pyridyl)trimesic amide was used as a suitable selectophore for samarium sensor. Black-Right-Pointing-Pointer Detection limit of the sensor is 4.7 Multiplication-Sign 10{sup -7} mol L{sup -1} with a short response time of less than 10 s.

Fluorometric determination of samarium and europium in rare earth minerals with. beta. -diketoneternary complex

Energy Technology Data Exchange (ETDEWEB)

Huang, H; Hiraki, K; Nishikawa, Y [Kinki Univ., Higashi-Osaka, Osaka (Japan). Faculty of Science and Technology

1981-07-01

This communication reported the optimum conditions for the fluorometric determination of these ions, and the method was adopted in the simultaneous determination of samarium and europium in xenotime and monazite minerals. From the experimental results on the effect of diverse ions and the extraction pH of the aqueous phase, it became clear that TTA-TOPO hexane method was the best system for the determination of samarium and europium because of the highest fluorescence sensitivity of the ternary complex, and also because the lower extraction pH eliminated the effect of diverse ions. Moreover, the very high detection limit (2 ppb) of Sm was achieved by the use of a red sensitive photomultiplier. Which was used at 644 nm, and that of Eu (0.02 ppb) at 614 nm. The procedure was established as follows: The rare earth minerals (xenotime, monazite) sample was treated with hot conc. H/sub 2/SO/sub 4/ and twice precipitated with 0.5 mol dm/sup -3/ oxalic acid (pH was adjusted to 2.0 -- 2.2). Then the precipitate was filtered and ignited to give the rare earth oxide. Fifty milligrams of the oxide was dissolved in HCl and diluted with water in order to obtain the solution containing 5 ..mu..g cm/sup -3/ rare earth oxide. An aliquot of the solution ((1.0 -- 3.0) cm/sup 3/) was adjusted to pH 5.5 with sodium acetate and shaken with 1 x 10/sup -4/ mol dm/sup -3/ TTA- 2 x 10/sup -2/ mol dm/sup -3/ TOPO hexane solution. Then the fluorescence intensity of the organic layer was measured at 644 nm for Sm and 614 nm for Eu. In this procedure, the recovery of Sm and Eu was found to be about 96%. Xenotime contained 0.70% of Sm and 0.004% of Eu, and monazite contained 1.84% of Sm and 0.003% of Eu.

11 CFR 100.138 - Sale of food and beverages by vendor.

Science.gov (United States)

2010-01-01

... 11 Federal Elections 1 2010-01-01 2010-01-01 false Sale of food and beverages by vendor. 100.138...) Exceptions to Expenditures § 100.138 Sale of food and beverages by vendor. The sale of any food or beverage..., is not an expenditure, provided that the charge is at least equal to the cost of such food or...

33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for...

Memory effect of calcined layered samarium hydroxy chlorides in aqueous solution

International Nuclear Information System (INIS)

Lee, Byung Il; Byeon, Song Ho

2015-01-01

The decomposition and recovery behavior of layered samarium hydroxychloride (Sm 2 (OH) 5 Cl·nH 2 O, LSmH) has been closely studied in various conditions. Although the heat treatment of LSmH at 700 °C completely collapsed typical layered structure, the calcined LSmH (c-LSmH) recovered its layered characteristics and consequently its ability to intercalate anions into the interlayer space when it was rehydroxylated and rehydrated in aqueous solutions containing organic and inorganic anions. This phenomenon is similar to the memory effect observed in classical layered double hydroxides (LDHs), where LDHs calcined to a mixture of metal oxides can recover their layered structures in aqueous solutions. In contrast, the recovery reaction of c-LSmH in water without any counter anions was unsuccessful and instead resulted in the formation of Sm(OH) 3 . Such a difference was interpreted on the basis of the salt effect on Sm 2 (OH) 5 Cl·nH 2 O–Sm(OH) 3 phase equilibria in water

Galvanic interactions of HE15 /MDN138 & HE15 /MDN250 alloys in natural seawater

Science.gov (United States)

Parthiban, G. T.; Subramanian, G.; Muthuraman, K.; Ramakrishna Rao, P.

2017-06-01

HE15 is a heat treatable high strength alloy with excellent machinability find wide applications in aerospace and defence industries. In view of their excellent mechanical properties, workability, machinability, heat treatment characteristics and good resistance to general and stress corrosion cracking, MDN138 & MDN250 have been widely used in petrochemical, nuclear and aerospace industries. The galvanic corrosion behaviour of the metal combinations HE15 /MDN138 and HE15 /MDN250, with 1:1 area ratio, has been studied in natural seawater using the open well facility of CECRI's Offshore Platform at Tuticorin for a year. The open circuit potentials of MDN138, MDN250 and HE15 of the individual metal, the galvanic potential and galvanic current of the couples HE15 /MDN138 and HE15 /MDN250 were periodically monitored throughout the study period. The calcareous deposits on MDN138 and MDN250 in galvanic contact with HE15 were analyzed using XRD. The electrochemical behaviors of MDN138, MDN250 and HE15 in seawater have been studied using an electrochemical work station. The surface characteristics of MDN138 and MDN250 in galvanic contact with HE15 have been examined with scanning electron microscope. The results of the study reveal that HE15 offered required amount of protection to MDN138 & MDN250.

9 CFR 3.138 - Primary conveyances (motor vehicle, rail, air, and marine).

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Primary conveyances (motor vehicle, rail, air, and marine). 3.138 Section 3.138 Animals and Animal Products ANIMAL AND PLANT HEALTH... (motor vehicle, rail, air, and marine). (a) The animal cargo space of primary conveyances used in...

miR-138 protects cardiomyocytes from hypoxia-induced apoptosis via MLK3/JNK/c-jun pathway

Energy Technology Data Exchange (ETDEWEB)

He, Siyi; Liu, Peng; Jian, Zhao; Li, Jingwei; Zhu, Yun; Feng, Zezhou; Xiao, Yingbin, E-mail: xiaoyb@vip.sina.com

2013-11-29

Highlights: •First time to find miR-138 is up-regulated in hypoxic cardiomyocytes. •First time to find miR-138 targets MLK3 and regulates JNK/c-jun pathway. •Rare myocardial biopsy of patients with CHD were collected. •Both silence and overexpression of miR-138 were implemented. •Various methods were used to detect cell function. -- Abstract: Cardiomyocytes experience a series of complex endogenous regulatory mechanisms against apoptosis induced by chronic hypoxia. MicroRNAs are a class of endogenous small non-coding RNAs that regulate cellular pathophysiological processes. Recently, microRNA-138 (miR-138) has been found related to hypoxia, and beneficial for cell proliferation. Therefore, we intend to study the role of miR-138 in hypoxic cardiomyocytes and the main mechanism. Myocardial samples of patients with congenital heart disease (CHD) were collected to test miR-138 expression. Agomir or antagomir of miR-138 was transfected into H9C2 cells to investigate its effect on cell apoptosis. Higher miR-138 expression was observed in patients with cyanotic CHD, and its expression gradually increased with prolonged hypoxia time in H9C2 cells. Using MTT and LDH assays, cell growth was significantly greater in the agomir group than in the negative control (NC) group, while antagomir decreased cell survival. Dual luciferase reporter gene and Western-blot results confirmed MLK3 was a direct target of miR-138. It was found that miR-138 attenuated hypoxia-induced apoptosis using TUNEL, Hoechst staining and Annexin V-PE/7-AAD flow cytometry analysis. We further detected expression of apoptosis-related proteins. In the agomir group, the level of pro-apoptotic proteins such as cleaved-caspase-3, cleaved-PARP and Bad significantly reduced, while Bcl-2 and Bcl-2/Bax ratio increased. Opposite changes were observed in the antagomir group. Downstream targets of MLK3, JNK and c-jun, were also suppressed by miR-138. Our study demonstrates that up-regulation of miR-138 plays

The properties of samarium-doped zinc oxide/phthalocyanine structure for optoelectronics prepared by pulsed laser deposition and organic molecular evaporation

Czech Academy of Sciences Publication Activity Database

Novotný, Michal; Marešová, Eva; Fitl, Přemysl; Vlček, Jan; Bergmann, M.; Vondráček, Martin; Yatskiv, Roman; Bulíř, Jiří; Hubík, Pavel; Hruška, Petr; Drahokoupil, Jan; Abdellaoui, N.; Vrňata, M.; Lančok, Ján

2016-01-01

Roč. 122, č. 3 (2016), 1-8, č. článku 225. ISSN 0947-8396 R&D Projects: GA MŠk(CZ) LG15050; GA ČR(CZ) GAP108/11/0958; GA MŠk(CZ) LM2011029; GA ČR(CZ) GA14-10279S; GA MŠk(CZ) 7AMB14FR010 Institutional support: RVO:68378271 ; RVO:67985882 Keywords : samarium-doped zinc oxide zinc/phthalocyanine deposition * evaporation * pulsed laser deposition * thin films Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.455, year: 2016

Structural and decay properties of Z = 132, 138 superheavy nuclei

Energy Technology Data Exchange (ETDEWEB)

Rather, Asloob A.; Ikram, M.; Usmani, A.A. [Aligarh Muslim University, Department of Physics, Aligarh (India); Kumar, Bharat; Patra, S.K. [Institute of Physics, Bhubaneswar (India); Homi Bhabha National Institute, Mumbai, Anushakti Nagar (India)

2016-12-15

In this paper, we analyze the structural properties of Z = 132 and Z = 138 superheavy nuclei within the ambit of axially deformed relativistic mean-field framework with NL3* parametrization and calculate the total binding energies, radii, quadrupole deformation parameter, separation energies, density distributions. We also investigate the phenomenon of shape coexistence by performing the calculations for prolate, oblate and spherical configurations. For clear presentation of nucleon distributions, the two-dimensional contour representation of individual nucleon density and total matter density has been made. Further, a competition between possible decay modes such as α-decay, β-decay and spontaneous fission of the isotopic chain of superheavy nuclei with Z = 132 within the range 312 ≤ A ≤ 392 and 318 ≤ A ≤ 398 for Z = 138 is systematically analyzed within self-consistent relativistic mean-field model. From our analysis, we inferred that the α-decay and spontaneous fission are the principal modes of decay in majority of the isotopes of superheavy nuclei under investigation apart from β-decay as dominant mode of decay in {sup 318-322}138 isotopes. (orig.)

Cross sections for d-{sup 3}H neutron interactions with samarium isotopes

Energy Technology Data Exchange (ETDEWEB)

Luo, Junhua; He, Long [Hexi Univ., Zhangye (China). School of Physics and Electromechanical Engineering; Wu, Chunlei; Jiang, Li [Chinese Academy of Engineering Physics, Mianyang (China). Inst. of Nuclear Physics and Chemistry

2016-11-01

The cross sections for (n,x) reactions on samarium isotopes were measured at (d-T) neutron energies of 13.5 and 14.8 MeV with the activation technique. Samples were activated along with Nb and Al monitor foils to determine the incident neutron flux. Theoretical calculations of excitation functions were performed using the nuclear model codes TALYS-1.6 and EMPIRE-3.2 Malta with default parameters, at neutron energies varying from the reaction threshold to 20 MeV. The results were discussed and compared with experimental data found in the literature. At neutron energies 13.5 and 14.8 MeV, the cross sections of the {sup 149}Sm(n,p){sup 149}Pm reaction are reported for the first time. The cross sections of the {sup 150}Sm(n,p){sup 150}Pm, {sup 144}Sm(n,p){sup 144}Pm, {sup 152}Sm(n,α){sup 149}Nd and {sup 144}Sm(n,α){sup 141}Nd reactions at different neutron energies reported in the present work can be added as new data in the nuclear databases.

Charge and transition densities of samarium isotopes in the interacting Boson model

International Nuclear Information System (INIS)

Moinester, M.A.; Alster, J.; Dieperink, A.E.L.

1982-01-01

The interacting boson approximation (IBA) model has been used to interpret the ground-state charge distributions and lowest 2 + transition charge densities of the even samarium isotopes for A = 144-154. Phenomenological boson transition densities associated with the nucleons comprising the s-and d-bosons of the IBA were determined via a least squares fit analysis of charge and transition densities in the Sm isotopes. The application of these boson trasition densities to higher excited 0 + and 2 + states of Sm, and to 0 + and 2 + transitions in neighboring nuclei, such as Nd and Gd, is described. IBA predictions for the transition densities of the three lowest 2 + levels of 154 Gd are given and compared to theoretical transition densities based on Hartree-Fock calculations. The deduced quadrupole boson transition densities are in fair agreement with densities derived previously from 150 Nd data. It is also shown how certain moments of the best fit boson transition densities can simply and sucessfully describe rms radii, isomer shifts, B(E2) strengths, and transition radii for the Sm isotopes. (orig.)

Thermodynamics of coproportionation reactions of homogeneous samarium (3) and yttrium (3) nitrates solvates with neutral organic phosphorus compounds

International Nuclear Information System (INIS)

Pyartman, A.K.

1995-01-01

Reaction heats of homogeneous samarium (3) and yttrium (3) nitrate solvates coproportionation with neutral organophosphoric compounds (tri-n.-butylphosphate, diisooctylmethylphosphonate, diisoamylmethylphosphonate) at T=298.15 K in hexane have been measured by thermochemical method. It has been ascertained that enthalpies of coproportionation reactions practically do not depend on the nature, concentration of rare earth metal (3) nitrate solvates in hexane, nature of neutral organophosphoric compound and constitute 1.1±-.2 kJ/mol. The Gibbs free energy of coproportionation reactions is -5.43 kJ/mol, while entropy of the reactions in 14.5±0.7 J/mol·K. 8 refs., 1 tab

33 CFR 138.240 - Procedure for calculating limit of liability adjustments for inflation.

Science.gov (United States)

2010-07-01

... of liability adjustments for inflation. 138.240 Section 138.240 Navigation and Navigable Waters COAST... calculating limit of liability adjustments for inflation. (a) Formula for calculating a cumulative percent... later than every three years from the year the limits of liability were last adjusted for inflation, the...

40 CFR 86.138-96 - Hot soak test.

Science.gov (United States)

2010-07-01

....138-96 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... preparation for the hot soak test. (2) Gaseous-fueled vehicles. Since gaseous-fueled vehicles are not required.... (iii) Fresh impingers shall be installed in the methanol sample collection system immediately prior to...

MicroRNA-138 is a potential regulator of memory performance in humans

Directory of Open Access Journals (Sweden)

Julia eSchröder

2014-07-01

Full Text Available Genetic factors underlie a substantial proportion of individual differences in cognitive functions in humans, including processes related to episodic and working memory. While genetic association studies have proposed several candidate memory genes, these currently explain only a minor fraction of the phenotypic variance. Here, we performed genome-wide screening on 13 episodic and working memory phenotypes in 1,318 participants of the Berlin Aging Study II aged 60 years or older. The analyses highlight a number of novel single nucleotide polymorphisms (SNPs associated with memory performance, including one located in a putative regulatory region of microRNA (miRNA hsa-mir-138-5p (rs9882688, P-value = 7.8x10-9. Expression quantitative trait locus analyses on next-generation RNA-sequencing data revealed that rs9882688 genotypes show a significant correlation with the expression levels of this miRNA in 309 human lymphoblastoid cell lines (P-value = 5x10-4. In silico modeling of other top-ranking GWAS signals identified an additional memory-associated SNP in the 3' untranslated region (3'UTR of DCP1B, a gene encoding a core component of the mRNA decapping complex in humans, predicted to interfere with hsa-mir-138-5p binding. This prediction was confirmed in vitro by luciferase assays showing differential binding of hsa-mir-138-5p to 3'UTR reporter constructs in two human cell lines (HEK293: P-value = 0.0470; SH-SY5Y: P-value = 0.0866. Finally, expression profiling of hsa-mir-138-5p and DCP1B mRNA in human post-mortem brain tissue revealed that both molecules are expressed simultaneously in frontal cortex and hippocampus, suggesting that the proposed interaction between hsa-mir-138-5p and DCP1B may also take place in vivo. In summary, by combining unbiased genome-wide screening with extensive in silico modeling, in vitro functional assays, and gene expression profiling, our study identified miRNA-138 as a potential molecular regulator of human memory

MicroRNA-138 regulates osteogenic differentiation of human stromal (mesenchymal) stem cells in vivo

DEFF Research Database (Denmark)

Eskildsen, Tilde; Taipaleenmäki, Hanna; Stenvang, Jan

2011-01-01

Elucidating the molecular mechanisms that regulate human stromal (mesenchymal) stem cell (hMSC) differentiation into osteogenic lineage is important for the development of anabolic therapies for treatment of osteoporosis. MicroRNAs (miRNAs) are short, noncoding RNAs that act as key regulators......-regulated during osteoblast differentiation of hMSCs. Overexpression of miR-138 inhibited osteoblast differentiation of hMSCs in vitro, whereas inhibition of miR-138 function by antimiR-138 promoted expression of osteoblast-specific genes, alkaline phosphatase (ALP) activity, and matrix mineralization. Furthermore...

Efficacy and toxicity of Samarium-153-EDTMP locally produced in the treatment of painful skeletal metastases

International Nuclear Information System (INIS)

Olea, E.; Quintana, J.C.; Nagel, J.; Arenas, L.; Tomicic, M.; Gil, M.C.; Araya, G.

2001-01-01

Samarium-153 emits medium-energy beta particles an a gamma photon with a physical half-life of 46,3 hours. When chelated to ethylenediaminetetramethylenephosphonic acid (EDTMP), it is remarkably stable in vitro and in vivo. In this study we administered randomly 0,5 and 1,0 mCi/Kg body weight (two groups), to 30 patients with painful metastatic bone cancer. Slight and spontaneously reversible myelotoxicity was observed. A bigger leukocyte and platelet suppression was obtained with 1,0 mCi/kg than 0,5 mCi/Kg dose. Pain palliation was obtained in 66% of the treated patients. Our preliminary results indicate that 153 Sm-EDTMP is a promising radiotherapeutic agent for palliative treatment of metastatic bone cancer pain where a reactor is available and at a very affordable cost. (author)

15 CFR 13.8 - Opportunity to comment on proposed Federal financial assistance and direct Federal development.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Opportunity to comment on proposed Federal financial assistance and direct Federal development. 13.8 Section 13.8 Commerce and Foreign Trade Office of the Secretary of Commerce INTERGOVERNMENTAL REVIEW OF DEPARTMENT OF COMMERCE PROGRAMS AND ACTIVITIES § 13.8 Opportunity to comment on...

Determination of the nuclear electric charge distribution of samarium isotopes 144, 148, 150, 152, 154 by the muonic atom method

International Nuclear Information System (INIS)

Barreau, Pierre.

1977-01-01

The theory of the nucleus-negative muon system in the case of electrical interactions is discussed. The interactions of muons with the samarium isotopes 152, 154, 144, 148, 150 are investigated. After a description of the experimental device, from muon beam production to data acquisition (detection of the gamma spectra), the results are analyzed and the nuclear charge distribution parameters determined: for each isotope the absolute value of c (half-density radius) and t (skin thickness); for 152 Sm and 154 Sm the parameter β 2 (quadrupolar defomation). Nuclear polarization was accounted for throughout the analysis [fr

7 CFR 457.138 - Grape crop insurance provisions.

Science.gov (United States)

2010-01-01

... types, in the county for which a premium rate is provided by the actuarial documents: (a) In which you... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.138 Grape crop insurance... avoirdupois. Type. A category of grapes (one or more varieties) identified as a type in the Special Provisions...

Pharmacokinetics of labelled compounds with technetium-99m and samarium-153

International Nuclear Information System (INIS)

Borda O, L.B.; Torres L, M.N.

1997-01-01

The purpose of this investigation was to establish the different pharmacokinetics parameters of the main radiopharmaceuticals labeled with technetium-99m and samarium-153. These parameters could be subsequently used as reference to compare other products with the same use. Mathematical models and a computerized pharmacokinetic program were used to this purpose. A biodistribution study in quadruplicate and/or quintuplicate was conducted for each radiopharmaceutical, data was was obtained in injection dose percentages. The biodistribution study involved the injection of a predetermined dose of the radiopharmaceutical into animals (rats or mice), which were subsequently put away at different time intervals, removing the relevant organs. Activity in each organ was read by means of a well-type NaI scintillation counter, data obtained in activity counts was transformed into injection dose percentages. Based on these percentages, the mathematical model was constructed and the pharmacokinetic parameters were obtained using the computerized program Expo 2 v. 1, which is written in C language and works in windows. Analyzing the results obtained, we can conclude that the use of the Expo 2 v. 1 program for a bi compartmental analysis allowed us to obtain reliable pharmacokinetic parameters which describe what happens in the organism when the radiopharmaceutical passes from the central compartment to the peripheral one and vice versa

Pyroelectric properties and electrical conductivity in samarium doped BiFeO 3 ceramics

KAUST Repository

Yao, Yingbang

2012-06-01

Samarium (Sm 3+) doped BiFeO 3 (BFO) ceramics were prepared by a modified solid-state-reaction method which adopted a rapid heating as well as cooling during the sintering process. The pyroelectric coefficient increased from 93 to 137 μC/m 2 K as the Sm 3+ doping level increased from 1 mol% to 8 mol%. Temperature dependence of the pyroelectric coefficient showed an abrupt decrease above 80 °C in all samples, which was associated with the increase of electrical conductivity with temperature. This electrical conduction was attributed to oxygen vacancy existing in the samples. An activation energy of ∼0.7 eV for the conduction process was found to be irrespective of the Sm 3+ doping level. On the other hand, the magnetic Néel temperature (T N) decreased with increasing Sm 3+ doping level. On the basis of our results, the effects of Sm doping level on the pyroelectric and electrical properties of the BFO were revealed. © 2011 Elsevier Ltd. All rights reserved.

Post-irradiation characterization of PH13-8Mo martensitic stainless steel

Energy Technology Data Exchange (ETDEWEB)

Jong, M.; Schmalz, F.; Rensman, J.W. [Nuclear Research and consultancy Group, Westerduinweg 3, 1755 ZG Petten (Netherlands); Luzginova, N.V., E-mail: luzginova@nrg.eu [Nuclear Research and consultancy Group, Westerduinweg 3, 1755 ZG Petten (Netherlands); Wouters, O.; Hegeman, J.B.J.; Laan, J.G. van der [Nuclear Research and consultancy Group, Westerduinweg 3, 1755 ZG Petten (Netherlands)

2011-10-01

The irradiation response of PH13-8Mo stainless steel was measured up to 2.5 dpa at 200 and 300 deg. C irradiation temperatures. The PH13-8Mo, a martensitic precipitation-hardened steel, was produced by Hot Isostatic Pressing at 1030 deg. C. The fatigue tests (high cycle fatigue and fatigue crack propagation) showed a test temperature dependency but no irradiation effects. Tensile tests showed irradiation hardening (yield stress increase) of approximately 37% for 200 deg. C irradiated material tested at 60 deg. C and approximately 32% for 300 deg. C irradiated material tested at 60 deg. C. This contradicts the shift in reference temperature (T{sub 0}) measured in toughness tests (Master Curve approach), where the {Delta}T{sub 0} for 300 deg. C irradiated is approximately 170 deg. C and the {Delta}T{sub 0} for the 200 deg. C irradiated is approximately 160 deg. C. This means that the irradiation hardening of PH13-8Mo steel is not suitable to predict the shift in the reference temperature for the Master Curve approach.

Studies on the structural, optical and dielectric properties of samarium coordinated with salicylic acid single crystal

Science.gov (United States)

Singh, Harjinder; Slathia, Goldy; Gupta, Rashmi; Bamzai, K. K.

2018-04-01

Samarium coordinated with salicylic acid was successfully grown as a single crystal by low temperature solution technique using mixed solvent of methanol and water in equal ratio. Structural characterization was carried out by single crystal X-ray diffraction analysis and it crystallizes in centrosymmetric space group P121/c1. FTIR and UV-Vis-NIR spectroscopy confirmed the compound formation and help to determine the mode of binding of the ligand to the rare earth-metal ion. Dielectric constant and dielectric loss have been measured over the frequency range 100 Hz - 30MHz. The decrease in dielectric constant with increases in frequency is due to the transition from interfacial polarization to dipolar polarization. The small value of dielectric constant at higher frequency ensures that the crystal is good candidate for NLO devices. Dielectric loss represents the resistive nature of the material.

Characterization of deamidation at Asn138 in L-chain of recombinant humanized Fab expressed from Pichia pastoris.

Science.gov (United States)

Ohkuri, Takatoshi; Murase, Eri; Sun, Shu-Lan; Sugitani, Jun; Ueda, Tadashi

2013-10-01

A method was previously established for evaluating Asn deamidation by matrix-assisted laser desorption/ionization time of flight-mass spectrometry using endoproteinase Asp-N. In this study, we demonstrated that this method could be applied to the identification of the deamidation site of the humanized fragment antigen-binding (Fab). First, a system for expressing humanized Fab from methylotrophic yeast Pichia pastoris was constructed, resulting in the preparation of ∼30 mg of the purified humanized Fab from 1 l culture. Analysis of the L-chain derived from recombinant humanized Fab that was heated at pH 7 and 100°C for 1 h showed the deamidation at Asn138 in the constant region. Then, we prepared L-N138D Fab and L-N138A Fab and examined their properties. The circular dichroism (CD) spectrum of the L-N138D Fab was partially different from that of the wild-type Fab. The measurement of the thermostability showed that L-N138D caused a significant decrease in the thermostability of Fab. On the other hand, the CD spectrum and thermostability of L-N138A Fab showed the same behaviour as the wild-type Fab. Thus, it was suggested that the introduction of a negative charge at position 138 in the L-chain by the deamidation significantly affected the stability of humanized Fab.

40 CFR 63.138 - Process wastewater provisions-performance standards for treatment processes managing Group 1...

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Process wastewater provisions-performance standards for treatment processes managing Group 1 wastewater streams and/or residuals removed from Group 1 wastewater streams. 63.138 Section 63.138 Protection of Environment ENVIRONMENTAL...

Detonation nanodiamond introduced into samarium doped ceria electrolyte improving performance of solid oxide fuel cell

Science.gov (United States)

Pei, Kai; Li, Hongdong; Zou, Guangtian; Yu, Richeng; Zhao, Haofei; Shen, Xi; Wang, Liying; Song, Yanpeng; Qiu, Dongchao

2017-02-01

A novel electrolyte materials of introducing detonation nanodiamond (DNDs) into samarium doped ceria (SDC) is reported here. 1%wt. DNDs doping SDC (named SDC/ND) can enlarge the electrotyle grain size and change the valence of partial ceria. DNDs provide the widen channel to accelerate the mobility of oxygen ions in electrolyte. Larger grain size means that oxygen ions move easier in electrolyte, it can also reduce the alternating current (AC) impedance spectra of internal grains. The lower valence of partial Ce provides more oxygen vacancies to enhance mobility rate of oxygen ions. Hence all of them enhance the transportation of oxygen ions in SDC/ND electrolyte and the OCV. Ultimately the power density of SOFC can reach 762 mw cm-2 at 800 °C (twice higher than pure SDC, which is 319 mw cm-2 at 800 °C), and it remains high power density in the intermediate temperature (600-800 °C). It is relatively high for the electrolyte supported (300 μm) cells.

Use of dispersive liquid-liquid microextraction for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium

International Nuclear Information System (INIS)

Mallah, M.H.; Atomic Energy Organization of Iran, Tehran; Shemirani, F.; Ghannadi Maragheh, M.

2008-01-01

A new preconcentration method of dispersive liquid-liquid microextraction (DLLME) was developed for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium. DLLME technique was successfully used as a sample preparation method. In this preconcentration method, an appropriate mixture of extraction solvent, disperser solvent was injected rapidly into an aqueous solution containing Sm, Eu, Gd and Dy after complex formation using chelating reagent of the 1-(2-pyridylazo)-2-naphthol (PAN). After phase separation, 0.5 mL of the settled phase containing enriched analytes was determined by inductively coupled plasma optical emission spectrometry (ICP-OES). The main factors affected the preconcentration of Sm, Eu, Gd and Dy were extraction and dispersive solvent type and their volume, extraction time, volume of chelating agent (PAN), centrifuge speed and drying temperature of the samples. Under the best operating condition simultaneous preconcentration factors of 80, 100, 103 and 78 were obtained for Sm, Eu, Gd and Dy, respectively. (author)

Porta-enxertos para o cultivar Máximo IAC 138-22 de uvas de vinho em Monte Alegre do Sul, SP Rootstocks for wine grape cultivar IAC 138-22

Directory of Open Access Journals (Sweden)

Maurilo Monteiro Terra

1990-01-01

Full Text Available Em Monte Alegre do Sul, SP, efetuou-se um experimento de longa duração para observar o comportamento do cultivar IAC 138-22 (Máximo de uvas para vinho, sobre cinco porta-enxertos: RR 101-14, 'Golia', "Ripária do Traviú', IAC 572 e IAC 313. Em oito colheitas sucessivas anuais, de 1974 a 1981, analisaram-se as produções médias de uvas por planta. Os resultados indicaram que o IAC 572' foi o melhor porta-enxerto para o IAC 138-22 'Máximo'. O IAC 313 superou o IAC 572 em um dos anos estudados. Todos os outros porta-enxertos apresentaram desempenho inferior.A long term experiment was conducted at Monte Alegre do Sul, State of São Paulo, Brazil, to study the behaviour of wine grape cultivar IAC 138-22 Máximo on five rootstocks: RR 101 14, 'Golia', "Ripária do Traviú', IAC 313 and IAC 572 The yields of eight consecutive annual harvests (from 1974 to 1981 were analysed. The results indicated that IAC 572 was the best rootstock. IAC 313 can also be used but with fair results. "Ripária do Traviú', RR 101-14 and 'Golia' are not recommended as rootstocks for IAC 138-22. Considering the row spacing (2 x 1m which allows 5,000 plants/ha, the difference between average yields of the best and the worst rootstock was 8,475kg/ha of grapes, a considerable figure for the grape grower.

Design of portable electrocardiogram device using DSO138

Science.gov (United States)

Abuzairi, Tomy; Matondang, Josef Stevanus; Purnamaningsih, Retno Wigajatri; Basari, Ratnasari, Anita

2018-02-01

Cardiovascular disease has been one of the leading causes of sudden cardiac deaths in many countries, covering Indonesia. Electrocardiogram (ECG) is a medical test to detect cardiac abnormalities by measuring the electrical activity generated by the heart, as the heart contracts. By using ECG, we can observe anomaly at the time of heart abnormalities. In this paper, design of portable ECG device is presented. The portable ECG device was designed to easily use in the village clinic or houses, due to the small size device and other benefits. The device was designed by using four units: (1) ECG electrode; (2) ECG analog front-end; (3) DSO138; and (4) battery. To create a simple electrode system in the portable ECG, 1-lead ECG with two electrodes were applied. The analog front-end circuitry consists of three integrated circuits, an instrumentation amplifier AD820AN, a low noise operational amplifier OPA134, and a low offset operational amplifier TL082. Digital ECG data were transformed to graphical data on DSO138. The results show that the portable ECG is successfully read the signal from 1-lead ECG system.

Characterization of luminescent samarium doped HfO2 coatings synthesized by spray pyrolysis technique

International Nuclear Information System (INIS)

Chacon-Roa, C; Guzman-Mendoza, J; Aguilar-Frutis, M; Garcia-Hipolito, M; Alvarez-Fragoso, O; Falcony, C

2008-01-01

Trivalent samarium (Sm 3+ ) doped hafnium oxide (HfO 2 ) films were deposited using the spray pyrolysis deposition technique. The films were deposited on Corning glass substrates at temperatures ranging from 300 to 550 deg. C using chlorides as raw materials. Films, mostly amorphous, were obtained when deposition temperatures were below 350 deg. C. However, for temperatures higher than 400 deg. C, the films became polycrystalline, presenting the HfO 2 monoclinic phase. Scanning electron microscopy of the films revealed a rough surface morphology with spherical particles. Also, electron energy dispersive analysis was performed on these films. The photoluminescence and cathodoluminescence characteristics of the HfO 2 : SmCl 3 films, measured at room temperature, exhibited four main bands centred at 570, 610, 652 and 716 nm, which are due to the well-known intra-4f transitions of the Sm 3+ ion. It was found that the overall emission intensity rose as the deposition temperature was increased. Furthermore, a concentration quenching of the luminescence intensity was also observed

The theoretical basis and clinical methodology for stereotactic interstitial brain tumor irradiation using iododeoxyuridine as a radiation sensitizer and samarium-145 as a brachytherapy source

International Nuclear Information System (INIS)

Goodman, J.H.; Gahbauer, R.A.; Kanellitsas, C.; Clendenon, N.R.; Laster, B.H.; Fairchild, R.G.

1989-01-01

High grade astrocytomas have proven resistant to all conventional therapy. A technique to produce radiation enhancement during interstitial brain tumor irradiation by using a radiation sensitizer (IdUrd) and by stimulation of Auger electron cascades through absorption of low energy photons in iodine (Photon activation) is described. Clinical studies using IdUrd, 192 Ir as a brachytherapy source, and external radiation have produced promising results. Substituting samarium-145 for 192 Ir in this protocol is expected to produce enhanced results. 15 refs

Enhancement of the fluorescence of the samarium (III) complex by gadolinium (III)

International Nuclear Information System (INIS)

Yun-Xiang, C.; Zhang-Hua, L.

1988-01-01

The increase in sensitivity and selectivity of reactions in which colored species are formed by the addition of different metal ions is an area of research that has recently been developed. This phenomenon, which is sometimes called cocolaration effect, has been explained by the formation of mixed metal complex. The authors found an analogous phenomenon of reactions forming fluorescent complexes. The complexes of Sm(III)-thenoyltrifluoroacetone (TTA)-phenanthroline (Phen)-Triton-X-100 (TX-100) and Gd(III) (or La(III), Lu(III) and Y(III))-TTA-Phen-TX-100 had practically no fluorescence separately. Instead, a fluorescence-enhancement phenomenon caused by adding Gd or La, Lu and Y ions to the system was observed for the first time. The intensity of the enhanced fluorescence of Sm(III) complex was increased in the following order: La< Y< Lu< Gd. By analogy with cocoloration effect, the authors call this new fluorescence-enhancement phenomenon the co-fluorescence effect. The object of this work was to study the enhancement effect of Gd(III) on the fluorescence of the Sm(III)-TTA-Phen-TX-100 system. The recommended fluorimetric method has been applied to the determination of trace amounts of samarium in ytterbium oxide with satisfactory results. A general reaction mechanism for the system studied was proposed

42 CFR 480.138 - Disclosure for other specified purposes.

Science.gov (United States)

2010-10-01

...) General requirements for disclosure. Except as specified in paragraph (b) of this section, the following... information is necessary to protect against a substantial risk to the public health. (3) Disclosure to the... 42 Public Health 4 2010-10-01 2010-10-01 false Disclosure for other specified purposes. 480.138...

Radioiodine therapy in management of thyroid carcinoma - A review of 138 patients

International Nuclear Information System (INIS)

Hossain, A.S.; Hossain, S.; Hafiz, N.; Taslima, D.A.; Rashid, H.

2001-01-01

Differentiated thyroid carcinomas are being treated by using a widely accepted protocol of surgery and radioiodine therapy followed by supplementation of thyroid hormones in the Nuclear Medicine Centre (NMC), Dhaka Medical College Hospital (DMCH) since 1990. In the present study 138 patients(Male-54, Female-84) with differentiated thyroid cancers received radioiodine therapy for ablation of residual thyroid tissue with a dose of 2.77-3.7 GBq (75-100 mCi), for lymph node metastases 5.55-6.5 GBq(150-175mCi), for lung metastases 5.55 GBq(150 mCi) and for bony metastases 7.4 GBq (200 mCi). Among 138 patients papillary carcinoma was observed in 94 cases (68%; Male-42, Female-52), follicular type was found in 30 cases (22%; Male-8, Female-22) and mixed type in 14 patients (10%, Male-4, Female-10). Single dose of 2.77-3.7 GBq(75-100 mCi) of radioiodine was received by all 138 patients. Among the unablated patients 62 received double doses totalling 9.25 GBq (250 mCi), 44 received three doses 12.95 GBq (350 mCi) and one patient received 8 doses 33.3 GBq (900 mCi). Out of 138 patients single dose ablated 76 cases and 62 remain unablated. Multiple doses ablated 28 patients and 34 still remain unablated and is under follow up. The success and failure in management of patients with differentiated thyroid cancer over 8 years period have been discussed here revealing a satisfactory outcome. (author)

Semaphorin 4C Protects against Allergic Inflammation: Requirement of Regulatory CD138+ Plasma Cells.

Science.gov (United States)

Xue, Di; Kaufman, Gabriel N; Dembele, Marieme; Beland, Marianne; Massoud, Amir H; Mindt, Barbara C; Fiter, Ryan; Fixman, Elizabeth D; Martin, James G; Friedel, Roland H; Divangahi, Maziar; Fritz, Jörg H; Mazer, Bruce D

2017-01-01

The regulatory properties of B cells have been studied in autoimmune diseases; however, their role in allergic diseases is poorly understood. We demonstrate that Semaphorin 4C (Sema4C), an axonal guidance molecule, plays a crucial role in B cell regulatory function. Mice deficient in Sema4C exhibited increased airway inflammation after allergen exposure, with massive eosinophilic lung infiltrates and increased Th2 cytokines. This phenotype was reproduced by mixed bone marrow chimeric mice with Sema4C deficient only in B cells, indicating that B lymphocytes were the key cells affected by the absence of Sema4C expression in allergic inflammation. We determined that Sema4C-deficient CD19 + CD138 + cells exhibited decreased IL-10 and increased IL-4 expression in vivo and in vitro. Adoptive transfer of Sema4c -/- CD19 + CD138 + cells induced marked pulmonary inflammation, eosinophilia, and increased bronchoalveolar lavage fluid IL-4 and IL-5, whereas adoptive transfer of wild-type CD19 + CD138 + IL-10 + cells dramatically decreased allergic airway inflammation in wild-type and Sema4c -/- mice. This study identifies a novel pathway by which Th2-mediated immune responses are regulated. It highlights the importance of plasma cells as regulatory cells in allergic inflammation and suggests that CD138 + B cells contribute to cytokine balance and are important for maintenance of immune homeostasis in allergic airways disease. Furthermore, we demonstrate that Sema4C is critical for optimal regulatory cytokine production in CD138 + B cells. Copyright © 2016 by The American Association of Immunologists, Inc.

Assessment of bone marrow plasma cell infiltrates in multiple myeloma: the added value of CD138 immunohistochemistry

Science.gov (United States)

Al-Quran, Samer Z.; Yang, Lijun; Magill, James M.; Braylan, Raul C.; Douglas-Nikitin, Vonda K.

2012-01-01

Summary Assessment of bone marrow involvement by malignant plasma cells is an important element in the diagnosis and follow-up of patients with multiple myeloma and other plasma cell dyscrasias. Microscope-based differential counts of bone marrow aspirates are used as the primary method to evaluate bone marrow plasma cell percentages. However, multiple myeloma is often a focal process, a fact that impacts the accuracy and reliability of the results of bone marrow plasma cell percentages obtained by differential counts of bone marrow aspirate smears. Moreover, the interobserver and intraobserver reproducibility of counting bone marrow plasma cells microscopically has not been adequately tested. CD138 allows excellent assessment of plasma cell numbers and distribution in bone marrow biopsies. We compared estimates of plasma cell percentages in bone marrow aspirates and in hematoxylin-eosin– and CD138-stained bone marrow biopsy sections (CD138 sections) in 79 bone marrows from patients with multiple myeloma. There was a notable discrepancy in bone marrow plasma cell percentages using the different methods of observation. In particular, there was a relatively poor concordance of plasma cell percentage estimation between aspirate smears and CD138 sections. Estimates of plasma cell percentage using CD138 sections demonstrated the highest interobserver concordance. This observation was supported by computer-assisted image analysis. In addition, CD138 expression highlighted patterns of plasma cell infiltration indicative of neoplasia even in the absence of plasmacytosis. We conclude that examination of CD138 sections should be considered for routine use in the estimation of plasma cell load in the bone marrow. PMID:17714757

Porta-enxertos para o cultivar Máximo IAC 138-22 de uvas de vinho em Monte Alegre do Sul, SP Rootstocks for wine grape cultivar IAC 138-22

OpenAIRE

Maurilo Monteiro Terra; Erasmo José Paioli Pires; Sônia Maria Bonilha Marcondes Coelho; Ilene Ribeiro da Silva Passos; Rui Ribeiro dos Santos; Celso Valdevino Pommer; André Camargo Pereira da Silva; Ivan José Antunes Ribeiro

1990-01-01

Em Monte Alegre do Sul, SP, efetuou-se um experimento de longa duração para observar o comportamento do cultivar IAC 138-22 (Máximo) de uvas para vinho, sobre cinco porta-enxertos: RR 101-14, 'Golia', "Ripária do Traviú', IAC 572 e IAC 313. Em oito colheitas sucessivas anuais, de 1974 a 1981, analisaram-se as produções médias de uvas por planta. Os resultados indicaram que o IAC 572' foi o melhor porta-enxerto para o IAC 138-22 'Máximo'. O IAC 313 superou o IAC 572 em um dos anos estudados. T...

Effects of Mo Content on Microstructure and Mechanical Property of PH13-8Mo Martensitic Precipitation-Hardened Stainless Steel

Science.gov (United States)

Yubing, Pei; Tianjian, Wang; Zhenhuan, Gao; Hua, Fan; Gongxian, Yang

This paper introduces the effects of Mo content on microstructure and mechanical property of PH13-8Mo martensitic precipitation-hardened stainless steel which is used for LP last stage blade in steam turbine. Thermodynamic software Thermo-Calc has been used to calculate precipitation temperature and the mass fraction of precipitated phases in PH13-8Mo steel with different Mo content. The result shows that when the mass of Mo is below 0.6wt.%, chi-phase mu-phase and sigma-phase could disappear. The microstructure and mechanical property of high Mo PH13-8Mo (Mo=0.57wt.%) and low Mo PH13-8Mo (Mo=2.15wt.%)have been investigated in different heat treatments. The investigations reveal that austenitizing temperature decrease with the reduce of Mo content, so the optimum solution temperature for low Mo PH13-8Mo is lower than that for high Mo PH13-8Mo.The influence of solution temperature on grain size is weakened with the increase of Mo content, Mo rich carbides could retard coarsening of grain. An enormous amount of nano-size uniformly distributed β-NiAl particles are found in both kinds of steels using transmission electron microscopy, they are the most important strengthening phase in PH13-8Mo.

Results after therapy of pain from bone metastases with Samarium-153 in our centers in Lima, Peru

International Nuclear Information System (INIS)

Alvarado, N.; Eskenazi, S.; Valle, M.P.; Montoya, J.; Castro, M.; Montiel, L.; Velarde, V.; Jauregui, I.; Cueto, C.

2004-01-01

Full text: 105 patients with bone metastases from prostate and breast cancer; between 42 and 78 years age (median 61 years) were evaluated. Patients had intense pain that could not be managed with combinations of analgesic and anti tumoral drugs. All patients received 1.2 mCi/kg of Samarium-153 intravenously as treatment for pain due to bony metastases. The isotope obtained from atomic reactor placed in Lima - Peru, was provided by Peruvian Nuclear Energy Institute (IPEN). One week before therapy, all the patients had a bone scan study with Tc99m-MDP that showed the presence of multiple bone metastases with high blastic activity. Haematology and biochemical parameter checked were: Creatinine ( 150,000 mm3), Leukocytes (> 5,000 mm3), Red cells (>3,500,000 mm3). No problems were encountered during intravenous administration of the radioisotope. The side effects after treatment were: Primary effects: 16 cases of nausea, 2 of vomiting, 3 of headache, 28 had increment of pain, 6 had flushing. 50 patients did not have the primary symptoms. Secondary effects: 3 Patients showed drop in leukocyte count between 2nd and 3rd week of therapy. Red cells showed 10-15% decrease between 6th to 8th week. Platelets showed a decrease of about 15% with one peak between 1st and 2nd week post Samarium therapy. Data was analysed using an analogue visual scale of the pain with values from 0 - 10 (0-no pain; 10-maximum pain) and in the same way using the E.C.O.G. scale (Eastern Cooperative Oncology Group) in relationship with the Karnofsky index in order to establish functional recovery for each patient. The decrease of pain was seen between 4th-7th days (average 8 days). A second dose was given after 60 days in 12 patients and a third dose in 3 cases.11 patients died due to different causes between 30 - 60 days post treatment. The analgesic dose came down significantly in 80% of patients. We conclude that palliative therapy of metastatic bone pain in Peru is possible with radionuclides. It

Effect of miR-138 on the antioxidant function of lens epithelial cells affected by age-related cataracts

Directory of Open Access Journals (Sweden)

Bo Lu

2018-03-01

Full Text Available AIM: To investigate the effects and mechanism of miR-138 in mediating the antioxidant function of lens epithelial cells affected by age-related cataracts. METHODS: Real-time quantitative PCR(RT-qPCRwas used to detect miR-138 expression in the anterior lens capsules of healthy people, the anterior lens capsules of patients with age-related cataracts, and human epithelial cell line(SRA01/04cells exposed to oxidative stress. A 2', 7'-dichloro-fluorescein diacetate(DCFH-DAprobe was used to measure the levels of endogenous reactive oxygen species(ROSin human lens epithelial cells(hLECsexposed to 400μmol/L H2O2 for 1h. SRA01/04 cells were transfected with either miR-138 mimics, mimic controls, miR-138 inhibitors or inhibitor controls. After 72h, these cells were exposed to 400μmol/L H2O2 for 1h, then p53 and Bax mRNA expression were measured using RT-qPCR. Expression of p53 and Bax protein were also measured by western blotting analysis. Finally, cell viability was assessed using an MTS assay. RESULTS: Compared to the control group, expression of miR-138 in the anterior lens capsules of age-related cataract patients and in SRA01/04 cells exposed to oxidative stress significantly increased(PPPPCONCLUSION: The expression of miR-138 is upregulated in the anterior lens capsules of age-related cataract patients. MiR-138 decreases the anti-oxidative stress capacity of lens epithelial cells by upregulating p53 and Bax, while inhibiting cell proliferation and repair. This finding suggests that miR-138 may play a key role in the development of age-related cataracts.

MiR-138 promotes smooth muscle cells proliferation and migration in db/db mice through down-regulation of SIRT1

Energy Technology Data Exchange (ETDEWEB)

Xu, Juan [Department of Gynecology, Changzhou Maternity and Children Health Hospital, Changzhou, Jiangsu 213003 (China); Li, Li; Yun, Hui-fang [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China); Han, Ye-shan, E-mail: yeshanhan123@163.com [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China)

2015-08-07

Background: Diabetic vascular smooth muscle cells (VSMCs) exhibit significantly increased rates of proliferation and migration, which was the most common pathological change in atherosclerosis. In addition, the study about the role for miRNAs in the regulation of VSMC proliferation is just beginning to emerge and additional miRNAs involved in VSMC proliferation modulation should be identified. Methods: The expression of miR-138 and SIRT1 were examined in SMCs separated from db/db mice and in SMC lines C-12511 exposed to high glucose with qRT-PCR and western blot. The regulation of miR-138 on the expression of SMCs was detected with luciferase report assay. VSMCs proliferation and migration assays were performed to examine the effect of miR-138 inhibitor on VSMCs proliferation and migration. Results: We discovered that higher mRNA level of miR-138 and reduced expression of SIRT1 were observed in SMCs separated from db/db mice and in SMC lines C-12511. Moreover, luciferase report assay showed that the activity of SIRT1 3′-UTR was highly increased by miR-138 inhibitor and reduced by miR-138 mimic. In addition, we examined that the up-regulation of NF-κB induced by high glucose in SMCs was reversed by resveratrol and miR-138 inhibitor. MTT and migration assays showed that miR-138 inhibitor attenuated the proliferation and migration of smooth muscle cells. Conclusion: In this study, we revealed that miR-138 might promote proliferation and migration of SMC in db/db mice through suppressing the expression of SIRT1. - Highlights: • Higher mRNA level of miR-138 was observed in SMCs from db/db mice. • The mRNA and protein level of SIRT1 in SMCs from db/db mice were greatly reduced. • miR-138 could regulate the expression of SIRT1 in SMCs. • SIRT1 overexpression reversed the up-regulation of acetylized p65 and NF-κB induced by high glucose. • MiR-138 inhibitor reversed VSMCs proliferation and migration induced by high glucose.

On the effects of pressure and irradiation on the transport properties of samarium compounds with unstable valence

International Nuclear Information System (INIS)

Morillo, J.

1983-06-01

We present the first extensive study of electronic transport properties of ''quasi-stoichiometric'' SmS as a function of pressure P, temperature T, magnetic field B and defect concentration C. SmS which is a semiconductor, undergoes with increasing P a first order transition towards an homogeneous intermediate valence state. In the semiconducting phase (s.c.), the energie epsilon(f) necessary to delocalize a 4f electron increases greatly with T and is about 250meV at 300K. The phase diagram for the first order electronic transition Sm 2 + →Smsup(2+epsilon) with P has been determined for T 6 has been investigated by resistivity measurements under irradiation at 21K. The threshold energy Ed for displacement of Sm in SmS has been determined: Ed(Sm) = 20 +- 2 eV, and the observed effects of irradiation have been associated to samarium displacements (vacancies and interstitials) [fr

Effect of Zinc Oxide Doping on Electroluminescence and Electrical Behavior of Metalloporphyrins-Doped Samarium Complex

Science.gov (United States)

Janghouri, Mohammad; Amini, Mostafa M.

2018-02-01

Samarium complex [(Sm(III)] as a new host material was used for preparation of red organic light-emitting diodes (OLEDs). Devices with configurations of indium-doped tin oxide (ITO)/poly(3,4-ethylenedioxythiophene):(poly(styrenesulfonate) (PEDOT:PSS (50 nm)/polyvinyl carbazole (PVK):[zinc oxide (ZnO)] (50 nm)/[(Sm(III)]:[zinc(II) 2,3-tetrakis(dihydroxyphenyl)-porphyrin and Pt(II) 2,3-dimethoxyporphyrin] (60 nm)/2,9-dimethyl-4,7-diphenyl-1,10-phenanthroline (BCP) (15 nm)/Al (150 nm) have been fabricated and investigated. An electroplex occurring at the (PVK/Sm: Pt(II) 2,3-dimethoxyporphyrin) interface has been suggested when ZnO nanoparticles were doped in PVK. OLED studies have revealed that the photophysical characteristics and electrical behavior of devices with ZnO nanoparticles are much better than those of devices with pure PVK. The efficiency of devices based on [(Sm(III)] was superior than that of known aluminum tris(8-hydroxyquinoline) (Alq3) and also our earlier reports on red OLEDs under the same conditions.

14 CFR 91.138 - Temporary flight restrictions in national disaster areas in the State of Hawaii.

Science.gov (United States)

2010-01-01

... disaster areas in the State of Hawaii. 91.138 Section 91.138 Aeronautics and Space FEDERAL AVIATION... areas in the State of Hawaii. (a) When the Administrator has determined, pursuant to a request and justification provided by the Governor of the State of Hawaii, or the Governor's designee, that an inhabited...

Complete genome sequence of a virulent Streptococcus agalactiae strain 138P isolated from diseased Nile tilapia

Science.gov (United States)

Streptococcus agalactiae strain 138P was isolated from the kidney of diseased Nile tilapia in Idaho during a 2007 streptococcal disease outbreak. The full genome of S. agalactiae 138P is 1,838,716 bp. The availability of this genome will allow comparative genomics to identify genes for antigen disco...

Solar Hydrogen Production via a Samarium Oxide-Based Thermochemical Water Splitting Cycle

Directory of Open Access Journals (Sweden)

Rahul Bhosale

2016-04-01

Full Text Available The computational thermodynamic analysis of a samarium oxide-based two-step solar thermochemical water splitting cycle is reported. The analysis is performed using HSC chemistry software and databases. The first (solar-based step drives the thermal reduction of Sm2O3 into Sm and O2. The second (non-solar step corresponds to the production of H2 via a water splitting reaction and the oxidation of Sm to Sm2O3. The equilibrium thermodynamic compositions related to the thermal reduction and water splitting steps are determined. The effect of oxygen partial pressure in the inert flushing gas on the thermal reduction temperature (TH is examined. An analysis based on the second law of thermodynamics is performed to determine the cycle efficiency (ηcycle and solar-to-fuel energy conversion efficiency (ηsolar−to−fuel attainable with and without heat recuperation. The results indicate that ηcycle and ηsolar−to−fuel both increase with decreasing TH, due to the reduction in oxygen partial pressure in the inert flushing gas. Furthermore, the recuperation of heat for the operation of the cycle significantly improves the solar reactor efficiency. For instance, in the case where TH = 2280 K, ηcycle = 24.4% and ηsolar−to−fuel = 29.5% (without heat recuperation, while ηcycle = 31.3% and ηsolar−to−fuel = 37.8% (with 40% heat recuperation.

Biodistribution of samarium-153-EDTMP in rats treated with docetaxel Biodistribuição de EDTMP-153-samário em ratos tratados com docetaxel

Directory of Open Access Journals (Sweden)

Arthur Villarim Neto

2009-02-01

Full Text Available PURPOSE: Many patients with metastatic bone disease have to use radiopharmaceuticals associated with chemotherapy to relieve bone pain. The aim of this study was to assess the influence of docetaxel on the biodistribution of samarium-153-EDTMP in bones and other organs of rats. METHODS: Wistar male rats were randomly allocated into 2 groups of 6 rats each. The DS (docetaxel/samarium group received docetaxel (15 mg/kg intraperitoneally in two cycles 11 days apart. The S (samarium/control group rats were not treated with docetaxel. Nine days after chemotherapy, all the rats were injected with 0.1ml of samarium-153-EDTMP via orbital plexus (25µCi. After 2 hours, the animals were killed and samples of the brain, thyroid, lung, heart, stomach, colon, liver, kidney and both femurs were removed. The percentage radioactivity of each sample (% ATI/g was determined in an automatic gamma-counter (Wizard-1470, Perkin-Elmer, Finland. RESULTS: On the 9th day after the administration of the 2nd chemotherapy cycle, the rats had a significant weight loss (314.50±22.09g compared (pOBJETIVO: Muitos pacientes com metástases ósseas são tratados com radiofármacos associados com quimioterapia para alívio da dor óssea. O objetivo do trabalho foi estudar a influência do docetaxel na biodistribuição do EDTMP-153-samário nos ossos e outros órgãos de ratos. MÉTODOS: Ratos Wistar foram aleatoriamente alocados em 2 grupos de 6 animais cada. O grupo DS (docetaxel/samário recebeu docetaxel (15 mg/kg intraperitoneal em dois ciclos com 11 dias de intervalo. Os ratos do grupo S (samário/controle não foram tratados com docetaxel. Nove dias após a quimioterapia, todos os animais receberam 0,1ml de EDTMP-153-samário via plexo orbital (25µCi. Após 2 horas, os animais foram mortos e feitas biópsias de cérebro, tireóide, pulmão, coração, estômago, cólon, fígado, rim e fêmures. O percentual de radioatividade por grama (%ATI/g de tecido de cada bi

The NK-1 Receptor Antagonist L-732,138 Induces Apoptosis and Counteracts Substance P-Related Mitogenesis in Human Melanoma Cell Lines

Directory of Open Access Journals (Sweden)

Miguel Muñoz

2010-04-01

Full Text Available It has been recently demonstrated that substance P (SP and neurokinin-1 (NK-1 receptor antagonists induce cell proliferation and cell inhibition in human melanoma cells, respectively. However, the antitumor action of the NK-1 receptor antagonist L-732,138 on such cells is unknown. The aim of this study was to demonstrate an antitumor action of L-732,138 against three human melanoma cell lines (COLO 858, MEL HO, COLO 679. We found that L-732,138 elicits cell growth inhibition in a concentration dependent manner in the melanoma cells studied. Moreover, L-732,138 blocks SP mitogen stimulation. The specific antitumor action of L-732,138 occurred through the NK-1 receptor and melanoma cell death was by apoptosis. These findings indicate that the NK-1 receptor antagonist L-732,138 could be a new antitumor agent in the treatment of human melanoma.

The NK-1 Receptor Antagonist L-732,138 Induces Apoptosis and Counteracts Substance P-Related Mitogenesis in Human Melanoma Cell Lines

Energy Technology Data Exchange (ETDEWEB)

Muñoz, Miguel, E-mail: mmunoz@cica.es; Rosso, Marisa; González-Ortega, Ana [Research Laboratory on Neuropeptides, Virgen del Rocío University Hospital, Sevilla (Spain); Coveñas, Rafael [Institute of Neurosciences of Castilla y León (INCYL), Laboratory of Neuroanatomy of the Peptidergic Systems (Laboratory 14), Salamanca (Spain)

2010-04-20

It has been recently demonstrated that substance P (SP) and neurokinin-1 (NK-1) receptor antagonists induce cell proliferation and cell inhibition in human melanoma cells, respectively. However, the antitumor action of the NK-1 receptor antagonist L-732,138 on such cells is unknown. The aim of this study was to demonstrate an antitumor action of L-732,138 against three human melanoma cell lines (COLO 858, MEL HO, COLO 679). We found that L-732,138 elicits cell growth inhibition in a concentration dependent manner in the melanoma cells studied. Moreover, L-732,138 blocks SP mitogen stimulation. The specific antitumor action of L-732,138 occurred through the NK-1 receptor and melanoma cell death was by apoptosis. These findings indicate that the NK-1 receptor antagonist L-732,138 could be a new antitumor agent in the treatment of human melanoma.

Down-regulation of human cytomegalovirus UL138, a novel latency ...

Indian Academy of Sciences (India)

2013-07-12

Jul 12, 2013 ... observed a 74.6% decrease in luciferase activity and a 46.2% decrease in HCMV UL138 protein expression. Our .... Trizol agent (Takara, Dalian, China), according to the man- ... hybrid primer and polyA structure were found in the se- quence. ..... resolution profiling and analysis of viral and host small RNAs.

Development and evaluation of copper-67 and samarium-153 labeled conjugates for tumor radioimmunotherapy

International Nuclear Information System (INIS)

Srivastava, S.C.; Mausner, L.F.; Mease, R.C.; Meinken, G.E.; Joshi, V.; Kolsky, K.; Sweet, M.; Steplewski, Z.

1995-01-01

The potential of utilizing receptor-specific agents such as monoclonal antibodies (MAb), and MAb-derived smaller molecules, as carriers of radionuclides for the selective destruction of tumors has stimulated much research activity. The success of such applications depends on many factors, especially the tumor binding properties of the antibody reagent, the efficiency of labeling and in-vivo stability of the radioconjugate and, on the careful choice of the radionuclide best suited to treat the tumor under consideration. The radiolabeled antibody technique for radioimmunotherapy (RIT), however, has experienced many limitations, and its success has not matched the expectations that were raised more than a decade ago. The problems that have been identified include: (i) degradation of antibody immunoreactivity resulting from chemical manipulations required for labeling; (ii) lack of suitable radioisotopes and methods for stable attachment of the radiolabel; (iii) in-vivo instability of the radioimmunoconjugates; (iv) excessive accumulation of activity in non-target locations; and (v) lack of radioimmunoconjugate accessibility to cells internal to a tumor mass. A careful choice of the radionuclide(s) best suited to treat the tumor under consideration is one of the most important requirements for successful radioimmunotherapy. This study evaluates copper 67 and samarium 153 for tumor radioimmunotherapy

Extracellular proteases from Streptomyces phaeopurpureus ExPro138 inhibit spore adhesion, germination and appressorium formation in Colletotrichum coccodes.

Science.gov (United States)

Palaniyandi, S A; Yang, S H; Suh, J-W

2013-07-01

To study the antifungal mechanism of proteases from Streptomyces phaeopurpureus strain ExPro138 towards Colletotrichum coccodes and to evaluate its utilization as biofungicide. We screened proteolytic Streptomyces strains from the yam rhizosphere with antifungal activity. Forty proteolytic Streptomyces were isolated, among which eleven isolates showed gelatinolytic activity and antagonistic activity on C. coccodes. Of the 11 isolates, protease preparation from an isolate designated ExPro138 showed antifungal activity. 16S rDNA sequence analysis of the strain showed 99% similarity with Streptomyces phaeopurepureus (EU841588.1). Zymography analysis of the ExPro138 culture filtrate revealed that the strain produced several extracellular proteases. The protease preparation inhibited spore germination, spore adhesion to polystyrene surface and appressorium formation. Microscopic study of the interaction between ExPro138 and C. coccodes revealed that ExPro138 was mycoparasitic on C. coccodes. The protease preparation also reduced anthracnose incidence on tomato fruits compared with untreated control. This study demonstrates possibility of utilizing antifungal proteases derived from antagonistic microbes as biofungicide. Microbial proteases having the ability to inhibit spore adhesion and appressorium formation could be used to suppress infection establishment by foliar fungal pathogens at the initial stages of the infection process. Journal of Applied Microbiology © 2013 The Society for Applied Microbiology.

25 CFR 170.138 - Can roads be built in roadless and wild areas?

Science.gov (United States)

2010-04-01

... RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and Trails § 170.138 Can roads be built in roadless and wild areas? Under 25 CFR part 265 no roads can be...

Study of samarium modified lead zirconate titanate and nickel zinc ferrite composite system

Energy Technology Data Exchange (ETDEWEB)

Rani, Rekha [Department of Physics, SD PG College, Panipat 132103 (India); School of Physics and Materials Science, Thapar University, Patiala 147004 (India); Juneja, J.K., E-mail: jk_juneja@yahoo.com [Department of Physics, Hindu College, Sonepat 131001 (India); Singh, Sangeeta [Department of Physics, GVM Girls College, Sonepat 131001 (India); Raina, K.K. [School of Physics and Materials Science, Thapar University, Patiala 147004 (India); Prakash, Chandra [Solid State Physics Laboratory, Timarpur, Delhi 110054 (India)

2015-03-15

In the present work, composites of samarium substituted lead zirconate titanate and nickel zinc ferrite with compositional formula 0.95Pb{sub 1−3x/2} Sm{sub x}Zr{sub 0.65}Ti{sub 0.35}O{sub 3}–0.05Ni{sub 0.8}Zn{sub 0.2}Fe{sub 2}O{sub 4} (x=0, 0.01, 0.02 and 0.03) were prepared by the conventional solid state route. X-ray diffraction analysis was carried out to confirm the coexistence of individual phases. Microstructural study was done by using scanning electron microscope. Dielectric constant and loss were studied as a function of temperature and frequency. To study ferroelectric and magnetic properties of the composite samples, corresponding P–E and M–H hysteresis loops were recorded. Change in magnetic properties of electrically poled composite sample (x=0.02) was studied to confirm the magnetoelectric (ME) coupling. ME coefficient (dE/dH) of the samples (x=0 and 0.02) was measured as a function of DC magnetic field. - Highlights: • We are reporting the effect of Sm substitution on PZT–NiZn ferrite composites. • Observation of both P–E and M–H loops confirms ferroelectric and magnetic ordering. • With Sm substitution, significant improvement in properties was observed. • Increase in magnetization for electrically poled sample is evidence of ME coupling. • Electric polarization is generated by applying magnetic field.

Retention capacity of samarium (III) in zircon for it possible use in retaining walls for confinement of nuclear residues; Capacidad de retencion de samario (III) en circon para su posible uso en barreras de contencion para confinamiento de residuos nucleares

Energy Technology Data Exchange (ETDEWEB)

Garcia G, N

2006-07-01

Mexico, as country that produces part of its electric power by nuclear means, should put special emphasis in the development of technologies guided to the sure and long term confinement of the high level nuclear residuals. This work studies the capacity that has the natural zircon to retain to the samarium (III) in solution, by what due, firstly, to characterize the zircon for technical instrumental to determine the purity and characteristic of the mineral in study. The instrumental techniques that were used to carry out the physicochemical characterization were the neutron activation analysis (NAA), the infrared spectroscopy (IS), the thermal gravimetric analysis (TGA), scanning electron microscopy (SEM), transmission electron microscopy (TEM), semiquantitative analysis, dispersive energy spectroscopy (EDS), X-ray diffraction (XRD) and luminescence technique. The characterization of the surface properties carries out by means of the determination of the surface area using the BET multipoint technique, acidity constants, hydration time, the determination of the point of null charge (pH{sub PCN}) and density of surface sites (D{sub s}). The luminescence techniques were useful to determine the optimal point hydration of the zircon and for the quantification of the samarium, for that here intends the development of both analysis techniques. With the adjustment of the titration curves in the FITEQL 4 package the constants of surface acidity in the solid/liquid interface were determined. To the finish of this study it was corroborated that the zircon is a mineral that presents appropriate characteristics to be proposed as a contention barrier for the deep geologic confinement. With regard to the study of adsorption that one carries out the samarium retention it is superior to 90% under the described conditions. This investigation could also be applicable in the confinement of dangerous industrial residuals. (Author)

Ferrites Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} doped with samarium: structural analysis, morphological and electromagnetic; Ferritas Ni{sub 0,5}Zn{sub 0,5}Fe{sub 2}O{sub 4} dopada com samario: analise estrutural, morfologica e eletromagnetica

Energy Technology Data Exchange (ETDEWEB)

Costa, A.C.F.M.; Diniz, A.P., E-mail: anacristina@dema.ufcg.edu.br [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Unidade Academinca de Engenharia de Materiais; Viana, K.M.S. [Universidade Federal do Rio Grande do Norte (UFRN), Natal, PE (Brazil). Escola de Ciencias e Tecnologia; Cornejo, D.R. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Fisica; Kiminami, R.H.G.A. [Universidade Federal de Sao Carlos (UFSCar), SP (Brazil). Departamento de Engenharia de Materiais

2010-07-01

This paper proposes to investigate the sintering at 1200 deg C/2h of Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2-x}Sm{sub x}O{sub 4} ferrite doped with 0.05; 0.075 e 0.1 mol of Sm synthesized by combustion reaction to evaluate the performance materials as absorbers of electromagnetic radiation. The influence of the concentration of samarium on the structure, morphology and electromagnetic properties of ferrites was studied. The resulting samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), magnetic measurements and reflectivity measurements in the frequency range between 8-12 GHz. The results showed that increasing the concentration of samarium caused a decrease in particle size of the samples, encouraging, therefore, to obtain materials with better values of magnetization and reflectivity, allowing for use as absorbers in narrow-band frequency between 9-10 GHz. (author)

Cysteine 138 mutation in HIV-1 Nef from patients with delayed disease progression

DEFF Research Database (Denmark)

Tolstrup, Martin; Laursen, Alex Lund; Gerstoft, J.

2006-01-01

.0139). The phylogeny of isolates was investigated and the variants harbouring the cysteine 138 mutation clustered independently. CONCLUSION: The present study describes a viral genetic polymorphism related to AIDS disease progression. The polymorphism (cysteine 138) has previously been reported to confer decreased......-1 isolates from patients in a long-term non-progressor (LTNP) cohort and a slow-progressor (SP) cohort (n = 11) was analysed and compared with isolates from a control patient group of progressors (n = 18). Most of the patients with delayed disease progression had extensive medical records, providing...... an insight into the LTNP disease profile and allowing for the stratification of patients based on their CD4 cell decline. RESULTS: In sequences from nine patients, most of the functional domains of HIV-1 Nef appeared intact, and no major deletions were observed to possibly account for an effect...

Características de las fallas en alimentadores de 13,8 kV del sistema soterrado de La Habana;Characteristic of 13,8 kV feeders faults of the Havana underground system

Directory of Open Access Journals (Sweden)

Boris Alba - Valle

2011-06-01

Full Text Available El sistema soterrado de La Habana enfrenta problemas de continuas fallas en sus alimentadores de 13,8 kV. En este trabajo se determinan las características de estas averías, en el período comprendido entre los años 2007 y 2009, y se proponen algunas medidas objetivas con el fin de contribuir a su disminución. La investigación se basó fundamentalmente en el estudio de la base de datos de los alimentadores de 13,8 kV proporcionada por el departamento técnico de la Unidad Empresarial Básica (UEB Soterrada y en el uso de herramientas estadísticas digitales. Como resultado se pudo constatar que las fallas son más frecuentes en los alimentadores de la subestación de Tallapiedra producto de la humedad en cables y empalmes con aislamiento de PILC (papel impregnado en aceite y con cubierta de plomo, dispuestos por tierra muerta. Finalmente, las medidas propuestas tuvieron un impacto positivo en la disminución de estas fallas, en un período inferior a un año.The Havana underground system has problems of continuous faults in their 13,8 kV feeders. In this article the characteristics of these mishaps in the period of 2007 to 2009 are determined and purpose some objective measurements with the end of contributing to their decrease. The investigation was fundamentally based on the study of the 13,8 kV feeders database proportioned by the technical department of the Underground Basic Managerial Unit (UEB and the use of digital statistical tools. As a result, it was verified that the faults occur with more frequency in the Tallapiedra substation feeders, due to the humidity in cables and connections with PILC isolation (impregnated in oil and lead covered paper, prepared for undergrounding directly in the earth. Finally, the proposed measures had a positive impact in the decrease of these faults, in a period less than to a year.

Effects of increasing doses of samarium-153-ethylenediaminetetramethylene phosphonate on axial and appendicular skeletal growth in juvenile rabbits

International Nuclear Information System (INIS)

Essman, Stephanie C.; Lewis, Michael R.; Fox, Derek B.

2008-01-01

Introduction: Targeted radiotherapy using samarium-153-ethylenediaminetetramethylene phosphonate ( 153 Sm-EDTMP) is currently under investigation for treatment of osteosarcoma. Osteosarcoma often occurs in children, and previous studies on a juvenile rabbit model demonstrated that clinically significant damage to developing physeal cartilage may occur as a result of systemic 153 Sm-EDTMP therapy. The aim of this study was to evaluate the late effects of 153 Sm-EDTMP on skeletal structures during growth to maturity and to determine if there is a dose response of 153 Sm-EDTMP on growth of long bones. Methods: Female 8-week-old New Zealand white rabbits were divided into three treatment groups plus controls. Each rabbit was intravenously administered a predetermined dose of 153 Sm-EDTMP. Multiple bones of each rabbit were radiographed every 2 months until physeal closure, with subsequent measurements made to assess for abbreviated bone growth. Statistical analyses were performed to determine the differences in bone length between groups, with significance set at P 153 Sm-EDTMP. Further investigation regarding the effects of bone-seeking radiopharmaceuticals on bone growth and physeal cartilage is warranted

Ubiquitin Ligase RNF138 Promotes Episodic Ataxia Type 2-Associated Aberrant Degradation of Human Cav2.1 (P/Q-Type) Calcium Channels.

Science.gov (United States)

Fu, Ssu-Ju; Jeng, Chung-Jiuan; Ma, Chia-Hao; Peng, Yi-Jheng; Lee, Chi-Ming; Fang, Ya-Ching; Lee, Yi-Ching; Tang, Sung-Chun; Hu, Meng-Chun; Tang, Chih-Yung

2017-03-01

Voltage-gated Ca V 2.1 channels comprise a pore-forming α 1A subunit with auxiliary α 2 δ and β subunits. Ca V 2.1 channels play an essential role in regulating synaptic signaling. Mutations in the human gene encoding the Ca V 2.1 subunit are associated with the cerebellar disease episodic ataxia type 2 (EA2). Several EA2-causing mutants exhibit impaired protein stability and exert dominant-negative suppression of Ca V 2.1 wild-type (WT) protein expression via aberrant proteasomal degradation. Here, we set out to delineate the protein degradation mechanism of human Ca V 2.1 subunit by identifying RNF138, an E3 ubiquitin ligase, as a novel Ca V 2.1-binding partner. In neurons, RNF138 and Ca V 2.1 coexist in the same protein complex and display notable subcellular colocalization at presynaptic and postsynaptic regions. Overexpression of RNF138 promotes polyubiquitination and accelerates protein turnover of Ca V 2.1. Disrupting endogenous RNF138 function with a mutant (RNF138-H36E) or shRNA infection significantly upregulates the Ca V 2.1 protein level and enhances Ca V 2.1 protein stability. Disrupting endogenous RNF138 function also effectively rescues the defective protein expression of EA2 mutants, as well as fully reversing EA2 mutant-induced excessive proteasomal degradation of Ca V 2.1 WT subunits. RNF138-H36E coexpression only partially restores the dominant-negative effect of EA2 mutants on Ca V 2.1 WT functional expression, which can be attributed to defective membrane trafficking of Ca V 2.1 WT in the presence of EA2 mutants. We propose that RNF138 plays a critical role in the homeostatic regulation of Ca V 2.1 protein level and functional expression and that RNF138 serves as the primary E3 ubiquitin ligase promoting EA2-associated aberrant degradation of human Ca V 2.1 subunits. SIGNIFICANCE STATEMENT Loss-of-function mutations in the human Ca V 2.1 subunit are linked to episodic ataxia type 2 (EA2), a dominantly inherited disease characterized by

Long non-coding RNA TUG1 promotes cervical cancer progression by regulating the miR-138-5p-SIRT1 axis.

Science.gov (United States)

Zhu, Jie; Shi, Huirong; Liu, Huina; Wang, Xiaojuan; Li, Fengmei

2017-09-12

Increasing evidences showed that long non-coding RNAs (lncRNAs) play vital roles in tumor progression. Recent studies indicated that lncRNA TUG1 was upregulated and promoted tumor processes in several cancers. However, the expression and underlying mechanism of TUG1 in cervical cancer remain unclear. In the present study, we found that TUG1 expression was upregulated in cervical cancer tissues and correlated with advanced clinical features and poor overall survival. TUG1 knockdown suppressed cervical cancer cell growth and metastasis in vitro and tumor growth in vivo . In addition, our results indicated that TUG1 could act as an endogenous sponge by directly binding to miR-138-5p and suppressed miR-138-5p expression. Furthermore, we found that TUG1 could reverse the inhibitory effect of miR-138-5p on cervical cancer cells processes, which might be involved in the activation of SIRT1, a target gene of miR-138-5p, and activation of Wnt/β-catenin signaling pathway. Taken together, we elucidated that TUG1 might promote cervical cancer malignant progression via miR-138-5p-SIRT1-Wnt/β-catenin signaling pathway axis.

42 CFR 137.138 - Once the Indian Tribe's final offer has been accepted or deemed accepted by operation of law...

Science.gov (United States)

2010-10-01

... accepted or deemed accepted by operation of law, what is the next step? 137.138 Section 137.138 Public... final offer has been accepted or deemed accepted by operation of law, what is the next step? After the... the acceptance or the deemed acceptance. Rejection of Final Offers ...

Analysis on metallogenetic geological and physicochemical conditions in uranium deposit No.138

International Nuclear Information System (INIS)

Tang Qitao

1996-01-01

The uranium deposit No.138 is of Mesozoic volcano-sedimentary transformation type. This paper discusses such geological conditions as source of uranium, stratigraphy and lithology, lithofacies and paleogeography, paleoclimate, structure and reworking-regeneration, and such physicochemical conditions as uranium adsorbent and reductant, effective porosity, chemical compositions, pH and Eh of rocks in the deposit

25 CFR 224.138 - What must the Director do if a tribe's noncompliance has caused imminent jeopardy to a physical...

Science.gov (United States)

2010-04-01

... noncompliance with the TERA or a Federal law has caused imminent jeopardy to a physical trust asset. ... caused imminent jeopardy to a physical trust asset? 224.138 Section 224.138 Indians BUREAU OF INDIAN... the Director do if a tribe's noncompliance has caused imminent jeopardy to a physical trust asset? If...

Observation of near infrared and enhanced visible emissions from electroluminescent devices with organo samarium(III) complex

Energy Technology Data Exchange (ETDEWEB)

Chu, B [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Li, W L [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Hong, Z R [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Zang, F X [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Wei, H Z [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Wang, D Y [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Li, M T [Key Laboratory of the Excited States Process, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, 16-Dong NanHu Road, Economic Development Area, Changchun, 130033 (China); Lee, C S [Department of Physics and Materials Science, City University of Hong Kong, Hong Kong (China); Lee, S T [Department of Physics and Materials Science, City University of Hong Kong, Hong Kong (China)

2006-11-07

Samarium (dibenzoylmethanato){sub 3} bathophenanthroline (Sm(DBM){sub 3} bath) was employed as an emitting and electron transport layer in organic light emitting diodes (OLEDs), and narrow electroluminescent (EL) emissions of a Sm{sup 3+} ion were observed in the visible and near infrared (NIR) region, differing from those of the same devices with Eu{sup 3+}- or Tb{sup 3+}-complex EL devices with the same structure. The EL emissions of the Sm{sup 3+}-devices originate from transitions from {sup 4}G{sub 5/2} to the lower respective levels of Sm{sup 3+} ions. A maximum luminance of 490 cd m{sup -2} at 15 V and an EL efficiency of 0.6% at 0.17 mA cm{sup -2} were obtained in the visible region, and the improved efficiency should be attributed to introducing a transitional layer between the N,N'-diphenyl-N,N'-bis(3-methylphenyl)-1,1'-diphenyl-4,4'-diamine (TPD) film and the Sm(DBM){sub 3} bath film and the avoidance of interfacial exciplex emission in devices. Sharp emissions of Sm{sup 3+} ions in the NIR region were also observed under a lower threshold value less than 4.5 V.

Synthesis and characterization of samarium-doped ZnS nanoparticles: A novel visible light responsive photocatalyst

Energy Technology Data Exchange (ETDEWEB)

Hanifehpour, Younes, E-mail: y_hanifehpour@yu.ac.kr [School of Mechanical Engineering, Yeungnam University, Gyeongsan 712-749 (Korea, Republic of); Soltani, Behzad; Amani-Ghadim, Ali Reza; Hedayati, Behnam [Department of Chemistry, Faculty of Basic Sciences, Azarbaijan Shahid Madani University, Tabriz (Iran, Islamic Republic of); Khomami, Bamin [Department of Chemical and Biomolecular Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Joo, Sang Woo, E-mail: swjoo1@gmail.com [School of Mechanical Engineering, Yeungnam University, Gyeongsan 712-749 (Korea, Republic of)

2016-04-15

Highlights: • Sm-doped ZnS Nanomaterials were synthesized by hydrothermal method. • The as-prepared compounds were characterized by XRD, TEM, XPS, SEM and UV techniques. • The photocatalytic effect of compounds was determined by Reactive Red 43 degradation. • The degradation of RRed 43 followed the Langmuir–Hinshelwood kinetic model. - Abstract: We prepared pure and samarium-doped ZnS (Sm{sub x}Zn{sub 1−x}S{sub 1+0.5x}) nanoparticles via hydrothermal process at 160 °C for 24 h. XRD analysis shows that the particles were well crystallized and corresponds to a cubic sphalerite phase. SEM and TEM images indicate that the sizes of the particles were in the range of 20–60 nm. The photocatalytic activity of Sm-doped ZnS nanoparticles was evaluated by monitoring the decolorization of Reactive Red 43 in aqueous solution under visible light irradiation. The color removal efficiency of Sm{sub 0.04}Zn{sub 0.96}S and pure ZnS was 95.1% and 28.7% after 120 min of treatment, respectively. Among the different amounts of dopant agent used, 4% Sm-doped ZnS nanoparticles indicated the highest decolorization. We found that the presence of inorganic ions such as Cl{sup −}, CO{sub 3}{sup 2−} and other radical scavengers such as buthanol and isopropyl alcohol reduced the decolorization efficiency.

Study for the determination of samarium, europium,terbium, dysprosium and yttrium in gadolinium oxide matrix by means of atomic absorption spectrophotometry using a graphite furnace

International Nuclear Information System (INIS)

Caires, A.C.F.

1985-01-01

A study for determination of samarium, europium, terbium, dysprosium and yttrium in a gadolinium oxide matrix by atomic absorption spectrophotometry using a graphite furnace is presented. The best charrring and atomization conditions were estabilished for each element, the most convenient ressonance lines being selected as well. The study was carried out for the mentioned lanthanides both when pure and when in binary mixtures with gadolinium, besides those where all for them were together with gadolinium. The determination limits for pure lanthanides were found to be between 1.3 and 9.6 ng assuming a 20% relative standard deviation as acceptable. The detection limits were in the range 0.51 and 7.5 ng, assuming as positive any answer higher than twofold the standard deviation. (author) [pt

75 FR 54921 - Withdrawal of Regulatory Guides 1.38, 1.94, and 1.116

Science.gov (United States)

2010-09-09

... Guide 1.38, ``Quality Assurance Requirements for Packaging, Shipping, Receiving, Storage, and Handling....116, ``Quality Assurance Requirements for Installation, Inspection, and Testing of Mechanical... Development Branch, Division of Engineering, Office of Nuclear Regulatory Research, U.S. Nuclear Regulatory...

Anchoring samarium oxide nanoparticles on reduced graphene oxide for high-performance supercapacitor

Energy Technology Data Exchange (ETDEWEB)

Dezfuli, Amin Shiralizadeh [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Ganjali, Mohammad Reza, E-mail: ganjali@khayam.ut.ac.ir [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Biosensor Research Center, Endocrinology & Metabolism Molecular-Cellular Sciences Institute, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Naderi, Hamid Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)

2017-04-30

Highlights: • Samarium oxide nanoparticles have been anchored on the surface of reduced graphene oxide for the first time. • Sm{sub 2}O{sub 3}/RGO nanocomposite show high capacitance, good rate and cycling performance. • Sm{sub 2}O{sub 3}/RGO nanocomposite can serve as efficient electrode material for energy storage. • The best composite electrode exhibits specific capacitance of 321 F g{sup −1} in 2 mV s{sup −1}. - Abstract: We have synthesized Sm{sub 2}O{sub 3} nanoparticles (SmNs) and anchored them onto the surface of reduced graphene oxide (RGO) through a self-assembly thereof by utilizing a facile sonochemical procedure. The nanomaterials were characterized by means of powder X-ray diffraction (XRD), Field-emission scanning electron microscopy (FE-SEM), fourier transform infrared spectroscopy (FT-IR) spectra, and X-ray photoelectron spectroscopy (XPS). As the next step, the supercapacitive behavior of the resulting nanocomposites were investigated when used as electrode material, through with cyclic voltammetric (CV), galvanostatic charge-discharge and electrochemical impedance spectroscopy (EIS) techniques. The SmNs decorated RGO (SmN-RGO) nanocomposites were found to possess a specific capacitance (SC) of 321 F g{sup −1} when used in a 0.5 M Na{sub 2}SO{sub 4} solution as an electrolyte, in a scan rate of 2 mV s{sup −1}. The SC of the SmN-RGO based electrodes were also found to be 268 F g{sup −1} at a current density of 2 A g{sup −1} through galvanostatic charge-discharge tests. The outstanding properties of the SmN-RGOs were attributed to synergy of the high charge mobility of SmNs and the flexibility of the sheets of RGOs. Additionally, the nano-composite revealed a unique cycling durability (maintaining 99% of its SC even after 4000 cycles).

Complete genome sequence of an attenuated Sparfloxacin-resistant Streptococcus agalactiae strain 138spar

Science.gov (United States)

The complete genome of a sparfloxacin-resistant Streptococcus agalactiae vaccine strain 138spar is 1,838,126 bp in size. The genome has 1892 coding sequences and 82 RNAs. The annotation of the genome is added by the NCBI Prokaryotic Genome Annotation Pipeline. The publishing of this genome will allo...

The K2-138 System: A Near-resonant Chain of Five Sub-Neptune Planets Discovered by Citizen Scientists

DEFF Research Database (Denmark)

Christiansen, Jessie L.; Crossfield, Ian J. M.; Barentsen, Geert

2018-01-01

K2-138 is a moderately bright (V = 12.2, K = 10.3) main-sequence K star observed in Campaign 12 of the NASA K2 mission. It hosts five small (1.6-3.3 R⊕) transiting planets in a compact architecture. The periods of the five planets are 2.35, 3.56, 5.40, 8.26, and 12.76 days, forming an unbroken...... chain of near 3:2 resonances. Although we do not detect the predicted 2-5 minute transit timing variations (TTVs) with the K2 timing precision, they may be observable by higher-cadence observations with, for example, Spitzer or CHEOPS. The planets are amenable to mass measurement by precision radial...... velocity measurements, and therefore K2-138 could represent a new benchmark system for comparing radial velocity and TTV masses. K2-138 is the first exoplanet discovery by citizen scientists participating in the Exoplanet Explorers project on the Zooniverse platform....

Study of unstable valences of cadmium and samarium by pulse radiolysis. Influence of complexation by some synthetical ionophores

International Nuclear Information System (INIS)

Lerat-Parizot, O.

1992-01-01

Instable valences of cations in solution are evidenced by pulse radiolysis, in spite of a lifetime often lower than a milli-second they participate to electron transfer reactions, owing to their redox potential. In this work are studied Cd + and Sm 2+ obtained respectively by reduction of Cd 2+ and Sm 3+ by a solvated electron. The reactivity of Cd + in a cryptand and in a coronand is studied; it is a powerful reducing agent (redox potential -2V) going back to the stable valence by electron transfer to an acceptor. Transfer kinetics is studied by reduction of organic molecules, effect of solvents and ligands is also examined. For samarium the reduction kinetics by hydrated electrons is increased when the ion is in a cryptand in agreement with electrochemical observations, showing that the valence 2+ is stabilized in respect to the valence 3+ for lanthanides. The difference of behaviour between Cd + and Sm 2+ is probably due to the fact that for Cd the transferred electron comes from the external layer and for Sm it is a f electron protected by the 5s and 5p orbitals

Clinical characteristics of 138 Chinese female patients with idiopathic hypogonadotropic hypogonadism

Directory of Open Access Journals (Sweden)

Rui-yi Tang

2017-11-01

Full Text Available Objective: To evaluate the clinical features of Chinese women with idiopathic hypogonadotropic hypogonadism (IHH. Methods: We retrospectively reviewed the clinical characteristics, laboratory and imaging findings, therapeutic management and fertility outcomes of 138 women with IHH. All patients had been treated and followed up at an academic medical centre during 1990–2016. Results: Among the 138 patients, 82 patients (59.4% were diagnosed with normosmic IHH and 56 patients (40.6% were diagnosed with Kallmann syndrome (KS. The patients with IHH experienced occasional menses (4.3%, spontaneous thelarche (45.7% or spontaneous pubarche (50.7%. Women with thelarche had a higher percentage of pubarche (P < 0.001 and higher gonadotropin concentrations (P < 0.01. Olfactory bulb/sulci abnormalities were found during the magnetic resonance imaging (MRI of all patients with KS. Most patients with IHH had osteopenia and low bone age. Among the 16 women who received gonadotropin-releasing hormone treatment, ovulation induction or assisted reproductive technology, the clinical pregnancy rate was 81.3% and the live birth rate was 68.8%. Conclusions: The present study revealed that the phenotypic spectrum of women with IHH is broader than typical primary amenorrhoea with no secondary sexual development, including occasional menses, spontaneous thelarche or pubarche. MRI of the olfactory system can facilitate the diagnosis of KS. Pregnancy can be achieved after receiving appropriate treatment.

Spin-dependent γ softness or triaxiality in even-even 132-138Nd nuclei

Science.gov (United States)

Chai, Qing-Zhen; Wang, Hua-Lei; Yang, Qiong; Liu, Min-Liang

2015-02-01

The properties of γ instability in rapidly rotating even-even 132-138Nd isotopes have been investigated using the pairing-deformation self-consistent total-Routhian-surface calculations in a deformation space of (β2, γ, β4). It is found that even-even 134-138Nd nuclei exhibit triaxiality in both ground and excited states, even up to high-spin states. The lightest isotope possesses a well-deformed prolate shape without a γ deformation component. The current numerical results are compared with previous calculations and available observables such as quadrupole deformation β2 and the feature of γ-band levels, showing basically a general agreement with the observed trend of γ correlations (e.g. the pattern of the odd-even energy staggering of the γ band). The existing differences between theory and experiment are analyzed and discussed briefly. Supported by National Natural Science Foundation of China (10805040,11175217), Foundation and Advanced Technology Research Program of Henan Province(132300410125) and S & T Research Key Program of Henan Province Education Department (13A140667)

The "11K" gene family members sf68, sf95 and sf138 modulate transmissibility and insecticidal properties of Spodoptera frugiperda multiple nucleopolyhedrovirus.

Science.gov (United States)

Beperet, Inés; Simón, Oihane; Williams, Trevor; López-Ferber, Miguel; Caballero, Primitivo

2015-05-01

The "11K" gene family is notable for having homologs in both baculoviruses and entomopoxviruses and is classified as either type 145 or type 150, according to their similarity with the ac145 or ac150 genes of Autographa californica multiple nucleopolyhedrovirus (AcMNPV). One homolog of ac145 (sf138) and two homologs of ac150 (sf68 and sf95) are present in Spodoptera frugiperda multiple nucleopolyhedrovirus (SfMNPV). Recombinant bacmids lacking sf68, sf95 or sf138 (Sf68null, Sf95null and Sf138null, respectively) and the respective repair bacmids were generated from a bacmid comprising the complete virus genome. Occlusion bodies (OBs) of the Sf138null virus were ∼15-fold less orally infective to insects, which was attributed to a 100-fold reduction in ODV infectious titer. Inoculation of insects with Sf138null OBs in mixtures with an optical brightener failed to restore the pathogenicity of Sf138null OBs to that of the parental virus, indicating that the effects of sf138 deletion on OB pathogenicity were unlikely to involve an interaction with the gut peritrophic matrix. In contrast, deletion of sf68 and sf95 resulted in a slower speed-of-kill by 9h, and a concurrent increase in the yield of OBs. Phylogenetic analysis indicated that sf68 and sf95 were not generated after a duplication event of an ancestral gene homologous to the ac150 gene. We conclude that type 145 genes modulate the primary infection process of the virus, whereas type 150 genes appear to have a role in spreading systemic infection within the insect. Copyright © 2015 Elsevier Inc. All rights reserved.

Samarium-modified vanadium phosphate catalyst for the selective oxidation of n-butane to maleic anhydride

International Nuclear Information System (INIS)

Wu, Hua-Yi; Wang, Hai-Bo; Liu, Xin-Hua; Li, Jian-Hui; Yang, Mei-Hua; Huang, Chuan-Jing; Weng, Wei-Zheng; Wan, Hui-Lin

2015-01-01

Graphical abstract: The addition of a small amount of Sm into VPO catalyst brought about great changes in its physicochemical properties such as surface area, surface morphology, phase composition and redox property, thus leading to a higher catalytic performance in the selective oxidation of n-butane to maleic anhydride, as compared to the undoped VPO catalyst. - Highlights: • The addition of Sm leads to great changes in the structure of VPO catalyst. • Sm improves performance of VPO for oxidation of n-butane to maleic anhydride. • Catalytic performance is closely related to structure of VPO catalyst. - Abstract: A series of samarium-modified vanadium phosphate catalysts were prepared and studied in selective oxidation of n-butane to maleic anhydride. The catalytic evaluation showed that Sm modification significantly increased the overall n-butane conversion and intrinsic activity. N 2 -adsorption, XRD, SEM, Raman, XPS, EPR and H 2 -TPR techniques were used to investigate the intrinsic difference among these catalysts. The results revealed that the addition of Sm to VPO catalyst can increase the surface area of the catalyst, lead to a significant change in catalyst morphology from plate-like structure into rosette-shape clusters, and largely promote the formation of (VO) 2 P 2 O 7 . All of these were related to the different catalytic performance of Sm-doped and undoped VPO catalysts. The roles of the different VOPO 4 phases and the influence of Sm were also described and discussed

Dgroup: DG01196 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available DG01196 Chemical ... DGroup Samarium (153Sm) lexidronam ... D08504 ... Samarium (153Sm) lexidron...am (INN) D05795 ... Samarium Sm 153 lexidronam pentasodium (USAN); Samarium (153Sm) lexidronam sodium (JA

Band structures in near spherical 138Ce

Science.gov (United States)

Bhattacharjee, T.; Chanda, S.; Bhattacharyya, S.; Basu, S. K.; Bhowmik, R. K.; Das, J. J.; Pramanik, U. Datta; Ghugre, S. S.; Madhavan, N.; Mukherjee, A.; Mukherjee, G.; Muralithar, S.; Singh, R. P.

2009-06-01

The high spin states of N=80138Ce have been populated in the fusion evaporation reaction 130Te( 12C, 4n) 138Ce at E=65 MeV. The γ transitions belonging to various band structures were detected and characterized using an array of five Clover Germanium detectors. The level scheme has been established up to a maximum spin and excitation energy of 23 ℏ and 9511.3 keV, respectively, by including 53 new transitions. The negative parity ΔI=1 band, developed on the 6536.3 keV 15 level, has been conjectured to be a magnetic rotation band following a semiclassical analysis and comparing the systematics of similar bands in the neighboring nuclei. The said band is proposed to have a four quasiparticle configuration of [πgh]⊗[. Other band structures are interpreted in terms of multi-quasiparticle configurations, based on Total Routhian Surface (TRS) calculations. For the low and medium spin states, a shell model calculation using a realistic two body interaction has been performed using the code OXBASH.

Study of the interactions of 13.8 GeV/c protons with the heavy nuclei of the emulsions exposed in magnetic fuel of 170 kgauss; Estudio de las interacciones de protones de 13,8 geV/c con los nucleos pesados de emusiones

Energy Technology Data Exchange (ETDEWEB)

Gomez Aleixandre, J L

1967-07-01

145 stars with N{sub h}>8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c {pi}- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs.

An experiment using neutron activation analysis and a rare earth element to mark cotton plants and two insects that feed on them

Energy Technology Data Exchange (ETDEWEB)

Showler, Allan T. [USDA-ARS IFNRRU, Kika de la Garza Subtropical Agricultural Research Center, 2413 East Highway 83, Weslaco, TX 78596 (United States)]. E-mail: ashowler@weslaco.ars.usda.gov; James, William D. [Elemental Analysis Laboratory, 3144 Texas A and M University, College Station, TX 77843-3144 (United States); Armstrong, John S. [USDA-ARS BIRU, Kika de la Garza Subtropical Agricultural Research Center, 2413 East Highway 83, Weslaco, TX 78596 (United States); Westbrook, John K. [USDA-ARS APMRU, 2771 F and B Road, College Station, TX 77845-4966 (United States)

2006-08-15

Studies on insect dispersal and other behaviors can benefit from using markers that will not alter flight and fitness. Rare earth elements, such as samarium (Sm), have been used as ingested markers of some insects and detected using neutron activation analysis (NAA). In this study, samarium nitrate hexahydrate was mixed into artificial diet for boll weevils, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), at different dosages and in water used to irrigate cotton, Gossypium hirsutum L. Samarium was detected in adult boll weevils fed on the samarium-labeled diet, but not after 5 or 10 days of being switched to non-labeled diet, even if the insects were given labeled diet for as long as 7 consecutive days. Introduced in irrigation water, 1% samarium (m/m) was detectable in cotton squares and leaf tissue. However, boll weevil adults fed samarium-labeled squares did not retain detectable levels of samarium, nor did boll weevil adults reared to adulthood from samarium-labeled squares. Fourth instar beet armyworms, Spodoptera exigua (Huebner) (Noctuidae: Lepidoptera), fed on samarium-labeled cotton leaves obtained enough samarium for NAA detection, but adult moths reared from them did not have detectable amounts of samarium. Although samarium can be useful as a marker when insects are presented with a continuous pulse of the label, elements that are assimilated by the insect would be more useful if a continuous infusion of the marker cannot be provided.

28 CFR 0.138 - Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of Alcohol, Tobacco...

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of Alcohol, Tobacco, Firearms, and Explosives, Bureau of Prisons, Federal... Administrative Matters § 0.138 Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of...

TGFβ1-induced down-regulation of microRNA-138 contributes to epithelial-mesenchymal transition in primary lung cancer cells.

Science.gov (United States)

Zhang, Fang; Li, Tiepeng; Han, Lu; Qin, Peng; Wu, Zhao; Xu, Benling; Gao, Quanli; Song, Yongping

2018-02-19

The existence of cancer stem cells within the tumor could lead to cancer therapy resistance. TGFβ1 is considered as one of the most powerful players in the generation of CSCs through induction of epithelial-mesenchymal transition in different types of cancer including lung cancer, however, the detailed mechanisms by which TGFβ1 contribute to EMT induction and CSC maintenance remains unclear. Here, we showed primary lung cancer cells treated by TGFβ1 exhibit mesenchymal features, including morphology and expression of mesenchymal marker in a time-dependent manner. We also observed long-term TGFβ1 exposure leads to an enrichment of a sub-population of CD44 + CD90 + cells which represent CSCs in lung cancer cells. Moreover, the differential expression microRNAs between CSCs and non-CSCs were identified using next-generation sequencing to screen key miRNAs which might contribute to TGFβ1-induced EMT and CSCs generation. Among those differentially expressed miRNAs, the expression of microRNA-138 was time-dependently down-regulated by TGFβ1 treatment. We further demonstrated primary lung cancer cells, in which we knockdown the expression of miR-138, exhibit mesenchymal phenotypes and stem cell properties. Taken together, these findings indicate TGFβ1-induced down-regulation of microRNA-138 contributes to EMT in primary lung cancer cells, and suggest that miR-138 might serve as a potential therapeutic target. Copyright © 2018 Elsevier Inc. All rights reserved.

Fabrication and properties of samarium doped calcium sulphate thin films using spray pyrolysis technique

Energy Technology Data Exchange (ETDEWEB)

Reghima, Meriem [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia); Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Faculté des Sciences de Bizerte, Université de Carthage, Zarzouna 7021 (Tunisia); Guasch, Cathy [Institut d' Electronique et des systèmes, Unité Mixte de Recherche 5214 UM2-CNRS (ST2i) – Université Montpellier, 860 rue de Saint Priest, Bâtiment 5, 34097 Montpellier (France); Azzaza, Sonia; Alleg, Safia [Laboratoire de Magnétisme et Spectroscopie des Solides (LM2S), Département de Physique, Faculté des Sciences, Université Badji Mokhtar Annaba, B.P. 12, 23000 Annaba (Algeria); Kamoun-Turki, Najoua [Université Tunis El Manar, Faculté des Sciences de Tunis, Département de Physique, LR99ES13 Laboratoire de Physique de la Matière Condensée (LPMC), 2092 Tunis, Tunisie (Tunisia)

2016-10-01

Using low cost spray pyrolysis technique, polycrystalline CaSO{sub 4} thin films were successfully grown on a glass substrate with a thickness of about 1 μm. Samarium doping has been performed on CaSO{sub 4} thin films to explore luminescence properties. The characterizations of these films were carried out using X-ray diffraction, Scanning Electron Microscopy and optical measurements. The structural analyses reveal the existence of hexagonal CaSO{sub 4} phase with a (200) preferred orientation belonging to CaS compound for substrate temperatures below 350 °C. It is shown that the crystallinity of the sprayed thin films can be improved by increasing substrate temperature up to 250 °C. Warren-Averbach analysis has been applied on X-ray diffractogram to determine structural parameters involving the phase with its amount, the grain size and the lattice parameters using Maud software. The surface topography shows a rough surface covered by densely packed agglomerated clusters having faceted and hexagonal shapes. Energy dispersive microscopy measurements confirm the presence of calcium and sulfur in equal proportions as well as high percentage of oxygen. Photoluminescence at room temperature revealed that luminescence peaks are attributed to the intrinsic emission of pure CaSO{sub 4} phase. - Highlights: • Warren Averbach analysis reveal the presence of hcp structure of CaSO{sub 4} phase. • A mixture of CaSO{sub 4} and CaHO{sub 4.5}S phases has been detected for lower T{sub s}. • For increasing T{sub s}, the CaHO{sub 4.5}S phase has been disappeared. • The origin of PL peaks has been identified.

Samarium oxide as a radiotracer to evaluate the in vivo biodistribution of PLGA nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Mandiwana, Vusani, E-mail: VMandiwana@csir.co.za; Kalombo, Lonji, E-mail: LKalombo@csir.co.za [Centre of Polymers and Composites, CSIR (South Africa); Venter, Kobus, E-mail: Kobus.Venter@mrc.ac.za [South African Medical Research Council (South Africa); Sathekge, Mike, E-mail: Mike.Sathekge@up.ac.za [University of Pretoria and Steve Biko Academic Hospital, Department of Nuclear Medicine (South Africa); Grobler, Anne, E-mail: Anne.Grobler@nwu.ac.za; Zeevaart, Jan Rijn, E-mail: zeevaart@necsa.co.za [North-West University, DST/NWU Preclinical Drug Development Platform (South Africa)

2015-09-15

Developing nanoparticulate delivery systems that will allow easy movement and localization of a drug to the target tissue and provide more controlled release of the drug in vivo is a challenge in nanomedicine. The aim of this study was to evaluate the biodistribution of poly(d,l-lactide-co-glycolide) (PLGA) nanoparticles containing samarium-153 oxide ([{sup 153}Sm]Sm{sub 2}O{sub 3}) in vivo to prove that orally administered nanoparticles alter the biodistribution of a drug. These were then activated in a nuclear reactor to produce radioactive {sup 153}Sm-loaded-PLGA nanoparticles. The nanoparticles were characterized for size, zeta potential, and morphology. The nanoparticles were orally and intravenously (IV) administered to rats in order to trace their uptake through imaging and biodistribution studies. The {sup 153}Sm-loaded-PLGA nanoparticles had an average size of 281 ± 6.3 nm and a PDI average of 0.22. The zeta potential ranged between 5 and 20 mV. The [{sup 153}Sm]Sm{sub 2}O{sub 3} loaded PLGA nanoparticles, orally administered were distributed to most organs at low levels, indicating that there was absorption of nanoparticles. While the IV injected [{sup 153}Sm]Sm{sub 2}O{sub 3}-loaded PLGA nanoparticles exhibited the highest localization of nanoparticles in the spleen (8.63 %ID/g) and liver (3.07 %ID/g), confirming that nanoparticles are rapidly removed from the blood by the RES, leading to rapid uptake in the liver and spleen. From the biodistribution data obtained, it is clear that polymeric nanoscale delivery systems would be suitable for improving permeability and thus the bioavailability of therapeutic compounds.

Fabrication of samarium strontium aluminate ceramic and deposition of thermal barrier coatings by air plasma spray process

Directory of Open Access Journals (Sweden)

Baskaran T

2018-01-01

Full Text Available Thermal barrier coatings (TBC with the metallic NiCrAlY bond coat are often used in many aircraft engines to protect superalloy components from high-temperature corrosion thereby to improve the life of gas turbine components. The search for new TBC material has been intensified in recent years due to lack of thermo-physical properties of conventionally used Yttria stabilized Zirconia (YSZ TBCs. Recently, the rare earth containing Samarium Strontium Aluminate (SSA based ceramic was proposed as a new TBC material due to its matching thermo-physical properties with the substrate. The present work focused on the synthesis of SSA ceramics for TBCs application and its coatings development on Ni-based superalloy Inconel 718 substrate by air plasma spray process. The X-ray photoelectron spectroscopy (XPS result confirmed the formation of single phase SSA ceramic after synthesis. The surface morphology of SSA TBCs is mainly composed of melted splats, semi and un-melted particles. The cross-sectional SEM micrographs did not show any spallation at the interface which indicated good mechanical interlocking between the bond coat and ceramic top coat. The Young’s modulus and hardness of SSA TBCs were found to be 80 and 6.1 GPa, respectively. The load-depth curve of SSA TBC showed good elastic recovery about 47 %.

Natural radioactive nuclides 138La and 176Lu in rare earth ore samples

International Nuclear Information System (INIS)

Zhang Weiping; Shen Jianfeng; Lu Zhaolun; Jiang Rangrong

1993-01-01

The contents of 1 '3 8 La and 176 Lu in some rare earth mines have been measured with a HPGE γ spectrometer. The measurements show that the contents of 138 La and 176 Lu in one rare earth mine are remarkably different from those in the other and they do not display a proportional relation, and that the contents of 40 K in this mine are very low

A functional screen implicates microRNA-138-dependent regulation of the depalmitoylation enzyme APT1 in dendritic spine morphogenesis

DEFF Research Database (Denmark)

Siegel, Gabriele; Obernosterer, Gregor; Fiore, Roberto

2009-01-01

of acyl protein thioesterase 1 (APT1), an enzyme regulating the palmitoylation status of proteins that are known to function at the synapse, including the alpha(13) subunits of G proteins (Galpha(13)). RNA-interference-mediated knockdown of APT1 and the expression of membrane-localized Galpha(13) both...... suppress spine enlargement caused by inhibition of miR-138, suggesting that APT1-regulated depalmitoylation of Galpha(13) might be an important downstream event of miR-138 function. Our results uncover a previously unknown miRNA-dependent mechanism in neurons and demonstrate a previously unrecognized...

The effectiveness of samarium-153 (153Sm) lexidronam (EDTMP) in treatment of bone metastases

International Nuclear Information System (INIS)

Ma Yubo; Huang Gang; Liu Jianjun

2004-01-01

Objectives: To evaluate the effectiveness of samarium-153 (153Sm) lexidronam (EDTMP) in treatment of bone metastases. Methods: 380 patients with bone metastases were studied (221 men, 159 women; average age 65.3 y; ranged 27-91 y; average weight 59.3 kg, ranged 39-95 kg). The tumor types were prostate carcinoma (n=155), pulmonary carcinoma (n=92), breast cancer (n=57), gastric carcinoma (n=12), colorectal carcinoma (n=22), nasopharyngeal carcinoma (n=8), lymphoma (n=8), hepatic carcinoma (n=6), ovary carcinoma (n=4) and others (n=16). All patients were received 135Sm-EDTMP 0.8 or 1.0 mCi/kg during 1 to 7 course of treatment. Patients and physician evaluations were used to assess pain relief. Numbers of metastatic foci and activity of ROIs were used to observe post-therapy change in bone scanning. Results: In 380 patients, pain relief was observed in 257 patients (67.6%). Persistence of pain relief was seen through 2 to 24 weeks. The mean relief time is 5.8±3.4 weeks. KPS score was higher 10% than pre-therapy (71.2%±9.6% Vs 80.9%±10.3%, p<0.001). Numbers of metastatic foci (11.2+8.8 Vs 8.4±5.7, p<0.001) and activity of ROIs (3.28±2.04 Vs 2.15±0.94, p<0.01) were less than pre-therapy. Bone marrow suppression was mild and reversible (5.87±1.56 Vs 4.94±1.16 x 109/L). Conclusions: 153Sm-EDTMP provided relief of pain associated with bone metastases and inhibition of metastatic foci. As a relief drug of painful bone metastases, 153Sm-EDTMP is safe and effective. (authors)

Influence of a low calcium and phosphorus diet on the anabolic effect of human parathyroid hormone (1-38) in female rats

DEFF Research Database (Denmark)

Steiner, P.D.; Forrer, R.; Kneissel, Michaela

2001-01-01

Parathyroid hormone (PTH) or synthetic N-terminal PTH fragments administered intermittently have been established as anabolic agents in animal and human bones. In the present study, the influence of a low calcium diet on the anabolic effect of human PTH(1-38) [hPTH(1-38)] was investigated. Forty......-eight 10-week-old female Sprague-Dawley rats were randomly assigned to a diet with a low calcium content (LCa) or a diet with the recommended amount of calcium (RCa). After an adaptation period of 15 days, the rats were randomly assigned to hPTH(1-38) treatment (+LCa/+RCa) or vehicle only (-LCa....../-RCa) for an additional 14 days. Total bone mineral density (BMD) values of several bones were determined using quantitative computed tomography and from ratios of ash weight to volume. Biomechanical competence of the fourth lumbar vertebrae and of the right femora was assessed. An anabolic effect could be detected...

Promiscuity of MCMV immunoevasin of NKG2D: m138/fcr-1 down-modulates RAE-1epsilon in addition to MULT-1 and H60.

Science.gov (United States)

Arapović, Jurica; Lenac Rovis, Tihana; Reddy, Anil Butchi; Krmpotić, Astrid; Jonjić, Stipan

2009-11-01

Both human and mouse cytomegalovirus (CMV) encode proteins that inhibit the activation of NK cells by down-regulating the cellular ligands for activating NK cell receptor, NKG2D. MCMV proteins m145, m152 and m155 interfere with the expression of all known NKG2D ligands, MULT-1, RAE-1 family members and H60, respectively, whereas m138 affects the expression of MULT-1 and H60. Here we show that m152 affects the maturation of newly synthesized RAE-1 molecules, but is not sufficient to prevent surface expression of RAE-1varepsilon. We have identified m138 as a main inhibitor of the surface expression of RAE-1varepsilon. In contrast to m152, m138 affects the surface-resident protein leading to its endocytosis, which can be prevented by a dynamin inhibitor. Moreover, we demonstrated that m138 does not need other viral proteins to down-modulate the expression of RAE-1varepsilon.

Determination of the speciation and bioavailability of samarium to Chlamydomonas reinhardtii in the presence of natural organic matter.

Science.gov (United States)

Rowell, Justine-Anne; Fillion, Marc-Alexandre; Smith, Scott; Wilkinson, Kevin J

2018-06-01

As technological interest and environmental emissions of the rare earth elements increase, it is becoming more important to assess their potential environmental impact. Samarium (Sm) is a lanthanide of intermediate molar mass that is used in numerous high-technology applications including wind turbines, solar panels, and electric vehicles. The present study relates the speciation of Sm determined in the presence of natural organic matter (NOM) to its bioavailability to the unicellular green alga Chlamydomonas reinhardtii. The free ion concentration was determined using a cation exchange resin (ion exchange technique) in dynamic mode and compared with thermodynamic modeling. Short-term biouptake experiments were performed in the presence of 4 types of NOM: Suwannee River fulvic acids, Pahokee Peat fulvic acids, Suwannee River humic acids, and a Luther Marsh dissolved organic matter isolate (90-95% humic acids). It was clearly shown that even a small amount of NOM (0.5 mg C L -1 ) resulted in a significant decrease (10 times) in the Sm internalization fluxes. Furthermore, complexation with humic acids (and the corresponding reduction in Sm bioavailability) was stronger than that with fulvic acids. The results showed that the experimentally measured (free) Sm was a better predictor of Sm internalization than either the total concentrations or the free ion concentrations obtained using thermodynamic modeling. Environ Toxicol Chem 2018;37:1623-1631. © 2018 SETAC. © 2018 SETAC.

Propuesta del programaS-GeMS para el análisis estadístico espacial de fallas en alimentadores soterrados de 13,8 kV; PropodedS-GEMS program for statistical analysis of failure space of 13.8 kV underground feeders

Directory of Open Access Journals (Sweden)

Boris Alba Valle

2011-06-01

Full Text Available Actualmente, el sistema soterrado de Ciudad de La Habana, carece de herramientas gráficas de trabajo con lascuales poder visualizar zonas con alta incidencia de fallas en alimentadores de 13,8 kV y que permitan tomardecisiones certeras en cuanto a los tramos de alimentadores a reparar o sustituir por su deterioro. En este trabajo sepropone el uso de los programas S-GeMS (Stanford Geostatistical Modeling Software y Autocad comoherramientas para el análisis estadístico espacial de la cantidad de fallas. Se realiza, en lo fundamental, el estudiode toda la documentación referente a las aplicaciones del programa S-GeMS y la Base de Datos de la cantidad defallas del 2007 al 2009, de los alimentadores de 13,8 kV perteneciente a la Unidad Empresarial Básica (UEBSoterrada. Finalmente se muestran, a modo de ejemplo, los resultados obtenidos con su aplicación al determinarsela dirección preferencial de distribución de la cantidad de fallas.   Nowadays, the Havana City underground system, lacks of graphical working tools which not only allow to visualizehigh faults incidence areas in 13,8 kV feeders but also make good decisions in reference to the feeder sections to berepaired or substituted due to their impairment. The use of S-GeMS (Stanford Geostatistical Modeling Software andAutocad programs as tools for the spatial statistic analysis of faults quantity is proposed in this article. The study ofthe whole documentation related to the S-GeMS program applications is carried out as well as the UndergroundManagement Basic Unit (UEB 13,8 kV feeders faults quantity database from 2007 to 2009. Finally, the results afterdetermining the faults quantity distribution preferential address with the program application are shown, as anexample.

Propuesta del programa S-GeMS para el análisis estadístico espacial de fallas en alimentadores soterrados de 13,8 kV;PropodedS-GEMS program for statistical analysis of failure space of 13.8 kV underground feeders

Directory of Open Access Journals (Sweden)

Boris Alba - Valle

2011-06-01

Full Text Available Actualmente, el sistema soterrado de Ciudad de La Habana, carece de herramientas gráficas de trabajo con lascuales poder visualizar zonas con alta incidencia de fallas en alimentadores de 13,8 kV y que permitan tomardecisiones certeras en cuanto a los tramos de alimentadores a reparar o sustituir por su deterioro. En este trabajo sepropone el uso de los programas S-GeMS (Stanford Geostatistical Modeling Software y Autocad comoherramientas para el análisis estadístico espacial de la cantidad de fallas. Se realiza, en lo fundamental, el estudiode toda la documentación referente a las aplicaciones del programa S-GeMS y la Base de Datos de la cantidad defallas del 2007 al 2009, de los alimentadores de 13,8 kV perteneciente a la Unidad Empresarial Básica (UEBSoterrada. Finalmente se muestran, a modo de ejemplo, los resultados obtenidos con su aplicación al determinarsela dirección preferencial de distribución de la cantidad de fallas.Nowadays, the Havana City underground system, lacks of graphical working tools which not only allow to visualizehigh faults incidence areas in 13,8 kV feeders but also make good decisions in reference to the feeder sections to berepaired or substituted due to their impairment. The use of S-GeMS (Stanford Geostatistical Modeling Software andAutocad programs as tools for the spatial statistic analysis of faults quantity is proposed in this article. The study ofthe whole documentation related to the S-GeMS program applications is carried out as well as the UndergroundManagement Basic Unit (UEB 13,8 kV feeders faults quantity database from 2007 to 2009. Finally, the results afterdetermining the faults quantity distribution preferential address with the program application are shown, as anexample.

Free radical scavenging activity and neuroprotective potentials of D138, one Cu(II)/Zn(II) Schiff-base complex derived from N,N'-bis(2-hydroxynaphthylmethylidene)-1,3-propanediamine.

Science.gov (United States)

Wang, Che; Cai, Zheng-Xu; You, Zhong-Lu; Guo, Hui-Shu; Shang, De-Jing; Wang, Xiao-Ling; Zhang, Liang; Ma, Li-Jie; Tan, Jun; Le, Wei-Dong; Li, Song

2014-09-01

There is increasing evidence that free radicals play an important role in neuronal damages induced by diabetes mellitus or cerebral ischemia insults. Antioxidants with free radical scavenging activities have been shown to be beneficial and neuroprotective for these pathological conditions. Here, we report free radical scavenging activity and neuroprotective potential of D138, one copper(II)/zinc(II) Schiff-base complex derived from N,N'-2(2-hydroxynaphthylmethylidene)-1,3-propanediamine. The data from three in vitro assays, 2,2-diphenyl-1-picrylhydrazyl assay, nitro blue tetrazolium assay and hydroxyl radical scavenging assay, indicated that D138 presented a potent free radical scavenging activity. The neuroprotective and antioxidative effects of D138 were further evaluated in vivo using bilateral common carotid artery occlusion (BCCAO) mouse model and streptozotocin (STZ) diabetic mouse model. Our results indicated that treatment of D138 significantly ameliorated the hippocampal neuronal damage and the oxidative stress levels in these animal models. Moreover, D138 also reversed the behavioral deficiencies induced by BCCAO or STZ, as assessed by Y-maze test and fear conditioning test. In conclusion, all these findings support that D138 exerts free radical scavenging and neuroprotective activities and has the potentials to be a potent therapeutic candidate for brain oxidative damage induced by cerebral ischemia or diabetes mellitus.

Samarium-153 Oksabifor in the treatment of metastatic bone disease

International Nuclear Information System (INIS)

Solodyannikova, O.; Voit, N.; Sukach, G.; Sagan, D.

2015-01-01

patients - reducing the number of foci and the level of radiopharmaceutical uptake in them. Conclusions: radionuclide therapy in patients with BM can effectively suppress pain and significantly reduce the number of analgesics. Post-treatment patients, life quality statistically significantly improved. Samarium-153 has the ability to reduce BM number and intensity of radiopharmaceutical accumulation in spots in the control study. (authors)

Fluorescence properties of europium and samarium. beta. -diketonates and their use in fluorometry

Energy Technology Data Exchange (ETDEWEB)

Huang, H; Hiraki, K; Nishikawa, Y [Kinki Univ., Higashi-Osaka, Osaka (Japan). Faculty of Science and Technology

1981-01-01

Several europium and samarium ..beta..-diketonates (tta, ntfa, bfa) complexed with 1, 10-phenanthroline, or with trioctylphosphine oxide (topo) were synthesized. The fluorescence properties of these compounds in benzene or hexane have been studied. Absorption and fluorescence spectra, fluorescence quantum yield, fluorescence sensitivity index (F.S.I.), and fluorescence lifetime were measured. From the measurement of fluorescence lifetime of the ..beta..-diketonates, the velocity of radiative process (k sub(f)/phi sub(f)) has almost the same value for benzene and hexane solvent. The red fluorescence (Em. max. : 619 nm) of Eu(III) in these chelates is attributed to transitions from /sup 5/D/sub 0/ ..-->.. /sup 7/F/sub 2/ levels of this ion, and the three-band spectrum (Em. max. : 569 nm, 606 nm, 650 nm) indicates the transitions from the /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(5/2), /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(7/2), and /sup 4/G sub(5/2) ..-->.. /sup 6/H sub(9/2) levels of Sm(III), respectively. These spectra are not changed by any solvents and ligands. From the results, the fluorescence of the ..beta..-diketonates in organic solvent has been attributed to m* ..-->.. m luminescence transition. The complexes of Eu(III) and Sm(III) show radiative transition within orbitals, composed exclusively of 4f orbitals of rare earth ions (m* ..-->.. m radiative transition). Fluorinated ligands show better sensitivity than unfluorinated ligands, and the best sensitivity is obtained with TTA-phen system, and/or TTA-topo system for the spectrofluorometric determination of the two metals. In the case of Eu determination, 619 nm emission wavelength is used (the determinable range : 0.2 -- 10 ppb Eu), and in the case of Sm determination, 650 nm emission wavelength is adopted (the determinable range : 0.1 -- 1 ppm Sm), because of much higher sensitivity than the other two peaks (569, 606 nm) without interference from europium complex.

Chemical Abundances of M-Dwarfs from the Apogee Survey. I. The Exoplanet Hosting Stars Kepler-138 and Kepler-186

Energy Technology Data Exchange (ETDEWEB)

Souto, D.; Cunha, K. [Observatório Nacional, Rua General José Cristino, 77, 20921-400 São Cristóvão, Rio de Janeiro, RJ (Brazil); García-Hernández, D. A.; Zamora, O.; Prieto, C. Allende; Jönsson, H.; Pérez, A. E. García [Instituto de Astrofísica de Canarias (IAC), Vía Lactea S/N, E-38205, La Laguna, Tenerife (Spain); Smith, V. V. [National Optical Astronomy Observatory, 950 North Cherry Avenue, Tucson, AZ 85719 (United States); Mahadevan, S. [Department of Astronomy and Astrophysics, The Pennsylvania State University (United States); Blake, C. [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104 (United States); Johnson, J. A.; Pinsonneault, M. [Department of Astronomy, The Ohio State University, Columbus, OH 43210 (United States); Holtzman, J. [New Mexico State University, Las Cruces, NM 88003 (United States); Majewski, S. R.; Sobeck, J. [Department of Astronomy, University of Virginia, Charlottesville, VA 22904-4325 (United States); Shetrone, M. [University of Texas at Austin, McDonald Observatory (United States); Teske, J. [Department of Terrestrial Magnetism, Carnegie Institution for Science, Washington, DC 20015 (United States); Nidever, D. [Department of Astronomy, University of Michigan, Ann Arbor, MI, 48104 (United States); Schiavon, R. [Astrophysics Research Institute, Liverpool John Moores University, 146 Brownlow Hill, Liverpool, L3 5RF (United Kingdom); and others

2017-02-01

We report the first detailed chemical abundance analysis of the exoplanet-hosting M-dwarf stars Kepler-138 and Kepler-186 from the analysis of high-resolution ( R ∼ 22,500) H -band spectra from the SDSS-IV–APOGEE survey. Chemical abundances of 13 elements—C, O, Na, Mg, Al, Si, K, Ca, Ti, V, Cr, Mn, and Fe—are extracted from the APOGEE spectra of these early M-dwarfs via spectrum syntheses computed with an improved line list that takes into account H{sub 2}O and FeH lines. This paper demonstrates that APOGEE spectra can be analyzed to determine detailed chemical compositions of M-dwarfs. Both exoplanet-hosting M-dwarfs display modest sub-solar metallicities: [Fe/H]{sub Kepler-138} = −0.09 ± 0.09 dex and [Fe/H]{sub Kepler-186} = −0.08 ± 0.10 dex. The measured metallicities resulting from this high-resolution analysis are found to be higher by ∼0.1–0.2 dex than previous estimates from lower-resolution spectra. The C/O ratios obtained for the two planet-hosting stars are near-solar, with values of 0.55±0.10 for Kepler-138 and 0.52±0.12 for Kepler-186. Kepler-186 exhibits a marginally enhanced [Si/Fe] ratio.

[Clinical analysis of 138 multiple primary cancers diagnosed of digestive system malignant tumor initially].

Science.gov (United States)

Lyu, J M; Xiong, H C; Wu, B; Zhou, X Q; Hu, J

2018-02-23

Objective: To study the clinical characteristics, strategy of treatment and prognosis of multiple primary cancers(MPC) diagnosed of digestive system malignant tumor firstly. Methods: From January, 2000 to December, 2015, the clinical, follow-up and prognostic data of 138 MPC patients diagnosed of digestive system malignant tumor firstly were retrospectively analyzed. Results: 138 cases were found in 10 580 cases with malignant tumors, and the incidence was 1.30%. There were 129 cases of duplex primary cancers, 8 cases of triple primary cancers and 1 case of quintuple primary cancers. The repetitive primary cancer was occurred in digestive system (61cases, 44.2%) most frequently, with the next in respiratory system (46 cases, 33.3%). 52.2% (72 cases) suffered second primary cancer in 2 years after first primary cancer diagnosed, and 75.4% (104 cases) in 5 years. The median overall survival in patients with all cancer lesions radically treated was 168 months, better than any other treatment (68 months, P digestive system malignant tumor most frequently occurred in the digestive system and respiratory system. More concern should be attracted in follow-up, especially in the first 5 years. The key to improve patient' prognosis was radical treatment to every primary cancer.

Porta-enxertos para o cultivar Máximo IAC 138-22 de uvas de vinho em Monte Alegre do Sul, SP

OpenAIRE

Terra, Maurilo Monteiro; Pires, Erasmo José Paioli; Coelho, Sônia Maria Bonilha Marcondes; Passos, Ilene Ribeiro da Silva; Santos, Rui Ribeiro dos; Pommer, Celso Valdevino; Silva, André Camargo Pereira da; Ribeiro, Ivan José Antunes

1990-01-01

Em Monte Alegre do Sul, SP, efetuou-se um experimento de longa duração para observar o comportamento do cultivar IAC 138-22 (Máximo) de uvas para vinho, sobre cinco porta-enxertos: RR 101-14, 'Golia', "Ripária do Traviú', IAC 572 e IAC 313. Em oito colheitas sucessivas anuais, de 1974 a 1981, analisaram-se as produções médias de uvas por planta. Os resultados indicaram que o IAC 572' foi o melhor porta-enxerto para o IAC 138-22 'Máximo'. O IAC 313 superou o IAC 572 em um dos anos estudados. T...

Retrospective evaluation of bone pain palliation after samarium-153-EDTMP therapy Avaliação retrospectiva do tratamento da dor óssea metastática com Samário-153-EDTMP

Directory of Open Access Journals (Sweden)

Marcelo Tatit Sapienza

2004-01-01

Full Text Available PURPOSE: The aim of this study was to evaluate the degree of metastatic bone pain palliation and medullar toxicity associated with samarium-153-EDTMP treatment. METHODS: Seventy-three patients with metastatic bone pain having previously undergone therapy with samarium-153-EDTMP (1 mCi/kg were retrospectively evaluated. Routine follow-up included pain evaluation and blood counts for 2 months after treatment. Pain was evaluated using a subjective scale (from 0 to 10 before and for 8 weeks after the treatment. Blood counts were obtained before treatment and once a week for 2 months during follow-up. Dosimetry, based upon the urinary excretion of the isotope, was estimated in 41 individuals, and the resulting radiation absorbed doses were correlated with hematological data. RESULTS: Reduction in pain scores of 75% to 100% was obtained in 36 patients (49%, with a decrease of 50% to 75%, 25% to 50%, and 0% to 25% in, respectively, 20 (27%, 10 (14%, and 7 (10% patients. There was no significant relationship between the pain response and location of the primary tumor (breast or prostate cancer. Mild to moderate myelosuppression was noted in 75.3% of patients, usually with hematological recovery at 8 weeks. The mean bone marrow dose was 347 ± 65 cGy, and only a weak correlation was found between absorbed dose and myelosuppression (Pearson coefficient = .4. CONCLUSIONS: Samarium-153-EDTMP is a valuable method for metastatic bone pain palliation. A mild to moderate and transitory myelosuppression is the main toxicity observed after samarium therapy, showing a weak correlation with dosimetric measures.OBJETIVO: O presente trabalho teve por objetivo avaliar o efeito paliativo da dor e a toxicidade medular associados ao tratamento com Samário-153-EDTMP em pacientes com metástases ósseas. MÉTODOS: O estudo foi realizado de forma retrospectiva, a partir do levantamento de prontuário de 178 pacientes submetidos a tratamento com 1mCi/kg de 153Sm

CORRELATION OF 48Ca, 50Ti, AND 138La HETEROGENEITY IN THE ALLENDE REFRACTORY INCLUSIONS

International Nuclear Information System (INIS)

Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang

2015-01-01

Precise determinations of 48 Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive 48 Ca/ 44 Ca anomalies in all analyzed CAIs after normalization to 42 Ca/ 44 Ca, and it is clearly shown that there is no simple correlation between 48 Ca/ 44 Ca and 50 Ti/ 48 Ti anomalies, in agreement with Jungck et al. Compared to the 48 Ca/ 44 Ca versus 50 Ti/ 48 Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated 50 Ti/ 48 Ti. Assuming the 48 Ca/ 44 Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess 50 Ti anomalies in CAIs can be calculated by subtracting the part associated with 48 Ca/ 44 Ca. These excesses show a linear correlation with 138 La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system 48 Ca, 50 Ti, and 138 La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II

Quantitative analysis of T-wave morphology increases confidence in drug-induced cardiac repolarization abnormalities: evidence from the investigational IKr inhibitor Lu 35-138

DEFF Research Database (Denmark)

Graff, Claus; Matz, Jørgen; Christensen, Ellen B

2009-01-01

prolongation. Seventy-nine healthy subjects were included in this parallel study. After a baseline day during which no drug was given, 40 subjects received an I(Kr)-blocking antipsychotic compound (Lu 35-138) on 7 consecutive days while 39 subjects received placebo. Resting ECGs were recorded and used...... to determine a combined measure of repolarization morphology (morphology combination score [MCS]), based on asymmetry, flatness, and notching. Replicate measurements were used to determine reliable change and study power for both measures. Lu 35-138 increased the QTc interval with corresponding changes in T......-wave morphology as determined by MCS. For subjects taking Lu 35-138, T-wave morphology was a more reliable indicator of I(Kr) inhibition than QTcF (chi(2) = 20.3, P = .001). At 80% study power for identifying a 5-millisecond placebo-adjusted change from baseline for QTcF, the corresponding study power for MCS...

ROOTSTOCKS EFFECTS ON THE PHYSICOCHEMICAL CHARACTERISTICS OF BORDÔ, ISABEL AND IAC 138-22 MÁXIMO MUST AND WINE

Directory of Open Access Journals (Sweden)

MARLON JOCIMAR RODRIGUES DA SILVA

2017-09-01

Full Text Available ABSTRACT It has been demonstrated that rootstocks can influence grape characteristics, but there are few data in literature about the rootstocks influence in the wine characteristics, especially in wines elaborated with Vitis labrusca or hybrid grapes. This study evaluated the influence of ‘IAC 766’ and ‘106-8 Mgt’ rootstocks on the physicochemical characteristics of ‘Bordô’, ‘Isabel’ and ‘IAC 138-22 ‘Máximo’ musts and wines. The musts were evaluated for pH, soluble solids, total acidity and soluble solids/acidity ratio. The wines were evaluated for density, alcohol content; total, volatile and fixed acidity; pH, dry extract, reducing sugars, reduced dry extract, alcohol in weight/reduced dry extract; free and total sulfur dioxide; anthocyanins, polyphenols index (I 280; polyphenols and total flavonoids and antioxidant activity. The ‘Bordô’, ‘Isabel’ and IAC 138-22 ‘Máximo’ musts had low soluble solids for winemaking. The ‘106-8 Mgt’ rootstock promoted higher dry extract content and reduced dry extract in Bordô wine, and lower total and fixed acidity in IAC 138-22 Máximo wine. In Isabel wine, higher pH was promoted by the ‘IAC 766’ rootstock. Aside from low total acidity of the Bordô wine, all the physicochemical characteristics of the wines studied are in accordance with Brazilian law. There was no effect of rootstocks in the phenolics content and antioxidant activity of wines.

Effects of samarium (Sm) additions on the microstructure and mechanical properties of as-cast and hot-extruded Mg-5 wt%Al-3 wt%Ca-based alloys

International Nuclear Information System (INIS)

Son, Hyeon-Taek; Lee, Jae-Seol; Kim, Dae-Guen; Yoshimi, Kyosuke; Maruyama, Kouichi

2009-01-01

Samarium (Sm) additions to as-cast Mg-5Al-3Ca-based alloys result in changes, such as equiaxed grains and a refined grain size. The microstructure of as-cast Mg-5Al-3Ca-xSm alloys consists of an α-Mg matrix, a (Mg, Al) 2 Ca eutectic phase, and an Al 2 Sm intermetallic compound. In as-cast alloys, the (Mg, Al) 2 Ca eutectic phase was located at grain boundaries with a chain structure, and the Al 2 Sm intermetallic compounds were homogeneously distributed at the α-Mg matrix and grain boundaries. The eutectic phase of the extruded alloys was elongated in the extrusion direction and crushed into fine particles because of severe deformation during hot extrusion, and the grain size was refined with an increased amount of Sm addition. The maximum values of the yield strength and tensile strength were 313 MPa and 330 MPa at 2 wt%Sm alloy content, respectively

Sh2-138: physical environment around a small cluster of massive stars

Science.gov (United States)

Baug, T.; Ojha, D. K.; Dewangan, L. K.; Ninan, J. P.; Bhatt, B. C.; Ghosh, S. K.; Mallick, K. K.

2015-12-01

We present a multiwavelength study of the Sh2-138, a Galactic compact H II region. The data comprise of optical and near-infrared (NIR) photometric and spectroscopic observations from the 2-m Himalayan Chandra Telescope, radio observations from the Giant Metrewave Radio Telescope (GMRT), and archival data covering radio through NIR wavelengths. A total of 10 Class I and 54 Class II young stellar objects (YSOs) are identified in a 4.6 arcmin×4.6 arcmin area of the Sh2-138 region. Five compact ionized clumps, with four lacking of any optical or NIR counterparts, are identified using the 1280 MHz radio map, and correspond to sources with spectral type earlier than B0.5. Free-free emission spectral energy distribution fitting of the central compact H II region yields an electron density of ˜2250 ± 400 cm-3. With the aid of a wide range of spectra, from 0.5-15 μm, the central brightest source - previously hypothesized to be the main ionizing source - is characterized as a Herbig Be type star. At large scale (15 arcmin ×15 arcmin), the Herschel images (70-500 μm) and the nearest neighbour analysis of YSOs suggest the formation of an isolated cluster at the junction of filaments. Furthermore, using a greybody fit to the dust spectrum, the cluster is found to be associated with the highest column density (˜3 × 1022 cm-2) and high temperature (˜35 K) regime, as well as with the radio continuum emission. The mass of the central clump seen in the column density map is estimated to be ˜3770 M⊙.

A novel nano-immunoassay method for quantification of proteins from CD138-purified myeloma cells: biological and clinical utility.

Science.gov (United States)

Misiewicz-Krzeminska, Irena; Corchete, Luis Antonio; Rojas, Elizabeta A; Martínez-López, Joaquín; García-Sanz, Ramón; Oriol, Albert; Bladé, Joan; Lahuerta, Juan-José; Miguel, Jesús San; Mateos, María-Victoria; Gutiérrez, Norma C

2018-05-01

Protein analysis in bone marrow samples from patients with multiple myeloma has been limited by the low concentration of proteins obtained after CD138 + cell selection. A novel approach based on capillary nano-immunoassay could make it possible to quantify dozens of proteins from each myeloma sample in an automated manner. Here we present a method for the accurate and robust quantification of the expression of multiple proteins extracted from CD138-purified multiple myeloma samples frozen in RLT Plus buffer, which is commonly used for nucleic acid preservation and isolation. Additionally, the biological and clinical value of this analysis for a panel of 12 proteins essential to the pathogenesis of multiple myeloma was evaluated in 63 patients with newly diagnosed multiple myeloma. The analysis of the prognostic impact of CRBN /Cereblon and IKZF1 /Ikaros mRNA/protein showed that only the protein levels were able to predict progression-free survival of patients; mRNA levels were not associated with prognosis. Interestingly, high levels of Cereblon and Ikaros proteins were associated with longer progression-free survival only in patients who received immunomodulatory drugs and not in those treated with other drugs. In conclusion, the capillary nano-immunoassay platform provides a novel opportunity for automated quantification of the expression of more than 20 proteins in CD138 + primary multiple myeloma samples. Copyright © 2018 Ferrata Storti Foundation.

Studies on the rare earth complexes with pyridine derivatives and their N-oxide(II) - Synthesis and properties of fluorescent solid complexes of samarium, europium, gadolium and terbium chlorides with 2,2'-bipyridine-N,N'-dioxide

International Nuclear Information System (INIS)

Minyu, T.; Ning, T.; Yingli, Z.; Jiyuan, B.

1985-01-01

The solid complexes of rare earth nitrates perchlorates and thiocyanates with 2,2'-bipyridine-N,N'-dioxide (bipyO/sub 2/) have been reported. However, the corresponding complexes of other rear earth chlorides have not been investigated except lanthanum, cerium and yttrium. As an extension of our previous work on the synthesis of complexes of praseodymium and neodymium chlorides wiht bipoyO/sub 2/, the authors have now prepared fluorescent solid complexes of samarium, europium, gadolium and terbium chlorides with biphyO/sub 2/, using methanol as a reaction medium. The new synthesized compounds have been identified by means of elemental analysis, infrared spectrometry, conductometry, differential thermal analysis (DTA), thermogravimetry (TG) and X-ray powder diffraction

Crossing 138: two approaches to churn under the Affordable Care Act.

Science.gov (United States)

Ravel, Gabriel; DeSantis, J Angelo

2014-01-01

A predicted side effect of the Medicaid expansion and state-based Exchanges under the Affordable Care Act is churn. Churn is the shifting into and out of eligibility for insurance affordability programs due to income changes. Because the line between Medicaid and Exchange eligibility is fine -138% of the federal poverty level -millions of Americans are expected to gain and lose eligibility. Frequently, this churning undermines continuity of care, raises costs, and frustrates those affected. This article explores two proposed programs to mitigate the effects of churn: the Basic Health Program and the Bridge Program. This article evaluates both programs' ability to mitigate the effects of churn, the likely side effects to states' implementing them, and legal and practical obstacles to their implementation. It concludes that the Bridge Program is the better approach.

Photocatalytic dechlorination of PCB 138 using leuco-methylene blue and visible light; reaction conditions and mechanisms

International Nuclear Information System (INIS)

Izadifard, Maryam; Langford, Cooper H.; Achari, Gopal

2010-01-01

A study of dechlorination of PCB 138, under visible light employing methylene blue (MB) and triethylamine (TEA) in acetonitrile/water has been conducted to investigate the details of the mechanism of dechlorination and to determine the efficiency of the process for this representative congener. Two other amines, N-methyldiethanolamine (MEDA) and (triethanolamine) TEOA also replaced TEA and two other solvents, methanol and ethanol replacing acetonitrile were examined for effects on reaction rates. The results show that PCB 138 can be dechlorinated efficiently in this photocatalytic reaction. Clarifying ambiguities in several previous reports, the reduced form of MB, leuco-methylene blue (LMB) was identified as responsible for the photoreaction with its excited state transferring an electron to PCBs; oxidized LMB (i.e. MB) is reduced back to LMB by the excess amine present. The reaction depends on a cycle driven by the amine as a sacrificial electron donor. MEDA proved to be the most efficient electron donor; apparently in consequence of the most favourable steady state concentration of LMB. Methanol and ethanol may be used to replace acetonitrile with little change in the efficiency of the reaction.

Pharmacokinetics of labelled compounds with technetium-99m and samarium-153; Farmacocinetica de compuestos marcados con tecnecio-99m y samario-153

Energy Technology Data Exchange (ETDEWEB)

Borda O, L B; Torres L, M N

1997-07-01

The purpose of this investigation was to establish the different pharmacokinetics parameters of the main radiopharmaceuticals labeled with technetium-99m and samarium-153. These parameters could be subsequently used as reference to compare other products with the same use. Mathematical models and a computerized pharmacokinetic program were used to this purpose. A biodistribution study in quadruplicate and/or quintuplicate was conducted for each radiopharmaceutical, data was was obtained in injection dose percentages. The biodistribution study involved the injection of a predetermined dose of the radiopharmaceutical into animals (rats or mice), which were subsequently put away at different time intervals, removing the relevant organs. Activity in each organ was read by means of a well-type NaI scintillation counter, data obtained in activity counts was transformed into injection dose percentages. Based on these percentages, the mathematical model was constructed and the pharmacokinetic parameters were obtained using the computerized program Expo 2 v. 1, which is written in C language and works in windows. Analyzing the results obtained, we can conclude that the use of the Expo 2 v. 1 program for a bi compartmental analysis allowed us to obtain reliable pharmacokinetic parameters which describe what happens in the organism when the radiopharmaceutical passes from the central compartment to the peripheral one and vice versa.

Percepce rodičovského chování a jeho souvislost se sebehodnocením. 138. klinicko-psychologický den. Praha, 8. 1. 2007.

OpenAIRE

Macek Petr; Širůček Jan

2007-01-01

Prezentace, 138. klinicko-psychologický den. Praha, 8.1.2007. Příspěvek byl zaměřen na výzkum souvislostí mezi sebehodnocením adolescentů a jejich hodnocení obou rodičů. Presentation, 138th clinical-psychology workshop. Prague, 8.1.2007. Paper was focused on perception of parenting style during childhood and perception of parents as predictors of adolescent's self-esteem

[Management of spontaneous pneumothorax: about 138 cases].

Science.gov (United States)

Habibi, Bouchra; Achachi, Leila; Hayoun, Sohaib; Raoufi, Mohammed; Herrak, Laila; Ftouh, Mustapha El

2017-01-01

Pneumothorax is a collection of air in the pleural cavity. We conducted a retrospective study of patients with spontaneous pneumothorax in the Department of Pneumology at the Ibn Sina Hospital in Rabat (2009-2011) with the aim to determine the epidemiological, clinical, radiological, therapeutic and evolutionary manifestation of spontaneous pneumothorax. The study involved 138 patients: 128 men and 10 women (17-83 years), with an average age of 44.5 +/- 17.4 years and sex ratio of 12/8. 81.2% of patients were smokers. Clinical symptomatology was chest pain (92%), dyspnea (60%). Chest radiograph showed total unilateral (110 cases); partial (10 cases); localized (6 cases); bilateral (4 cases); right (51.4%) or left (45.7%) PNO (pneumothorax). During our study period we found that 70% of patients had spontaneous primitive pneumothorax and 30% had PNO secondary to Chronic obstructive pulmonary disease (COPD) (44%) and pulmonary tuberculosis (TB) (39%). Initial management included patients hospitalization, chest drainage (95%), needle exsufflation (1%), rest and O 2 (4%). It enables the lung to stick to the chest wall within 10 days in 63% of patients. Evolution was favorable in 89% of patients. Immediate complications included: subcutaneous emphysema (5 cases); infection (6 cases) and 3 deaths (cardiorespiratory arrest). Late complications included: recurrences in 11.6%; the first recurrence occurred in 13 cases (chest drainage in 11 cases and oxygen therapy in 2 cases) while the second recurrence occurred in 3 cases (surgery). This study shows the role of chest drainage and monitoring in the management of pneumothorax to avoid complications and especially to prevent recurrences, with a possible need to resort to surgery.

Addressing the psychosocial and communication challenges posed by radiological/nuclear terrorism: key developments since NCRP Report No. 138.

Science.gov (United States)

Becker, Steven M

2005-11-01

One of the most innovative aspects of NCRP Report No. 138 (Management of Terrorist Incidents Involving Radioactive Material) was the high priority it accorded to psychosocial and communication issues. While previous discussions of radiological and nuclear terrorism had occasionally referred to these topics, NCRP Report No. 138 was the first report of its kind to recognize the profound challenges posed by these issues and to place them at the heart of preparedness and response efforts. In the years since the report's release, a host of important developments have taken place in relation to psychosocial and communication issues. This paper reviews key changes and advances in five broad areas: (1) training exercises, (2) policy and guidance development, (3) findings on hospital and clinician needs, (4) survey research on public perceptions of radiological terrorism, and (5) risk communication for radiological and nuclear terrorism situations. The article concludes with a discussion of continuing psychosocial and communication challenges, including critical areas needing further attention as the nation moves to meet the threat of terrorism involving radioactive materials.

Avaliação da resistência à corrosão de implantes em aços inoxidáveis ISO 5832-9 e F138 removidos de pacientes

Directory of Open Access Journals (Sweden)

Elison da Fonseca e Silva

2012-01-01

Full Text Available This work has compared the surfaces of two different steel samples used as orthopedical implants, classified as ASTM F138 and ISO5832-9, through optical emission spectroscopy, by means of SEM and EDS. The samples (implants were also submitted to potentiodynamic cyclic polarization in Ringer lactate and NaCl 0.9 M L-1 solutions; ISO5832-9 sample did not show any kind of localized corrosion, but in the case of F138 steel was observed a pit localized corrosion in both solutions. In Ringer lactate solution it was observed a loss of about 63% for nickel and 26% for iron for F138 stell, compared to the initial composition.

Effects of increasing doses of samarium-153-ethylenediaminetetramethylene phosphonate on axial and appendicular skeletal growth in juvenile rabbits

Energy Technology Data Exchange (ETDEWEB)

Essman, Stephanie C. [Department of Veterinary Medicine and Surgery, College of Veterinary Medicine, University of Missouri-Columbia, Columbia, MO 65211 (United States)], E-mail: essmans@missouri.edu; Lewis, Michael R. [Department of Veterinary Medicine and Surgery, College of Veterinary Medicine, University of Missouri-Columbia, Columbia, MO 65211 (United States); Department of Radiology, University of Missouri-Columbia, Columbia, MO 65211 (United States); Nuclear Science and Engineering Institute, University of Missouri-Columbia, Columbia, MO 65211 (United States); Research Service, Harry S. Truman Memorial Veterans' Hospital, Columbia, MO 65201 (United States); Fox, Derek B. [Department of Veterinary Medicine and Surgery, College of Veterinary Medicine, University of Missouri-Columbia, Columbia, MO 65211 (United States)

2008-02-15

Introduction: Targeted radiotherapy using samarium-153-ethylenediaminetetramethylene phosphonate ({sup 153}Sm-EDTMP) is currently under investigation for treatment of osteosarcoma. Osteosarcoma often occurs in children, and previous studies on a juvenile rabbit model demonstrated that clinically significant damage to developing physeal cartilage may occur as a result of systemic {sup 153}Sm-EDTMP therapy. The aim of this study was to evaluate the late effects of {sup 153}Sm-EDTMP on skeletal structures during growth to maturity and to determine if there is a dose response of {sup 153}Sm-EDTMP on growth of long bones. Methods: Female 8-week-old New Zealand white rabbits were divided into three treatment groups plus controls. Each rabbit was intravenously administered a predetermined dose of {sup 153}Sm-EDTMP. Multiple bones of each rabbit were radiographed every 2 months until physeal closure, with subsequent measurements made to assess for abbreviated bone growth. Statistical analyses were performed to determine the differences in bone length between groups, with significance set at P<.05. Results: Significant differences in lengths of multiple bones were detected between the high-dose group and other treatment groups and controls at each time interval. A significant difference in lengths of the tibias was also noted in the medium-treatment group, compared to controls. Mean reduction of bone length was first detected at 4 months and did not increase significantly over time. Conclusions: These data suggest that clinically significant bone shortening may occur as a result of high-dosage administration of {sup 153}Sm-EDTMP. Further investigation regarding the effects of bone-seeking radiopharmaceuticals on bone growth and physeal cartilage is warranted.

Study of the interactions of 13.8 GeV/c protons with the heavy nuclei of the emulsions exposed in magnetic fuel of 170 kgauss

International Nuclear Information System (INIS)

Gomez Aleixandre, J. L.

1967-01-01

145 stars with N h >8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c π- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs

Paclitaxel-Fe3O4 nanoparticles inhibit growth of CD138–  CD34– tumor stem-like cells in multiple myeloma-bearing mice

Directory of Open Access Journals (Sweden)

Yang C

2013-04-01

Full Text Available Cuiping Yang,1,3,* Jing Wang,2,* Dengyu Chen,1,* Junsong Chen,1 Fei Xiong,4 Hongyi Zhang,1 Yunxia Zhang,2 Ning Gu,4 Jun Dou11Department of Pathogenic Biology and Immunology, Medical School, 2Department of Gynecology and Obstetrics, Zhongda Hospital, Southeast University, Nanjing, 3Department of Pathogenic Biology and Immunology, School of Basic Medicine, Jiangxi University of Traditional Chinese Medicine, Nanchang, 4School of Biological Science and Medical Engineering, Southeast University, Nanjing, People’s Republic of China*These authors contributed equally to this workBackground: There is growing evidence that CD138– CD34– cells may actually be tumor stem cells responsible for initiation and relapse of multiple myeloma. However, effective drugs targeted at CD138– CD34– tumor stem cells are yet to be developed. The purpose of this study was to investigate the inhibitory effect of paclitaxel-loaded Fe3O4 nanoparticles (PTX-NPs on CD138– CD34– tumor stem cells in multiple myeloma-bearing mice.Methods: CD138– CD34– cells were isolated from a human U266 multiple myeloma cell line using an immune magnetic bead sorting method and then subcutaneously injected into mice with nonobese diabetic/severe combined immunodeficiency to develop a multiple myeloma-bearing mouse model. The mice were treated with Fe3O4 nanoparticles 2 mg/kg, paclitaxel 4.8 mg/kg, and PTX-NPs 0.64 mg/kg for 2 weeks. Tumor growth, pathological changes, serum and urinary interleukin-6 levels, and molecular expression of caspase-3, caspase-8, and caspase-9 were evaluated.Results: CD138– CD34– cells were found to have tumor stem cell characteristics. All the mice developed tumors in 40 days after injection of 1 × 106 CD138– CD34– tumor stem cells. Tumor growth in mice treated with PTX-NPs was significantly inhibited compared with the controls (P <  0.005, and the groups that received nanoparticles alone (P < 0.005 or paclitaxel alone (P < 0.05. In addition

Crystallization in Zr41.2Ti13.8Cu12.5Ni10Be22.5 bulk metallic glass under pressure

DEFF Research Database (Denmark)

Jiang, Jianzhong; Zhou, T.J.; Rasmussen, Helge Kildahl

2000-01-01

The effect of pressure on the crystallization behavior of the bulk metallic glass-forming Zr41.2Ti13.8Cu12.5Ni10Be22.5 alloy with a wide supercooled liquid region has been investigated by in situ high-pressure and high-temperature x-ray powder diffraction measurements using synchrotron radiation......)], reporting a decrease of the crystallization temperature under pressure in a pressure range of 0-6 GPa for the bulk glass Zr41Ti14Cu12.5Ni9Be22.5C1 alloy. Compressibility with a volume reduction of approximately 22% at room temperature does not induce crystallization in the Zr41.2Ti13.8Cu12.5Ni10Be22.5 bulk...... glass alloy. This indicates that the densification effect induced by pressure in the pressure range investigated plays a minor role in the crystallization behavior of this bulk glass alloy. The different crystallization behavior of the carbon-free and the carbon-containing glassy alloys has been...

Moessbauer spectroscopy study on the corrosion resistance of plasma nitrided ASTM F138 stainless steel in chloride solution

International Nuclear Information System (INIS)

Souza, S.D. de; Olzon-Dionysio, M.; Basso, R.L.O.; Souza, S. de

2010-01-01

Plasma nitriding of ASTM F138 stainless steel samples has been carried out using dc glow discharge under 80% H 2 -20% N 2 gas mixture, at 673 K, and 2, 4, and 7 h time intervals, in order to investigate the influence of treatment time on the microstructure and the corrosion resistance properties. The samples were characterized by scanning electron microscopy, glancing angle X-ray diffraction and conversion electron Moessbauer spectroscopy, besides electrochemical tests in NaCl aerated solution. A modified layer of about 6 μm was observed for all the nitrided samples, independent of nitriding time. The X-ray diffraction analysis shows broad γ N phase peaks, signifying a great degree of nitrogen supersaturation. Besides γ N, the Moessbauer spectroscopy results indicated the occurrence of γ' and ε phases, as well as some other less important phases. Corrosion measurements demonstrate that the plasma nitriding time affects the corrosion resistance and the best performance is reached at 4 h treatment. It seems that the ε/γ' fraction ratio plays an important role on the resistance corrosion. Additionally, the Moessbauer spectroscopy was decisive in this study, since it was able to identify and quantify the iron phases that influence the corrosion resistance of plasma nitrided ASTM F138 samples.

Comparative analysis of CD138 antigen targeting for the treatment of multiple myeloma with bismuth-213 and Melphalan chemotherapy

International Nuclear Information System (INIS)

Gouard, S.; Gaschet, J.; Maurel, C.; Barbet, J.; Davodeau, F.; Pallardy, A.; Faivre-Chauvet, A.; Kraeber-Bodere, F.; Bruchertseifer, F.; Morgenstern, A.; Cherel, M.

2015-01-01

Full text of publication follows. Aim: multiple myeloma (MM) is a B-cell malignancy of terminally differentiated plasma cells within the bone marrow, with the presence of a monoclonal immunoglobulin in serum and/or urine and development of osteolytic bone lesions in human. Despite intense research to develop new treatments, cure is almost never achieved. Alpha-radioimmunotherapy (RIT) has been shown to be effective in vivo in a multiple myeloma model and seems particularly suited for disseminated tumour cells or small clusters of tumour cells. CD138 (Syndecan-1) is found mainly in epithelial cells, but has been shown to be expressed by most myeloma cells, both in human and in mouse. In order to define where alpha RIT stands in MM treatment, the aim of this study was to compare Melphalan, MM standard treatment, with alpha RIT using a bismuth-213-labelled anti-mouse CD138 rat antibody in a syngeneic mouse MM model. Material and Methods: C57BL/KaLwRij mice were grafted with 10 6 5T33 cells (murine myeloma cells). Luciferase transfected 5T33 were used for in vivo localization of the cells during the course of disease. The first step of the study was to assess the dose-response of Melphalan (100, 200 et 300 μg/mouse), 21 days after engraftment. The second step consisted in therapeutic association: Melphalan followed by RIT at d22 et d25 after engraftment. Toxicity (animal weight, blood cell counts) and treatment efficacy were studied in animals receiving no treatment, injected with Melphalan alone (200 μg), RIT alone at d22 and d25 (3.7 MBq of 213 Bi-anti-CD138) and Melphalan combined with alpha RIT. Results: fifty percent of untreated mice died by d64 after MM engraftment. In mice treated with Melphalan alone, only the 200 μg dose improved median survival. No animal was cured after Melphalan treatment whereas 60% of the mice survived with RIT alone at d22 after tumour engraftment. However, the therapeutic window seems to be narrow, indeed no effect was observed with

Effect of samarium (Sm) addition on the microstructures and mechanical properties of Al–7Si–0.7Mg alloys

International Nuclear Information System (INIS)

Qiu, Hongxu; Yan, Hong; Hu, Zhi

2013-01-01

Highlights: •Sm affected the secondary dendrite arm spacing of Al–7Si–0.7Mg alloy. •The coarse plate-like eutectic silicon was fully modified into a fine branched and particle structure when 0.6 wt.% Sm added. •The tensile properties were enhanced by the addition of Sm. •Sm has marked effects on eutectic temperature and the latent heat ΔH R on remelting behavior. •The morphology and chemical composition of Sm-rich intermetallics were studied. -- Abstract: The effects of samarium (Sm) additions (0–0.9 wt.%) on the microstructures and mechanical properties of Al–7Si–0.7Mg alloys have been studied in this article. The microstructures of the as-cast samples were examined by optical microscopy (OM) and scanning electron microscopy (SEM). The experimental results indicated that the rare earth Sm affected the secondary dendrite arm spacing (SDAS) of Al–7Si–0.7Mg alloy. And it was found that Sm had great modification effects on the microstructures of eutectic silicon. When 0.6 wt.% Sm was added to the alloy, the coarse plate-like eutectic silicon was fully modified into a fine fibrous structure; the dendrites of Al–7Si–0.7Mg alloy was best refined. The mechanical properties were investigated by tensile test. The findings indicate that the tensile properties and elongation were improved by the addition of Sm. And a good combination of ultimate tensile strength (215 MPa) and elongation (3.3%) was obtained when the Sm addition was up to 0.6 wt.%. Furthermore the results of thermal analysis reveal that Sm addition had marked effects on eutectic temperature and the latent heat ΔH R on remelting behavior

Structural and superconducting properties of (Y,Gd)Ba2Cu3O7-δ grown by MOCVD on samarium zirconate buffered IBAD-MgO

International Nuclear Information System (INIS)

Stan, L; Holesinger, T G; Maiorov, B; Feldmann, D M; Usov, I O; DePaula, R F; Civale, L; Foltyn, S R; Jia, Q X; Chen, Y; Selvamanickam, V

2008-01-01

Textured samarium zirconate (SZO) films have been grown by reactive cosputtering directly on an ion beam assisted deposited (IBAD) MgO template, without an intermediate homoepitaxial MgO layer. The subsequent growth of 0.9 μm thick (Y,Gd)Ba 2 Cu 3 O 7-δ ((Y, Gd)BCO) films by metal organic chemical vapor deposition (MOCVD) yielded well textured films with a full width at half maximum of 1.9 0 and 3.4 0 for the out-of-plane and in-plane texture, respectively. Microstructural characterizations of the SZO buffered samples revealed clean interfaces. This indicates that the SZO not only provides a diffusion barrier, but also functions as a buffer for (Y, Gd)BCO grown by MOCVD. The achievement of self-field critical current densities (J c ) of over 2 MA cm -2 at 75.5 K is another proof of the effectiveness of SZO as a buffer on the IBAD-MgO template. The in-field measurements revealed an asymmetric angular dependence of J c and a shift of the ab-plane maxima due to the tilted nature of the template and (Y,Gd) 2 O 3 particles existing in the (Y, Gd)BCO matrix. The present results are especially important because they demonstrate that high temperature superconducting coated conductors with simpler architecture can be fabricated using commercially viable processes

Sorption of samarium in soils: influence of soil properties and Sm concentration

Energy Technology Data Exchange (ETDEWEB)

Ramirez-Guinart, Oriol; Salaberria, Aitor; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

2014-07-01

Due to the fact that barriers of Deep Geological Repositories (DGR) may lose efficiency before the radioisotopes present in the High Level Radioactive Waste (HLRW) completely decay, it is possible that, in the long-term, radioactive leachates may escape from the DGR and reach the soil and water compartments in the biosphere. Therefore, it is required to examine the interaction and mobility of radionuclides present in the HLRW, or their chemical analogues, to predict the impact of their eventual incorporation in the biosphere and to assess the derived risk. Although relevant data have been recently obtained for a few radionuclides in soils, there are still some important gaps for some radionuclides, such us for samarium (Sm). Sm is a lanthanide that, besides being considered as a natural analogue of actinides, may also be present in HLRW in the form of the radioactive isotope {sup 151}Sm. The main objective of this work was to obtain sorption data (K{sub d}) of {sup 151}Sm gathered from a set of soil samples physicochemical fully-characterized (pH, texture, cationic exchange capacity, soil solution cationic composition, organic matter, carbonate and metallic oxides content, etc.). Additionally, as an alternative for testing sorption capacity of radionuclides in soils is the use of the corresponding stable isotope or a chemical analogue, the influence of Sm concentration was also checked. To evaluate {sup 151}Sm sorption, batch assays were carried out for each soil sample, which consisted in a pre-equilibration step of 2 g of each soil with 50 ml of double deionised water, and a subsequent equilibration step with the same solution, but labelled with {sup 151}Sm. The activity of {sup 151}Sm in initial and final solutions was measured by liquid scintillation and K{sub d} ({sup 151}Sm) data were calculated. The reversibly sorbed fraction was estimated by the application of a single extraction test, with double deionised water, to soil residues coming from the previous

Targeting of human GGT in a renal cell carcinoma mouse model with 99mTc-HYNIC-mAb 138H11

International Nuclear Information System (INIS)

Kuenstler, J.U.; Seifert, S.; Zimmermann, J.; Fischer, P.; Invancevic, V.; Johannsen, B.

2002-01-01

The study shows that the specific tumor uptake of 99m Tc-HYNIC-mAb 138H11 in GGT positive tumours was 2 to 5 times as high as in the controls. A high unspecific background activity was observed in the blood and in all organs well supplied with blood. (orig.)

An estimation of influence of humic acid and organic matter originated from bentonite on samarium solubility

International Nuclear Information System (INIS)

Kanaji, Mariko; Sato, Haruo; Sasahira, Akira

1999-10-01

Organic acids in groundwater are considered to form complexes and increase the solubility of radionuclides released from vitrified waste in a high-level radioactive waste (HLW) repository. To investigate whether the solubility of samarium (Sm) is influenced by organic substances, we measured Sm solubility in the presence of different organic substances and compared those values with results from thermodynamic predictions. Humic acid (Aldrich) is commercially available and soluble organic matter originated from bentonite were used as organic substances in this study. Consequently, the solubility of Sm showed a tendency to apparently increase with increasing the concentration of humic acid, but in the presence of carbonate, thermodynamic predictions suggested that the dominant species are carbonate complexes and that the effect of organic substances are less than that of carbonate. Based on total organic carbon (TOC), the increase of Sm solubility measured with humic acid (Aldrich) was more significant than that in the case with soluble organic matter originated from bentonite. Since bentonite is presumed to include also simple organic matters of which stability constant for forming complexes is low, the effect of soluble organic matter originated from bentonite on the solubility of Sm is considered to be less effective than that of humic acid (Aldrich). Experimental values were compared with model prediction, proposed by Kim, based on data measured in a low pH region. Tentatively we calculated the increase in Sm solubility assuming complexation with humic acid. Trial calculations were carried out on the premise that the complexation reaction of metal ion with humic acid is based on neutralization process by 1-1 complexation. In this process, it was assumed that one metal ion coordinates with one unit of complexation sites which number of proton exchange sites is equal to ionic charge. Consequently, Kim's model indicated that carbonate complexes should be dominant

CORRELATION OF {sup 48}Ca, {sup 50}Ti, AND {sup 138}La HETEROGENEITY IN THE ALLENDE REFRACTORY INCLUSIONS

Energy Technology Data Exchange (ETDEWEB)

Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang, E-mail: hart.chen@bristol.ac.uk [Institute of Earth Sciences, Academia Sinica, Taipei, Taiwan, ROC (China)

2015-06-10

Precise determinations of {sup 48}Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive {sup 48}Ca/{sup 44}Ca anomalies in all analyzed CAIs after normalization to {sup 42}Ca/{sup 44}Ca, and it is clearly shown that there is no simple correlation between {sup 48}Ca/{sup 44}Ca and {sup 50}Ti/{sup 48}Ti anomalies, in agreement with Jungck et al. Compared to the {sup 48}Ca/{sup 44}Ca versus {sup 50}Ti/{sup 48}Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated {sup 50}Ti/{sup 48}Ti. Assuming the {sup 48}Ca/{sup 44}Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess {sup 50}Ti anomalies in CAIs can be calculated by subtracting the part associated with {sup 48}Ca/{sup 44}Ca. These excesses show a linear correlation with {sup 138}La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system {sup 48}Ca, {sup 50}Ti, and {sup 138}La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II.

Study of 138 Neisseria meningitidis strains isolated from blood or cerebrospinal fluid in Lombardy between 2007 and 2010

Directory of Open Access Journals (Sweden)

Laura Daprai

2012-06-01

Full Text Available Neisseria meningitidis, Streptococcus pneumoniae, and Haemophilus influenzae type b cause the majority of cases of bacterial septicaemia in children and young adults. Disease epidemiology is evolving rapidly due to the introduction of vaccines and changing in bacterial antibiotic-resistance patterns. (Asymptomatic nasopharyngeal colonization with Neisseria meningitides occurs in 5-10% of adult. The aim of this study was to calculate the frequency of each serogroup of this pathogens involved in invasive infection and to study susceptibility to antibiotics of these strains. Between March 2007 and June 2010 we received, from 43 hospitals of Lombardy, 138 strains of Neisseria meningitidis, from 138 patients aged (2-80yrs. The most frequent serogroup was B (58%, followed by serogroup C (34%, serogroup G (4% and W 135 (2%. Serogroup A end X accounted for 1% of invasive infection, each. We observed a decrease in susceptibility towards penicillin in 38% of strains. In addition we studied, by REP- PCR, genotype of 9 strains selected on the basis of epidemiological data.Among these strains, 3 different clusters according to the 3 small epidemic outbreaks occurred between June and September 2009, were recognised. Seven of these strains, although belonged to the same serogroup, brought about two different clusters. The present findings demonstrated that phenotypic data are not sufficient to define epidemic clusters, therefore molecular genotyping is required.

Recurrent De Novo Mutations Affecting Residue Arg138 of Pyrroline-5-Carboxylate Synthase Cause a Progeroid Form of Autosomal-Dominant Cutis Laxa.

Science.gov (United States)

Fischer-Zirnsak, Björn; Escande-Beillard, Nathalie; Ganesh, Jaya; Tan, Yu Xuan; Al Bughaili, Mohammed; Lin, Angela E; Sahai, Inderneel; Bahena, Paulina; Reichert, Sara L; Loh, Abigail; Wright, Graham D; Liu, Jaron; Rahikkala, Elisa; Pivnick, Eniko K; Choudhri, Asim F; Krüger, Ulrike; Zemojtel, Tomasz; van Ravenswaaij-Arts, Conny; Mostafavi, Roya; Stolte-Dijkstra, Irene; Symoens, Sofie; Pajunen, Leila; Al-Gazali, Lihadh; Meierhofer, David; Robinson, Peter N; Mundlos, Stefan; Villarroel, Camilo E; Byers, Peter; Masri, Amira; Robertson, Stephen P; Schwarze, Ulrike; Callewaert, Bert; Reversade, Bruno; Kornak, Uwe

2015-09-03

Progeroid disorders overlapping with De Barsy syndrome (DBS) are collectively denoted as autosomal-recessive cutis laxa type 3 (ARCL3). They are caused by biallelic mutations in PYCR1 or ALDH18A1, encoding pyrroline-5-carboxylate reductase 1 and pyrroline-5-carboxylate synthase (P5CS), respectively, which both operate in the mitochondrial proline cycle. We report here on eight unrelated individuals born to non-consanguineous families clinically diagnosed with DBS or wrinkly skin syndrome. We found three heterozygous mutations in ALDH18A1 leading to amino acid substitutions of the same highly conserved residue, Arg138 in P5CS. A de novo origin was confirmed in all six probands for whom parental DNA was available. Using fibroblasts from affected individuals and heterologous overexpression, we found that the P5CS-p.Arg138Trp protein was stable and able to interact with wild-type P5CS but showed an altered sub-mitochondrial distribution. A reduced size upon native gel electrophoresis indicated an alteration of the structure or composition of P5CS mutant complex. Furthermore, we found that the mutant cells had a reduced P5CS enzymatic activity leading to a delayed proline accumulation. In summary, recurrent de novo mutations, affecting the highly conserved residue Arg138 of P5CS, cause an autosomal-dominant form of cutis laxa with progeroid features. Our data provide insights into the etiology of cutis laxa diseases and will have immediate impact on diagnostics and genetic counseling. Copyright © 2015 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

ROOTSTOCKS EFFECTS ON THE PHYSICOCHEMICAL CHARACTERISTICS OF BORDÔ, ISABEL AND IAC 138-22 MÁXIMO MUST AND WINE

OpenAIRE

MARLON JOCIMAR RODRIGUES DA SILVA; LUCIANA TREVISAN BRUNELLI; MARA FERNANDES MOURA; JOSÉ LUIZ HERNANDES; SARITA LEONEL; MARCO ANTONIO TECCHIO

2017-01-01

ABSTRACT It has been demonstrated that rootstocks can influence grape characteristics, but there are few data in literature about the rootstocks influence in the wine characteristics, especially in wines elaborated with Vitis labrusca or hybrid grapes. This study evaluated the influence of ‘IAC 766’ and ‘106-8 Mgt’ rootstocks on the physicochemical characteristics of ‘Bordô’, ‘Isabel’ and ‘IAC 138-22 ‘Máximo’ musts and wines. The musts were evaluated for pH, soluble solids, total acidity and...

The effect of samarium doping on structure and enhanced thermionic emission properties of lanthanum hexaboride fabricated by spark plasma sintering

Energy Technology Data Exchange (ETDEWEB)

Zhou, Shenlin; Hu, Qianglin [College of Mathematics and Physics, Jinggangshan University, Jian (China); Zhang, Jiuxing; Liu, Danmin [Key Laboratory of Advanced Functional Materials, Ministry of Education, College of Materials Science and Engineering, Beijing University of Technology, Beijing (China); Huang, Qingzhen [NIST Center for Neutron Research, National Institute of Standards and Technology, MD (United States)

2014-03-15

Single-phase polycrystalline solid solutions (La{sub 1-x}Sm{sub x})B{sub 6} (x = 0, 0.2, 0.4, 0.8, 1) are fabricated by spark plasma sintering (SPS). This study demonstrates a systematic investigation of structure-property relationships in Sm-doped LaB{sub 6} ternary rare-earth hexaborides. The microstructure, crystallographic orientation, electrical resistivity, and thermionic emission performance of these compounds are investigated. Analysis of the results indicates that samarium (Sm) doping has a noticeable effect on the structure and performance of lanthanum hexaboride (LaB{sub 6}). The analytical investigation of the electron backscatter diffraction confirms that (La{sub 0.6}Sm{sub 0.4})B{sub 6} exhibits a clear (001) texture that results in a low work function. Work functions are determined by pulsed thermionic diode measurements at 1500-1873 K. The (La{sub 0.6}Sm{sub 0.4})B{sub 6} possesses improved thermionic emission properties compared to LaB{sub 6}. The current density of (La{sub 0.6}Sm{sub 0.4})B{sub 6} is 42.4 A cm{sup -2} at 1873 K, which is 17.5% larger than that of LaB{sub 6}. The values of Φ{sub R} for (La{sub 0.6}Sm{sub 0.4})B{sub 6} and LaB{sub 6} are 1.98 ± 0.03 and 1.67 ± 0.03 eV, respectively. Furthermore, the Sm substitution of lanthanum (La) effectively increases the electrical resistivity. These results reveal that Sm doping lead to significantly enhanced thermionic emission properties of LaB{sub 6}. The compound (La{sub 0.6}Sm{sub 0.4})B{sub 6} appears most promising as a future emitter material. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Adjustable permanent quadrupoles for the next linear collider

International Nuclear Information System (INIS)

Volk, James T.

2001-01-01

The proposed Next Linear Collider (NLC) will require over 1400 adjustable quadrupoles between the main linacs' accelerator structures. These 12.7 mm bore quadrupoles will have a range of integrated strength from 0.6 to 138 Tesla, with a maximum gradient of 141 Tesla per meter, an adjustment range of +0 to -20% and effective lengths from 324 mm to 972 mm. The magnetic center must remain stable to within 1 micron during the 20% adjustment. In an effort to reduce costs and increase reliability, several designs using hybrid permanent magnets have been developed. Four different prototypes have been built. All magnets have iron poles and use Samarium Cobalt to provide the magnetic fields. Two use rotating permanent magnetic material to vary the gradient, one uses a sliding shunt to vary the gradient and the fourth uses counter rotating magnets. Preliminary data on gradient strength, temperature stability, and magnetic center position stability are presented. These data are compared to an equivalent electromagnetic prototype

Adjustable Permanent Quadrupoles for the Next Linear Collider

International Nuclear Information System (INIS)

Spencer, Cherrill M

2001-01-01

The proposed Next Linear Collider (NLC) will require over 1400 adjustable quadrupoles between the main linacs' accelerator structures. These 12.7 mm bore quadrupoles will have a range of integrated strength from 0.6 to 138 Tesla, with a maximum gradient of 141 Tesla per meter, an adjustment range of +0 to - 20% and effective lengths from 324 mm to 972 mm. The magnetic center must remain stable to within 1 micron during the 20% adjustment. In an effort to reduce costs and increase reliability, several designs using hybrid permanent magnets have been developed. Four different prototypes have been built. All magnets have iron poles and use Samarium Cobalt to provide the magnetic fields. Two use rotating permanent magnetic material to vary the gradient, one uses a sliding shunt to vary the gradient and the fourth uses counter rotating magnets. Preliminary data on gradient strength, temperature stability, and magnetic center position stability are presented. These data are compared to an equivalent electromagnetic prototype

New limits on 2ε, εβ{sup +} and 2β{sup +} decay of {sup 136}Ce and {sup 138}Ce with deeply purified cerium sample

Energy Technology Data Exchange (ETDEWEB)

Belli, P.; Bernabei, R. [INFN Sezione Roma ' ' Tor Vergata' ' , Rome (Italy); Universita di Roma ' ' Tor Vergata' ' , Dipartimento di Fisica, Rome (Italy); Boiko, R.S. [Institute for Nuclear Research, Kyiv (Ukraine); National University of Life and Environmental Sciences of Ukraine, Kyiv (Ukraine); Cappella, F. [INFN Sezione Roma, Rome (Italy); Cerulli, R.; Laubenstein, M. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Danevich, F.A.; Kropivyansky, B.N.; Polischuk, O.G.; Tretyak, V.I. [Institute for Nuclear Research, Kyiv (Ukraine); Incicchitti, A. [INFN Sezione Roma, Rome (Italy); Universita di Roma ' ' La Sapienza' ' , Dipartimento di Fisica, Rome (Italy); Mokina, V.M. [Institute for Nuclear Research, Kyiv (Ukraine); INFN Sezione Roma, Rome (Italy)

2017-08-15

A search for double electron capture (2ε), electron capture with positron emission (εβ{sup +}), and double positron emission (2β{sup +}) in {sup 136}Ce and {sup 138}Ce was realized with a 465 cm{sup 3} ultra-low background HP Ge γ spectrometer over 2299 h at the Gran Sasso underground laboratory. A 627 g sample of cerium oxide deeply purified by liquid-liquid extraction method was used as a source of γ quanta expected in double β decay of the cerium isotopes. New improved half-life limits were set on different modes and channels of double β decay of {sup 136}Ce and {sup 138}Ce at the level of T{sub 1/2} > 10{sup 17}-10{sup 18} yr. (orig.)

An Overview of NCRP Report No. 138 on Terrorist Activities

Science.gov (United States)

Poston, John, Sr.

2005-04-01

In late 1998, the National Council on Radiation Protection and Measurements (NCRP) convened Scientific Committee 46-14 to prepare a report on the radiological safety aspects of terrorist activities involving radioactivity. The work of this committee was funded through a contract with the Planning and Preparedness Division of the Office of Emergency Management of the Department of Energy. The committee was composed of a diverse group of individuals with expertise in many areas in addition to radiation safety and emergency response. These areas included law (both federal and state), public communications, and psychosocial aspects of such incidents. The statement of work focused the work of the committee, and the resulting report did not necessarily address all issues of such activities. One of the charges of the committee was to provide guidance as to necessary research and make recommendations regarding the present infrastructure with the responsibility for responding to such incidents. This presentation will provide an overview of NCRP Report No. 138 and focus on some of the critical issues raised in the report. These issues include recognition of the event, the interface between federal, state, and local authorities, exposure limits for the first-responders, clean-up criteria, training and resources, the psychosocial aspects of such events, and communications with the media and the public. This report represented the ``beginning'' of such considerations. It pointed the way for additional studies and research in this very important area.

Emodin (1,3,8-trihydroxy-6-methylanthraquinone): a spectrophotometric reagent for the determination of beryllium(II), magnesium(II) and calcium(II)

International Nuclear Information System (INIS)

Pal, T.; Jana, N.R.

1993-01-01

The individual determination of Be II , Mg II or Ca II by conventional spectrophotometry and simultaneous determination of Mg II and Ca II in mixtures by first-derivative spectrophotometry are possible at trace levels, using emodin (1,3,8-trihydroxy-6-methylanthraquinone) as spectrophotometric reagent. Interference from other metal species, application of these methods to rock samples and statistical analysis of the results are discussed. (author)

Validation of interphase fluorescence in situ hybridization (iFISH for multiple myeloma using CD138 positive cells

Directory of Open Access Journals (Sweden)

Renata Kiyomi Kishimoto

2016-06-01

Full Text Available ABSTRACT BACKGROUND: Multiple myeloma is a plasma cell neoplasm with acquired genetic abnormalities of clinical and prognostic importance. Multiple myeloma differs from other hematologic malignancies due to a high fraction of low proliferating malignant plasma cells and the paucity of plasma cells in bone marrow aspiration samples, making cytogenetic analysis a challenge. An abnormal karyotype is found in only one-third of patients with multiple myeloma and interphase fluorescence in situ hybridization is the most useful test for studying the chromosomal abnormalities present in almost 90% of cases. However, it is necessary to study the genetic abnormalities in plasma cells after their identification or selection by morphology, immunophenotyping or sorting. Other challenges are the selection of the most informative FISH panel and determining cut-off levels for FISH probes. This study reports the validation of interphase fluorescence in situ hybridization using CD138 positive cells, according to proposed guidelines published by the European Myeloma Network (EMN in 2012. METHOD: Bone marrow samples from patients with multiple myeloma were used to standardize a panel of five probes [1q amplification, 13q14 deletion, 17p deletion, t(4;14, and t(14;16] in CD138+ cells purified by magnetic cell sorting. RESULTS: This test was validated with a low turnaround time and good reproducibility. Five of six samples showed genetic abnormalities. Monosomy/deletion 13 plus t(4;14 were found in two cases. CONCLUSION: This technique together with magnetic cell sorting is effective and can be used in the routine laboratory practice. In addition, magnetic cell sorting provides a pure plasma cell population that allows other molecular and genomic studies.

sup 8 sup 9 Sr and sup 1 sup 5 sup 3 Sm-EDTMP therapy of disseminated skeletal metastasis

CERN Document Server

Zhang Jun Ning; Zhu Shou Peng

2001-01-01

A retrospective analysis was performed on 72 patients with disseminated skeletal metastasis to evaluate the effect of strontium-89 or samarium-153 EDTMP therapy. There existed 87.88% of clinical response, 12.12% of no response in the group treated with strontium-89 as compared with 90.24% of clinical response, 9.76% no response in one treated with samarium-153 EDTMP; and there were no correlation between the treatment results and the amounts of isotopes administrated. The results suggest that strontium-89 or samarium-153 EDTMP therapy is a method of first choice in the palliative treatment for disseminated skeletal metastasis

89Sr and 153Sm-EDTMP therapy of disseminated skeletal metastasis

International Nuclear Information System (INIS)

Zhang Junning; Hong Chengjiao; Zhu Shoupeng

2001-01-01

A retrospective analysis was performed on 72 patients with disseminated skeletal metastasis to evaluate the effect of strontium-89 or samarium-153 EDTMP therapy. There existed 87.88% of clinical response, 12.12% of no response in the group treated with strontium-89 as compared with 90.24% of clinical response, 9.76% no response in one treated with samarium-153 EDTMP; and there were no correlation between the treatment results and the amounts of isotopes administrated. The results suggest that strontium-89 or samarium-153 EDTMP therapy is a method of first choice in the palliative treatment for disseminated skeletal metastasis

{sup 89}Sr and {sup 153}Sm-EDTMP therapy of disseminated skeletal metastasis

Energy Technology Data Exchange (ETDEWEB)

Junning, Zhang; Chengjiao, Hong; Shoupeng, Zhu [Suzhou Univ., Suzhou (China)

2001-07-01

A retrospective analysis was performed on 72 patients with disseminated skeletal metastasis to evaluate the effect of strontium-89 or samarium-153 EDTMP therapy. There existed 87.88% of clinical response, 12.12% of no response in the group treated with strontium-89 as compared with 90.24% of clinical response, 9.76% no response in one treated with samarium-153 EDTMP; and there were no correlation between the treatment results and the amounts of isotopes administrated. The results suggest that strontium-89 or samarium-153 EDTMP therapy is a method of first choice in the palliative treatment for disseminated skeletal metastasis.

Crystal structure and tautomerism of Pigment Yellow 138 determined by X-ray powder diffraction and solid-state NMR

DEFF Research Database (Denmark)

Gumbert, Silke D.; Körbitzer, Meike; Alig, Edith

2016-01-01

The crystal structure of C.I. Pigment Yellow 138 was determined from X-ray powder diffraction data using real-space methods with subsequent Rietveld refinements. The tautomeric state was investigated by solid-state 1D and 2D multinuclear NMR experiments. In the crystals, the compound exhibits...... the NH-tautomer with a hydrogen atom situated at the nitrogen of the quinoline moiety. Direct evidence of the presence of the NH-tautomer is provided by 1H–14N HMQC solid-state NMR at very fast MAS. Solid-state dispersion-corrected density functional theory calculations with BLYP-D3 confirm...

Results of the radiological survey at 23 Yardboro Avenue, Albany, New York (AL138)

International Nuclear Information System (INIS)

Marley, J.L.

1987-12-01

A number of properties in the Albany/Colonie area have been identified as being potentially contaminated with uranium originating from the former National Lead Company's uranium forming plant in Colonie, New York. The property at 23 Yardboro Avenue in Albany, New York (AL138) was the subject of a radiological investigation initiated May 7, 1986. The property was a residence with a one and one-half-story frame house located on a rectangular lot. An asphalt driveway or parking area is located at the east side of the house. An area of /approximately/10 m /times/ 14 m at the rear was inaccessible. A diagram of the property showing the approximate boundaries and the 3-m grid network established for measurements outside the house is shown. The lot included in the radiological survey was /approximately/14 m wide by 36 m deep. Front and rear views of the property are shown. 13 refs., 5 figs., 5 tabs

Heat treatment of investment cast PH 13-8 Mo stainless steel: Part II. Isothermal aging kinetics

Science.gov (United States)

Robino, C. V.; Cieslak, M. J.; Hochanadel, P. W.; Edwards, G. R.

1994-04-01

The hardening response of investment cast PH 13-8 Mo stainless steel has been evaluated by hardness measurements following aging in the temperature range normally specified for this alloy (510 °C to 593 °C). A new relationship between fraction transformed and hardness was developed, and analysis of the data in terms of the kinetics of precipitation, in a manner similar to that frequently applied to other precipitation-hardenable martensitic steels, yielded low time exponents and a low value for the apparent activation energy. The values of the time exponents were 0.49, 0.37, 0.56, and 0.53 at 510 °C, 538 °C, 566 °C, and 593 °C, respectively, and that for the apparent activation energy was 139 kJ/mole. As has been proposed for other maraging type steels, these estimates suggest that Β-NiAl precipitates along or near dislocations and that growth of the precipitates is dominated by dislocation pipe diffusion. However, these predictions were neither supported nor refuted by transmission electron microscopy (TEM) because of difficulties in imaging the Β-NiAl precipitates at the aging times and temperatures used. Further, analysis of the data using the formalism of Wert and Zener for the growth of precipitates with interfering diffusion fields indicated that the estimates of fraction transformed from hardness data are not fully appropriate for maraging type steels. Consideration of the nature of the Avrami analysis and the electron microscopy results suggests that other phenomena, including dislocation recovery and reversion of martensite to austenite, occur at rates sufficient to convolute the Avrami analysis. It is further suggested that these results cast doubt on the fundamental implications of previous analyses of precipitation kinetics in age-hardening martensitic steels. Although the Avrami analysis was found not to provide a tenable description of the precipitation kinetics, it does provide a reasonable methodology for portrayal of the hardening response

Grazing incidence synchrotron X-ray diffraction and Moessbauer spectroscopy analyses of plasma nitrided ASTM F138 stainless steel

Energy Technology Data Exchange (ETDEWEB)

Souza, Danilo Olzon Dionysio de; Ardisson, Jose Domingos, E-mail: dolzon@gmail.com [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Silva, Edilaine Honorio [Studiecentrum voor Kernenergie (Belgium); Olzon-Dionysio, Maristela; Souza, Sylvio Dionysio de; Fabris, Jose Domingos [Universidade Federal dos Vales do Jequitinhonha e Mucuri (UFVJM), Diamantina, MG (Brazil); Martinez, L.G. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

2016-07-01

Full text: systematic investigation of samples of plasma-nitriding austenitic stainless steels ASTM F138 and AISI 316L is reported. The surface treatment of the steels through plasma-nitriding was used to improve further the hardness, wear and corrosion resistance of these stainless steels. The resulting layered crystallographic structure actually corresponds to several phases with close cell parameters, making their identification and quantification a real experimental challenge. The ASTM F138 and AISI 316L stainless steel disks were plasma nitrided for 4 h at 400 deg C in a 80% H{sub 2} -20% N2 atmosphere at 6 torr, using plasma current frequencies between 6 and 100 kHz. Data of Moessbauer (CEMS and CXMS) and grazing incidence synchrotron X-ray diffraction (XRD-SR) were systematically collected. The nitrided layer thickness were not in general influenced by the plasma frequency, except at 12 kHz, which produced a layer thickness of approximately 8.0 mm, being in average 40% thicker than for the other samples. CXMS and CEMS Moessbauer spectra for this 12 kHz-sample show a much more pronounced magnetic resonance lines than for the other samples. The Fe{sub 4}N phase presents a single magnetic hyperfine interaction; the other two (Fe{sub 2-3}N and the expanded austenite) present both paramagnetic and magnetic components, even though their hyperfine parameters may not be safely separated. We also present the results of XRD-SR that were probed at several depths. The data from these techniques may be consistently correlated and this leads to an improved model to explain the structure of the nitrided layers. (author)

A simple MRI protocol in patients with clinically suspected appendicitis: results in 138 patients and effect on outcome of appendectomy

International Nuclear Information System (INIS)

Cobben, Lodewijk; Groot, Ingrid; Kingma, Lucas; Coerkamp, Emile; Puylaert, Julien; Blickman, Johan

2009-01-01

To establish the value of breathhold magnetic resonance imaging (MRI) in the diagnosis of acute appendicitis. Over a 14-month period, 138 patients clinically suspected of having appendicitis were evaluated prospectively with MRI and comprised the study group. Fast turbo spin-echo breathhold T1, T2 and T2 fat suppression sequences were used in coronal and axial planes. The imaging results were recorded separately and subsequently correlated with clinical, radiological and histopathological follow-up. The effect of imaging strategies in patients suspected of appendicitis on hospital resources was calculated. Sixty-two of the 138 patients had a histopathologically proven appendicitis. MRI determined appendicitis in 63 patients, with one examination being false positive. The resulting sensitivity and specificity were 100% and 99%, respectively. MRI showed an alternative diagnosis in 41 of the 75 remaining patients. In 22 of the remaining 34 patients, a normal appendix was depicted with MRI. In two patients, where MRI showed no appendicitis, an alternative diagnosis or normal appendix, an unnecessary appendectomy was performed. The overall effect of using MRI in patients suspected of appendicitis on the use of hospital resources could have been a net saving between EUR 55,746 and EUR 72,534. MRI has a high accuracy in detecting and excluding appendicitis, an alternative diagnosis or showing the normal appendix, and can be a valuable and cost-effective tool in the workup of patients clinically suspected of having appendicitis. (orig.)

A simple MRI protocol in patients with clinically suspected appendicitis: results in 138 patients and effect on outcome of appendectomy

Energy Technology Data Exchange (ETDEWEB)

Cobben, Lodewijk [Medisch Centrum Haaglanden, Department of Radiology, Leidschendam (Netherlands); Groot, Ingrid [Medisch Centrum Haaglanden, Department of Surgery, Leidschendam (Netherlands); Kingma, Lucas; Coerkamp, Emile; Puylaert, Julien [Medisch Centrum Haaglanden, Department of Radiology, Den Haag (Netherlands); Blickman, Johan [Universitair Medisch Centrum St Radboud, Department of Radiology, Geert Grooteplein 10, GA, Nijmegen (Netherlands)

2009-05-15

To establish the value of breathhold magnetic resonance imaging (MRI) in the diagnosis of acute appendicitis. Over a 14-month period, 138 patients clinically suspected of having appendicitis were evaluated prospectively with MRI and comprised the study group. Fast turbo spin-echo breathhold T1, T2 and T2 fat suppression sequences were used in coronal and axial planes. The imaging results were recorded separately and subsequently correlated with clinical, radiological and histopathological follow-up. The effect of imaging strategies in patients suspected of appendicitis on hospital resources was calculated. Sixty-two of the 138 patients had a histopathologically proven appendicitis. MRI determined appendicitis in 63 patients, with one examination being false positive. The resulting sensitivity and specificity were 100% and 99%, respectively. MRI showed an alternative diagnosis in 41 of the 75 remaining patients. In 22 of the remaining 34 patients, a normal appendix was depicted with MRI. In two patients, where MRI showed no appendicitis, an alternative diagnosis or normal appendix, an unnecessary appendectomy was performed. The overall effect of using MRI in patients suspected of appendicitis on the use of hospital resources could have been a net saving between EUR 55,746 and EUR 72,534. MRI has a high accuracy in detecting and excluding appendicitis, an alternative diagnosis or showing the normal appendix, and can be a valuable and cost-effective tool in the workup of patients clinically suspected of having appendicitis. (orig.)

Stable isotope tracer marking of individual boll weevils

International Nuclear Information System (INIS)

James, W.D.; Showler, A.T.; Armstrong, J.S.; Westbrook, J.K.

2006-01-01

Stable isotope markers have been used to study animal nutrition for several decades and more recently to study the foraging and cultural habits of imported fire ants. In this work, we have extended that effort to evaluate the potential for marking boll weevils, Anthonomus grandis grandis Boheman (Coleoptera: Curculionidae), with the rare earth element samarium to aid in studies of insect invasion and pest eradication protocols. Neutron activation analysis (NAA) was performed on the marked boll weevils as well as plant material from the cotton squares on which the insects were fed. Samarium levels in non-dosed insects average about 20 ng/g or about 100 pg total element per insect. Our computed average determination limit was 36 pg samarium/weevil. The determination limit for cotton plant squares and leaves averaged 3.5 ng/g and 8.2 ng/g, respectively. These initial results indicate the NAA method is capable of identifying individual marked insects which have assimilated 1 ng of samarium, a ten-fold increase in content over average blank values. (author)

Structural and superconducting properties of (Y,Gd)Ba{sub 2}Cu{sub 3}O{sub 7-{delta}} grown by MOCVD on samarium zirconate buffered IBAD-MgO

Energy Technology Data Exchange (ETDEWEB)

Stan, L; Holesinger, T G; Maiorov, B; Feldmann, D M; Usov, I O; DePaula, R F; Civale, L; Foltyn, S R; Jia, Q X [Los Alamos National Laboratory, PO Box 1663, Los Alamos, NM 87545 (United States); Chen, Y; Selvamanickam, V [SuperPower, Incorporated, 450 Duane Avenue, Schenectady, NY 12304 (United States)

2008-10-01

Textured samarium zirconate (SZO) films have been grown by reactive cosputtering directly on an ion beam assisted deposited (IBAD) MgO template, without an intermediate homoepitaxial MgO layer. The subsequent growth of 0.9 {mu}m thick (Y,Gd)Ba{sub 2}Cu{sub 3}O{sub 7-{delta}} ((Y, Gd)BCO) films by metal organic chemical vapor deposition (MOCVD) yielded well textured films with a full width at half maximum of 1.9{sup 0} and 3.4{sup 0} for the out-of-plane and in-plane texture, respectively. Microstructural characterizations of the SZO buffered samples revealed clean interfaces. This indicates that the SZO not only provides a diffusion barrier, but also functions as a buffer for (Y, Gd)BCO grown by MOCVD. The achievement of self-field critical current densities (J{sub c}) of over 2 MA cm{sup -2} at 75.5 K is another proof of the effectiveness of SZO as a buffer on the IBAD-MgO template. The in-field measurements revealed an asymmetric angular dependence of J{sub c} and a shift of the ab-plane maxima due to the tilted nature of the template and (Y,Gd){sub 2}O{sub 3} particles existing in the (Y, Gd)BCO matrix. The present results are especially important because they demonstrate that high temperature superconducting coated conductors with simpler architecture can be fabricated using commercially viable processes.

Estudio seccional de crecimiento, desarrollo y nutrición en 12.138 niños de Bogotá, Colombia

Directory of Open Access Journals (Sweden)

Helberto Luna Jaspe

1971-01-01

Full Text Available Se informan los resultados de un estudio antropométrico practicado en 12.138 individuos de ambos sexos, pertenecientes a 4 clases socio-económicas de Bogotá, Colombia. Los valores centilares encontrados en grupo de edad y sexo, se proponen como patrones de referencia en la evaluación del crecimiento de niños de comunidades de características similares a la estudiada. Se comenta acerca de la influencia de los factores ambientales sobre el potencial genético de crecimiento, así como de la capacidad de adaptación de la especie humana a las influencias ambientales.

COMPETITION BEETWEN DYNAMIC RECUPERATION AND RECRYSTALLIZATION OF ASTM F 138 AUSTENITIC STAINLESS STEEL UTILIZED IN MEDICAL DEVICES

Directory of Open Access Journals (Sweden)

Fabio Henrique Casarini Geronimo

2013-06-01

Full Text Available ASTM F 138 austenitic stainless steel has being used in the manufacture of orthopedical devices by hot forging. In this work, the flow stress curves are determined by hot torsion tests in a wide range of temperatures and strain rates. With the observed microestrutural evolution by optical microscopy in different hot forming conditions in addiction with EBSD (Electron Backscatter Diffraction techniques it is possible to obtained the recrystallized volume fraction and the misorientation angles of the samples. Due to the intermediate level of stacking fault energy of this material, during the dynamic softening occurs a competition between recrystallization and recovery. The aim of this work is to identify the softening mechanisms in this stainless steel, as well as in which hot work conditions they become more active.

PCB138, but not PCB153 and PCB180, acts as a weak antiandrogen in vitro

DEFF Research Database (Denmark)

Vinggaard, A.M.; Bonefeld-Jørgensen, Eva Cecilie

2000-01-01

The polychlorinated biphenyls (PCBs) constitute a group of persistent environmental chemicals including 209 possible congeners exhibiting a variety of chlorine substitution patterns. Due to their lipophilic nature and resistance toward biotransformation, PCBs accumulate in the food chain and all...... environmental matrixes including human adipose tissue, blood and milk. In most biological extracts PCB#138 (2,2',3,4,4',5-hexaCB), PCB#153 (2,2',4,4',5,5'-hexaCB), and PCB#180 (2,2',3,4,4',5,5'-heptaCB) are the dominating components. Depending on the position and number of chlorine substitutions, different...... classes of PCB congeners elicit a complex spectrum of biological and toxic responses in in vivo and in vitro models. Some PCBs exert dioxin-like activities mediated through the aryl hydrocarbon receptor (Ah receptor) giving rise to health risk such as organ toxicity and carcinogenesis. Although reports...

An UHPLC-MS/MS method for simultaneous quantification of human amyloid beta peptides Aβ1-38, Aβ1-40 and Aβ1-42 in cerebrospinal fluid using micro-elution solid phase extraction.

Science.gov (United States)

Lin, Ping-Ping; Chen, Wei-Li; Yuan, Fei; Sheng, Lei; Wu, Yu-Jia; Zhang, Wei-Wei; Li, Guo-Qing; Xu, Hong-Rong; Li, Xue-Ning

2017-12-01

Amyloid beta (Aβ) peptides in cerebrospinal fluid are extensively estimated for identification of Alzheimer's disease (AD) as diagnostic biomarkers. Unfortunately, their pervasive application is hampered by interference from Aβ propensity of self-aggregation, nonspecifically bind to surfaces and matrix proteins, and by lack of quantitive standardization. Here we report on an alternative Ultra-high performance liquid chromatography-tandem mass spectrometry (UHPLC-MS/MS) method for simultaneous measurement of human amyloid beta peptides Aβ1-38, Aβ1-40 and Aβ1-42 in cerebrospinal fluid (CSF) using micro-elution solid phase extraction (SPE). Samples were pre-processing by the mixed-mode micro-elution solid phase extraction and quantification was performed in the positive ion multiple reaction monitoring (MRM) mode using electrospray ionization. The stable-isotope labeled Aβ peptides 15 N 51 - Aβ1-38, 15 N 53 - Aβ1-40 and 15 N 55 - Aβ1-42 peptides were used as internal standards. And the artificial cerebrospinal fluid (ACSF) containing 5% rat plasma was used as a surrogate matrix for calibration curves. The quality control (QC) samples at 0.25, 2 and 15ng/mL were prepared. A "linear" regression (1/x 2 weighting): y=ax+b was used to fit the calibration curves over the concentration range of 0.1-20ng/mL for all three peptides. Coefficient of variation (CV) of intra-batch and inter-batch assays were all less than 6.44% for Aβ1-38, 6.75% for Aβ1-40 and 10.74% for Aβ1-42. The precision values for all QC samples of three analytes met the acceptance criteria. Extract recoveries of Aβ1-38, Aβ1-40 and Aβ1-42 were all greater than 70.78%, both in low and high QC samples. The stability assessments showed that QC samples at both low and high levels could be stable for at least 24h at 4°C, 4h at room temperature and through three freeze-thaw cycles without sacrificing accuracy or precision. And no significant carryover effect was observed. This validated UHPLC

The Level of Europium-154 Contaminating Samarium-153-EDTMP Activates the Radiation Alarm System at the US Homeland Security Checkpoints

Directory of Open Access Journals (Sweden)

Mohammed Najeeb Al Hallak

2009-08-01

Full Text Available 153Sm-EDTMP is a radiopharmaceutical composed of EDTMP (ethylenediamine-tetramethylenephosphonate and Samarium-153 [1]. 153Sm-EDTMP has an affinity for skeletal tissue and concentrates in areas with increased bone turnover; thus, it is successfully used in relieving pain related to diffuse bone metastases [1]. The manufacturing process of 153Sm-EDTMP leads to contamination with 154Eu (Europium-154 [2]. A previous study only alluded to the retention of 154Eu in the bones after receiving treatment with 153Sm-EDTMP [2]. Activation of the alarm at security checkpoints after 153Sm-EDTMP therapy has not been previously reported. Two out of 15 patients who received 153Sm-EDTMP at Roger Maris Cancer Center (Fargo, N. Dak., USA activated the radiation activity sensors while passing through checkpoints; one at a US airport and the other while crossing theAmerican-Canadian border. We assume that the 154Eu which remained in the patients’ bones activated the sensors. Methods: In order to investigate this hypothesis, we obtained the consent from 3 of our 15 patients who received 153Sm-EDTMP within the previous 4 months to 2 years, including the patient who had activated the radiation alarm at the airport. The patients were scanned with a handheld detector and a gamma camera for energies from 511 keV to 1.3 MeV. Results: All three patients exhibited identical spectral images, and further analysis showed that the observed spectra are the result of 154Eu emissions. Conclusion: Depending on the detection thresholds and windows used by local and federal authorities, the remaining activity of 154Eu retained in patients who received 153Sm-EDTMP could be sufficient enough to increase the count rates above background levels and activate the sensors. At Roger Maris Cancer Center, patients are now informed of the potential consequences of 153Sm-EDTMP therapy prior to initiating treatment. In addition, patients treated with 153Sm-EDTMP at Roger Maris Cancer Center

Carrageenan-based semi-IPN nanocomposite hydrogels: Swelling kinetic and slow release of sequestrene Fe 138 fertilizer

Directory of Open Access Journals (Sweden)

Mohammad Kazem Bahrami

2016-09-01

Full Text Available Nanocomposite hydrogels based on kappa-carrageenan were synthesized by incorporating natural sodium montmorillonite (Cloisite nanoclay. Acrylamide (AAm and methylenebisacrylamide (MBA were used as a monomer and a crosslinker, respectively. Effects of reaction variables on the swelling kinetics were studied. The results revealed that the rate of swelling for nanocomposites with high content of MBA was higher than those of nanocomposites consisting of low content of MBA. Similar to the effect of MBA, the rate of swelling enhanced as the carrageenan content was decreased. The influence of clay content on swelling rate was not remarkable. The experimental swelling data were evaluated by pseudo-first-order and pseudo-second-order kinetic models. The swelling data described well by pseudo-second-order kinetic model. Sequestrene Fe 138 (Sq as an agrochemical was loaded into nanocomposites and releasing of this active agent from nanocomposites was studied. The clay-free hydrogel released the whole loaded Sq; whereas the presence of clay restricted the release of Sq.

The Fragmentation of Heavy Nuclei by 13.8 GeV/c Protons as a Contribution to the Study of the Interaction Mechanism and Nuclear Structure; Fragmentacion de nucleos pesados por protones de 13'8 GeV/c, como contribucion al estudio del mecanismo de interaccion y estructura nuclear

Energy Technology Data Exchange (ETDEWEB)

Gil Perez, D

1967-07-01

We present here an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs.

Isolation of Human CD138+ Microparticles from the Plasma of Patients with Multiple Myeloma

Directory of Open Access Journals (Sweden)

Sabna Rajeev Krishnan

2016-01-01

Full Text Available The confinement of multiple myeloma (MM to the bone marrow microenvironment requires an invasive bone marrow biopsy to monitor the malignant compartment. The existing clinical tools used to determine treatment response and tumor relapse are limited in sensitivity mainly because they indirectly measure tumor burden inside the bone marrow and fail to capture the patchy, multisite tumor infiltrates associated with MM. Microparticles (MPs are 0.1- to 1.0-μm membrane vesicles, which contain the cellular content of their originating cell. MPs are functional mediators and convey prothrombotic, promalignant, proresistance, and proinflammatory messages, establishing intercellular cross talk and bypassing the need for direct cell-cell contact in many pathologies. In this study, we analyzed plasma cell–derived MPs (CD138+ from deidentified MM patients (n = 64 and normal subjects (n = 18 using flow cytometry. The morphology and size of the MPs were further analyzed using scanning electron microscopy. Our study shows the proof of a systemic signature of MPs in MM patients. We observed that the levels of MPs were significantly elevated in MM corresponding to the tumor burden. We provide the first evidence for the presence of MPs in the peripheral blood of MM patients with potential applications in personalized MM clinical monitoring.

Observations of three bright extragalactic radiosources at the 1.38 cm wavelength with the resolution up to 8''

International Nuclear Information System (INIS)

Berlin, A.B.; Korenev, Yu.V.; Lesovoj, V.Yu.; Parijskij, Yu.N.; Smirnov, V.I.; Soboleva, N.S.

1980-01-01

New observations of radiogalaxies in the shortest wavelength region of the RATAN-600 radiotelescope were performed using the 1.38-cm radiometer. One-dimentional radiobrightness distribution of 3C 405 (Cyg A) and Cen A as well as instantaneous spectra of the nuclear sources in 3C 111, 3C 405 and Cen A are presented. Spectra of nuclear components in radiosources 3C 111 and Cen A show marked variations at the time scale of the order of three years. Fluxes for the nuclear component of Cyg A at the wavelengths greater than 3.9 cm have decreased during the last 5 years. Wavelength independence is pointed out for brightness distribution in the main components of all sources. This contradicts to some extragalactic radiosources models in which radiation losses of relativistic electrons when moving from the hot ''spots'' to ''tails'' are suggested

13.8 the quest to find the true age of the Universe and the Theory of Everything

CERN Document Server

Gribbin, John

2015-01-01

The twentieth century gave us two great theories of physics. The general theory of relativity describes the behaviour of very large things; quantum theory the behaviour of very small things. In this landmark book, John Gribbin - one of the best-known writers of popular science over the past 30 years - presents his own version of the Holy Grail of physics, the search that has been going on for decades to find a unified 'Theory of Everything' that combines these ideas into one mathematical package, a single equation that could be printed on a T-shirt, containing the answer to life, the Universe and everything. With his inimitable mixture of science, history and biography, Gribbin shows how - despite scepticism among many physicists - these two great theories are indeed very compatible, and point to a deep truth about the nature of our existence. The answer lies, intriguingly, with the age of the Universe: 13.8 billion years.

Synthesis of dihydropyrimidin-2-one/thione library and cytotoxic activity against the human U138-MG and Rat C6 glioma cell lines

International Nuclear Information System (INIS)

Canto, Romulo F.S.; Eifler-Lima, Vera Lucia; Bernardi, Andressa; Battastini, Ana Maria O.; Russowsky, Dennis

2011-01-01

Two series of 4-aryl-3,4-dihydropyrimidin-2(1H)-(thio)ones including monastrol (1a), have been synthesized by an environment-friendly methodology based on the combined use of citric acid or oxalic acid and TEOF (triethylorthoformate). The library was evaluated as inhibitor of cell proliferation on two glioma cell lines (human-U138-MG and Rat-C6). The compounds derived from thiourea 1f and 1d were more cytotoxic than monastrol. The compound derived from urea 2d showed the highest cytotoxic activity among the analyzed compounds. (author)

Microwave studies on the dielectric properties of Sm3+ and Sm3+/CdTe doped sol-gel silica glasses

International Nuclear Information System (INIS)

Mathew, Siby; Rejikumar, P.R.; Yohannan, Jaimon; Mathew, K.T.; Unnikrishnan, N.V.

2008-01-01

Complex permittivity and conductivity studies of Samarium and Samarium/semiconductor cadmium telluride sol-gel silica glass samples were done. We use cavity perturbation technique at S band frequencies using TE 10p Mode. Structural evolution of the matrix on annealing is discussed based on FTIR analysis/XRD power diffraction. In cavity perturbation technique dielectric parameters like complex permittivity and conductivity are determined by measuring changes in resonant frequency due to small perturbation inside the cavity produced by the introduction of the samples. The addition of the semiconductor along with the samarium was found to lower the permittivity, loss factor and conductivity. Variations of permittivity values with annealing temperature find applications in IC Technology, optic fibre communication, etc. The Sm 3+ /CdTe doped glasses can also be used in the fabrication of new and improved materials for microwave electronic circuits and in electromagnetic shielding devices

MERLIN observations of the OH/IR stars OH 53.6-0.2, OH 138.0+7.2 and OH 141.7+3.5

International Nuclear Information System (INIS)

Chapman, J.; Cohen, R.J.; Norris, R.P.; Diamond, P.J.; Booth, R.S.

1984-01-01

OH maser emission from the three OH/IR stars OH 53.6-0.2, OH 138.0+7.2 and OH 141.7+3.5 has been mapped with an angular resolution of 0.28 arcsec and a velocity resolution of 0.7 km s -1 using the Jodrell Bank MERLIN array. Maps are presented of the 1612-MHz OH emission over individual velocity ranges. The maps are consistent with a uniform expanding shell model, and by fitting such models to the data the angular diameters of the shells have been estimated to an accuracy of approx. 25 per cent. (author)

Corrosion fatigue investigation of a high nitrogen 12% Cr-steel and of a high strength martensitic PH 13-8 Mo steel under simulated steam turbine conditions. Final report

International Nuclear Information System (INIS)

Schmitt-Thomas, K.G.; Schweigart, H.

1992-01-01

This report summarizes the results of the corrosion fatigue investigations of two martensitic stainless steels (PH 13-8 Mo, X20 CrMoV 12 1; corrosion medium: 0,01 m NaCl or 22 wt% NaCl; pH value 3 or 7). The working programm includes electrochemical and corrosion fatigue tests. Also chemical analysis, mechanical-technological and metallographical as SEM investigations were performed. (orig.)

Udvikling af materialer til brintpermeable membraner

DEFF Research Database (Denmark)

Bentzer, Henrik Karnøe

doped samarium titanate, lanthanum magnesium titanate and strontium cerate doped with yttrium and nickel. Concentration cell measurements were used to estimate transport numbers for protons and oxide ions in yttrium doped strontium cerate and calcium doped samarium titanate. Furthermore, the voltage......Due to global warming as well as other factors, it is necessary to find alternatives to the current consumption of fossil fuels. Oxide materials with high protonic conductivity can potentially find application within many different technological fields in a society that is based on renewable energy...

Thermodynamics and statistical mechanics of some hydrides of the lanthanides and actinides

International Nuclear Information System (INIS)

Mintz, M.H.

1976-06-01

This work deals mainly with the thermodynamic and physical properties of the hydrides of the lanthanides and actinides. In addition, statistical models have been developed and applied to metal-hydrogen systems. A kinetic study of the uranium-hydrogen system was performed. The thermodynamic properties of the hydrides of neptunium, thorium, praseodymium, neodymium, samarium and europium were determined. In addition the samarium-europium-hydrogen ternary system was investigated. Moessbauer effect measurements of cubic neptunium hydrides were interpreted according to a model presented. A comparison. (author)

Environmental Assessment for Central Power and Light Company`s proposed Military Highway-CFE tie 138/69-kV transmission line project Brownsville, Cameron County, Texas

Energy Technology Data Exchange (ETDEWEB)

1992-04-01

Central Power and Light Company (CPL) intends to upgrade its existing transmission line ties with the Commision Federal de Electricidad (CFE) system in Mexico. CPL currently has a single 69-kilovolt (kV) transmission line in the Brownsville area which connects CPL`s system with the system of CFE. This existing line runs between the Brownsville Switching Station, located on Laredo Road in Brownsville, Cameron County, Texas, and an existing CFE 69-kV line at the Rusteberg Bend of the Rio Grande in Cameron County. Under current conditions of need, the existing 69-kV line does not possess sufficient capability to engage in appropriate power exchanges. Therefore, CPL is proposing to build a new line to link up with CFE. This proposed line would be a double-circuit line, which would (1) continue (on a slightly relocated route) the existing 69-kV tie from CPL`s Brownsville Switching Station to CFE`s facilities, and (2) add a 138-kV tie from the Military Highway Substation, located on Military Highway (US Highway 281), to CFE`s facilities. The proposed 138/69-kV line, which will be constructed and operated by CPL, will be built primarily on steel single-pole structures within an average 60-foot (ft) wide right-of-way (ROW). It will be approximately 6900--9200 ft (1.3--1.7 miles) in length, depending on the alternative route constructed.

Establishment and antitumor effects of dasatinib and PKI-587 in BD-138T, a patient-derived muscle invasive bladder cancer preclinical platform with concomitant EGFR amplification and PTEN deletion.

Science.gov (United States)

Chang, Nakho; Lee, Hye Won; Lim, Joung Eun; Jeong, Da Eun; Song, Hye Jin; Kim, Sudong; Nam, Do-Hyun; Sung, Hyun Hwan; Jeong, Byong Chang; Seo, Seong Il; Jeon, Seong Soo; Lee, Hyun Moo; Choi, Han-Yong; Jeon, Hwang Gyun

2016-08-09

Muscle-invasive bladder cancer (MIBC) consists of a heterogeneous group of tumors with a high rate of metastasis and mortality. To facilitate the in-depth investigation and validation of tailored strategies for MIBC treatment, we have developed an integrated approach using advanced high-throughput drug screening and a clinically relevant patient-derived preclinical platform. We isolated patient-derived tumor cells (PDCs) from a rare MIBC case (BD-138T) that harbors concomitant epidermal growth factor receptor (EGFR) amplification and phosphatase and tensin homolog (PTEN) deletion. High-throughput in vitro drug screening demonstrated that dasatinib, a SRC inhibitor, and PKI-587, a dual PI3K/mTOR inhibitor, exhibited targeted anti-proliferative and pro-apoptotic effects against BD-138T PDCs. Using established patient-derived xenograft models that successfully retain the genomic and molecular characteristics of the parental tumor, we confirmed that these anti-tumor responses occurred through the inhibition of SRC and PI3K/AKT/mTOR signaling pathways. Taken together, these experimental results demonstrate that dasatinib and PKI-587 might serve as promising anticancer drug candidates for treating MIBC with combined EGFR gene amplification and PTEN deletion.

The Fragmentation of Heavy Nuclei by 13.8 GeV/c Protons as a Contribution to the Study of the Interaction Mechanism and Nuclear Structure

International Nuclear Information System (INIS)

Gil Perez, D.

1967-01-01

We present he re an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs

Valency state changes in lanthanide-contained systems under high pressure

Energy Technology Data Exchange (ETDEWEB)

Jayaraman, A

1980-08-01

Changes in valency state induced by pressure in samarium sulphide SmS remind one of alchemy, as the mat black initial substance shines golden after the electron transition. The alchemist's dream is of course not realized, however the compound does exhibit an unusually interesting behaviour in the new state. The valency state of samarium as newly appeared fluctuated very rapidly between two electron configurations. Manipulation of the valency state by pressure or chemical substitution can basically change the physical properties of systems containing lanthanides. The phenomena are described and discussed in the following survey.

Neutron capture cross section measurement of $^{151}Sm$ at the CERN neutron Time of Flight Facility (nTOF)

CERN Document Server

Abbondanno, U; Alvarez-Velarde, F; Alvarez-Pol, H; Andriamonje, Samuel A; Andrzejewski, J; Badurek, G; Baumann, P; Becvar, F; Benlliure, J; Berthoumieux, E; Calviño, F; Cano-Ott, D; Capote, R; Cennini, P; Chepel, V; Chiaveri, Enrico; Colonna, N; Cortés, G; Cortina-Gil, D; Couture, A; Cox, J; Dababneh, S; Dahlfors, M; David, S; Dolfini, R; Domingo-Pardo, C; Durán, I; Embid-Segura, M; Ferrant, L; Ferrari, A; Ferreira-Marques, R; Frais-Kölbl, H; Furman, W; Gonçalves, I; Gallino, R; Gonzalez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martínez, A; Isaev, S; Jericha, E; Kappeler, F; Kadi, Y; Karadimos, D; Kerveno, M; Ketlerov, V; Köhler, P; Konovalov, V; Krticka, M; Lamboudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marrone, S; Martinez-Val, J; Mastinu, P; Mengoni, A; Milazzo, P M; Molina-Coballes, A; Moreau, C; Mosconi, M; Neves, F; Oberhummer, Heinz; O'Brien, S; Pancin, J; Papaevangelou, T; Paradela, C; Pavlik, A; Pavlopoulos, P; Perlado, J M; Perrot, L; Pignatari, M; Plag, R; Plompen, A; Plukis, A; Poch, A; Policarpo, Armando; Pretel, C; Quesada, J; Raman, S; Rapp, W; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, Carlo; Rudolf, G; Rullhusen, P; Salgado, J; Soares, J C; Stéphan, C; Tagliente, G; Taín, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarín, D; Vincente, M C; Vlachoudis, V; Voss, F; Wendler, H; Wiescher, M; Wissha, K

2004-01-01

The measurement of **1**5**1Sm(n, gamma)**1**5**2Sm (samarium) cross section showed improved performance of the new spallation neutron facility. It covered a wide energy range with good resolution, high neutron flux, low backgrounds and a favourable duty factor. The samarium cross section was found to be of great importance for characterizing neutron capture nucleosynthesis in asymptotic giant stars. The combination of these features provided a promising basis for a broad experimental program directed towards application in astrophysics and advanced nuclear technologies. (Edited abstract)

Radiochemical and biological studies, including in non-human primates, towards indigenous development of 153Sm-EDTMP for metastatic bone pain palliation

International Nuclear Information System (INIS)

Saraswathy, P.; Mehra, K.S.; Ranganatha, D.K.; Das, M.K.; Balasubramanian, P.S.; Ananthakrishnan, M.; Ramamoorthy, N.; Gunasekaran, S.; Shanthly, N.; Retna Ponmalar, J.; Narasimhan, S.

2001-01-01

The combination of ease of formulation and superior biological features of 153 Sm-EDTMP in terms of safety and efficacy for metastatic bone pain palliation, together with the prospect of better logistics of production, has prompted extensive efforts by many groups world over for its preparation and evaluation. Our efforts have been directed towards exploring the feasibility for formulation of 153 Sm-EDTMP suitable for human use by neutron activation in medium flux reactors of the freely available and inexpensive natural samarium oxide target. The emphasis in biological studies was placed on tests in larger animals (monkeys) as a prelude to clinical evaluation. Feasibility to achieve reasonably high specific activity of 300-700 mCi/mg Sm at EOB with natural samarium has been adequately demonstrated. The radioeuropium contamination, estimated by γ-spectrometry to be 153 Sm-EDTMP from natural samarium at high radioactive concentrations of 40-50 mCi 153 Sm/mL, acceptable biolocalization, as revealed by both biodistribution studies in rats (femur uptake of 2-3% injected dose at 1h p.i. and retention up to 120 h p.i.) and gamma camera images in monkeys and adequate stability have been feasible. Excellent quality bone images of monkeys were recorded showing rapid clearance from blood, visualization of skeleton, clearance from kidneys within 2 hours and retention in skeleton up to 116 hours p.i. No significant activity in other soft tissues was noted. Comparative evaluation of the product prepared from enriched samarium as well as using in-house synthesized EDTMP has, likewise, revealed identical biolocalization features. EDTMP dose tolerance test in mice showed a safety factor of about 100 for a product made from natural samarium at an adult human dose of 50 mCi 153 Sm. Feasibility for production, reasonable safety and satisfactory biolocalisation of the indigenous product has been adequately established so as to warrant clinical trials in patients. (author)

Multicentre trial on the efficacy and toxicity of single-dose samarium-153-ethylene diamine tetramethylene phosphonate as a palliative treatment for painful skeletal metastases in China

International Nuclear Information System (INIS)

Tian Jia-he; Zhang Jin-ming; He Yi-jie; Hou Qing-tian; Oyang Qiao-hong; Wang Jian-min; Chuan Ling

1999-01-01

A multicentre trial was organized in China as part of an international coordinated research project to study the efficacy and toxicity of single-dose samarium-153 ethylene diamine tetramethylene phosphonate (EDTMP) as a palliative treatment for painful skeletal metastases. One hundred and five patients with painful bone metastases from various primaries were treated with 153 Sm-EDTMP at a dose of 37 MBq/kg(group I) or 18.5 MBq/kg (group II). The effects were evaluated according to change in daily analgesic consumption, pain score, sum of effect product (SEP), Physician's Global Assessment (PGA), blood counts, and organ function tests conducted regularly for 16 weeks. Fifty-eight of 70 patients in group I and 30 of 35 in group II had a positive response, with SEPs of 22.29±14.47 and 20.13±13.90 respectively. Of 72 patients who had been receiving analgesics, 63 reduced their consumption. PGA showed that the Karnofsky score (KS) increased from 58.54±25.90 to 71.67±26.53, indicating improved general condition, but the difference was not significant. Among subgroups of patients, only those with breast cancer showed a significant change in the Karnofsky score after treatment. Inter-group differences were found for net change in KS between patients with lung and patients with breast cancer, and between patients with lung and patients with oesophageal cancer. Seventeen patients showed no response. No serious side-effects were noted, except for falls in the white blood cell (nadir 1.5 x 10 9 /l) and platelet (nadir 6.0 x 10 10 /l) counts in 44/105 and 34/105 cases, respectively. Ten patients had an abnormal liver function test. Response and side-effects were both independent of dose. In conclusion, 153 Sm-EDTMP provided effective palliation in 83.8% of patients with painful bone metastases; the major toxicity was temporary myelosuppression. Further studies are needed to identify better ways of determining the appropriate dose in the individual case and the efficacy of

Avaliação de compostos fenólicos em geléia de uva produzida com a variedade IAC-138-22 (máximo)

OpenAIRE

Luciula Lemos Lima Morelli

2011-01-01

Resumo: O presente trabalho buscou avaliar a presença de compostos fenólicos antioxidantes em geleia de uva produzida com a variedade Máximo (IAC-138-22), por meio de (1) métodos colorimétricos e (2) cromatografia liquida de alta eficiência. Foram produzidas 3 formulações de geleia com a nova variedade e 3 outras com a mistura entre as variedades Niágara Rosada e Isabel, para efeito comparativo. As formulações diferiam em relação à quantidade de casca de uva incorporada à formulação, sendo a ...

Mechanical properties of Zr41.2Ti13.8Ni10Cu12.5Be22.5 bulk metallic glass with different geometric confinements

Science.gov (United States)

Zhang, Changqin; Zhang, Haifeng; Sun, Qilei; Liu, Kegao

2018-03-01

Zr41.2Ti13.8Ni10Cu12.5Be22.5 (Vit 1) bulk metallic glass with Cu sleeves at different positions was prepared by the Cu mold casting method, and the effects of different geometric confinements offered by Cu sleeves on the mechanical properties of Vit 1 were investigated. It was found that the mechanical properties were prominently influenced by different geometric confinements and the plasticity could be modified by optimizing the positions of Cu sleeves. The results revealed that shear band initiation and propagation could be efficiently intervened by changing the radial boundary restraints, which led to quite different mechanical behaviors.

A138

Directory of Open Access Journals (Sweden)

K. Yurchenko

2015-11-01

Thus, results suggest that vascular disruption in the NDV-treated group indicates the virus ability to directly or indirectly affect tumor angiogenesis and regulate tissue trophism in that way. Understanding how and in which step this effect occurs may provide capacity to use oncolytic NDV strains for therapeutic benefit.

Determination of the {sup 151}Sm half-life

Energy Technology Data Exchange (ETDEWEB)

Be, Marie-Martine; Cassette, Philippe [CEA, LIST, Gif sur Yvette (France). LNE-Laboratoire National Henri Becquerel; Isnard, Helene [CEA-LANIE, Gif sur Yvette (France); and others

2015-07-01

New measurements have been undertaken to determine the half-life of {sup 151}Sm. A pure {sup 151}Sm solution was obtained after chemical separation from a samarium solution resulting from the dissolution of an irradiated samarium sample. The concentration of {sup 151}Sm in the solution was measured by mass spectrometry, combined with the isotope dilution technique. The activity of the solution was measured by liquid scintillation counting by six European laboratories as part of an international comparison. These combined results lead to a half-life of T{sub 1/2} = 94.6(6)a.

The effect of equal channel angular pressing on the tensile properties and microstructure of two medical implant materials: ASTM F-138 austenitic steel and Grade 2 titanium

Science.gov (United States)

Mendes Filho, A. de A.; Sordi, V. L.; Kliauga, A. M.; Ferrante, M.

2010-07-01

Titanium and F-138 stainless steel are employed in bone replacement and repair. The former material was ECAP-deformed at room temperature and at 300°C, followed in some cases by cold rolling. The steel was ECAP-deformed at room temperature only. Work-hardening behavior was studied by making use of the Kocks-mecking plots and microstructural evolution was followed by TEM. Conclusions show that for Ti, ECAP combined with cold rolling gives the best strength-ductility combination, whilst room temperature ECAP increases the tensile strength of the steel but caused substantial ductility loss.

Guided ion beam and theoretical studies of the bond energy of SmS+

Science.gov (United States)

Armentrout, P. B.; Demireva, Maria; Peterson, Kirk A.

2017-12-01

Previous work has shown that atomic samarium cations react with carbonyl sulfide to form SmS+ + CO in an exothermic and barrierless process. To characterize this reaction further, the bond energy of SmS+ is determined in the present study using guided ion beam tandem mass spectrometry. Reactions of SmS+ with Xe, CO, and O2 are examined. Results for collision-induced dissociation processes with all three molecules along with the endothermicity of the SmS+ + CO → Sm+ + COS exchange reaction are combined to yield D0(Sm+-S) = 3.37 ± 0.20 eV. The CO and O2 reactions also yield a SmSO+ product, with measured endothermicities that indicate D0(SSm+-O) = 3.73 ± 0.16 eV and D0(OSm+-S) = 1.38 ± 0.27 eV. The SmS+ bond energy is compared with theoretical values characterized at several levels of theory, including CCSD(T) complete basis set extrapolations using all-electron basis sets. Multireference configuration interaction calculations with explicit spin-orbit calculations along with composite thermochemistry using the Feller-Peterson-Dixon method and all-electron basis sets were also explored for SmS+, and for comparison, SmO, SmO+, and EuO.

Optimal Timing of Bisphosphonate Administration in Combination with Samarium-153 Oxabifore in the Treatment of Painful Metastatic Bone Disease

International Nuclear Information System (INIS)

Rasulova, Nigora; Lyubshin, Vladimir; Arybzhanov, Dauranbek; Sagdullaev, Sh.; Krylov, Valery; Khodjibekov, Marat

2013-01-01

While bisphosphonates are indicated for prevention of skeletal-related events, radionuclide therapy is widely used for treatment of painful bone metastases. Combined radionuclide therapy with bisphosphonates has demonstrated improved effectiveness in achieving bone pain palliation in comparison to mono therapy with radionuclides or bisphosphonates alone. However, there are conflicting reports as to whether bisphosphonates adversely influence skeletal uptake of the bone-seeking radiotracers used for therapy. Recent studies analyzing influence of Zoledronic acid on total bone uptake of Samarium-153 EDTMP (Sm-153 EDTMP) by measuring cumulative urinary activity of Sm-153 on baseline study, as well as in combination with bisphosphonates (administrated 48 hours prior to Sm-153) did not provide any statistically significant difference in urinary excretion of Sm-153 between the two groups. It may be noted that the exact temporal sequence of bisphosphonate administration vis a vis radionuclide therapy has not yet been studied. One of the side effects of bisphosphonates is transient flare effect on bone pain. Radionuclide therapy may also have similar side effect. Keeping in view the above the current study was designed with the main objective of determining the exact timing of bisphosphonate administration in patients receiving combined therapy so as to achieve optimal efficacy of bone pain palliation. Ninety-three patients suffering from metastatic bone pain who received combination therapy with Sm-153 oxabifore (an analog of Sm-153 EDTMP) and Zoledronic acid were divided into three groups according to the timing of Zoledronic acid administration: Group I: 39 patients who received Zoledronic acid 7 or more days prior to Sm-153 oxabifore treatment; Group II: 32 patients who received Zoledronic acid 48-72 hours prior to Sm-153 oxabifore treatment and Group III: 22 patients who received Zoledronic acid 7 days after Sm-153 oxabifore treatment. Sm-153 oxabifore was administered

A educação como projeto de melhoramento racial: uma análise do art. 138 da Constituição de 1934 (Education as a racial enhancement project: an analysis of art. 138 of the 1934 Brazilian Constitution

Directory of Open Access Journals (Sweden)

Simone Rocha

2018-01-01

Full Text Available Historically, laws are created to meet the needs of a particular place and time, taking into account cultural, ideological and political aspects on which they act. In this sense, the Brazilian parliamentarians intended to encourage the promotion of an “eugenic education” by adopting legislative and administrative measures related to social hygiene, seeking racial “improvement” through socio-educational measures. For the eugenics, the “education” factor would only have the purpose of stimulating the good strains of the “well born.” The bill advocated in Art. 138 of the 1934 Constitution would pretend to act before a population constituted mostly of blacks and mulattos, making it diffcult for them to contract marriage with white people of high social status. The present article sought to analyze the discourse of parliamentarians and eugenics that defended and articulated the preliminary project that advocated the encouragement of eugenic education in a moment of signifcant historical and educational importance. Approaching this theme leads us to think how political actions, articulated aiming at racial improvement, influenced the decisions in the educational policy of the country, and for which social segments did they effectively act as a propellant of social and human development though education. Historicamente as leis são criadas visando atender às necessidades de um determinado local e tempo, levando em consideração aspectos culturais, ideológicos e políticos sobre os quais atuam. Nesse sentido, os parlamentares brasileiros pretendiam fomentar o estímulo a uma “educação eugênica” pela adoção de medidas legislativas e administrativas relacionadas à higiene social buscando o “melhoramento” racial através de medidas sócio/educativas. Logo, para os eugenistas, o fator “educação” teria apenas o objetivo de estimular as boas estirpes dos “bem nascidos”. O projeto de lei defendido no Art. 138, da

HIGH-TIME-RESOLUTION MEASUREMENTS OF THE POLARIZATION OF THE CRAB PULSAR AT 1.38 GHz

Energy Technology Data Exchange (ETDEWEB)

Słowikowska, Agnieszka [Kepler Institute of Astronomy, University of Zielona Góra, Lubuska 2, 65-265 Zielona Góra (Poland); Stappers, Benjamin W. [Jodrell Bank Centre for Astrophysics, University of Manchester, Manchester M13 9PL (United Kingdom); Harding, Alice K. [Astrophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); O' Dell, Stephen L.; Elsner, Ronald F.; Weisskopf, Martin C. [Astrophysics Office, NASA Marshall Space Flight Center, ZP12, Huntsville, AL 35812 (United States); Van der Horst, Alexander J. [Astronomical Institute, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands)

2015-01-20

Using the Westerbork Synthesis Radio Telescope, we obtained high-time-resolution measurements of the full polarization of the Crab pulsar. At a resolution of 1/8192 of the 34 ms pulse period (i.e., 4.1 μs), the 1.38 GHz linear-polarization measurements are in general agreement with previous lower-time-resolution 1.4 GHz measurements of linear polarization in the main pulse (MP), in the interpulse (IP), and in the low-frequency component (LFC). We find the MP and IP to be linearly polarized at about 24% and 21% with no discernible difference in polarization position angle. However, contrary to theoretical expectations and measurements in the visible, we find no evidence for significant variation (sweep) in the polarization position angle over the MP, the IP, or the LFC. We discuss the implications, which appear to be in contradiction to theoretical expectations. We also detect weak circular polarization in the MP and IP, and strong (≈20%) circular polarization in the LFC, which also exhibits very strong (≈98%) linear polarization at a position angle of 40° from that of the MP or IP. The properties are consistent with the LFC, which is a low-altitude component, and the MP and IP, which are high-altitude caustic components. Current models for the MP and IP emission do not readily account for the absence of pronounced polarization changes across the pulse. We measure IP and LFC pulse phases relative to the MP consistent with recent measurements, which have shown that the phases of these pulse components are evolving with time.

Alignment creation in atomic ensembles by elastic electron scattering; the case of 138Ba(...6s6p 1P1) atoms

International Nuclear Information System (INIS)

Trajmar, S.; Kanik, I.; LeClair, L.R.; Khakoo, M.A.; Bray, I.; Fursa, D.; Csanak, G.

1998-01-01

We describe some of our results from a joint experimental and theoretical program concerning elastic electron scattering by 138 Ba(...6s6p 1 P 1 ) atoms. From the experimental results, we derived various scattering parameters and magnetic sublevel specific differential elastic scattering cross sections at impact energy (E 0 ) of 20.0 eV and at scattering angles (θ) of 10deg, 15deg, and 20deg. The same parameters and cross sections were calculated by the convergent close coupling (CCC) approximation and compared to the experimental results. An excellent agreement, found for the two sets of data, gave us confidence in the CCC method and allowed us to extend the angular and energy ranges for the purpose of generating integral elastic scattering cross sections needed for the deduction of the alignment creation cross sections. (J.P.N.)

Investigation of precipitation and hardening response of maraging stainless steels 17-4 and 13-8+Mo during multi-pass welding

Science.gov (United States)

Hamlin, Robert J.

Martensitic precipitation strengthened stainless steels 17-4 and 13-8+Mo are candidate alloys for high strength military applications. These applications will require joining by fusion welding processes thus, it is necessary to develop an understanding of microstructural and mechanical property changes that occur during welding. Previous investigations on these materials have demonstrated that significant softening occurs in the heat affected zone (HAZ) during welding, due to dissolution of the strengthen precipitates. It was also observed that post weld heat treatments (PWHT's) were required to restore the properties. However, PWHT's are expensive and cannot be applied when welding on a large scale or making a repair in the field. Thus, the purpose of the current work is to gain a fundamental understanding of the precipitation kinetics in these systems so that optimized welding procedures can be developed that do not require a PWHT. Multi-pass welding provides an opportunity to restore the strengthening precipitates that dissolve during primary weld passes using the heat from secondary weld passes. Thus, a preliminary investigation was performed to determine whether the times and temperatures associated with welding thermal cycles were sufficient to restore the strength in these systems. A Gleeble thermo-mechanical simulator was used to perform multi-pass welding simulations on samples of each material using a 1000 J/mm and 2000 J/mm heat input. Additionally, base metal and weld metal samples were used as starting conditions to evaluate the difference in precipitation response between each. Hardness measurements were used to estimate the extent of precipitate dissolution and growth. Microstructures were characterized using light optical microscopy (LOM), scanning electron microscopy (SEM), and energy dispersive spectrometry (EDS). It was determined that precipitate dissolution occurred during primary welding thermal cycles and that significant hardening could be

The effect of equal channel angular pressing on the tensile properties and microstructure of two medical implant materials: ASTM F-138 austenitic steel and Grade 2 titanium

Energy Technology Data Exchange (ETDEWEB)

Filho, A de A Mendes; Sordi, V L; Kliauga, A M; Ferrante, M, E-mail: ferrante@ufscar.b [Federal University of Sao Carlos, Materials Engineering Department, Sao Carlos, 13565-905 (Brazil)

2010-07-01

Titanium and F-138 stainless steel are employed in bone replacement and repair. The former material was ECAP-deformed at room temperature and at 300{sup 0}C, followed in some cases by cold rolling. The steel was ECAP-deformed at room temperature only. Work-hardening behavior was studied by making use of the Kocks-mecking plots and microstructural evolution was followed by TEM. Conclusions show that for Ti, ECAP combined with cold rolling gives the best strength-ductility combination, whilst room temperature ECAP increases the tensile strength of the steel but caused substantial ductility loss.

Extraction of lanthanide elements and bismuth in molten lithium chloride-liquid bismuth-lithium alloy system

International Nuclear Information System (INIS)

Harada, Makoto; Adachi, Motonari; Kai, Yuichi; Koike, Kenichi

1987-01-01

The equilibrium distributions of neodymium and samarium between molten LiCl and liquid Bi-Li alloy were measured in a wide range of Li-mole fraction in the alloy phase, X Li . These lanthanide elements were extracted through redox reactions. In high X Li range, X Li > 0.03, the distributions of neodymium and bismuth in the salt phase increased markedly. The anomalous increase is attributed to the formation of the compound comprized of Nd, Li, Bi and oxygen in the salt phase. The reaction processes in samarium and neodymium were very fast and the extraction rates are controlled by the diffusion processes of the solutes and metallic lithium. (author)

Reductive trapping of [(OC){sub 5}W-W(CO){sub 5}]{sup 2-} in a mixed-valent Sm{sup II/III} calix[4]pyrrolide sandwich

Energy Technology Data Exchange (ETDEWEB)

Deacon, Glen B.; Guo, Zhifang [School of Chemistry, Monash University, VIC (Australia); Junk, Peter C.; Wang, Jun [College of Science and Engineering, James Cook University, Townsville, QLD (Australia)

2017-07-10

Reduction of tungsten hexacarbonyl by the divalent samarium(II) complex [Sm{sub 2}(N{sub 4}Et{sub 8})(thf){sub 4}] ((N{sub 4}Et{sub 8}){sup 4-}=meso-octaethylcalix[4]pyrrolide) in toluene at ambient temperature gave the remarkable heteronuclear mixed-valent samarium(II/III)/tungsten complex [{(thf)_2Sm"I"I(N_4Et_8)Sm"I"I"I(thf)}{sub 2}{(μ-OC)_2W_2(CO)_8}], which features the trapping of a rare [W{sub 2}(CO){sub 10}]{sup 2-} anion with an unsupported W-W bond. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

A Study of the r-Process Path Nuclides,$^{137,138,139}$Sb using the Enhanced Selectivity of Resonance Ionization Laser Ionization

CERN Multimedia

Walters, W

2002-01-01

The particular features of the r-process abundances with 100 < A < 150 have demonstrated the close connection between knowledge of nuclear structure and decay along the r-process path and the astrophysical environement in which these elements are produced. Key to this connection has been the measurement of data for nuclides (mostly even-N nuclides) that lie in the actual r-process path. Such data are of direct use in r-process calculations and they also serve to refine and test the predictive power of nuclear models where little or no data now exist. In this experiment we seek to use the newly developed ionization scheme for the Resonance Ionization Laser Ion Source (RILIS) to achieve selective ionization of neutron-rich antimony isotopes in order to measure the decay properties of r-process path nuclides $^{137,138,139}$Sb. These properties include the half-lives, delayed neutron branches, and daughter $\\gamma$-rays. The new nuclear structure data for the daughter Te nuclides is also of considerable in...

Outpatient management of pulmonary embolism in cancer: data on a prospective cohort of 138 consecutive patients.

Science.gov (United States)

Font, Carme; Carmona-Bayonas, Alberto; Fernández-Martinez, Aranzazu; Beato, Carmen; Vargas, Andrés; Gascon, Pere; Otero, Remedios

2014-03-01

The purpose of this prospective cohort study was to assess the feasibility of outpatient treatment in patients with cancer and objectively confirmed pulmonary embolism (PE), and to compare the performance of the different prognostic scales available in this setting. Patients were selected for outpatient management according to a set of exclusion criteria. Outcomes at 30 and 90 days of follow-up included thromboembolic recurrences, major bleeding, and all-cause death. The performance of 4 prognostic scales (Pulmonary Embolism Severity Index, Geneva Prognostic Score, POMPE-C, and Registro Informatizado de Enfermedad Tromboembólica [RIETE registry]) was evaluated. Of 138 patients, 62 (45%) were managed as outpatients. Incidental PE constituted 47% of the sample. Most patients treated at home had an incidentally detected PE (89%). The rate of recurrence and major bleeding events was similar in both groups. Mortality rates were higher for patients admitted to the hospital compared with outpatients at 30 days (18% vs 3%; P=.06) and 90 days (34% vs 10%; P=.001) of follow-up. None of the patients selected for home treatment required further admission because of PE complications. None of the prognostic models developed for symptomatic PE was significantly associated with 30-day mortality. Improved survival outcomes were observed in incidentally detected PEs compared with acute symptomatic events (overall mortality rates, 3.2% vs 18.4%; P=.006). A large proportion of patients with cancer and PE may be safely treated as outpatients, especially those with incidental PE. Cancer-specific prognostic scales including incidental PE should be developed for the optimal management of PE in this setting.

Association between gender inequality index and child mortality rates: a cross-national study of 138 countries.

Science.gov (United States)

Brinda, Ethel Mary; Rajkumar, Anto P; Enemark, Ulrika

2015-03-09

Gender inequality weakens maternal health and harms children through many direct and indirect pathways. Allied biological disadvantage and psychosocial adversities challenge the survival of children of both genders. United Nations Development Programme (UNDP) has recently developed a Gender Inequality Index to measure the multidimensional nature of gender inequality. The global impact of Gender Inequality Index on the child mortality rates remains uncertain. We employed an ecological study to investigate the association between child mortality rates and Gender Inequality Indices of 138 countries for which UNDP has published the Gender Inequality Index. Data on child mortality rates and on potential confounders, such as, per capita gross domestic product and immunization coverage, were obtained from the official World Health Organization and World Bank sources. We employed multivariate non-parametric robust regression models to study the relationship between these variables. Women in low and middle income countries (LMICs) suffer significantly more gender inequality (p Gender Inequality Index (GII) was positively associated with neonatal (β = 53.85; 95% CI 41.61-64.09), infant (β = 70.28; 95% CI 51.93-88.64) and under five mortality rates (β = 68.14; 95% CI 49.71-86.58), after adjusting for the effects of potential confounders (p gender inequality and child mortality. We present the socio-economic problems, which sustain higher gender inequality and child mortality in LMICs. We further discuss the potential solutions pertinent to LMICs. Dissipating gender barriers and focusing on social well-being of women may augment the survival of children of both genders.

A de novo 1.38 Mb duplication of 1q31.1 in a boy with hemifacial microsomia, anophthalmia, anotia, macrostomia, and cleft lip and palate.

Science.gov (United States)

Huang, Xue-shuang; Zhu, Bao; Jiang, Hai-ou; Wu, Su-fan; Zhang, Zai-qi; Xiao, Lin; Yi, Li-lan; Zhang, Jian-xiang

2013-04-01

We reported a 2-year-old boy with developmental delay, mild mental retardation, and severe craniofacial malformation, including facial asymmetry with hypoplasia of the left zygoma, maxilla, and mandible, and left anophthalmia and anotia. A genome-wide screen revealed a 1.38 Mb duplication on chromosome 1q31.1, which was absent in his parents and 27 healthy controls. The duplication region contains two Refseq genes, PLA2G4A and C1orf99, which have not been reported to be implicated in craniofacial malformation. Functional studies of these genes and additional clinical analysis are necessary to elucidate the pathogenesis of craniofacial malformation. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

Effect of heat treatment on the electrochemical behaviour and catalytic activity of metal-glass of an Fe76.1Cu1.0Nb3.0Si13.8B6.1

International Nuclear Information System (INIS)

Zhdanova, L.I.; Sharipova, E.Kh.; Lad'yanov, V.I.; Volkov, V.A.

1999-01-01

Effect of the different degree of the initial surface crystallization of Fe 76.1 Cu 1.0 Nb 3.0 Si 13.8 B 6.1 metal glasses on the electrochemical behaviour and catalytic activity of the alloy during thermal treatment of tapes was studied. Growth of amorphous-nanocrystalline structure during annealing is shown to improve protective properties of fast-hardened tapes. The highest corrosion resistance of the material is manifested when in nanocrystalline state subsequent to annealing under 550 deg C [ru

Sm cluster superlattice on graphene/Ir(111)

Science.gov (United States)

Mousadakos, Dimitris; Pivetta, Marina; Brune, Harald; Rusponi, Stefano

2017-12-01

We report on the first example of a self-assembled rare earth cluster superlattice. As a template, we use the moiré pattern formed by graphene on Ir(111); its lattice constant of 2.52 nm defines the interparticle distance. The samarium cluster superlattice forms for substrate temperatures during deposition ranging from 80 to 110 K, and it is stable upon annealing to 140 K. By varying the samarium coverage, the mean cluster size can be increased up to 50 atoms, without affecting the long-range order. The spatial order and the width of the cluster size distribution match the best examples of metal cluster superlattices grown by atomic beam epitaxy on template surfaces.

Synthesis and evaluation of 3-[(2,4-dioxo-1,3,8-triazaspiro[4.6]undec-3-yl)methyl]benzonitrile derivatives as potential anticonvulsants.

Science.gov (United States)

Madaiah, Malavalli; Prashanth, Maralekere K; Revanasiddappa, Hosakere D; Veeresh, Bantal

2013-03-01

New 3-[(2,4-dioxo-1,3,8-triazaspiro[4.6]undec-3-yl)methyl]benzonitrile derivatives 8-37 were synthesized and their pharmacological activities were determined with the objective to better understand their structure-activity relationship (SAR) for anticonvulsant activity. All the compounds were evaluated for their possible anticonvulsant activity by maximal electroshock seizure (MES) and pentylenetetrazole (PTZ) test. Compounds 11, 18, 31, and 32 showed significant and protective effect on seizure, when compared with the standard drug valproate. The same compounds were found to exhibit advanced anticonvulsant activity as well as lower neurotoxicity than the reference drug. From this study, it is quite apparent that there are at least three parameters for the activity of anticonvulsant drugs, that is, a lipophilic domain, a hydrophobic center, and a two-electron donor. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Quantitation of amyloid beta peptides Aβ(1-38), Aβ(1-40), and Aβ(1-42) in human cerebrospinal fluid by ultra-performance liquid chromatography-tandem mass spectrometry.

Science.gov (United States)

Lame, Mary E; Chambers, Erin E; Blatnik, Matthew

2011-12-15

Critical events in Alzheimer's disease (AD) involve an imbalance between the production and clearance of amyloid beta (Aβ) peptides from the brain. Current methods for Aβ quantitation rely heavily on immuno-based techniques. However, these assays require highly specific antibodies and reagents that are time-consuming and expensive to develop. Immuno-based assays are also characterized by poor dynamic ranges, cross-reactivity, matrix interferences, and dilution linearity problems. In particular, noncommercial immunoassays are especially subject to high intra- and interassay variability because they are not subject to more stringent manufacturing controls. Combinations of these factors make immunoassays more labor-intensive and often challenging to validate in support of clinical studies. Here we describe a mixed-mode solid-phase extraction method and an ultra-performance liquid chromatography tandem mass spectrometry (SPE UPLC-MS/MS) assay for the simultaneous quantitation of Aβ(1-38), Aβ(1-40), and Aβ(1-42) from human cerebrospinal fluid (CSF). Negative ion versus positive ion species were compared using their corresponding multiple reaction monitoring (MRM) transitions, and negative ions were approximately 1.6-fold greater in intensity but lacked selectivity in matrix. The positive ion MRM assay was more than sufficient to quantify endogenous Aβ peptides. Aβ standards were prepared in artificial CSF containing 5% rat plasma, and quality control samples were prepared in three pooled CSF sources. Extraction efficiency was greater than 80% for all three peptides, and the coefficient of variation during analysis was less than 15% for all species. Mean basal levels of Aβ species from three CSF pools were 1.64, 2.17, and 1.26 ng/ml for Aβ(1-38); 3.24, 3.63, and 2.55 ng/ml for Aβ(1-40); and 0.50, 0.63, and 0.46 ng/ml for Aβ(1-42). Copyright © 2011 Elsevier Inc. All rights reserved.

Neutron Activation Resonance Integrals of 74Se, 78Se, 80Se, 81Br, 127I, 130Te, 138Ba, 140Ce, and 142Ce

International Nuclear Information System (INIS)

Ricabarra, M. D.; Turjanskl, R.; Ricabarra, G. H.; Bigham, C.B.

1968-01-01

A lithium-drift germanium γ-ray spectrometer has been used to make accurate intercomparisons of the ratio of resonance-integral to thermal-activation cross section by measuring cadmium ratios or relative activation rates in two different neutron spectra. The standard, gold, or secondary standard, indium, was mixed uniformly in the samples and the activities resolved with the spectrometer. Expressed as Westcott S 0 values, the results relative to S 0 = 17.7 for gold were as follows: 74 Se = 10.3 +± 0.1, 78 Se = 12.3 ± 0.3, 80 Sc = 2.65 ± 0.02, 81 Br = 24.3 ± 0.5, 127 I = 27.8 ± 0.5, 130 Te = 2.10 ± 0.07, 138 Ba = 0.649 ± 0.004, 140 Ce = 0.476 ± 0.003, 142 Ce = 0.865 ± 0.005. (author)

T-138C and A-7G polymorphisms in the MGP gene and the association with coronary arthery disease: Iranian patients

Directory of Open Access Journals (Sweden)

Abiri M

2009-05-01

Full Text Available "n Normal 0 false false false EN-GB X-NONE AR-SA MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:Arial; mso-bidi-theme-font:minor-bidi;} Background: Coronary Artery Disease (CAD is a major cause of death worldwide including Iran.  The risk of developing disease in patients without symptoms is assessed in part by factors that are associated with disease. Among these factors family history points to the significance of genetic component in the risk of CAD. The identification of the genetic variants that confer risk for CAD is essential for detecting high-risk individuals, so preventative life style and therapeutic action can be taken before overt disease develops. So far more than 100 genes have been reported with possible role in developing risk for CAD. Matrix- Gla Protein (MGP is one of these genes that association of its single nucleotide polymorphism (SNP with CAD has been reported.  Among the polymorphisms, there are two promoter SNPs at position -7 & -138 that their association with CAD has been reported before. Here we investigated the association of these SNPs with CAD in Iranian population. "n"n Methods: 150 cases and 150 controls were selected on the basis of their clinical assessments and angiographic reports. DNA was extracted from blood samples. The genotypes for both SNPs were determined using Polymerase Chain Reaction

Emission properties of Sm(III) complex having ten-coordination structure

International Nuclear Information System (INIS)

Hasegawa, Yasuchika; Tsuruoka, Shin-ichi; Yoshida, Takahiko; Kawai, Hideki; Kawai, Tsuyoshi

2008-01-01

Sammarium(III) complex having ten-coordination structure, bis-(1,10-phenanthroline)tris-(hexafluoroacetylacetonato)samarium(III) (Sm(hfa) 3 (phen) 2 ) was prepared by chelation of tris-(hexafluoroacetylacetonato) samarium(III) (Sm(hfa) 3 (H 2 O) 2 ) with 1,10-phenantroline (phen). The characteristic ten-coordination structure of Sm(hfa) 3 (phen) 2 was determined by 1 H NMR and elemental analyses. Strong deep-red emission (λ max =643 nm) and narrow emission band (FWHM=5 nm) of Sm(hfa) 3 (phen) 2 originated from electronic allowed transition from characteristics ten coordinate structure. The emission quantum yields Sm(hfa) 3 (phen) 2 excited at absorption bands of ligands and Sm(III) ion were found to be 0.36 and 1.4%, respectively

Half-life of samarium-147

CERN Document Server

Kinoshita, N; Nakanishi, T

2003-01-01

The alpha-decay half-life of sup 1 sup 4 sup 7 Sm has been reevaluated. Known amounts of natural Sm and an alpha-emitter standard ( sup 2 sup 1 sup 0 Po, sup 2 sup 3 sup 8 U, or sup 2 sup 4 sup 1 Am) were mixed well to prepare thin sources for the simultaneous counting of sup 1 sup 4 sup 7 Sm and the alpha-emitter standard by means of an alpha-spectrometer using a silicon surface barrier detector. The alpha-disintegration rate of known amounts of sup 1 sup 4 sup 7 Sm was determined by reference to the alpha activity of the standard. The source preparation and counting were repeated to establish the reproducibility of the present half-life determination, and supplementary alpha spectrometry was carried out by a liquid-scintillation spectrometer. The arithmetic mean of the experimental half-life values was obtained to be (1.17 +- 0.02) x 10 sup 1 sup 1 y. This value is about 10% longer than the currently adopted value, (1.06 +- 0.02) x 10 sup 1 sup 1 y, and the possible factors for this difference are discussed...

Photoluminescence and spectroscopic dependence of fluorophosphate glasses on samarium ions concentration and the induced defects by gamma irradiation

Energy Technology Data Exchange (ETDEWEB)

Marzouk, M.A., E-mail: marzouk_nrc@yahoo.com [Glass Research Department, National Research Centre, 33 El Bohouth Street (former EL Tahrir), P.O. 12622, Dokki, Giza (Egypt); Hamdy, Y.M. [Spectroscopy Department, National Research Centre, 33 El Bohouth Street (former EL Tahrir), P.O. 12622, Dokki, Giza (Egypt); ElBatal, H.A. [Glass Research Department, National Research Centre, 33 El Bohouth Street (former EL Tahrir), P.O. 12622, Dokki, Giza (Egypt); Ezz ElDin, F.M. [National Institute for Radiation Research & Technology, Nasr City, Cairo (Egypt)

2015-10-15

/2} and {sup 6}H{sub 11/2}, respectively. The intensity of the emission spectra is observed to increase with the increase of Sm{sub 2}O{sub 3} content. The optical spectra within the visible–near IR region and photoluminescence spectra of Sm{sub 2}O{sub 3}-doped glasses are found to be stable and show almost no variations after gamma irradiation especially when rare-earth ions are present in noticeable contents (1–3%). FTIR spectra of all the studied glasses reveal repetitive and characteristic vibrational bands mainly due to phosphate groups with abundant of Q{sup 2} and Q{sup 3} groups due to the high content of P{sub 2}O{sub 5} (70 mol%). The introduction of 10% NaF and 20% AlF{sub 3} is observed to cause formation of mixed fluorophosphate groups (PO{sub 3}F){sup 2−}. The formation of (AlPO){sub 4} and/or (AlPO{sub 6}) groups needs further justification by combined techniques. The increase of Sm{sub 2}O{sub 3} content to 3% causes obvious increase of the IR absorption bands within the wavenumbers range of about 850–1400 cm{sup −1} due to suggested depolymerization effect. Gamma irradiation causes no distinct variations in the FTIR spectra due to suggested compactness through the formation of additional structural groups from AlF{sub 4} or AlF{sub 6}. - Highlights: • Samarium ions doped in host fluorophosphate glasses were prepared. • Optical and FT infrared absorption techniques were applied to study the spectral properties of the glasses. • Photoluminescence properties were measured. • Collective spectroscopic variations generated by gamma irradiation were investigated.

49 CFR 571.138 - Standard No. 138; Tire pressure monitoring systems.

Science.gov (United States)

2010-10-01

... following statement in English: Each tire, including the spare (if provided), should be checked monthly when... level to trigger illumination of the TPMS low tire pressure telltale. [The following paragraph is.... If necessary, drive the vehicle until the telltale has extinguished. (o) The test may be repeated...

Microstructural Evolution and Mechanical Properties of Simulated Heat-Affected Zones in Cast Precipitation-Hardened Stainless Steels 17-4 and 13-8+Mo

Science.gov (United States)

Hamlin, Robert J.; DuPont, John N.

2017-01-01

Cast precipitation-hardened (PH) stainless steels 17-4 and 13-8+Mo are used in applications that require a combination of high strength and moderate corrosion resistance. Many such applications require fabrication and/or casting repair by fusion welding. The purpose of this work is to develop an understanding of microstructural evolution and resultant mechanical properties of these materials when subjected to weld thermal cycles. Samples of each material were subjected to heat-affected zone (HAZ) thermal cycles in the solution-treated and aged condition (S-A-W condition) and solution-treated condition with a postweld thermal cycle age (S-W-A condition). Dilatometry was used to establish the onset of various phase transformation temperatures. Light optical microscopy (LOM), scanning electron microscopy (SEM), and energy dispersive spectrometry (EDS) were used to characterize the microstructures, and comparisons were made to gas metal arc welds that were heat treated in the same conditions. Tensile testing was also performed. MatCalc thermodynamic and kinetic modeling software was used to predict the evolution of copper (Cu)-rich body center cubic precipitates in 17-4 and β-NiAl precipitates in 13-8+Mo. The yield strength was lower in the simulated HAZ samples of both materials prepared in the S-A-W condition when compared to their respective base metals. Samples prepared in the S-W-A condition had higher and more uniform yield strengths for both materials. Significant changes were observed in the matrix microstructure of various HAZ regions depending on the peak temperature, and these microstructural changes were interpreted with the aid of dilatometry results, LOM, SEM, and EDS. Despite these significant changes to the matrix microstructure, the changes in mechanical properties appear to be governed primarily by the precipitation behavior. The decrease in strength in the HAZ samples prepared in the S-A-W condition was attributed to the dissolution of precipitates

Avaliação da apoptose de leucócitos polimorfonucleares CH138+ em leite bovino de alta e baixa contagem de células somáticas : dados preliminares

Directory of Open Access Journals (Sweden)

R.B Pessoa

2012-06-01

Full Text Available A apoptose de leucócitos polimorfonucleares (PMN é um evento central no processo de resolução da inflamação. Sendo a contagem de células somáticas (CCS um indicador da situação imunológica da glândula mamária, o presente estudo buscou esclarecer a influência que esses fatores têm um sobre o outro e sobre a evolução do processo inflamatório. Marcaram-se as amostras de leite com anexina-V, iodeto de propídeo (PI, anticorpo anti-CH138A. Encontrou-se correlação negativa entre apoptose de PMN e CCS, além de diferença estatística entre um grupo de alta CCS e um grupo de baixa CCS quanto à taxa de PMN viáveis, em apoptose, em necrose e em necrose e/ou apoptose. De modo geral, o grupo de alta celularidade apresentou menos CH138+ em apoptose e mais células em necrose ou viáveis do que o grupo de baixa celularidade. Conclui-se que apoptose de PMN e CCS estão relacionados, e que em mamas com CCS elevada este evento está diminuído. Apesar de haver maior disponibilidade de fagócitos para a defesa nessa situação, os efeitos anti-inflamatórios da apoptose também estão diminuídos, enquanto os efeitos pró-inflamatórios da necrose estão aumentados, o que pode colaborar com a cronificação da inflamação.

Single-dose radiosurgical treatment for hepatic metastases - therapeutic outcome of 138 treated lesions from a single institution

International Nuclear Information System (INIS)

Habermehl, Daniel; Herfarth, Klaus K; Bermejo, Justo Lorenzo; Hof, Holger; Rieken, Stefan; Kuhn, Sabine; Welzel, Thomas; Debus, Jürgen; Combs, Stephanie E

2013-01-01

Local ablative therapies such as stereotactically guided single-dose radiotherapy or helical intensity-modulated radiotherapy (tomotherapy) with high single-doses are successfully applied in many centers in patients with liver metastasis not suitable for surgical resection. This study presents results from more than 10 years of clinical experience and evaluates long-term outcome and efficacy of this therapeutic approach. From 1997 to 2009 a total of 138 intrahepatic tumors of 90 patients were irradiated with single doses of 17 to 30 Gy (median dose 24 Gy). Median age of the patients was 64 years (range 31–89 years). Most frequent underlying tumor histologies were colorectal adenocarcinoma (70 lesions) and breast cancer (27 lesions). In 35 treatment sessions multiple targets were simultaneously irradiated (up to four lesions at once). Local progression-free (PFS) and overall survival (OS) after treatment were investigated using uni- and multiple survival regression models. Median overall survival of all patients was 24.3 months. Local PFS was 87%, 70% and 59% after 6, 12 and 18 months, respectively. Median time to local progression was 25.5 months. Patients with a single lesion and no further metastases at time of RT had a favorable median PFS of 43.1 months according to the Kaplan-Meier estimator. The type of tumor showed a statistical significant influence on local PFS, with a better prognosis for breast cancer histology than for colorectal carcinoma in uni- and multiple regression analysis (p = 0.05). Multiple regression analysis revealed no influence of planning target volume (PTV), patient age and radiation dose on local PFS. Treatment was well tolerated with no severe adverse events. This study confirms safety of SBRT in liver lesions, with 6- and 12 months local control of 87% and 70%. The dataset represents the clinical situation in a large oncology setting, with many competing treatment options and heterogeneous patient characteristics

Association between the porcine Escherichia coli F18 receptor genotype and phenotype and susceptibility to colonisation and postweaning diarrhoea caused by E-coli O138 : F18

DEFF Research Database (Denmark)

Frydendahl, K.; Jensen, Tim Kåre; Andersen, Jens Strodl

2003-01-01

Porcine postweaning Escherichia coli enteritis is a cause of significant morbidity and mortality in pigs worldwide, and effective prevention remains an unsolved problem. This study examined the correlation between susceptibility of pigs to experimental infection with an E. coli F18 strain...... and the porcine intestinal F18 receptor genotypes. Thirty-one pigs classified as either belonging to the susceptible or the resistant genotype were inoculated with cultures of an E. coli 0138:F18 isolated from a pig with postweaning diarrhoea. Susceptibility to colonisation and diarrhoea was assessed by clinical...... and heterozygotic susceptible pigs. Faecal shedding of the challenge strain correlated with the genetic receptor profile. Twenty pigs examined immunohistochemically revealed focal to extensive small intestinal mucosal colonisation by E. coli O138:F18 in nine of 10 susceptible and three of 10 resistant pigs. Results...

Preparation of plutonium waste forms with ICPP calcined high-level waste

Energy Technology Data Exchange (ETDEWEB)

Staples, B.A.; Knecht, D.A. [Lockheed Idaho Technologies Co., Idaho Falls, ID (United States); O`Holleran, T.P. [Argonne National Lab.-West, Idaho Falls, ID (United States)] [and others

1997-05-01

Glass and glass-ceramic forms developed for the immobilization of calcined high-level wastes generated by Idaho Chemical Processing Plant (ICPP) fuel reprocessing activities have been investigated for ability to immobilize plutonium and to simultaneously incorporate calcined waste as an anti-proliferation barrier. Within the forms investigated, crystallization of host phases result in an increased loading of plutonium as well as its incorporation into potentially more durable phases than the glass. The host phases were initially formed and characterized with cerium (Ce{sup +4}) as a surrogate for plutonium (Pu{sup +4}) and samarium as a neutron absorber for criticality control. Verification of the surrogate testing results were then performed replacing cerium with plutonium. All testing was performed with surrogate calcined high-level waste. The results of these tests indicated that a potentially useful host phase, based on zirconia, can be formed either by devitrification or solid state reaction in the glass studied. This phase incorporates plutonium as well as samarium and the calcined waste becomes part of the matrix. Its ease of formation makes it potentially useful in excess plutonium dispositioning. Other durable host phases for plutonium and samarium, including zirconolite and zircon have been formed from zirconia or alumina calcine through cold press-sintering techniques and hot isostatic pressing. Host phase formation experiments conducted through vitrification or by cold press-sintering techniques are described and the results discussed. Recommendations are given for future work that extends the results of this study.

Preparation of plutonium waste forms with ICPP calcined high-level waste

International Nuclear Information System (INIS)

Staples, B.A.; Knecht, D.A.; O'Holleran, T.P.

1997-05-01

Glass and glass-ceramic forms developed for the immobilization of calcined high-level wastes generated by Idaho Chemical Processing Plant (ICPP) fuel reprocessing activities have been investigated for ability to immobilize plutonium and to simultaneously incorporate calcined waste as an anti-proliferation barrier. Within the forms investigated, crystallization of host phases result in an increased loading of plutonium as well as its incorporation into potentially more durable phases than the glass. The host phases were initially formed and characterized with cerium (Ce +4 ) as a surrogate for plutonium (Pu +4 ) and samarium as a neutron absorber for criticality control. Verification of the surrogate testing results were then performed replacing cerium with plutonium. All testing was performed with surrogate calcined high-level waste. The results of these tests indicated that a potentially useful host phase, based on zirconia, can be formed either by devitrification or solid state reaction in the glass studied. This phase incorporates plutonium as well as samarium and the calcined waste becomes part of the matrix. Its ease of formation makes it potentially useful in excess plutonium dispositioning. Other durable host phases for plutonium and samarium, including zirconolite and zircon have been formed from zirconia or alumina calcine through cold press-sintering techniques and hot isostatic pressing. Host phase formation experiments conducted through vitrification or by cold press-sintering techniques are described and the results discussed. Recommendations are given for future work that extends the results of this study

Preparation and dosimetry of radiotherapeutic particles for arthropaties; Preparacion y dosimetria de particulas radioterapeuticas para artropatias

Energy Technology Data Exchange (ETDEWEB)

Gonzalez Z, M A [Departamento de Medicina Nuclear, Instituto Nacional de Pediatria (Mexico); Ferro F, G [Departamento de Materiales Radiactivos, Instituto nacional de Investigaciones Nucleares, Salazar, Estado de Mexico C.P. 52045 (Mexico); Rivera M, T; Azorin N, J [Departamento de Fisica, UAM Iztapalapa, Mexico D.F. (Mexico)

1999-07-01

It was developed a new formulation of macro aggregates of Samarium 153 ({sup 153} Sm-MH) for the arthropaties treatment. The radio pharmaceutic was prepared by reaction of Samarium 153 chloride (SmCl{sub 3}) in aqueous environment with sodium boron hydride in NaOH 0.5 N. The microscopic analysis shown that the particles have an average size of 4% m (range 1-14 {mu} m). The velocity of sedimentation was 0.008 cm/min with high stability in vitro in human serum. The biological studies in healthy rabbits, shown that the complex is retained inside the articulation still eight days after of the administration of the radiopharmaceutical. Likewise, it is presented the data of absorbed dose in the different target organs, which was determined by thermoluminescent dosimetry (TLD) through the use of a REMCAL phantom (radiation equivalent manikin calibration). (Author)

Preparation and dosimetry of radiotherapeutic particles for arthropaties

International Nuclear Information System (INIS)

Gonzalez Z, M.A.; Ferro F, G.; Rivera M, T.; Azorin N, J.

1999-01-01

It was developed a new formulation of macro aggregates of Samarium 153 ( 153 Sm-MH) for the arthropaties treatment. The radio pharmaceutic was prepared by reaction of Samarium 153 chloride (SmCl 3 ) in aqueous environment with sodium boron hydride in NaOH 0.5 N. The microscopic analysis shown that the particles have an average size of 4% m (range 1-14 μ m). The velocity of sedimentation was 0.008 cm/min with high stability in vitro in human serum. The biological studies in healthy rabbits, shown that the complex is retained inside the articulation still eight days after of the administration of the radiopharmaceutical. Likewise, it is presented the data of absorbed dose in the different target organs, which was determined by thermoluminescent dosimetry (TLD) through the use of a REMCAL phantom (radiation equivalent manikin calibration). (Author)

Simplified syntheses of the water-soluble chiral shift reagents Sm-(R)-pdta and Sm-(S)-pdta

Czech Academy of Sciences Publication Activity Database

Hrubá, L.; Buděšínský, Miloš; Pícha, Jan; Jiráček, Jiří; Vaněk, Václav

2013-01-01

Roč. 54, č. 47 (2013), s. 6296-6297 ISSN 0040-4039 Institutional support: RVO:61388963 Keywords : NMR * chiral shift reagents * Sm-pdta * PDTA * samarium * 1,2-diaminopropane Subject RIV: CC - Organic Chemistry Impact factor: 2.391, year: 2013

Ground-state and isomeric-state cross sections for the {sup 138}Ce(n,2n){sup 137}Ce reaction from its threshold to 20 MeV

Energy Technology Data Exchange (ETDEWEB)

Luo, Junhua [Hexi Univ., Zhangye (China). Inst. of Theoretical Physics; Hexi Univ., Zhangye (China). School of Physics and Electromechanical Engineering; An, Li; Jiang, Li [Chinese Academy of Engineering Physics, Mianyang (China). Inst. of Nuclear Physics and Chemistry

2015-07-01

The cross sections of the {sup 138}Ce(n,2n){sup 137}Ce reactions and their isomeric cross section ratios σ{sub m}/σ{sub g} were measured at three neutron energies between 13.5 and 14.8 MeV using the activation technique. CeO{sub 2} samples and Nb monitor foils were activated together to determine the reaction cross section and the incident neutron flux. The monoenergetic neutron beams were formed via the {sup 3}H(d,n){sup 4}He reaction. The activities induced in the reaction products were measured using high-resolution γ-ray spectroscopy. The pure cross section of the ground-state was derived from the absolute cross section of the metastable state and the residual nuclear decay analysis. The cross sections were also estimated using the nuclear model code, TALYS-1.6 with different level density options at neutron energies varying from the reaction threshold to 20 MeV. Results are discussed and compared with the corresponding literature data.

The prognostic value of time parameters in adjuvant radiotherapy of head and neck cancer. A retrospective analysis of 138 patients

International Nuclear Information System (INIS)

Dietl, B.; Schaefer, C.; Koelbl, O.

2005-01-01

Purpose: to answer the question, how the parameters waiting time, radiation treatment time and overall treatment time (OTT) influenced the endpoints overall (OS), event-free (EFS) and local recurrence-free survival (LRFS) in patients with locally advanced head-and-neck cancer, who had received postoperative radiotherapy. Patients and methods: 138 patients were included into a retrospective analysis from 10/1993 to 05/2000. Besides the time parameters waiting time, radiation treatment time and OTT, tumor- and therapy-related parameters (T-, N-, R-status, grading, tumor site, surgical technique, and postoperative hemoglobin < 12 g/dl) with potential impact on the endpoints were investigated in the univariate analysis (Kaplan-Meier log-rank test). Individual parameters with a significant impact (p = 0.05) were subjected to a multivariate Cox regression analysis. Results: besides a postoperative hemoglobin value < 12 g/dl, in the univariate analysis an OTT ≥ 105 days negatively influenced all endpoints, as well as a radiation treatment time ≥ 60 days. On multivariate Cox regression analysis, postoperative hemoglobin < 12 g/dl and an OTT ≥ 105 days were identified as independent negative prognostic factors for all endpoints. Conclusion: the waiting time should be managed according to the ASARA (as short as reasonably achievable) recommendation, radiation treatment should not be protracted exceeding an overall treatment of 105 days. Generally, time parameters should be routinely included in the standard tumor documentation, thus facilitating further evaluation of these prognostically relevant factors. (orig.)

miR-371, miR-138, miR-544, miR-145, and miR-214 could modulate Th1/Th2 balance in asthma through the combinatorial regulation of Runx3.

Science.gov (United States)

Qiu, Yu-Ying; Zhang, Ying-Wei; Qian, Xiu-Fen; Bian, Tao

2017-01-01

Asthma is tightly related to the imbalance of Th1/Th2 cells, and Runx3 plays a pivotal role in the differentiation of T helper cells. The present study aimed to investigate dysregulated microRNAs that may target Runx3 in CD4 + T cells from asthmatic patients and reveal Runx3 function in Th1/Th2 balance regulation. We detected the levels of Th1- and Th2-related cytokines by ELISA and analyzed the differentiation marker gene of T helper cells by qRT-PCR. Results indicated that an imbalance of Th1/Th2 cells was present in our asthmatic subject. Runx3 expression was reduced in the CD4 + T cells from asthmatic patients. Overexpression of Runx3 could restore the Th1/Th2 balance. After performing microRNA microarray assay, we found a series of microRNAs that were considerably altered in the CD4 + T cells from asthmatic patients. Among these upregulated microRNAs, eight microRNAs that may target Runx3 were selected by bioinformatics prediction. Five microRNAs, namely miR-371, miR-138, miR-544, miR-145, and miR-214, were confirmed by qRT-PCR and selected as candidate microRNAs. Luciferase reporter assay showed that these five microRNAs could directly target the 3'-UTR of Runx3. However, only simultaneous inhibition of these five microRNAs could alter the expression of Runx3. Most importantly, only simultaneous inhibition could improve the Th1/Th2 balance. Thus, we suggest that miR-371, miR-138, miR-544, miR-145, and miR-214 can modulate the Th1/Th2 balance in asthma by regulating Runx3 in a combinatorial manner.

A NOVEL SAMARIUM COMPLEX WITH INTERESTING ...

African Journals Online (AJOL)

2017 Chemical Society of Ethiopia and The Authors ... 1Institute of Applied Chemistry, School of Chemistry and Chemical Engineering, Jinggangshan ... 3State Key Laboratory of Structural Chemistry, Fujian Institute of Research ... INTRODUCTION ..... Fenamate cocrystals with 4,4'-bipyridine: structural and thermodynamic ...

Pramana – Journal of Physics | Indian Academy of Sciences

Indian Academy of Sciences (India)

... and theoretical aspects of fundamental symmetry violations in atoms .... The current status of and achievements in targets are provided and validation experiments are ... of samarium by spectrally resolved laser-induced fluorescence technique .... Surface roughness-aided hard X-ray emission from carbon nanotubes.

Analysis of bioactive glasses obtained by sol-gel processing for radioactive implants

Directory of Open Access Journals (Sweden)

Roberto Wanderley dos Santos

2003-01-01

Full Text Available This paper presents the chemical and physical characterizations of SiO2 and SiO2-CaO bioactive glasses incorporated with samarium atoms, produced by sol-gel synthesis. The objective is to provide biocompatible and biodegradable radioactive seeds as an alternative to be used in Brachytherapy for the treatment of prostate cancer. The glasses were produced and analyzed by X-ray fluorescence spectroscopy (XRF, energy dispersive X-ray spectroscopy (EDS, scanning electron microscopy (SEM, He picnometry and nitrogen adsorption analysis. A theoretical evaluation of the specific activity of the samples upon neutron activation is proposed. The XRF and EDS results demonstrate the incorporation of samarium atoms in the glass matrix. The experimental data coupled with the theoretical studies in neutron activation suggest that it is possible to obtain radioactive seeds with activities equivalent to 125I seeds used in brachytherapy prostatic.

Pain therapy with Samario 153-EDTM in prostate cancer. Pilot experience in Paraguay

International Nuclear Information System (INIS)

Jara Yorg, Jorge

2001-07-01

To relieve the skeletal pain in metastasis disseminated in bones, numerous radiotracers have been used without achieving important clinical acceptance. The SAMARIUM 153 EDT (Etilendiaminetrametilen acid phosphonic) is a radiopharmaceutic that is chemically and biologically stable and preferably concentrates on the skeletal metastasis [es

Electric Field-Assisted Pressureless Sintering of Ceramic Protonic Conductors

DEFF Research Database (Denmark)

Muccillo, R.; Esposito, Vincenzo; Zanetti De Florio, Daniel

2017-01-01

Gadolinium, yttrium and samarium-doped barium cerate (BCGd, BCY and BCSm, respectively) polycrystalline green pellets were submitted to electric field-assisted pressureless sintering experiments isothermally in the temperature range 800-1200oC under 100-200 V cm-1 electric fields, limiting to 1-5...

A convenient method for the conversion of N-acyloxazolidinones to hydroxamic acids.

Science.gov (United States)

Sibi, Mukund P; Hasegawa, Hikaru; Ghorpade, Sandeep R

2002-10-03

Treatment of N-acyloxazolidinones with hydroxylamines using samarium triflate as a Lewis acid provides the corresponding hydroxamic acids in 50-98% yields at room temperature. The conversion proceeds with high degree of chemoselectivity and without racemization of chiral centers alpha- to the acyl group. [reaction: see text

Biological evaluation of 153Sm-ethylenediaminetetra methylene phosphonate (EDTMP)

International Nuclear Information System (INIS)

Ranganatha, D.K.; Lal, Ramji

1997-01-01

Samarium-153 EDTMP has been studied in rats to establish bone localisation in normal bone tissue and the uptake in the soft tissue. Biodistribution results were highly promising with >3% of the injected dose localizing in the femurs and 15 days. (author). 4 refs., 2 tabs

2. Home 3. Journals 4. Bulletin of Materials Science 5. Volume 28 6 ...

Indian Academy of Sciences (India)

483. Acceptor. Study on electrical properties of Ni-doped SrTiO3 ceramics .... Effect of Cr and Ni on diffusion bonding of Fe3Al with steel. 63. Creep ... Oriented growth of thin films of samarium oxide by MOCVD. 49 .... Grain boundary. Study on ...

Electric Field-Assisted Pressureless Sintering of Ceramic Protonic Conductors

DEFF Research Database (Denmark)

Muccillo, R.; Esposito, Vincenzo; de Florio, D. Z.

2017-01-01

Gadolinium, yttrium and samarium-doped barium cerate pressed pellets were submitted to flash sintering experiments isothermally in the temperature range 800-1300oC under 200 V cm-1 electric field. The pellets were positioned inside a dilatometer furnace with Pt-Ir electrodes connected either to a...

Contribution to the study of the diffusion of fission products in uranium; Contribution a l'etude de la diffusion des produits de fission dans l'uranium

Energy Technology Data Exchange (ETDEWEB)

Tournier, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1964-10-15

In this work we have developed a simple method for determining the diffusion constants and the solid-state solubilities of a metal which is volatile and only slightly soluble in second metal. This method has been applied to the behaviour of certain fission products in {gamma} uranium: strontium, barium, lanthanum, samarium and cerium. This work has made it possible to show the effect of the atomic radius of the solute on the diffusion constants. (author) [French] Dans ce travail nous avons mis au point une methode simple permettant de determiner les constantes de diffusion ainsi que les solubilites a l'etat solide d'un metal volatil et peu soluble dans un autre. Cette methode a ete appliquee au comportement de certains produits de fission dans l'uranium {gamma}: strontium, baryum, lanthane, samarium et cerium. Cette etude a permis de mettre en evidence le role du rayon atomique du solute sur les constantes de diffusion. (auteur)

Kinetic energy of ions produced with first-, second-, and multi-shot femtosecond laser ablation on a solid surface

International Nuclear Information System (INIS)

Kobayashi, Tohru; Kato, Toshiyuki; Kurata-Nishimura, Mizuki; Matsuo, Yukari; Kawai, Jun; Motobayashi, Tohru; Hayashizaki, Yoshihide

2007-01-01

We report that the kinetic energy of samarium (Sm) atom and Sm + ion produced by femtosecond laser ablation of solid samarium is strongly dependent on the number of ablation laser shots in the range from 1 to 10. By ablating the fresh surface (i.e. 1st shot), we find the kinetic energy of both Sm and Sm + ion to be the largest (24 and 250 eV, respectively). Almost 10 times larger kinetic energy of Sm + ion than that of Sm clearly indicates the contribution of Coulomb explosion in the acceleration process. From the second shot, kinetic energies of Sm and Sm + ion are lower than those of the first shot and almost constant (ca. 12 and 80 eV, respectively). This behaviour suggests the change in the nature of the solid surface after femtosecond laser ablation, which can be explained by the amorphization of ablated sample surface reported in recent studies

Spontaneous and stimulated emission in Sm3+-doped YAl3(BO3)4 single crystal

International Nuclear Information System (INIS)

Ryba-Romanowski, Witold; Lisiecki, Radosław; Beregi, Elena; Martín, I.R.

2015-01-01

Single crystals of YAl 3 (BO 3 ) 4 doped with trivalent samarium were grown by the top-seeded high temperature solution method and their absorption and emission spectra were investigated. Optical pumping into prominent absorption band around 405 nm feeds the 4 G 5/2 metastable level giving rise to intense visible luminescence distributed in several spectral lines with the most intense line around 600 nm characterized by a branching ratio of 0.42 and peak emission cross section of 0.25×10 −20 cm 2 . Optical amplification at 600 nm with a gain coefficient of 2.9 cm −1 was achieved during a pump-and-probe experiment. - Highlights: • YAB:Sm crystal grown by the top-seeded high temperature solution method. • Spectroscopic qualities relevant for visible laser operation. • YAB:Sm single crystal used in a pump-and-probe experiment. • Optical amplification properties of samarium doped YAl 3 (BO 3 ) 4

The K2 Ecliptic Plane Input Catalog (EPIC) and Stellar Classifications of 138,600 Targets in Campaigns 1-8

Science.gov (United States)

Huber, Daniel; Bryson, Stephen T.; Haas, Michael R.; Barclay, Thomas; Barentsen, Geert; Howell, Steve B.; Sharma, Sanjib; Stello, Dennis; Thompson, Susan E.

2016-05-01

The K2 Mission uses the Kepler spacecraft to obtain high-precision photometry over ≈80 day campaigns in the ecliptic plane. The Ecliptic Plane Input Catalog (EPIC) provides coordinates, photometry, and kinematics based on a federation of all-sky catalogs to support target selection and target management for the K2 mission. We describe the construction of the EPIC, as well as modifications and shortcomings of the catalog. Kepler magnitudes (Kp) are shown to be accurate to ≈0.1 mag for the Kepler field, and the EPIC is typically complete to Kp ≈ 17 (Kp ≈ 19 for campaigns covered by Sloan Digital Sky Survey). We furthermore classify 138,600 targets in Campaigns 1-8 (≈88% of the full target sample) using colors, proper motions, spectroscopy, parallaxes, and galactic population synthesis models, with typical uncertainties for G-type stars of ≈3% in {T}{{eff}}, ≈0.3 dex in {log} g, ≈40% in radius, ≈10% in mass, and ≈40% in distance. Our results show that stars targeted by K2 are dominated by K-M dwarfs (≈41% of all selected targets), F-G dwarfs (≈36%), and K giants (≈21%), consistent with key K2 science programs to search for transiting exoplanets and galactic archeology studies using oscillating red giants. However, we find significant variation of the fraction of cool dwarfs with galactic latitude, indicating a target selection bias due to interstellar reddening and increased contamination by giant stars near the galactic plane. We discuss possible systematic errors in the derived stellar properties, and differences with published classifications for K2 exoplanet host stars. The EPIC is hosted at the Mikulski Archive for Space Telescopes (MAST): http://archive.stsci.edu/k2/epic/search.php.

Reducing Striping and Near Field Response Influence in the MODIS 1.38um Cirrus Detection Band.

Science.gov (United States)

Ackerman, S. A.; Moeller, C. C.; Frey, R. A.; Gumley, L. E.; Menzel, W. P.

2002-05-01

Since first light in February 2000, the MODIS L1B data from Terra has exhibited detector striping in the cirrus detection band at 1.38 um (B26). This band's unique characteristic is that it is potentially able to discriminate very thin cirrus (optical depth of 0.1) because water vapor absorption effectively attenuates the upwelling signal from the earth's surface, leaving a flat dark background underneath the thin cirrus. The striping has diminished the power of this band for detecting thin cirrus in the MODIS Cloud Mask (MOD35) over the global environment by imparting a structure on the background. The striping amplitude (valley to peak) is 10 - 15% of the MODIS Ltyp radiance in B26 over land backgrounds, thus exceeding the 5% radiance prelaunch accuracy specification for the band. Also unexpected has been the presence of earth surface reflectance in B26. Forward model calculations indicate that the two-way transmittance of B26 in-band (1% to 1% response) should be water (TPW) exceeds about 12 mm. However, MODIS B26 imagery has routinely shown land surface reflectance, such as Florida, even in very moist (TPW > 30 mm) tropical air masses. MODIS prelaunch test data suggests that a near field response (NFR) at about 1.3 um in the B26 filter may be contributing to this behavior. A destriping and out-of-band correction algorithm has been under development at the University of Wisconsin to address the these issues. The simple linear algorithm is based on tuning detector dependent influence coefficients for B26 as a function of B5 (1.24 um) radiance so that the corrected B26 radiance is near zero for all B26 detectors in moist atmospheric conditions. B5 was chosen as a surrogate to characterize the NFR leak in the B26 filter because of its close spectral proximity to the NFR leak. Real MODIS L1B data is being used to estimate the influence coefficients. The paper will describe the B5 based destriping and NFR correction algorithm and influence coefficient development. It

Bulletin of Materials Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

It is observed that. the dielectric permittivity () and loss tangent (tan ) are dependent on frequency,; the temperature of dielectric permittivity maximum shifts toward lower temperature side with the increase of samarium ion (Sm+3) concentration at the Pb sites, and; observed and calculated -values of XRD patterns show ...

Tuning the activity of Pt alloy electrocatalysts by means of the lanthanide contraction

DEFF Research Database (Denmark)

Escribano, Maria Escudero; Malacrida, Paolo; Hansen, Martin Hangaard

2016-01-01

is lanthanum, cerium, samarium, gadolinium, terbium, dysprosium, thulium, or calcium. The materials are among the most active polycrystalline Pt-based catalysts reported, presenting activity enhancement by a factor of 3 to 6 over Pt. The active phase consists of a Pt overlayer formed by acid leaching. The ORR...

Bis(phenolate)amine-supported lanthanide borohydride complexes for styrene and trans-1,4-isoprene (co-)polymerisations

NARCIS (Netherlands)

Bonnet, Fanny; Dyer, Hellen E.; El Kinani, Yassine; Dietz, Carin; Roussel, Pascal; Bria, Marc; Visseaux, Marc; Zinck, Philippe; Mountford, Philip

2015-01-01

New bis(phenolate)amine-supported neodymium borohydride complexes and their previously reported samarium analogues were tested as catalysts for the polymerisation of styrene and isoprene. Reaction of Na2O2NL (L = py, OMe, NMe2) with Nd(BH4)3(THF)3 afforded the borohydride complexes

Separation and purification of gadolinium and others rare earths, and yttrium

International Nuclear Information System (INIS)

Awwal, M.A.; Filgueiras, S.A.C.

1988-01-01

The experimental works in laboratories for developing a solvent extraction process with the purpose of gadolinium separation and purification, and secondarily samarium, europium, lanthanum and yttrium are described. Using as solvent di-2-ethylhexylphosphoric acid (DEHPA) a preliminary flow chart for separation for these elements are developed. (author)

Measurement of total angular momentum values of high-lying even ...

Indian Academy of Sciences (India)

Spectrally resolved laser-induced fluorescence technique was used to uniquely assign total angular momentum () values to high-lying even-parity energy levels of atomic samarium. Unique value assignment was done for seven energy levels in the energy region 34,800–36,200 cm-1 , recently observed and reported in ...

Study of 148-152Sm nuclei employing γ - derived from B(E2) values and level energies

International Nuclear Information System (INIS)

Sharma, Aparna; Varshney, A.K.; Singh, M.; Gupta, D.K.; Singh, Yuvraj; Gupta, K.K.; Bihari, Chhail; Varshney, Mani

2011-01-01

The study of samarium nuclei has been a challenging theoretical problem, since they lie in the range from near spherical to well deformed shapes. 148 Sm was believed to be basically spherical while 154 Sm is thought to be well deformed nucleus and 150-15 '2Sm are transitional nuclei

Specification and comparative calculation of enthalpies and Gibbs formation energies of anhydrous lanthanide nitrates

International Nuclear Information System (INIS)

Del' Pino, Kh.; Chukurov, P.M.; Drakin, S.I.

1980-01-01

Analyzed are the results of experimental depermination of formation enthalpies of waterless nitrates of lanthane cerium, praseodymium, neodymium and samarium. Using method of comparative calculation computed are enthalpies of formation of waterless lanthanide and yttrium nitrates. Calculated values of enthalpies and Gibbs energies of waterless lanthanide nitrate formation are tabulated

Perovskite catalysts for oxidative coupling

Science.gov (United States)

Campbell, Kenneth D.

1991-01-01

Perovskites of the structure A.sub.2 B.sub.2 C.sub.3 O.sub.10 are useful as catalysts for the oxidative coupling of lower alkane to heavier hydrocarbons. A is alkali metal; B is lanthanide or lanthanum, cerium, neodymium, samarium, praseodymium, gadolinium or dysprosium; and C is titanium.

Atomic structure of Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10}Be{sub 22.5} bulk metallic glass alloy

Energy Technology Data Exchange (ETDEWEB)

Hui, X. [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China)], E-mail: huixd01@hotmail.com; Fang, H.Z.; Chen, G.L. [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China); Shang, S.L.; Wang, Y. [Department of Materials Science and Engineering, Pennsylvania State University, University Park, PA 16802 (United States); Qin, J.Y. [Key Laboratory of Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University - Southern Campus, Jinan 250061 (China); Liu, Z.K. [Department of Materials Science and Engineering, Pennsylvania State University, University Park, PA 16802 (United States)

2009-01-15

Ab initio molecular dynamics (AIMD) calculations were performed on the atomic configuration of Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10}Be{sub 22.5} bulk metallic glass. The local structures were characterized in terms of structure factors (SF), pair correlation functions (PCF), coordinate numbers, bond pairs and Voronoi polyhedra. The glass transition temperature, generalized PCF and SF predicated by AIMD are in good agreement with the experimental data. Icosahedral short-range orders (ISRO) are found to be the most dominant, in view of the presence of the majority of bond pairs with 1551, 1541 and 1431, and Voronoi polyhedra with <0,3,6,1>, <0,2,8,1>, <0,0,12,0> and <0,2,8,4>. Icosahedral medium range orders (IMROs) are formed from icosahedra via the linkage of vertex-, edge-, face- and intercross-shared atoms. The glass structure on the nanometer scale is accumulated by polyhedra through an efficient packing mode. It is suggested that the extraordinary glass-forming ability of this alloy is essentially attributable to the formation of ISRO and IMRO, and the dense packing of atoms.

Food Insecurity Is Associated with Subjective Well-Being among Individuals from 138 Countries in the 2014 Gallup World Poll.

Science.gov (United States)

Frongillo, Edward A; Nguyen, Hoa T; Smith, Michael D; Coleman-Jensen, Alisha

2017-04-01

Background: Food insecurity is an aspect of living conditions that is particularly important for quality of life, health, and subjective well-being. The implementation of the 8-item Food Insecurity Experience Scale in 147 countries in the 2014 Gallup World Poll provided an unprecedented opportunity to understand the association of food insecurity with subjective well-being. Objective: We examined how food insecurity relates with measures of living conditions and how food insecurity and other living conditions relate with physical health and, in turn, subjective well-being. Methods: Data were collected from individuals aged ≥15 y by telephone in 38 countries and via face-to-face interviews in 111 others. The available sample was 132,618 (138 countries) and 122,137 (137 countries) for the daily experience and life evaluation indexes of subjective well-being, respectively. Daily experience was a continuous measure and life evaluation was categorized into thriving, struggling, and suffering. We estimated 6 linear or logistic regression models for each index controlling for country as a fixed effect. Results: Food insecurity was associated with the other 3 measures of living conditions: household income, shelter and housing, and employment. Food insecurity explained poor physical health and lower subjective well-being beyond other measures of living conditions. Instrumental and emotional support was associated with higher subjective well-being. The associations of food insecurity with subjective well-being were larger than with other explanatory variables. Food insecurity was associated with subjective well-being within each of the 4 World Bank income classes of countries, with a larger magnitude of differences for the higher-income classes. Conclusions: Food insecurity was strongly and negatively associated with subjective well-being in a large global sample of individuals aged ≥15 y. These results demonstrate the consistency of goal 2 of the Sustainable

Samarium-cobalt type rare earth permanent magnets

International Nuclear Information System (INIS)

Kamat, S.V.

2014-01-01

Permanent magnets are one of the oldest and largest applications of magnetic materials and form an integral part of our modern industrial society. They belong to a special class of functional materials and are characterized for remanence (flux output from the magnet), coercivity (resistance to demagnetization) and energy product (material energy density) from the second quadrant of the magnetic hysteresis loop. The reliability, stability, size, weight, cost and performance of many electro-technical devices depend mainly on the properties of permanent magnets used in them. There are three important families of permanent magnets viz., Ferrites, Alnicos and Rare Earth Permanent Magnets (REPMs) with energy product values ranging from 3 to 50 MGOe and among the front ranking high performance REPMs, SmCo 5 , Sm 2 Co 17 type and NdFeB alloys are technologically the most important materials. They are used in a wide range of applications ranging from consumer products to very specialized areas of tele-communications, microelectronics, defence, space, avionics etc. While NdFeB has the highest energy product, Sm-Co based magnets are preferred for most critical applications where temperature stability of magnetic properties is essential because of their significantly higher Curie temperatures. In this presentation some of the key challenges associated with these Sm-Co based rare earth permanent magnets will be highlighted. (author)

Samarium-cobalt-copper-iron-titanium permanent magnets

International Nuclear Information System (INIS)

Inomata, K.; Yamada, M.

1980-01-01

A permanent magnet, which comprises a composition containing a Sm-Co compound and consisting essentially of 23 to 30 wt.% of Sm, 0.2 to 1.5 wt.% Ti, 9 to 13 wt., Cu, 3 to 12 wt.% Fe and the balance Co, said magnet having a residual flux density (Br) of about 10 (kG), a coercive force (IC) of about 8 (KOe) and a maximum energy product (BH max) of about 25 (MGOe), having the aforesaid magnetic properties without the necessity of an ageing treatment

Vaporization of Samarium trichloride studied by thermogravimetry

International Nuclear Information System (INIS)

Esquivel, Marcelo R.; Pasquevich, Daniel M.

2003-01-01

In the present work, the vaporization reaction of SmCl 3 (l) obtained from the 'in situ' reaction of Sm 2 O 3 (s) and Cl 2 (g)-C(s) was studied by thermogravimetry under controlled atmosphere. The effects of both the temperature between 825 C degrees and 950 C degrees and the total flow gas on the vaporization rate of the following reaction: SmCl 3 (l) = SmCl 3 (g) were analyzed. The vaporization rate of the process was found to be independent of then total gas flow rate and highly dependent on the temperature. E ap calculation led to a value of 240 ± 10 kJ.mol -1 . A comparison between this value and that of the molar enthalpy of vaporization allow to the conclusion that the reaction occur in conditions near to equilibrium. The SmCl 3 identity was determined by X-ray diffraction (XRD) and energy dispersive spectroscopy (EDS). (author)

Reactive Materials for Evaporating Samarium (Pre-Print)

Science.gov (United States)

2016-04-15

further below  in  the  sample were not effectively  heated  and did not ignite.   Heat   transfer  was improved in pressed  pellets, which were, therefore...particles.  This combustion regime is most desired  for Sm  evaporation  based on the measured mass of the remaining coarse  condensed  combustion  products...the  evaporated  Sm could  condense  on top of the cooled burned out pellet,  forming  the surface coating.   Further EDX characterization qualitatively

Coupled IVPs to Investigate a Nuclear Reactor Poison Burn Up

Science.gov (United States)

Faghihi, F.; Saidi-Nezhad, M.

2009-09-01

A set of coupled IVPs that describe the change rate of an important poison, in a nuclear reactor, has been written herein. Specifically, in this article, we have focused on the samarium-149 (as a poison) burnup in a desired pressurized water nuclear reactor and its concentration are given using our MATLAB-linked "solver."

Coupled IVPs to Investigate a Nuclear Reactor Poison Burn Up

International Nuclear Information System (INIS)

Faghihi, F.

2009-01-01

A set of coupled IVPs that describe the change rate of an important poison, in a nuclear reactor, has been written herein. Specifically, in this article, we have focused on the samarium-149 (as a poison) burnup in a desired pressurized water nuclear reactor and its concentration are given using our MATLAB-linked 'solver'.

Xe-135 and Sm-149 Isotopic Evolution Analysis Xesamo code; Analisis de la Evolucion Isotopica del Xe-135 y Sm-149. Programa Xesamo

Energy Technology Data Exchange (ETDEWEB)

Caro, R; Gallego, J; Martinez Fanegas, R

1977-07-01

In this report the time evolution analysis of the nuclides concentration Xe-135 and Sm-149 as a function of the neutron flux is carried out. The neutron flux may be any function of time. It is analyzed as well the reactivity changes associated with the xenon and samarium concentration variations. (Author) 5 refs.

Xe-135 and Sm-149 Isotopic Evolution Analysis Xesamo code

International Nuclear Information System (INIS)

Caro, R.; Gallego, J.; Martinez Fanegas, R.

1977-01-01

In this report the time evolution analysis of the nuclides concentration Xe-135 and Sm-149 as a function of the neutron flux is carried out. The neutron flux may be any function of time. It is analyzed as well the reactivity changes associated with the xenon and samarium concentration variations. (Author) 5 refs

33 CFR 138.15 - Applicability.

Science.gov (United States)

2010-07-01

... POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION FINANCIAL RESPONSIBILITY FOR WATER POLLUTION (VESSELS) AND OPA 90 LIMITS OF LIABILITY (VESSELS AND DEEPWATER PORTS) Financial Responsibility for Water... exclusive economic zone to transship or lighter oil (whether delivering or receiving) destined for a place...

33 CFR 138.130 - Fees.

Science.gov (United States)

2010-07-01

... in paragraphs (c) and (d) of this section have been paid. (b) For those using E-COFR, credit card... Certificate, Fleet Certificate, or Master Certificate), except as follows: (1) An Application for an...

Structural and Spectroscopic Studies of Sm3+/CdS Nanocrystallites in Sol-Gel TiO2-ZrO2 Matrix

Science.gov (United States)

Karthika, S.; Prathibha, Vasudevan; Ann, Mary K. A.; Viji, Vidyadharan; Biju, P. R.; Unnikrishnan, N. V.

2014-02-01

A sol-gel method was used to prepare titania-zirconia matrices doped with Sm3+/CdS nanocrystallites. The structural properties of the matrices were characterized using transmission electron microscopy (TEM), thermogravimetric analysis (TGA), differential thermal analysis (DTA), and Fourier-transform infrared spectroscopy studies. The thermal stability of the material was determined by TGA/DTA analysis. The absorption spectrum shows the characteristic peaks of the Sm3+ ions and the absorption peak corresponding to the CdS nanocrystallites. The optical bandgap and size of the CdS nanoparticles were calculated from the absorption spectrum. From TEM, the interplanar distance ( d) was estimated to be 3.533 Å, which matches with the (1 0 0) plane of bulk CdS. The measurements yield a nanocrystallite size of around 7.8 nm. The optical absorption and emission spectra confirmed the formation of CdS nanoparticles along with samarium ions in the titania-zirconia matrices. The fluorescence intensity of the samarium ions was found to be greatly enhanced by codoping with CdS nanocrystallites.

Viability of biocompatible and biodegradable seeds production with incorporated radionuclides

International Nuclear Information System (INIS)

Roberto, W.S.; Pereira, M.M.; Vasconcelos, W.L.; Campos, T.P.R.

2000-01-01

The present work aims the development of radioactive seeds, biocompatible and biodegradable, with the objective of adding options in the cancer treatment. The work focus on the production of seeds biodegradable that incorporate radioisotopes with half life inferior than the degradation time of the material. The idea of producing devices with biodegradable materials impregnated with radioisotopes of short half life will offer new possibilities in the cancer treatment, since they can be used following the same procedures of the permanent interstitial brachytherapy, but using degradable materials compatible with the physiological environment. It will be discussed in particular the possible application of these seeds in the treatment of prostate cancer. A review of the subject and a preliminary evaluation of the viability of production of the seeds will be presented. The method of production of the seeds is based on the incorporation of Iodine and Samarium in glass matrixes obtained by sol-gel processing. X-ray fluorescence was done in the samples produced and the incorporation of Iodine and Samarium atoms was confirmed. (author)

OXIDATIVE DEHYDROGENATION OF PROPANE BY RARE EARTH PHOSPHATES SUPPORTED ON AL-PILC

Directory of Open Access Journals (Sweden)

Carolina De Los Santos

2012-12-01

Full Text Available Catalytic activity in propane oxidative dehydrogenation of rare earth phosphates LnPO4 (where Ln = La, Ce, Pr, Nd, Sm and of the same supported by an aluminum pillared clay, of high specific surface area, is presented. The solids were characterized by TGA, XRD, nitrogen adsorption and immediate analysis after reaction in order to determine eventual carbon formation. Catalytic assays were performed at temperatures in the range 400oC-600oC, the reaction mixture was C3H8/O2/Ar = 10/10/80. All the catalysts were active. The reaction products were H2, CO, CO2, CH4, C2H4 and C3H6 and there were no organic oxygenated compounds detected. Although all the investigated systems were active, the Al-PILC supported catalysts presented a higher activity than the bulk materials. In this context, the samarium supported catalyst showed a propene yield increase from 4% to 10% compared with bulk samarium phosphate at 600°C. This effect was attributed to the increase in the specific surface area.

Viability of biocompatible and biodegradable seeds production with incorporated radionuclides; Viabilidade da producao de sementes biocompativeis e biodegradaveis com radionuclideos incorporados

Energy Technology Data Exchange (ETDEWEB)

Roberto, W.S. [Centro Federal de Educacao Tecnologica de Ouro Preto (CEFET/OP), MG (Brazil); Pereira, M.M.; Vasconcelos, W.L.; Campos, T.P.R. [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)], e-mail: wanderley@nuclear.ufmg.br

2000-07-01

The present work aims the development of radioactive seeds, biocompatible and biodegradable, with the objective of adding options in the cancer treatment. The work focus on the production of seeds biodegradable that incorporate radioisotopes with half life inferior than the degradation time of the material. The idea of producing devices with biodegradable materials impregnated with radioisotopes of short half life will offer new possibilities in the cancer treatment, since they can be used following the same procedures of the permanent interstitial brachytherapy, but using degradable materials compatible with the physiological environment. It will be discussed in particular the possible application of these seeds in the treatment of prostate cancer. A review of the subject and a preliminary evaluation of the viability of production of the seeds will be presented. The method of production of the seeds is based on the incorporation of Iodine and Samarium in glass matrixes obtained by sol-gel processing. X-ray fluorescence was done in the samples produced and the incorporation of Iodine and Samarium atoms was confirmed. (author)

Study of rare earth separation by counter current electromigration

International Nuclear Information System (INIS)

Correa, Sergio Machado

1995-08-01

The counter current electromigration (CCEM) is an electrophoretic technique where the charged species migrate on an electrical field toward an electrolytic flux. Usually this electrolyte is a complexing agent and is necessary to increase the small differences between the species mobilities. A new column was developed, all made of acrylic, in a cylindrical shape. A set of experiments was carried out with the species Na + /K + , K + /Sm +3 , K + /Eu +3 and K + /Sm +3 /Eu +3 using the α-hydrox i-isobutyric acid o,01 M as the counter current electrolytic flux. From a synthetic mixture of 90% of samarium and 10% of europium was obtained the samarium ion in a purity better than 99,9% where the concentration of Eu was determined by the polarography technique. The potassium ion was used as a leading electrolyte. It was also measured the mobilities of the involved species in the α-HIBA medium. Two models are proposed, a stationary model and a dynamic one. A simulator of a simplified stationary model, prepared in FORTRAN language, was developed and tested toward experimental results. (author)

Investigation of doped Perovskite systems RAIO3 using density functional theory based electronic structure and thermoelectric studies

International Nuclear Information System (INIS)

Sandeep; Ghimire, M. P.; Thapa, R. K.; Rai, D. P.; Shankar, A

2016-01-01

Samarium doping effects on the thermoelectric properties in Eu 1-x Sm x AlO 3 (x=0%, 50%, and 100%) were studied using first principles calculations based thermal transport property measurement. The result indicate that the compound is an intrinsic n-type material. Samarium doping has a positive effect on the overall thermoelectric performance of the Eu 1-x Sm x AlO 3 system, with sharp increase in figure of merit (ZT) observed when x=0, 50 and 100% up to 150K. Compared to x=0 and 100%, the case of x=50% was found to have more positive increment in ZT value suggesting that the doing to have positive effect on figure of merit in Eu 1-x Sm x AlO 3 . Furthermore, all the samples show stable thermoelectric compatibility factors over a broad temperature range from 700 to 1000 K, which could have great benefits for their practical applications. It is concluded that the overall thermoelectric performance of the Eu 1-x Sm x AlO 3 could be highly enhanced using doping techniques. (paper)

Oklo natural reactor. Study of uranium and rare earths migration on a core drilled through a reaction zone. Application to determination of the date of the nuclear reaction by measurement of fission products

International Nuclear Information System (INIS)

Ruffenach, J.C.

1977-01-01

Isotopic and chemical analysis of uranium and five rare earths: neodymium, samarium, europium, gadolinium and dysprosium were effected on fourteen samples taken in the same core drilled through a reaction zone of the Oklo uranium deposit. This study points out the general stability of uranium and fission rare earths; spatial distributions of these elements are quite analogous. Migrations have affected about 5% only of fission neodymium in the core of the reaction zone; corresponding values for samarium and gadolinium are slightly higher. These migration phenomena have carried rare earths to no more than 80 cm out of the core. By study of the europium it is shown that nuclear reactions have stayed in the ground since the time of reactions. On the other hand it is shown by analysis of the dysprosium that rare earths have not undergone an important movement. This study allow also the datation of nuclear reactions from the measurement of the quantity of fission neodymium produced. A value of 1.98x10 9 years is obtained slightly higher than the value obtained by geochronology [fr

Contribution to the study of samarium-151 excited levels; Contribution a l'etude des niveaux excites du samarium-151

Energy Technology Data Exchange (ETDEWEB)

Locard, P [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Grenoble, 38 (France)

1967-07-01

The nucleus of {sup 151}Sm, which has 89 neutrons, happens to be on the lower edge of the deformed nuclei of region II. Therefore, the study of its levels is very interesting for the verification of the goodness of the collective models for deformed nuclei when the deformation is small (we introduce these models in the first chapter). {sup 151}Sm has often been studied, but the direct gamma spectrum measured with a lithium drift-germanium detector (chapter 3) shows many high energy transitions which did not appear in the previous level schemes. In order to settle these transitions, we have undertaken gamma-gamma coincidence spectra (as well as sum-coincidence spectra) experiments with a scintillation spectrometer designed in our laboratory (chapter 2). The investigation of the intensities of these coincidences leads us to modify the last proposed level schemes: we suppress the levels at 405,5 and 650 keV, we add levels at 245,6 - 306,6 - 522 - 952 and 962 keV. We have also verified the multipolarities of the main transitions and measured the half-lives of a few levels (chapter 3) (we find a half-life of 1.1 {+-} 0.5 nanosecond for the level at 167,7 keV). In chapter 4, we compare our results to the predictions of the models described in chapter 1. (author) [French] Le noyau de {sup 151}Sm, qui possede 89 neutrons, se trouve a la limite inferieure des noyaux deformes de la region II. L'etude de ses niveaux excites est donc d'un interet tout particulier pour la verification de la validite des differents modeles collectifs pour les noyaux deformes, lorsque la deformation est petite (nous introduisons ces modeles dans un premier chapitre). Le {sup 151}Sm a deja fait l'objet de nombreuses etudes, mais le spectre gamma direct fait avec une jonction de germanium compense au lithium (chapitre 3), nous a montre l'existence d'un grand nombre de transitions de hautes energies qui ne sont pas placees dans les schemas proposes jusqu'a ce jour. Pour preciser la place de ces transitions, nous avons donc entrepris des experiences de coincidences gamma-gamma (et de ''spectre de somme'') a l'aide d'un ensemble de spectrometrie a scintillation realise au laboratoire (chapitre 2). L'etude des intensites de ces coincidences (chapitre 3) nous amene a modifier le dernier schema propose: nous supprimons les niveaux a 405,5 et 650 keV, nous ajoutons des niveaux a 245,6 - 306,6 - 522 - 952 et 962 keV. Nous avons egalement verifie la multipolarite des principales transitions et mesure la duree de vie de certains des niveaux (chapitre 3) (nous trouvons une periode de 1,1 {+-} 0,5) nanoseconde pour le niveau a 167,7 keV). Le chapitre 4 est enfin consacre a la comparaison de nos resultats avec les predictions des differents modeles decrits au chapitre 1. (auteur)

Nuclear structure from radioactive decay

International Nuclear Information System (INIS)

Wood, J.L.

1991-01-01

This report discusses nuclear structure from radioactive decay of the following: Neutron-Deficient Iridium Isotopes; Neutron-Deficient Platinum Isotopes; Neutron-Deficient Gold Isotopes; Neutron-Deficient Mercury Isotopes; Neutron-Deficient Thallium Isotopes; Neutron-Deficient Lead Isotopes; Neutron-Deficient Samarium Isotopes; Neutron-Deficient Promethium Isotopes; Neutron-Deficient Neodymium Isotopes; and Neutron-Deficient Praseodymium Isotopes. Also discussed are Nuclear Systematics and Models

Influence of rare earth elements on radiation defect formation in silicon

International Nuclear Information System (INIS)

Nazyrov, D.E.

2006-01-01

Full text: It is known that efficiency of form and kinetics annealing of radiation defects influence greatly presence of initial in controlling electrically active or inactive impurities, their concentration and position in a lattice of a semiconductor. From this point of view of impurities of group of rare earths elements (REE) are of great interest, they interact with primary radiation defects creating electrically passive complexes such as . Thus they increase radiation stability of silicon. The purpose of the given work was the investigation of effect of irradiation by γ-quanta 60 Co properties of silicon doped REE-by samarium, gadolinium and erbium. The doping of silicon was carried out by growth process. Concentration of REE - samarium, gadolinium and erbium in silicon according to neutron-activation analysis equaled 10 14 /5·10 18 cm 2 . Silicon doped by phosphorus - 15/50 Ωcm were used as control samples. The results of investigations were obtained from DLTS (deep level transient spectroscopy) measurements, Hall effect and electrical measurements on definition of a resistivity, lifetime of minority carriers of a charge and optically active of concentrations of oxygen and carbon. The optical recharge by the infrared light emitting diode (P=10 mV, λ=0,95 μm) was used for investigation of deep levels (DL) situated in lower half of band gap. In control samples irradiated by the γ-quanta 60 Co with a dose 10 16 / 5·10 18 cm -2 formation DL was found in band, the parameters of which are well-known: A-, E-centers etc. Depending on a dose of an effect of irradiate in an energy spectrum of radiation defects in Si of essential changes, except for concentration is not observed. The deep levels concentration the E c -0,17 eV and E c -0,4 eV in Si is essentially reduced with respect control samples. The comparison the dose of associations of observable levels in irradiated n-Si with similar associations in control samples shows, that a velocity of introduction

A Novel Molecular Fluorescent Technique for Imaging the Somatostatin Receptor 2, Using a DOTATOC Lanthanide Conjugate

DEFF Research Database (Denmark)

Andersen, Rune Wiik; Prakash, Vineet; Stensballe, Allan

-functional DOTATOC component.                       METHOD AND MATERIALS            The chelation of Europium and Samarium to DOTATOC was proven using MALDI-TOF Mass Spectrometry. The rise in quantum yield between unchelated lanthanides and those bound by DOTATOC was examined using fluorescence spectroscopy...

Solid solutions in the system Nd2(SeO4)3 - Sm2(SeO4)3 - H2O

International Nuclear Information System (INIS)

Serebrennikov, V.V.; Tsybukova, T.N.; Velikov, A.A.

1984-01-01

Using the method of isothermal solubility at 25 deg C the system Nd 2 (SeO 4 ) 3 -Sm 2 (SeO 4 ) 3 -H 2 O has been studied. Roentgenographic recording of solid ''residues'' is realized. For solid solutions energies of interchange and formation heats are calculated. Formation heats of solid solutions on the basis of samarium selenates are also found experimentally

Thermoluminescent coactivated rare earth oxyhalide phosphors and x-ray image converters utilizing said phosphors

International Nuclear Information System (INIS)

Rabatin, J.G.

1984-01-01

Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)

Carmen system: a code block for neutronic PWR calculation by diffusion theory with spacedependent feedback effects

International Nuclear Information System (INIS)

Ahnert, C.; Aragones, J.M.

1982-01-01

The Carmen code (theory and user's manual) is described. This code for assembly and core calculations uses diffusion theory (Citation), with feedback in the cross sections by zone due to the effects of burnup, water density, fuel temperature, Xenon and Samarium. The burnup calculation of a full cycle is solved in only an execution of Carmen, and in a reduced computer time. (auth.)

Self-Q-switched ytterbium-doped cladding-pumped fibre laser

International Nuclear Information System (INIS)

Grukh, Dmitrii A; Kurkov, Andrei S; Razdobreev, I M; Fotiadi, A A

2002-01-01

A self-Q-switched ytterbium-doped double-clad fibre laser is described. A samarium-doped fibre is used as a filter for protecting a pump source. A fibre coupler is employed to obtain a nonlinear feedback. The mechanism of pulse formation in the laser is considered, and the dependence of its output pulse on the coupler parameters is studied. (solitons and optical fibers)

Contribution of current carrier mobility variation to piezo-resistive effect in SmS

International Nuclear Information System (INIS)

Vasil'ev, L.N.; Kaminskij, V.V.

1999-01-01

The value of the contribution from the change in the current carriers mobility and pressure to the piezo-resistive effect value in the materials on the basis of the samarium, monosulfide is studied. The conclusion, that the value of the piezoresistance of comprehensive compression should not exceed 7x10 -3 MPa -1 at T=300 K, experimental data [ru

Fundamental studies on multicharged impurities of the Tokamaks

International Nuclear Information System (INIS)

Bernardi, J. de; Geller, R.; Jacquot, B.; Jacquot, C.

1979-11-01

We describe Micromafios which is an Ion source delivering particles up to completely stripped Carbon, Nitrogen and Oxygen ions. The beams are utilized on an experiment device for cross section measurements enabling fondamental studies for Tokamak impurity ions. The source is a miniaturized Supermafios device where the minimum B configuration is obtained with Samarium Cobalt magnetized Ferrites and a solenoidal axial field [fr

Therapeutic Efficacy of Alpha-RIT Using a (213)Bi-Anti-hCD138 Antibody in a Mouse Model of Ovarian Peritoneal Carcinomatosis.

Science.gov (United States)

Derrien, Aurélie; Gouard, Sébastien; Maurel, Catherine; Gaugler, Marie-Hélène; Bruchertseifer, Frank; Morgenstern, Alfred; Faivre-Chauvet, Alain; Classe, Jean-Marc; Chérel, Michel

2015-01-01

Ovarian peritoneal carcinomatosis is a pathology for which effective cures are currently lacking. New research protocols seek to eradicate residual micrometastases following cytoreductive surgery by using hyperthermic intraperitoneal chemotherapy (HIPEC) or radioimmunotherapy (RIT). This study aims to first develop alpha-RIT using an anti-CD138 mAb radiolabeled with an alpha-emitter, bismuth-213 ((213)Bi-B-B4) and HIPEC in a nude mouse model and second to compare and combine these techniques. A murine model of postoperative ovarian peritoneal carcinomatosis was established. A pilot group of six mice received an intraperitoneal injection of luciferase-tagged SHIN-3 cells and bioluminescence was measured every day. Cytoreductive surgery was performed at day 14 (n = 4) and 29 (n = 2). Because the residual bioluminescence signal measured after surgery was equivalent to that obtained 3 days after the graft, HIPEC or alpha-RIT treatments were applied 3 days after the graft. Ten mice were treated by HIPEC with cisplatine (37.5 mg/mL), 11 with 7.4 MBq of (213)Bi-B-B4, seven with 11.1 MBq of (213)Bi-B-B4, and 10 mice were treated with the combined therapy (HIPEC + 7.4 MBq of (213)Bi-B-B4). Eleven mice received no treatment. Bioluminescence imaging and survival were assessed. Alpha-RIT 7.4 MBq and 11.1 MBq significantly improved survival (p = 0.0303 and p = 0.0070, respectively), whereas HIPEC and HIPEC + alpha-RIT treatments did not significantly ameliorate survival as compared to the control group. Survival was significantly increased by alpha-RIT treatment in mice with peritoneal carcinomatosis of ovarian origin; however, HIPEC alone or in combination with alpha-RIT had no significant effect.

Understanding Statin Use in America and Gaps in Patient Education (USAGE): an internet-based survey of 10,138 current and former statin users.

Science.gov (United States)

Cohen, Jerome D; Brinton, Eliot A; Ito, Matthew K; Jacobson, Terry A

2012-01-01

Statins substantially reduce the risk of cardiovascular disease and are generally well-tolerated. Despite this, many patients discontinue therapy. A better understanding of the characteristics of current and former statin users may be helpful for formulating strategies to improve long-term adherence. The Understanding Statin Use in America and Gaps in Education (USAGE) survey assessed the attitudes, beliefs, practices, and behavior of current and former statin users. Individuals 18 years or older who reported a history of high cholesterol and current or former statin use were identified within a registered consumer panel cohort in the United States and invited to participate in an Internet survey. Of the 10,138 respondents, 8918 (88%) were current statin users and 1220 (12%) were former users. Participants (mean age 61 years) were predominantly white (92%), female (61%), of middle income (median $44,504/yr), and had health insurance (93%). Among current users, 95% took a statin alone, and 70% had not missed a dose in the past month. Although ∼70% reported that their physicians had explained the importance of cholesterol levels for their heart health former users were less satisfied with the discussions (65% vs. 83%, P users, respectively (P users was cost (32%) and the primary reason for discontinuation was side effects (62%). This survey provides important insights into behavior and attitudes among current and former statin users and the results suggest that more effective dialogue between healthcare providers and patients may increase persistence of statin use, particularly when the patient has concerns about side effects and drug costs. Copyright © 2012 National Lipid Association. Published by Elsevier Inc. All rights reserved.

Measurement of solubility of plutonium trifluoride and rare-earth fluorides in molten LiF-BeF2-ZrF4

International Nuclear Information System (INIS)

Naumov, V.S.; Bychkov, A.V.; Kormilitsyn, M.V.

1996-12-01

Data on behavior of plutonium fluoride and fission products (FP) dissolved in fuel composition are needed to calculate the duration of an operating cycle of the ADTT facility (Accelerator-Driver Transmutation Technologies) and to determine the effect of their equilibrium concentrations on nuclear-physical characteristics of reactor operation. The data on the FP fluoride solubility in the molten salts are of great important for some industrial processes (electrolytical metal deposition, development of physical-chemical mean for processes of chemical technology, etc.) As noted above, some information on this question is given in monography and articles. Data concerning fluoride salts are given in reports. However, it was impossible to make the substantial analysis of mutual solubility of fluoride melts. The primary investigation of CeF 3 and neodymium, samarium and lanthanum fluorides showed that the solubility of the melt LiF-BeF 2 and LiF-BeF 2 -ThF 4 was a linear function of reverse temperature and increases from lanthanum to samarium in the row of rare-earth elements. Disagreement in estimation of plutonium trifluoride solubility and incomplete data on the solubility of rare-earth elements prompted this study

Behavior of radioactive metal surrogates under various waste combustion conditions

International Nuclear Information System (INIS)

Yang, Hee Chul; Lee, Jae Hee; Kim, Jung Guk; Yoo, Jae Hyung; Kim, Joon Hyung

2002-01-01

A laboratory investigation of the behavior of radioactive metals under the various waste combustion atmospheres was conducted to predict the parameters that influence their partitioning behavior during waste incineration. Neodymium, samarium, cerium, gadolinium, cesium and cobalt were used as non-radioactive surrogate metals that are representative of uranium, plutonium, americium, curium, radioactive cesium, and radioactive cobalt, respectively. Except for cesium, all of the investigated surrogate metal compounds converted into each of their stable oxides at medium temperatures from 400 to 900 .deg. C, under oxygen-deficient and oxygen-sufficient atmospheres (0.001-atm and 0.21-atm O 2 ). At high temperatures above 1,400 .deg. C, cerium, neodymium and samarium in the form of their oxides started to vaporize but the vaporization rates were very slow up to 1500 .deg. C. Inorganic chlorine (NaCl) as well as organic chlorine (PVC) did not impact the volatility of investigated Nd 2 O 3 , CoO and Cs 2 O. The results of laboratory investigations suggested that the combustion chamber operating parameters affecting the entrainment of particulate and filtration equipment operating parameters affecting particle collection efficiency be the governing parameters of alpha radionuclides partitioning during waste incineration

Preparation and Luminescent Properties of the antibacterial materials of the La3+ Doped Sm3+-Hydroxyapatite

Science.gov (United States)

Lv, Yuguang; Shi, Qi; Jin, Yuling; Ren, Hengxin; Qin, Yushan; Wang, Bo; Song, Shanshan

2018-03-01

In this paper, the La3+-doped Sm3+ hydroxyapatite (La/Sm/HAP) complexes were prepared by a precipitation method. The sample was defined by IR spectra, fluorescence spectra and X ray diffraction analysis et al. The structure of complexes were discussed. The emission wavelength of heat treatment of Sm3+ do not change, but will affect the intensity of the peak Sm3+ luminescence properties and the occupy hydroxyapatite in the lattice Ca( II )and Ca( I ) loci with Sm3+ doped concentration and the proportion of the sintering temperature change and change: The nano hydroxyapatite complex of the La3+ doped samarium obtain the good fluorescence intensity, by La3+ doping content of Sm3+ were hydroxyapatite 6% (La3+, Sm3+ mole ratio) device. The complex of La3+ doped samarium HAP have Stable chemical property, fluorescence property and excellent biological activity. The ligand HAP absorbs energy or captures an electron-hole pair and then transfers it to the lanthanide ions. The catalytic activity influence of the La3+-doped Sm3+hydroxyapatite was discussed, the La/Sm/HAP had excellent antibacterial property, which used as potential biological antibacterial material.

Synthesis, crystal structure and thermal decomposition mechanism of the complex [Sm(p-BrBA)3bipy.H2O]2.H2O

International Nuclear Information System (INIS)

Zhang Haiyan; Zhang Jianjun; Ren Ning; Xu Suling; Tian Liang; Bai Jihai

2008-01-01

A new binuclear samarium (III) complex [Sm(p-BrBA) 3 bipy.H 2 O] 2 .H 2 O (p-BrBA = p-bromobenzoic acid; bipy = 2,2'-bipyridine) has been synthesized and characterized by elemental analysis, UV, IR, molar conductance and TG-DTG techniques. The structure of the complex was established by single crystal X-ray diffraction. It crystallizes in triclinic, space group P1-bar with a = 8.2476(7) A, b = 13.3483(10) A, c = 15.9035(13) A, α 73.9160(10) o , β = 78.9630(10) o , γ = 74.4770(10) o , Z = 1, D c 1.947 g cm -3 , F(000) = 910. The carboxylic groups are bonded to the samarium ion in two modes: bidentate bridging, monodentate. Each center Sm 3+ ion is eight-coordinated by one 2,2'-bipyridine molecular, four bidentate bridging and a monodentate carboxylic group, as well as one water molecular. The coordination polyhedron around each Sm 3+ ion can be described as bi-capped triangular prism geometry. The thermal decomposition behavior of the title complex in a static air atmosphere was investigated by TG-DTG and IR techniques

Nuclear study of Melusine; Etude nucleaire de Melusine

Energy Technology Data Exchange (ETDEWEB)

Cherot, J [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

1959-07-01

In this report are reviewed - with respect to starting of experiments - the main nuclear characteristics of a 20 per cent enriched uranium lattice, with light water as moderator and reflector. The reactor is to operate at 1 MW. 1) Study of various critical masses. 2) Control. Effectiveness of cadmium. Control rods and of a stainless steel regulating rod. 3) Study of the effect on reactivity of disturbances in the core center. 4) Study of xenon and samarium poisoning. 5) Temperature factor. 6) Heat exchanges in a fuel element. (author) [French] On etudie, dans ce rapport, les principales proprietes nucleaires d'un reseau a uranium enrichi (20 pour cent), dont le moderateur et le reflecteur sont l'eau legere en vue des experiences de demarrage. Ce reacteur devra fonctionner a 1 MW. 1) Etude de diverses masses critiques. 2) Controle. Efficacite des barres de controle en cadmium et d'une barre de reglage en acier inoxydable. 3) Etude de l'effet sur la reactivite de perturbation au centre du coeur. 4) Etude de l'empoisonnement xenon et samarium. 5) Coefficient de temperature. 6) Echanges thermiques dans un element. (auteur)

Study of rare earth separation by counter current electromigration; Estudo da separacao de terras raras por eletromigracao em contra corrente

Energy Technology Data Exchange (ETDEWEB)

Correa, Sergio Machado

1995-08-01

The counter current electromigration (CCEM) is an electrophoretic technique where the charged species migrate on an electrical field toward an electrolytic flux. Usually this electrolyte is a complexing agent and is necessary to increase the small differences between the species mobilities. A new column was developed, all made of acrylic, in a cylindrical shape. A set of experiments was carried out with the species Na{sup +}/K{sup +}, K{sup +}/Sm{sup +3}, K{sup +}/Eu{sup +3} and K{sup +}/Sm{sup +3}/Eu{sup +3} using the {alpha}-hydrox i-isobutyric acid o,01 M as the counter current electrolytic flux. From a synthetic mixture of 90% of samarium and 10% of europium was obtained the samarium ion in a purity better than 99,9% where the concentration of Eu was determined by the polarography technique. The potassium ion was used as a leading electrolyte. It was also measured the mobilities of the involved species in the {alpha}-HIBA medium. Two models are proposed, a stationary model and a dynamic one. A simulator of a simplified stationary model, prepared in FORTRAN language, was developed and tested toward experimental results. (author)

Neutron activation analysis of geological material

International Nuclear Information System (INIS)

Greef, G.J.

1977-05-01

In neutron activation analysis the precision and accuracy of results are often misleading, since only the statistical errors which accompany the measuring of radioactivity are taken into consideration. Several other factors can, however, also influence precision and accuracy. It was found that a geological sample was contaminated with the construction material of the mill in which it had been pulverised. Several geometrical differences which could possibly play a role were also investigated. Impurities in the irradiation containers affect the determination of some elements in the samples; the contamination materials in quarts irradiation tubes were determined. The flux gradients which may effect the relative activities of the samples and standards were measured. Suitable standards are necessary to ensure accurate analyses of geological material. Available natural standards were critically evaluated and several methods were investigated by which synthetic standards may be prepared. In order to accurately determine gallium, lanthanum and samarium by means of neutron activation analysis, sodium first had to be removed. After irradiation the sample was dissolved in a mixture of acids and the soidium absorbed from the solution on a hydrated antimony pentoxide column. Gallium, lanthanum and samarium activities were measured by means of precision gamma-spectrometry

Molecular electrophosphorescence in (Sm, Gd)-β-diketonate complex blend for OLED applications

International Nuclear Information System (INIS)

Reyes, R.; Cremona, M.; Teotonio, E.E.S.; Brito, H.F.; Malta, O.L.

2013-01-01

In this work the preparation and characterization of the triple-layer organic light-emitting diode (OLED) using a mixture of the samarium and gadolinium β-diketonate complexes [Sm 0.5 Gd 0.5 (TTA) 3 (TPPO) 2 ] as emitting layer is reported. The OLED's devices contain 1-(3-methylphenyl)-1,2,3,4-tetrahydroquinoline-6-carboxyaldehyde-1, 1'-diphenylhydrazone (MTCD) as hole-transporting layer and tris(8-hydroxyquinoline aluminum) (Alq 3 ) as electron transporting layer. The electroluminescence spectrum present emission narrow bands from the 4 G 5/2 → 6 H J transitions (where J=5/2, 7/2 and 9/2) characteristic of the Sm 3+ ion. These sharp lines are overlapped with a broad band attributed to the electrophosphorescence from the T 1 →S 0 transition in the ligand TTA. The intramolecular energy transfer is discussed and applied on the change of the emission color of the organic LEDs at different bias voltages. - Highlights: ► Samarium and gadolinium complexes. ► OLED with complex blend (Sm,Gd). ► Electrophosphorescence emission detection. ► Application in OLED changing the color emission.

Magnetic and magnetoelastic properties of epitaxial SmFe{sub 2} thin film

Energy Technology Data Exchange (ETDEWEB)

Fuente, C de la; Arnaudas, J I; Ciria, M; Del Moral, A [Departamento de Magnetismo de Solidos and Departamento de Fisica de la Materia Condensada, Instituto de Ciencia de los Materiales de Aragon and Universidad de Zaragoza, 50071, Zaragoza (Spain); Dufour, C; Dumesnil, K, E-mail: cesar@unizar.e [Laboratoire de Metallurgie Physique et de Science des Materiaux, Universite Henry Poincare, Nancy 1, BP 239, 54506 (France)

2010-02-03

We report on magnetic and magnetoelastic measurements for a 5000 A (110) SmFe{sub 2} thin film, which was successfully analyzed by means of a point charge model for describing the effect of the epitaxial growth in this kind of system. Some of the main conclusions of the Moessbauer and magnetoelastic results and the new magnetization results up to 5 T allow us to get a full description of the crystal electric field, exchange, and magnetoelastic behavior in this compound. So, new single-ion parameters are obtained for the crystal field interaction of samarium ions, A{sub 4}(r{sup 4}) = +755 K/ion and A{sub 6}(r{sup 6}) = -180 K/ion, and new single-ion magnetoelastic coupling B{sup gamma}{sup ,2}approx =-200 MPa and B{sup epsilon}{sup ,2}approx =800 MPa, which represent the tetragonal and the in-plane shear deformations, respectively. Moreover, the new thermal behavior of the samarium magnetic moment, the exchange coupling parameter, and the magnetocrystalline anisotropy of the iron sublattice are obtained too. From these, the softening of the spin reorientation transition with respect to the bulk case could be accounted for.

Derivative spectrophotometry of cobalt alloys

International Nuclear Information System (INIS)

Spitsyn, P.K.

1985-01-01

The method of derivative spectrophotometry is briefly described, and derivative absorption spectra are presented for samarium, cobalt, and commercial Sm-Co alloys. It is shown that the use of derivative spectrophotometry not only improves the accuracy and selectivity of element determinations but also simplifies the analysis of alloys. Results of a statistical evaluation of the metrological characteristics of the analytical procedure described here are presented. 8 references

Recurrent novae as a consequence of the accretion of solar material onto a 1.38 M/sub sun/ white dwarf

International Nuclear Information System (INIS)

Starrfield, S.; Sparks, W.M.; Truran, J.W.; and Theoretical Division,Los Alamos National Laboratory)

1985-01-01

We have computed three evolutionary sequences which treat the accretion of hydrogen-rich material onto 1.38 M/sub sun/ white dwarfs. In each of these sequences the accreting matter had only a solar composition of the CNO nuclei (Z = 0.015). In the first sequence we utilized an accretion rate of 1.7 x 10/sup hyphen8/ M/sub sun/ yr/sup hyphen1/ onto a white dwarf with an initial luminosity of 0.1 L/sub sun/ . It took this sequence '33 yr to reach the peak of the thermonuclear runaway which resulted in an outburst that ejected 3x10/sup hyphen8/ M/sub sun/ . of material moving at speeds up to 2900 kn s/sup hyphen1/. The light curve, the time to outburst, and the amount of mass ejected during the evolution are in excellent agreement with the observed outburst of Nova U Sco 1979. However, only 6% of the accreted envelope was ejected during the outburst. The remaining material quickly burned to helium ('2 yr) and settled back onto the white dwarf. The second study involved an accretion rate of 1.7x10/sup hyphen9/ M/sub sun/ yr/sup hyphen1/ onto a white dwarf with an initial luminosity of 10/sup hyphen2/ L/sub sun/ . It took nearly 1600 yr to reach the burst phase of the evolution, and by this time the dwarf had accreted '3x10/sup hyphen6/ M/sub sun/ . Peak temperature in the shell source reached 3.5x10 8 K, about 1.3x10 8 K higher than was found for model 1. This sequence ejected 3x10/sup hyphen7/ M/sub sun/, only 13% of the accreted envelope, moving at low velocities. For both of these evolutionary sequences, we find that as a result of the accretion of matter onto a massive white dwarf, the mass of the white dwarf grows toward the Chandrasekhar limit. If our study is a realistic representation of the evolution of U Sco, then this star is well on its way to becoming an SN I

Nanocrystalline samarium oxide coated fiber optic gas sensor

International Nuclear Information System (INIS)

Renganathan, B.; Sastikumar, D.; Srinivasan, R.; Ganesan, A.R.

2014-01-01

Highlights: • This fiber optic gas sensor works at room temperature. • As-prepared and annealed Sm 2 O 3 nanoparticles are act as sensor materials. • Sm 2 O 3 clad modified fiber detect the ammonia, ethanol and methanol gases. • The response of evanescent wave loss has been studied for different concentrations. - Abstract: Nanocrystalline Sm 2 O 3 coated fiber optic sensor is proposed for detecting toxic gases such as ammonia, methanol and ethanol vapors. Sm 2 O 3 in the as prepared form as well as annealed form have been used as gas sensing materials, by making them as cladding of a PMMA fiber. The spectral characteristics of the Sm 2 O 3 gas sensor are presented for ammonia, methanol and ethanol gases with different concentrations ranging from 0 to 500 ppm. The sensor exhibits a linear variation in the output light intensity with the concentration. The enhanced gas sensitivity and selectivity of the sensor for ethanol is discussed briefly

Samarium-153 EDTMP therapy of disseminated skeletal metastasis

International Nuclear Information System (INIS)

Turner, J.H.; Martindale, A.A.; Fleay, R.F.; Hoffman, R.F.; Claringbold, P.G.

1989-01-01

153 Sm-EDTMP (ethylenediaminetetramethylene phosphonate), prepared from a kit, was administered to 28 patients in a clinical trial of therapy for painful skeletal metastases unresponsive to all conventional treatment. The 103 keV gamma emission of 153 Sm was utilized for prospective individual estimation of beta radiation absorbed dose to red marrow to minimize myelotoxicity and provide optimum internal radiotherapy to skeletal metastases in each patient. Pain relief occurred within 14 days of administration of 153 Sm-EDTMP in 15 of 19 patients (79%) who could vie evaluated at 6 weeks, when clinical response was maximal. Duration of response ranged from 4 to 35 weeks. Recurrence of pain responded to retreatment with 153 Sm-EDTMP in five of eight cases. No dose-response relationship was apparent for pain relief but reversible myelotoxicity was frequently observed at radiation absorbed doses to bone marrow ≥270 cGy. Dosimetry calculation was based on pharmacokinetic studies of a tracer administration of 153 Sm-EDTMP in each patient. Assumptions inherent in this prospective method of predicting dose to bone marrow were validated experimentally. Biodistribution studies in rats demonstrated rapid skeletal uptake and long term retention of 153 Sm-EDTMP in bone over 5 days. Urinary clearance accounted for 40% of injected dose, and less than 0.5% of administered activity was retained in non osseous tissue. Microdensitometry of autoradiographs of sheep vertebra and femur confirmed surface uptake of 153 Sm-EDTMP in cortical bone and demonstrated relatively high trabecular bone activity which is the major component of radiation absorbed dose to bone marrow. Haematological studies in rabbits showed 153 Sm-EDTMP-induced myelotoxicity to be transient and no histopathological abnormalities were demonstrable with doses ten times greater than those administered to patients. (orig.)

Samarium Polystibides Derived from Highly Activated Nanoscale Antimony.

Science.gov (United States)

Schoo, Christoph; Bestgen, Sebastian; Egeberg, Alexander; Klementyeva, Svetlana; Feldmann, Claus; Konchenko, Sergey N; Roesky, Peter W

2018-05-14

Zintl ions in molecular compounds are of fundamental interest for basic research and application. Two reactive antimony sources are presented that allow direct access to molecular polystibide compounds. These are Sb amalgam (Sb/Hg) and ultrasmall Sb 0 nanoparticles (d=6.6±0.8 nm), which were used independently as precursors for the synthesis of the largest f-element polystibide, [(Cp* 2 Sm) 4 Sb 8 ]. Whereas the reaction of the nanoparticles with [Cp* 2 Sm] directly led to [(Cp* 2 Sm) 4 Sb 8 ], Sm/Sb/Hg intermediates were isolated when using Sb/Hg as the precursor. These Sm/Sb/Hg intermediates [{(Cp* 2 Sm) 2 Sb} 2 (μ-Hg)] and [{(Cp* 2 Sm) 3 (μ 4 ,η 1:2:2:2 -Sb 4 )} 2 Hg] were synthetically trapped and structurally characterized, giving insight in the formation mechanism of polystibide compounds. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Hydroxyapatite synthesis and labelling with with Samarium-153

International Nuclear Information System (INIS)

Miranda, J.; Enciso, A.M.; Herrera, J.; Portilla, A.; Carrillo, D.

1999-01-01

153 Sm-labeled hydroxyapatite (HA) is used in synovectomy performed by radiation. HA was synthesized according to the method employed by Hayek and Newesely, using calcium nitrate and ammonium diacid phosphate in basic pH. Chemical characterization of HA was carried out by x-ray diffraction. HA labeling with Sm-153 is conducted using citric acid as ligand; radiochemical purity is greater than 99% and labeled particles are stable up to 9 days. This product is adequate to treat rheumatoid arthritis

Measurement of radiative lifetime in atomic samarium using ...

Indian Academy of Sciences (India)

2014-02-08

Feb 8, 2014 ... gations of radiative lifetime measurement of odd-parity energy level at ... introduced by an electronic delay generator between the two ... cascade repopulation and depopulation, Zeeman and hyperfine quantum beats [6]. The.

Optical properties of samarium doped zinc–tellurite glasses

Indian Academy of Sciences (India)

Unknown

Optical absorption spectra of these glasses were recorded in the range 300–700 nm at room ... cause of their potential as hosts of rare earth elements for ... nature of these glasses was examined by X-ray diffraction ... absorption coefficient).

A novel samarium complex with interesting photoluminescence and ...

African Journals Online (AJOL)

The 4,4'-Hbipy moieties, isolated nitrates and [Sm(H2O)4(NO3)3] species are held together via hydrogen bonds and p…p interactions to form a 3-D supramolecular framework. Luminescent investigation reveals a strong emission in blue region. Optical absorption spectrum of 1 reveals the presence of an optical gap of 3.60 ...

Optical characteristics of transparent samarium oxide thin films ...

Indian Academy of Sciences (India)

2016-10-07

Oct 7, 2016 ... The estimated direct optical band gap energy (Ed g) values were found to ... rpm substrate rotation and power of 150 W. The rate of deposition was 2 .... tion by annealing is due to the generation of oxygen vacancies due to ...

CCT-K2.1: NRC/VNIIFTRI bilateral comparison of capsule-type standard platinum resistance thermometers from 13.8 K to 273.16 K

Energy Technology Data Exchange (ETDEWEB)

Hill, K.D.; Steele, A.G. [National Research Council of Canada, Institute for National Measurement Standards, Ottawa, ON (Canada); Dedikov, Y.A.; Shkraba, V.T. [Institute for Physical-Technical and Radiotechnical Measurements (VNIIFTRI), Moscow (Russian Federation)

2005-04-01

The Consultative Committee for Thermometry Key Comparison 2 (CCT-K2) results were published two years ago (2002 Metrologia 39 551-71). NRC served as the pilot laboratory for CCT-K2 and remains able to provide a scale and measurement system suitable for performing bilateral comparisons linked to the original key comparison results. In March 2003, measurements of two VNIIFTRI 100 {omega} capsule-style platinum resistance thermometers (CSPRTs), S/N 356 and 476, were undertaken to relate their local calibration to the results from the CCT-K2 exercise. The NRC Leeds and Northrup (L and N) CSPRT S/N 1872174 provides the link to the CCT-K2 results. The three CSPRTs were compared at the eight defining cryogenic temperatures of the International Temperature Scale of 1990 (ITS-90) in the range from 13.8033 K to 273.16 K. The reader is referred to the full text of the CCT-K2 report for a detailed explanation of the methodology employed for the comparison. Only the details unique to the measurements reported here will be addressed in this article. The NRC/VNIIFTRI bilateral comparison of capsule-style platinum resistance thermometers over the range 13.8 K to 273.16 K has revealed calibrations at VNIIFTRI to be in agreement with the KCRV of CCT-K2 within the expanded uncertainty for all temperatures of the comparison with the exception of the triple point of hydrogen at 13.8033 K. One of the two CSPRTs supplied by VNIIFTRI was found to be discrepant as revealed by differences at the triple point of water and at the lowest temperatures of the comparison, and was therefore excluded from further analysis. The linkage to the CCT-K2 data supports the evaluation of the VNIIFTRI CMCs in Appendix C of the KCDB. (authors)

The Fragmentation of Heavy Nuclei by 13.8 GeV/c Protons as a Contribution to the Study of the Interaction Mechanism and Nuclear Structure; Fragmentacion de nucleos pesados por protones de 13'8 GeV/c, como contribucion al estudio del mecanismo de interaccion y estructura nuclear

Energy Technology Data Exchange (ETDEWEB)

Gil Perez, D.

1967-07-01

We present here an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs.

21 CFR 133.138 - Edam cheese.

Science.gov (United States)

2010-04-01

... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... having the same physical and chemical properties. The minimum milkfat content is 40 percent by weight of... this section may be warmed and is subjected to the action of a lactic acid-producing bacterial culture...

Publications | Page 138 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Infectious disease has a great impact on livestock production and livelihoods in Africa. ... Small and medium enterprises under the global economic crisis : evidence ... Social networks, research evidence, and innovation in health policymaking ...

40 CFR 52.138 - Conformity procedures.

Science.gov (United States)

2010-07-01

... considering any growth likely to result from the project; (3) for each transportation control measure in the... described in 40 CFR 81.303 (i.e., the MAG urban planning area). (7) Transportation control measure (TCM...) the disaggregated population projections and employment which were assumed in: (1) the applicable plan...

45 CFR 147.138 - Patient protections.

Science.gov (United States)

2010-10-01

..., issuer, or any person (including a primary care provider) in the case of a female participant... the participant and the participant's family. Participant A, a female, requests a gynecological exam.... If a covered individual notifies the plan within two business days after the day an individual...

37 CFR 1.138 - Express abandonment.

Science.gov (United States)

2010-07-01

... before the date of issue or publication unless it is actually received by appropriate officials in time... application to avoid publication of the application (see § 1.211(a)(1)) must submit a declaration of express abandonment by way of a petition under this paragraph including the fee set forth in § 1.17(h) in sufficient...

Publications | Page 138 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Knowledge management is about identifying critical knowledge areas that makes a ''big difference or big change in target groups/trainees through ... demand for healthcare, and carries out an analysis as detailed as the input data allows for.

Surgical, pathological and clinical correlation of Tc-99m DISIDA hepatobiliary imaging in 138 adult males, in the diagnosis of functional cystic duct obstruction VS acute or chronic cholecystitis

International Nuclear Information System (INIS)

Yoo, J.H.K.; Beal, W.H.; Ware, R.W.; Straw, J.D.; Chaudhuri, T.K.

1985-01-01

Despite the wide acceptance of the hepatobiliary scintigraphy as a popular diagnostic imaging modality for gallbladder and hepatobiliary disease, correlation between radionuclide diagnoses and the final clinical and/or pathologic findings have not been thoroughly evaluated. The lack of correlative studies frequently generates difficulties in making appropriate diagnostic interpretation of the objective findings. A retrospective clinical pathological and surgical correlative study was undertaken by the authors in 138 male veteran patients, who underwent computer assisted minute by minute Tc-99m DISIDA cholescintigraphy. A very high percentage (75%) revealed abnormalities; non-visualization of gallbladder (GB) with normal choledochus system (46%), choledochal obstruction with no GB visualization (13%), choledochal obstruction with normal GB visualization (6%), severe hepatocellular disease with non-diagnostic GB (4%), and delayed GB visualization (longer than 60 minutes) (3%). Non-visualization of GB but normal choledochus demonstrated diverse pathologic etiologies, acute and chronic cholecystitis (64%), S/P cholecystectomy (8%), functional obstruction secondary to sepsis or pancreatitis (6%), and various other pathologies including porcelain GB and cholangitis (22%). The most important cause of choledochal obstruction was mass lesions or local infiltration with metastases (33%) rather than acute cholecystitis (27%). Although the sensitivity (98%) and specificity (92%) for cystic duct obstruction were very high, the specificity decreases significantly for cholecystitis

On three-dimensional nuclear thermo-hydraulic computation techniques for ATR

International Nuclear Information System (INIS)

1997-08-01

The three-dimensional computation code for nuclear thermo-hydraulic combination core LAYMON-2A is used for the calculation of the power distribution and the control rod reactivity value of the ATR. This code possesses various functions which are required for planning the core operation such as the search function for critical boric acid concentration, and can do various simulation calculations such as core burning calculation. Further, the three-dimensional analysis code for xenon dynamic characteristics in the core LAYMON-2C, in which the dynamic characteristic equation of xenon-samarium was incorporated into the LAYMON-2A code can take the change with time lapse of xenon-samarium concentration accompanying the change of power level and power distribution into account, and it is used for the analysis of the spatial vibration characteristics of power and the regional power control characteristics due to xenon in the core. As to the LAYMON-2A, the computation flow, power distribution and thermo-hydraulic computation models, and critical search function are explained. As to the LAYMON-2C, the computation flow is described. The comparison of the calculated values by using the LAYMON-2A code and the operation data of the Fugen is reported. (K.I.)

Neutron scattering studies of mixed-valence semiconductors

Energy Technology Data Exchange (ETDEWEB)

Mignot, J M [Laboratoire Leon Brillouin (LLB) - Centre d` Etudes de Saclay, 91 - Gif-sur-Yvette (France); Alekseev, P A [Kurchatov Institute, Moscow (Russian Federation)

1994-12-31

Neutron scattering experiments on the mixed-valence (MV) compounds SmB{sub 6} are reported. The inelastic magnetic response of SmB{sub 6} at T = 2 K, measured on a double-isotope single crystal,displays a strongly damped peak at 35 meV corresponding to the inter multiplet transition of Sm{sup 2+}. At lower energies ( h.{omega} {approx_equal} 14 meV), a narrow magnetic excitation is observed, with remarkable scattering-vector and temperature dependences of its intensity. This novel feature is discussed in terms of recent theoretical works describing the formation of an anisotropic local bound state in semiconducting MV materials. If the average samarium valence is decreased by substituting La for Sm, a peak is found to appear at high energies. The elastic magnetic form factor of SmB{sub 6} was determined using polarised neutrons and no significant difference is observed in its Q-dependence with respect to that of pure divalent samarium. This surprising behaviour is constant with previous measurements on the gold (high-pressure) phase of SmS. The above results are compared to those already reported for other MV materials. In particular existing information for TmSe is supplemented by recent inelastic scattering measurements carried out on a large stoichiometric single crystal. (author). 44 refs., 7 figs.

Influence of extragent dilution upon light rare earths separation

International Nuclear Information System (INIS)

Korpusova, R.D.; Smirnova, N.N.

1978-01-01

The effect of diluting the extragent on separation of REE in the presence of 6 g-equiv. of LiNO 3 has been studied. For experiments use was made of TBP diluted with kerosene or butylbenzene (40,50,70 vol.%). The separation coefficients have been determined under conditions of saturation. The content of trace amounts of the components has been determined by the weight method; the content of macroimpurities - by the radiometric method. It has been established that the coefficient of Ce-La, Pr-La separation is not affected by the dilution of the extragent. The only exception is the Pr 142 -La pair; in the presence of trace amounts of better extracted element and two-fold dilution the separation coefficient increases almost by 150%. For the Pr-Ce pair the effect of dilution is better noticeable in that case when more extracted element is present in trace amounts. However, a comparison of the effect of dilution on separation coefficients of all REE pairs under study has shown that this effect is the strongest for the samarium-neodymium pair. The data obtained allow an assumption to be made that kerosene, as a diluent, affects the steric factor and coordination. Therefore, upon dilution the coefficient of the samarium-neodymium pair separation is affected most of all

Molecular electrophosphorescence in (Sm, Gd)-{beta}-diketonate complex blend for OLED applications

Energy Technology Data Exchange (ETDEWEB)

Reyes, R., E-mail: fisicaplic@hotmail.com [Facultad de Ingenieria Quimica y Textil, Universidad Nacional de Ingenieria, UNI, Av. Tupac Amaru 210, Lima 31, Peru (Peru); Cremona, M. [DIMAT - Divisao de Metrologia de Materiais, Instituto Nacional de Metrologia, Normalizacao e Qualidade Industrial, INMETRO, Duque de Caxias, RJ (Brazil); Departamento de Fisica, Pontificia Universidade Catolica do Rio de Janeiro, PUC-Rio, C.P. 38071, Rio de Janeiro, RJ, CEP 22453-970 (Brazil); Teotonio, E.E.S. [Departamento de Quimica, CCEN, Universidade Federal da Paraiba, UFPB, C.P. 5093, Joao Pessoa, PB, CEP 5805-970 (Brazil); Brito, H.F. [Instituto de Quimica, Universidade de Sao Paulo, USP, C.P. 26077, Sao Paulo, SP, CEP 05599-970 (Brazil); Malta, O.L. [Departamento de Quimica Fundamental, CCEN, Universidade Federal de Pernambuco, Cidade Universitaria, Recife, PE, CEP 50670-901 (Brazil)

2013-02-15

In this work the preparation and characterization of the triple-layer organic light-emitting diode (OLED) using a mixture of the samarium and gadolinium {beta}-diketonate complexes [Sm{sub 0.5}Gd{sub 0.5}(TTA){sub 3}(TPPO){sub 2}] as emitting layer is reported. The OLED's devices contain 1-(3-methylphenyl)-1,2,3,4-tetrahydroquinoline-6-carboxyaldehyde-1, 1'-diphenylhydrazone (MTCD) as hole-transporting layer and tris(8-hydroxyquinoline aluminum) (Alq{sub 3}) as electron transporting layer. The electroluminescence spectrum present emission narrow bands from the {sup 4}G{sub 5/2}{yields}{sup 6}H{sub J} transitions (where J=5/2, 7/2 and 9/2) characteristic of the Sm{sup 3+} ion. These sharp lines are overlapped with a broad band attributed to the electrophosphorescence from the T{sub 1}{yields}S{sub 0} transition in the ligand TTA. The intramolecular energy transfer is discussed and applied on the change of the emission color of the organic LEDs at different bias voltages. - Highlights: Black-Right-Pointing-Pointer Samarium and gadolinium complexes. Black-Right-Pointing-Pointer OLED with complex blend (Sm,Gd). Black-Right-Pointing-Pointer Electrophosphorescence emission detection. Black-Right-Pointing-Pointer Application in OLED changing the color emission.

First calorimetric determination of heat of extraction of 248Cm in a bi-phasic system

International Nuclear Information System (INIS)

Martin, Leigh R.; Zalupski, Peter R.

2011-01-01

This report presents a summary of the work performed to meet FCR and D level 2 milestone M21SW050201, 'Complete the first calorimetric determination of heat of extraction of 248Cm in a bi-phasic system'. This work was carried out under the auspices of the Thermodynamics and Kinetics FCR and D work package. To complement previous work undertaken under this work package we have extended out heat of extraction studies by di-2-ethyl-hexyl-phosphoric acid to curium. This report also details the heat of extraction of samarium in the same system. This work was performed to not only test the methodology but also to check for consistency with the heats of extraction obtained with those in the prior literature. The heat of extraction for samarium that was obtained in this study was -9.6 kJ mol-1, which is in reasonable agreement with the previously obtained value of -10.9 kJ mol-1. The curium heat of extraction was performed under two sets of conditions and the obtained heats of extraction were in reasonable agreement with each other at -16.0 ± 1.1 and -16.8 ± 1.5 kJ mol-1.

Obsidian sources characterized by neutron-activation analysis.

Science.gov (United States)

Gordus, A A; Wright, G A; Griffin, J B

1968-07-26

Concentrations of elements such as manganese, scandium, lanthanum, rubidium, samarium, barium, and zirconium in obsidian samples from different flows show ranges of 1000 percent or more, whereas the variation in element content in obsidian samples from a single flow appears to be less than 40 percent. Neutron-activation analysis of these elements, as well as of sodium and iron, provides a means of identifying the geologic source of an archeological artifact of obsidian.

Reductive Bis-addition of Aromatic Aldehydes to α,β-Unsaturated Esters via the Use of Sm/Cu(I) in Air: A Route to the Construction of Furofuran Lignans.

Science.gov (United States)

Liu, Yongjun; Tian, Guang; Li, Jingjing; Qi, Yan; Wen, Yonghong; Du, Feng

2017-06-02

The novel bis-addition of benzaldehydes to acrylates or maleates was achieved by the direct use of samarium metal with the assistance of CuI under mild conditions under dry air, and the useful 2-hydroxylalkyl-γ-butyrolactons and lignan derivatives were thus constructed with high efficiency. The key factors that influence the reaction efficiency were investigated. The use of potassium iodide and molecular sieves as additives can improve the reaction efficiency remarkably.

JPRS Report Proliferation Issues

Science.gov (United States)

1991-10-29

MVLIS) which utilizes carbon dioxide lasers. such an experience in the United States or Europe. They were able to go into uranium enrichment and repro...yttrium, is used like phosphorous in color television Rhodia, Paranapanema, the Belgian Solvay group, and sets. By combining samarium with neodymium, two...use presently. There have been some using thorium and U-233. problems centering on the liquid sodium coolant used in FBTR reportedly accentuated by use

Sm and Y radiolabeled magnetic fluids: magnetic and magneto-optical characterization

Energy Technology Data Exchange (ETDEWEB)

Aquino, R. [Complex Fluids Group, Instituto de Quimica, Universidade de Brasilia, Caixa Postal 04478, 70919-970 Brasilia (DF) (Brazil) and Laboratoire des Milieux Deet Heterogenes, Universite Pierre et Marie Curie (Paris 6), Site de Boucicaut, case 86, 140, Rue de Lourmel, 75015 Paris (France)]. E-mail: reaquino@unb.br; Gomes, J.A. [Complex Fluids Group, Instituto de Fisica, Universidade de Brasilia, 70919-970 Brasilia (DF) (Brazil); Tourinho, F.A. [Complex Fluids Group, Instituto de Quimica, Universidade de Brasilia, Caixa Postal 04478, 70919-970 Brasilia (DF) (Brazil); Dubois, E. [Laboratoire des Liquides Ioniques et Interfaces Chargees, Universite Pierre et Marie Curie (Paris 6), Batiment F, Case 63, 4 place Jussieu, 75252 Paris Cedex 05 (France); Perzynski, R. [Laboratoire des Milieux Deet Heterogenes, Universite Pierre et Marie Curie (Paris 6), Site de Boucicaut, case 86, 140, Rue de Lourmel, 75015 Paris (France); Silva, G.J. da [Complex Fluids Group, Instituto de Fisica, Universidade de Brasilia, 70919-970 Brasilia (DF) (Brazil); Depeyrot, J. [Complex Fluids Group, Instituto de Fisica, Universidade de Brasilia, 70919-970 Brasilia (DF) (Brazil)

2005-03-15

We report on magnetic fluids based on samarium and ytrium-doped nanoparticles. The nanostructures chemical composition is checked and X-ray diffraction provides both their mean size and a structural characterization. Magnetization and magneto-optical birefringence results are presented and well agree with the pure maghemite behavior. Since these particles can become radioactive after neutron activation, they could therefore represent a new perspective for biomedical applications in the radiation therapy of cancer.

Sm and Y radiolabeled magnetic fluids: magnetic and magneto-optical characterization

Science.gov (United States)

Aquino, R.; Gomes, J. A.; Tourinho, F. A.; Dubois, E.; Perzynski, R.; da Silva, G. J.; Depeyrot, J.

2005-03-01

We report on magnetic fluids based on samarium and ytrium-doped nanoparticles. The nanostructures chemical composition is checked and X-ray diffraction provides both their mean size and a structural characterization. Magnetization and magneto-optical birefringence results are presented and well agree with the pure maghemite behavior. Since these particles can become radioactive after neutron activation, they could therefore represent a new perspective for biomedical applications in the radiation therapy of cancer.

Sm and Y radiolabeled magnetic fluids: magnetic and magneto-optical characterization

International Nuclear Information System (INIS)

Aquino, R.; Gomes, J.A.; Tourinho, F.A.; Dubois, E.; Perzynski, R.; Silva, G.J. da; Depeyrot, J.

2005-01-01

We report on magnetic fluids based on samarium and ytrium-doped nanoparticles. The nanostructures chemical composition is checked and X-ray diffraction provides both their mean size and a structural characterization. Magnetization and magneto-optical birefringence results are presented and well agree with the pure maghemite behavior. Since these particles can become radioactive after neutron activation, they could therefore represent a new perspective for biomedical applications in the radiation therapy of cancer

Stored ions in the Paul trap. Preliminary investigations on life-time measurement of the metastable 6D3/2 state of 226Ra+, storage properties of 138Ba+ and 28N2+ at variation of the buffer-gas pressure

International Nuclear Information System (INIS)

Leuthner, Heiko

2011-01-01

Paul-traps are a widely used tool in scientific research and play an important role in atomic physics and mass spectrometry. (1) From the earth-alkaline ions only spectroscopic data of Ra + are lacking. Those are important for the test of theoretical models and for a future atomic parity violation experiment. The first part of this work describes the setting up of a Paul-trap based Laser-experiment for measuring the lifetime of the 6D 3/2 state of 226 Ra + . Basic tests with 138 Ba + ions are presented. (2) Damping and space charge effects on resonances in the stability region strongly affect the use of Paul-traps in mass spectrometry and analysis of reaction products. The second part of this work presents detailed investigations on the storage of big, buffer-gas-cooled ion clouds in two different Paul-trap experiments; the first of them uses 138 Ba + ions detected continuously by electronic and optical detection systems, the second one uses N 2 + molecular ions and an automated destructive time-of-flight-detection method. A high precision measurement with N 2 + of the first stability region of the trap not only gives the possibility of direct comparison of experimental and theoretical resonances but also provides absolute ion numbers over the whole region for the first time. Unlike previous measurements, the investigations on nonlinear resonances where done on the superimposed stability regions of 4 simultaneously stored ion species. The nonlinear resonances were studied by varying buffer gas pressure and ion number and showed collective resonances without external excitation. By varying the buffer gas pressure the spatial distribution of a Ba + -ion cloud was investigated as well as the change of the optimal storing parameters using N 2 + -ions. Optimum Pressures for catching and trapping of ions turned out to be unequal. Shape and position of externally excited collective and individual resonances were studied under variation of ion number, buffer-gas pressure

Structural phase transition and elastic properties of samarium monopnictides

International Nuclear Information System (INIS)

Pagare, Gitanjali; Chouhan, Sunil Singh; Soni, Pooja; Sanyal, Sankar P.

2011-01-01

In recent years the monopnictides and monochalcogenides of the rare-earth elements with rocksalt structure (B 1 ) have aroused intensive interest due to the presence of strongly correlated f electrons in them. Under pressure, the nature of f-electrons of these compounds can be changed from localized to itinerant leading to significant changes in physical and chemical properties. These unusual structural, electronic, and high-pressure properties make them candidates for advanced industrial applications. For these applications they provide unique physical properties which cannot be achieved with other materials

Optical properties of lead–tellurite glasses doped with samarium ...

Indian Academy of Sciences (India)

Administrator

392. Table 1. Density, molar volume, optical energy bandgap, refractive index, molar refraction and polarizability of oxide ion for. Sm2O3–PbO–TeO2 glasses. Glass composition (mol%). Energy. Molar. Polarizability. Density Molar volume bandgap. Refractive refraction. (αe). Sm2O3. PbO. TeO2. (ρ) (g/cm. 3. ) (Vm) (cm. –3. ).

150 KVA Samarium Cobalt VSCF Starter Generator Electrical System

Science.gov (United States)

1978-12-01

4140 material where inertia welded for the bearing journals and spline interfaces. * Hub - The hub material is ’knconel 750" and is heat treated It...radial Conrad con- struction. The bearing balls and rings were vacuum melted AISI U50 tool steel, beat stabilized, and manu- factored to ABEC-7

Simulated samarium-neodymium thermochronology of garnet-clinopyroxene-plagioclase granulites

International Nuclear Information System (INIS)

Munha, J; Moita, P; Palacios, T

2001-01-01

Cooling and uplift histories (thermochronology) of metamorphic belts can be inferred from radiometric ages measured for appropriate geochronological systems (e.g., McDougall and Harrison, 1999). The strength of this approach lies on the potential to relate radiometric ages to the geothermobarometric conditions of mineral crystallization, and it depends on the interpretation that ages recorded by each decay system correspond to a particular temperature, the 'closure' temperature (Dodson, 1973), yielding a temperature vs. time path. However, closure temperatures should not have a single value for each decay system, since they are expected to be a function of several variables; therefore, it is crucial to assess the relative significance of all influential parameters in order to establish a rigorous thermochronological characterization of metamorphic rocks. Sm-Nd mineral geochronology has been widely used for dating high-grade rocks, including garnet(gt)- clinopyroxene(cpx)-plagioclase(pl) granulites (e.g., Burton et al., 1995). 'Real' ages of granulitic metamorphism and radiometric dates rarely coincide because the measured ages reflect only a fraction of the temperature - time path of the metamorphic process; this is the time during which each rock phase behaved essentially as a closed system, reflecting the progressive blocking of diffusion-limited isotope exchanges between coexisting minerals. The present study is an attempt to assess the time (temperature) bias between the metamorphic thermal peak event and the ages (apparent closure temperatures) obtained through the application of standard Sm-Nd geochronological methods. In particular, the model simulates the influence of variable (initial/boundary) conditions on radiometric ages that would be obtained from 147 Sm/ 144 Nd - 143 Nd/ 14 24Nd systematics of gt - cpx - pl mineral pairs; it should provide preliminary guidance on thermochronological studies of granulitic terranes (au)

Isotopic studies on oxidative methane coupling over samarium oxide

International Nuclear Information System (INIS)

Otsuka, Kiyoshi; Inaida, Masakatsu; Wada, Yuji; Komatsu, Takayuki; Morikawa, Akira

1989-01-01

The evident kinetic isotope effect was observed for the formations of ethylene and ethane through the oxidative coupling of methane on Sm 2 O 3 , when CH 4 and CD 4 were used as the reactants. Ethanes formed in the reaction of a mixture of CH 4 , CD 4 , and O 2 were C 2 H 6 , C 2 H 3 D 3 , and C 2 D 6 as major products. These results indicate that the rate-determining step of the reaction is abstraction of hydrogen from methane and that ethane is formed through the coupling of methyl intermediate. (author)

Contamination of YBCO bulk superconductors by samarium and ytterbium

Czech Academy of Sciences Publication Activity Database

Volochová, D.; Jurek, Karel; Radušovská, M.; Piovarči, S.; Antal, V.; Kováč, J.; Jirsa, Miloš; Diko, P.

2014-01-01

Roč. 496, JAN (2014), s. 14-17 ISSN 0921-4534 Institutional support: RVO:68378271 Keywords : YBCO bulk superconductors * critical temperature * critical current density * peak effect Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.942, year: 2014

Enantioselective cyclizations and cyclization cascades of samarium ketyl radicals

Science.gov (United States)

Kern, Nicolas; Plesniak, Mateusz P.; McDouall, Joseph J. W.; Procter, David J.

2017-12-01

The rapid generation of molecular complexity from simple starting materials is a key challenge in synthesis. Enantioselective radical cyclization cascades have the potential to deliver complex, densely packed, polycyclic architectures, with control of three-dimensional shape, in one step. Unfortunately, carrying out reactions with radicals in an enantiocontrolled fashion remains challenging due to their high reactivity. This is particularly the case for reactions of radicals generated using the classical reagent, SmI2. Here, we demonstrate that enantioselective SmI2-mediated radical cyclizations and cascades that exploit a simple, recyclable chiral ligand can convert symmetrical ketoesters to complex carbocyclic products bearing multiple stereocentres with high enantio- and diastereocontrol. A computational study has been used to probe the origin of the enantioselectivity. Our studies suggest that many processes that rely on SmI2 can be rendered enantioselective by the design of suitable ligands.

Samarium Hexaboride: The First True 3D Topological Insulator?

Science.gov (United States)

Wolgast, Steven G.

The recent theoretical prediction of a topologically protected surface state in the mixed-valent insulator SmB6 has motivated a series of charge transport studies, which are presented here. It is first studied using a specialized configuration designed to distinguish bulk-dominated conduction from surface-dominated conduction. As the material is cooled below 4 K, it exhibits a crossover from thermally activated bulk transport to metallic surface conduction with a fully insulating bulk. The robustness and magnitude of the surface conductivity, as is manifest in the literature of SmB6, is strong evidence for the topological insulator (TI) metallic surface states predicted for this material. This resolves a decades-old puzzle surrounding the low-temperature behavior of SmB6. Next, the magnetotransport properties of the surface are investigated using a Corbino disk geometry, which can directly measure the conductivity of individual surfaces. Both (011) and (001) crystal surfaces show a strong negative magnetoresistance at all magnetic field angles, due primarily to changes in the carrier density. The low mobility value accounts for the failure so far to observe Shubnikov-de Haas oscillations below 95 T. Small variations in the mobility and temperature dependence suggest a suppression of Kondo scattering from native oxide-layer magnetic moments. At low fields, a dynamical field-sweep-rate-dependent hysteretic behavior is observed. It persists at the slowest sweep rates, and cannot be explained by quantum interference corrections; it is likely due to extrinsic effects such as the magnetocaloric effect or glassy ordering of the native oxide moments. Pulsed magnetic field measurements up to 60 T at temperatures throughout the crossover regime clearly distinguish the surface magnetoresistance from the bulk magnetoresistance. The bulk magnetoresistance is due to a reduction in the bulk gap with increasing magnetic field. Finally, small subsurface cracks formed in SmB6 via systematic scratching or sanding results in a counter-intuitive increase in the electrical conduction due to the unique surface-conducting property of TIs, strengthening the building case for SmB 6's topological nature. This material is attractive as a TI because its bulk is fully insulating at a readily achieved 2 K, but it presents a large number of scientific mysteries and experimental challenges for future research.

Preparation of radiopharmaceutical formulations; Fremstilling av radioaktive farmasoeytiske blandinger

Energy Technology Data Exchange (ETDEWEB)

Simon, J.; Garlich, J.R.; Frank, R.K.; McMillan, K

1998-03-16

Radiopharmaceutical formulations for complexes comprising at least one radionuclide complexed with a ligand, or its physiologically-acceptable salts thereof, especially {sup 153}samarium-ethylenediaminetetramethylenephosphonic acid, which optionally contains a divalent metal ion, e.g. calcium, and is frozen, thawed, and then administered by injection. Alternatively, the radiopharmaceutical formulations must contain the divalent metal and are frozen only if the time before administration is sufficiently long to cause concern for radiolysis of the ligand. 2 figs., 9 tabs.

Preparation of radiopharmaceutical formulations

International Nuclear Information System (INIS)

Simon, J.; Garlich, J.R.; Frank, R.K.; McMillan, K.

1998-01-01

Radiopharmaceutical formulations for complexes comprising at least one radionuclide complexed with a ligand, or its physiologically-acceptable salts thereof, especially 153 samarium-ethylenediaminetetramethylenephosphonic acid, which optionally contains a divalent metal ion, e.g. calcium, and is frozen, thawed, and then administered by injection. Alternatively, the radiopharmaceutical formulations must contain the divalent metal and are frozen only if the time before administration is sufficiently long to cause concern for radiolysis of the ligand. 2 figs., 9 tabs

Investigation of adducts of tris-(acetylacetonato)lanthanides with o-phenanthroline and α,α'-dipyridyl by mass spectroscopy

International Nuclear Information System (INIS)

Gavrishchuk, E.M.; Dzyubenko, N.G.; Martynenko, L.I.

1984-01-01

Mass spectra of adducts of tris-acetylacetonates of REE (REE, Ln, M) with O-phenanthroline (Phen) and α, α 1 -dipyridyl (Dipy) are obtained. A scheme of fragmentation is suggested. Peculiarities of dissociative ionization processes for samarium-, europium-thulium-, and ytterbium compounds are shown to be determined by a possibility of changing the oxidation state of a central ion. Energy characteristics of separation of the first and second ligands of compleXes in the entire REE series are compared

Radiolesão vascular como efeito deletério da braquiterapia intra-arterial com dose elevada de Samário-153 em coelhos hipercolesterolêmicos Vascular radiolesion as a deleterious effect of high-dose-rate intraarterial brachytherapy with Samarium-153 in hypercholesterolemic rabbits

Directory of Open Access Journals (Sweden)

Dalton Bertolim Précoma

2006-10-01

Full Text Available OBJETIVO: Este estudo tem por objetivo avaliar as alterações vasculares morfológicas e morfométricas induzidas pela braquiterapia com Samário-153 (153 Sm em coelhos hipercolesterolêmicos, com doses elevadas. MÉTODOS: Foram analisados 43 coelhos hipercolesterolêmicos, brancos, da raça New Zealand, e o total de 86 artérias ilíacas submetidas a lesão por balão de angioplastia. Divididos em três grupos: dois (GI irradiados com as doses de 15Gy (n=14 e 60Gy (n=36 e um grupo controle (n=36. Foram realizadas avaliação histológica morfométrica e análise histológica qualitativa para análise tecidual. RESULTADOS: Foram observadas uma redução significativa da neoproliferação intimal (NPI no GI 15 Gy (pOBJECTIVE: This study was designed to evaluate vascular morphological and morphometric changes induced by brachytherapy with samarium-153 (Sm-153 at high doses in hypercholesterolemic rabbits. METHODS: Forty-three New Zealand White hypercholesterolemic rabbits were analyzed, and the total of 86 iliac arteries underwent balloon angioplasty injury. The rabbits were divided into three different groups: two irradiation groups (IG assigned to 15 Gy (n=14 and 60 Gy (n=36 irradiation doses, respectively, and a control group (n = 36. Histomorphometric and qualitative histological analyses were performed for tissue evaluation. RESULTS: Significant reductions were found in neointimal proliferation (NIP (p< 0.0001, media area (MA (p<0.0001 and percent stenosis (p<0.0001 in the 15-Gy IG, compared to the other groups. The 60-Gy IG had the higher rate of NIP, increase in media and vessel areas (VA and percent stenosis. The 60-Gy IG also showed the greatest number of xanthomatous cells (60-Gy IG: 86.11% and 15-Gy IG: 14.29%, p<0.0001 and the highest amount of hyaline amorphous tissue (60-Gy IG:58.33% and 15-Gy IG:0%, p=0.0001 and vascular proliferation (60-Gy IG:30.56% and 15-Gy IG:0%, p=0.0221. No statistically significant differences were found

Current data on the background burden to the persistent organochlorine pollutants HCB, p,p'-DDE as well as PCB 138, PCB 153 and PCB 180 in plasma of the general population in Germany.

Science.gov (United States)

Schettgen, Thomas; Alt, Anne; Esser, Andre; Kraus, Thomas

2015-06-01

Despite their long-term ban, persistent organochlorine compounds like hexachlorobenzene (HCB), p,p'-dichlorodiphenylethylene (DDE) as well as polychlorinated biphenyls (PCBs) are still of environmental concern. For the evaluation of potential occupational or environmental exposures to these substances, it is essential to know the current background burden of the general population. As representative and up-to-date information is missing for Germany, we have analysed a large dataset generated in studies on potential exposure to lower chlorinated PCBs to fill this gap for the levels of HCB, DDE as well as PCB 138, PCB 153 and PCB 180. We have investigated n=2750 plasma samples of persons of the general population living in North Rhine-Westfalia and Hesse aged 6-65 years and sampled between September 2010 and March 2014. For evaluation of the age-dependent accumulation in the general population we have generated seven age groups in the collective. Our laboratory used a validated and quality controlled procedure using GC/MS for quantification of the organochlorine compounds in plasma (LOQ: 0.01μg/L). The median (95th percentile) levels for ∑ PCB 138+PCB 153+PCB 180 were 0.14 (0.73); 0.30 (0.82); 0.38 (0.88); 0.50 (1.14); 0.92; 1.58 (3.54) and 2.41 (4.82)μg/L plasma in the age groups 6-10 years (n=102), 11-17 years (n=499), 18-25 years (n=157), 26-35 years (n=710), 36-45 years (n=400), 46-55 years (n=525) and 56-65 years (n=357), respectively. Similarly, the median (95th percentile) levels of p,p'-DDE were 0.18 (1.24); 0.18 (0.74); 0.24 (0.85); 0.30 (1.20); 0.45 (1.74); 0.64 (3.25) and 0.94 (4.7)μg/L plasma. Finally, the median (95th percentile) of HCB in plasma in these age groups was 0.05 (0.10); 0.06 (0.11); 0.08 (0.15); 0.08 (0.15); 0.11 (0.22); 0.14 (0.42) and 0.20 (0.68)μg/L plasma. Our results prove an overall substantial reduction in the body burden to organochlorine compounds in Germany compared to earlier studies. However, 15% and 3.6% of the examined

Comparison of the corrosion resistance of DIN W. Nr. 1.4970 (15%Cr-15%Ni-1.2%Mo-Ti and ASTM F-138 (17%Cr-13%Ni-2.5%Mo austenitic stainless steels for biomedical applications

Directory of Open Access Journals (Sweden)

Maysa Terada

2006-09-01

Full Text Available The resistance to localised corrosion of the full austenitic 15%Cr-15%Ni-1.2%Mo titanium stabilized stainless steel (DIN W. Nr. 1.4970 was investigated by electrochemical methods including electrochemical impedance spectroscopy (EIS, potentiodynamic polarization and potentiostatic polarization measurements in a phosphate-buffered solution (PBS. The low carbon and non-stabilized austenitic stainless steel, AISI 316L (ASTM F-138, widely used for surgical implants, was also tested for comparison. The tests were conducted at room temperature after a stable potential had been reached. After the electrochemical measurements, the surfaces of the specimens were observed using SEM to evaluate the presence of pits. Potentiodynamic polarization results showed that both steels are prone to localized corrosion. Larger pits were found on the surface of AISI 316L specimens after the electrochemical tests. EIS response has indicated the duplex structure of the passive oxides. The results showed that the electrochemical behaviour of the DIN W. Nr. 1.4970 is better than of AISI 316L steel. Therefore, their application as an implant material may be considered.

Effect of additives in the baking of electrolytic materials for SOFC; SOFC yo denkaishitsu zairyo no shoseiji ni okeru tenkabutsu no koka

Energy Technology Data Exchange (ETDEWEB)

Yoshida, H. [Kansai Electric Power Co. Inc., Osaka (Japan)

1998-09-10

A technique is discovered for improving on the baking properties of cerium oxide which is one of the solid electrolytic materials for SOFC (solid oxide fuel cell). Cerium oxide, samarium oxide, and gallium oxide are weighed, each to the specified element ratio. The element ratio of cerium is fixed at 0.8 against the other elements except oxygen, and the element ratios of samarium or gallium are caused to change. Specimens containing gallium are designated as CSGa, those not containing as SDC. SDC baked at 1600degC and CSGa (1%) baked at 1450degC are similar to each other in terms of average grain diameter. Specimens with gallium added thereto can be baked at temperatures that are lower than these by approximately 150degC. The conductivity of CSGa (0.2%) baked at 1500degC is higher than that of SDC baked at the same temperature, and is similar to that of SDC baked at 1600degC. Baking is enhanced by the addition of 0.2% gallium. In the domain where more than 1% of gallium is in presence, conductivity lowers with an increase in the amount of gallium added. The conductivity of CSGa (1%) baked at 1450degC is similar to that of SDC baked at 1600degC. 4 figs., 1 tab.

Scanning Electron Microscope-Cathodoluminescence Analysis of Rare-Earth Elements in Magnets.

Science.gov (United States)

Imashuku, Susumu; Wagatsuma, Kazuaki; Kawai, Jun

2016-02-01

Scanning electron microscope-cathodoluminescence (SEM-CL) analysis was performed for neodymium-iron-boron (NdFeB) and samarium-cobalt (Sm-Co) magnets to analyze the rare-earth elements present in the magnets. We examined the advantages of SEM-CL analysis over conventional analytical methods such as SEM-energy-dispersive X-ray (EDX) spectroscopy and SEM-wavelength-dispersive X-ray (WDX) spectroscopy for elemental analysis of rare-earth elements in NdFeB magnets. Luminescence spectra of chloride compounds of elements in the magnets were measured by the SEM-CL method. Chloride compounds were obtained by the dropwise addition of hydrochloric acid on the magnets followed by drying in vacuum. Neodymium, praseodymium, terbium, and dysprosium were separately detected in the NdFeB magnets, and samarium was detected in the Sm-Co magnet by the SEM-CL method. In contrast, it was difficult to distinguish terbium and dysprosium in the NdFeB magnet with a dysprosium concentration of 1.05 wt% by conventional SEM-EDX analysis. Terbium with a concentration of 0.02 wt% in an NdFeB magnet was detected by SEM-CL analysis, but not by conventional SEM-WDX analysis. SEM-CL analysis is advantageous over conventional SEM-EDX and SEM-WDX analyses for detecting trace rare-earth elements in NdFeB magnets, particularly dysprosium and terbium.

Improved transistor-controlled and commutated brushless DC motors for electric vehicle propulsion

Science.gov (United States)

Demerdash, N. A.; Miller, R. H.; Nehl, T. W.; Nyamusa, T. A.

1983-01-01

The development, design, construction, and testing processes of two electronically (transistor) controlled and commutated permanent magnet brushless dc machine systems, for propulsion of electric vehicles are detailed. One machine system was designed and constructed using samarium cobalt for permanent magnets, which supply the rotor (field) excitation. Meanwhile, the other machine system was designed and constructed with strontium ferrite permanent magnets as the source of rotor (field) excitation. These machine systems were designed for continuous rated power output of 15 hp (11.2 kw), and a peak one minute rated power output of 35 hp (26.1 kw). Both power ratings are for a rated voltage of 115 volts dc, assuming a voltage drop in the source (battery) of about 5 volts. That is, an internal source voltage of 120 volts dc. Machine-power conditioner system computer-aided simulations were used extensively in the design process. These simulations relied heavily on the magnetic field analysis in these machines using the method of finite elements, as well as methods of modeling of the machine power conditioner system dynamic interaction. These simulation processes are detailed. Testing revealed that typical machine system efficiencies at 15 hp (11.2 kw) were about 88% and 84% for the samarium cobalt and strontium ferrite based machine systems, respectively. Both systems met the peak one minute rating of 35 hp.

Synergistic Effects of Sm and C Co-Doped Mixed Phase Crystalline TiO2 for Visible Light Photocatalytic Activity

Directory of Open Access Journals (Sweden)

Fuchang Peng

2017-02-01

Full Text Available Mixed phase TiO2 nanoparticles with element doping by Sm and C were prepared via a facile sol-gel procedure. The UV-Vis light-diffuse reflectance spectroscopy analysis showed that the absorption region of co-doped TiO2 was shifted to the visible-light region, which was attributed to incorporation of samarium and carbon into the TiO2 lattice during high-temperature reaction. Samarium effectively decreased the anatase-rutile phase transformation. The grain size can be controlled by Sm doping to achieve a large specific surface area useful for the enhancement of photocatalytic activity. The photocatalytic activities under visible light irradiation were evaluated by photocatalytic degradation of methylene blue (MB. The degradation rate of MB over the Sm-C co-doped TiO2 sample was the best. Additionally, first-order apparent rate constants increased by about 4.3 times compared to that of commercial Degusssa P25 under the same experimental conditions. Using different types of scavengers, the results indicated that the electrons, holes, and •OH radicals are the main active species for the MB degradation. The high visible-light photocatalytic activity was attributed to low recombination of the photo-generated electrons and holes which originated from the synergistic effect of the co-doped ions and the heterostructure.

Some practical applications of an ICP-MS instrument

International Nuclear Information System (INIS)

Meddings, B.; Ng, R.

1987-01-01

An early model commercial ICP-MS instrument (PlasmaQuad from VG Isotopes Limited) was acquired more than two years ago. As a typical analytical laboratory in the metallurgical field, the application of the ICP-MS technique to real sample analysis is the authors prime concern. The process of introducing this state-of-the-art instrument into routine analysis will be described. The modifications and limitations necessary to achieve acceptable precision under normal working conditions will be outlined. In most cases, practical problems can be circumvented with some sacrifice in analytical performance in the area of detection limits and dynamic range. In this presentation, specific applications of the ICP-MS technique in the authors laboratory will be discussed. These include trace analysis on high purity metals such as copper, aluminum, cobalt, nickel etc., on refinery feed samples such as nickel sulfate, mixed cobalt and nickel sulfide, cobalt cathode, samarium oxide etc., on alloys such as cobalt-samarium magnetic materials, nickel or cobalt based alloys used in turbine blades etc. Other applications such as the determination of uranium in phosphate rock, trace analysis on fertilizers, water samples and high purity acids will also be mentioned. The solutions to the practical problems encountered in these applications will be discussed. The analytical power of the ICP-MS technique for real sample analysis will be assessed

Search Results | Page 138 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

South of Sahara 357 Apply South of Sahara filter · North of Sahara 313 Apply .... Journal articles ... A systemic lack of access to finance, markets, and knowledge networks is ... The Coastal Cities at Risk project takes an interdisciplinary approach involving natural, social, and health scientists, engineers, and economists.

Search Results | Page 138 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

... Argentina 78 Apply Argentina filter · Colombia 74 Apply Colombia filter .... an opportunity to inform new or strengthen existing legislation arises requiring a ... Addressing inequality and environmental insecurity in the Middle East and ... gender analysis in environment and natural resource management (ENRM) research.

Search Results | Page 138 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

... of the Social Sciences and Humanities Research Council (SSHRC) and IDRC. ... SAIC experts explored poverty, violence, and inequality in 40 cities across ... IDRC and Fundación Capital launch digital tool to empower Colombian youth.

17 CFR 1.38 - Execution of transactions.

Science.gov (United States)

2010-04-01

... Management and Budget under control numbers 3038-0007 and 3038-0022) [46 FR 54523, Nov. 3, 1981, as amended... trades involving the exchange of futures for cash commodities or the exchange of futures in connection with cash commodity transactions, shall identify and mark by appropriate symbol or designation all such...

BIPR-5 program

International Nuclear Information System (INIS)

Petrunin, D.M.; Belyaeva, E.D.; Kireeva, I.L.

1975-01-01

The BIPR-5 program, which solves the relevant one-group equation in a three-dimensional inhomogeneous WWER reactor, makes it possible to simulate all the principal states of the core, including the maintenance of the critical state by means of rods or a liquid absorber on fuel burn-up or in transitional processes on xenon and samarium. The present paper includes a brief description of the program structure and a detailed description of input data and actually represents maintenance instructions

Structural aspects of displacive transformations: what can optical microscopy contribute? Dehydration of Sm2(C2O43·10H2O as a case study

Directory of Open Access Journals (Sweden)

Alexander A. Matvienko

2017-09-01

Full Text Available For martensitic transformations the macroscopic crystal strain is directly related to the corresponding structural rearrangement at the microscopic level. In situ optical microscopy observations of the interface migration and the change in crystal shape during a displacive single crystal to single crystal transformation can contribute significantly to understanding the mechanism of the process at the atomic scale. This is illustrated for the dehydration of samarium oxalate decahydrate in a study combining optical microscopy and single-crystal X-ray diffraction.

Optical isotype shifts of 146Sm and 151Sm

International Nuclear Information System (INIS)

Eastham, D.A.; Walker, P.M.; Griffith, J.A.R.; Evans, D.E.; England, J.G.; Grant, I.S.

1984-01-01

We have measured the optical isotope shifts of 146 Sm and 151 Sm by laser resonance fluorescence. From these measurements the changes in the mean square nuclear radii are: delta 2 > (A=144 to 146)=0.266(10) fm 2 , and delta 2 > (A=151 to 152)=0.262(10) fm 2 . These results, together with those of the stable isotopes, show that the average nuclear expansion of samarium can be accounted for by the liquid drop model with deformations. (orig.)

Geochronology Intermediary Laboratory implantation at the Rio Grande do Norte Federal University: the dating of the Serrinha Granitoid (RN) and the correlate Brasiliana extensional deformation

International Nuclear Information System (INIS)

Macedo, Maria Helena F.; Sa, Emanuel F. Jardim de; Souza, Zorano S.; Mendes, Franklin S.; Ramalho, Karlos A.C.

1997-01-01

The article describes the activities developed by the Geochronology Intermediary Laboratory at the Federal University of the Rio Grande do Norte, a Brazilian university, where there were the preoccupation of establishing strategies for a geochronological development. It relates the Rubidium-Strontium (Rb/Sr) and Samarium-Neodymium (Sm/Nd) methods, describing the analysis realized in these methodologies. Afterward, it presents the geological and petrographic situation of the Granitoide de Serrinha, located at Rio Grande do Norte State, Brazil and its geochronological data

Physical and structural properties of Sm3+ ions doped heavy metal oxide containing lanthanum-boro-telluirte glass

Science.gov (United States)

Madhu, A.; Eraiah, B.

2018-05-01

The structural studies of Tellurium oxide substituted by samarium oxide in lathanum-lead-boro-tellurite glass are successfully prepared with physical and optical parameters are determined. Due to the effect of increased number of non-bridging oxygen's in the glass samples few physical parameters are observed to be decreased. For the better structural analysis FTIR was carried out and transformation of BO3 → BO4 is observed. Most effective absorption coefficient OH- group was attained in the present work.

Labeling of fruitflies and their identification by tracer activation

International Nuclear Information System (INIS)

Haisch, A.; Forster, S.; Staerk, H.

1975-01-01

A technique was worked out to label and identify cherry fruit flies (Rhagoletic cerasi L.) in large numbers. For that purpose, the tracers dysprosium and samarium were mingled with a carrier substance (silica gel) which, mixed with silica sand, formed the substrate for emergence. The flies, the pupae of which were in this substrate, took up with their ptilinum-labeled silica gel during their crawling through the sand up to the surface. The tracer was detected after its activation by neutron irradiation

Part I. An investigation into the mechanism of the samarium (II)-promoted Barbier reaction: Sequential radical cyclization/organometallic addition. Part II. Conjugate addition reactions of organosamarium reagents by in situ transmetalation to cuprates. Part III. Approximate absolute rate constants for the reaction of tributyltin radicals with aryl and vinyl halides. Part IV. An investigation into the synthetic utility of tri-n-butylgermanium hydride

Energy Technology Data Exchange (ETDEWEB)

Totleben, M.J.

1992-01-01

An investigation of the mechanism of the samarium diiodide mediated Barbier reaction was conducted. Through a series of alkyl halide-carbonyl coupling and deuterium labelling experiments, evidence supportive of an organometallic addition mechanism was collected. Further probing led to an expansion of the utility of SmI[sub 2] in synthesis. The author has shown that radical cyclization of aryl and alkyl radicals to olefins, followed by reduction to primary and secondary organosamarium species is feasible. Organosamarium (III) reagents, produced by the reduction of alkyl and select aryl halides with 2 equiv of SmI[sub 2] in THF/HMPA, were treated with copper (I) salts and complexes to effect in situ transmetalation to cuprates. This allowed the 1,4-addition to [alpha],[beta]-unsaturated ketones. This new methodology allows for the sequential formation of carbon-carbon bonds through a combination of free radical and cuprate chemistry. Absolute rate constants for the abstraction of bromine atoms (k[sub Br]) by tri-n-butyltin radicals from a series of vinyl and aryl bromides have been determined. Atom abstraction was modestly enhanced by proximity of the halogen to a substituent in the following order: para < meta < ortho. Tri-n-butyl germanium hydride is known to be a poorer hydrogen atom donor than its tin analog. This feature makes it attractive for use in slow radical cyclizations where tin hydride would provide mainly for reduction. A brief study was executed to improve on the utility of the reagent as current conditions do not yield desired products in high amounts. Initial investigations examined the effect of initiator on reduction by germanium hydride, and subsequent experiments probed solvent effects. t-Butyl alcohol was determined to be superior to benzene or acetonitrile, giving consistently higher yields of reduction products.

77 FR 40574 - Certain Frozen Warmwater Shrimp From Thailand: Final Results of Antidumping Duty Administrative...

Science.gov (United States)

2012-07-10

... Central Records Unit, room 7046, of the main Department of Commerce building. In addition, a complete... 1.38 Kosamut Frozen Foods Co., Ltd 1.38 Lee Heng Seafood Co., Ltd 1.38 Leo Transports 1.38 Li-Thai...

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC138 (Link to dictyBase) - - - Contig-U15456-1 VFC138P (Link... to Original site) VFC138F 411 VFC138Z 440 VFC138P 851 - - Show VFC138 Library VF (Link to library) Clone ID VFC138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...ducing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostelium discoideum mRNA for cathepsin D.... 815 0.0 4 AJ243946 |AJ243946.1 Dictyostelium discoideum ctsD gene for cathepsin D, exons 1 to 2. 815 0.0 5

Analysis and separation of lanthanide elements

International Nuclear Information System (INIS)

Almeida Pimentel, E. de.

1973-01-01

Improvements of rare earth separation by the combined use of acetic and critic acid were studied and analytical methods for determining some of the lanthanides were tryed out. Separations of the R.E. studied were favorable when citric acid (solution A) and acetic acid (solution B) were used in the proportion of 10:1 at pH=4,00. Neutron activation, spectro-photometric, polarographic, volumetric and gravimetric procedures allowed the determination of 8 R.E.; samarium, neodymium, praseodymium, lanthanum, cerium, holmium, erbium and europium

Extraction with tributyl phosphate (TBP) from ferric nitrate solutions

International Nuclear Information System (INIS)

Kolarik, Z.; Grudpan, K.

1985-01-01

Ferric nitrate acts as a strong salting-out agent in the extraction of thorium(IV), uranyl, europium(III), samarium(III) and zirconium(IV) nitrates as well as of nitric acid with tributyl phosphate in dodecane. Nitric acid, if present in the extraction system together with large amounts of ferric nitrate, markedly suppresses the extraction of thorium(IV) and lanthanides(III) but significantly supports the extraction of zirconium(IV). Separation factors of different metal pairs are presented as functions of the concentrations of ferric nitrate and nitric acid

Geochronology Intermediary Laboratory implantation at the Rio Grande do Norte Federal University: the dating of the Serrinha Granitoid (RN) and the correlate Brasiliana extensional deformation; Implantacao do Laboratorio Intermediario de Geocronologia na UFRN: a datacao do granitoide de Serrinha (RN) e da deformacao extensional brasiliana correlata

Energy Technology Data Exchange (ETDEWEB)

Macedo, Maria Helena F.; Sa, Emanuel F. Jardim de; Souza, Zorano S. [Pernambuco Univ., Recife, PE (Brazil). Nucleo de Pesquisa em Geodinamica e Geofisica; Mendes, Franklin S. [Pernambuco Univ., Recife, PE (Brazil). Curso de Quimica; Ramalho, Karlos A.C. [Pernambuco Univ., Recife, PE (Brazil). Curso de Geologia

1997-12-31

The article describes the activities developed by the Geochronology Intermediary Laboratory at the Federal University of the Rio Grande do Norte, a Brazilian university, where there were the preoccupation of establishing strategies for a geochronological development. It relates the Rubidium-Strontium (Rb/Sr) and Samarium-Neodymium (Sm/Nd) methods, describing the analysis realized in these methodologies. Afterward, it presents the geological and petrographic situation of the Granitoide de Serrinha, located at Rio Grande do Norte State, Brazil and its geochronological data 8 refs., 2 figs.

A Novel β-Globin Chain Hemoglobin Variant, Hb Allentown [β137(H15)Val→Trp (GTG>TGG) HBB: c.412_413delinsTG, p.Val138Trp], Associated with Low Oxygen Saturation, Intermittent Aplastic Crises and Splenomegaly.

Science.gov (United States)

Collier, Anderson B; Coon, Lea M; Monteleone, Philip; Umaru, Samuel; Swanson, Kenneth C; Hoyer, James D; Oliveira, Jennifer L

2016-01-01

Hemoglobin (Hb) variants may be associated with low oxygen saturation and exacerbated episodes of anemia from common stressors such as viral infections. These attributes frequently cause increased clinical concern and unnecessary and expensive testing if not considered early in the evaluation of the patient. Some clinically significant Hb variants result in a normal Hb electrophoresis result, which can be method-dependent. Herein we describe a patient with low oxygen saturation and a history of hemolytic anemia who was subsequently found to carry a novel, unstable β-globin variant that we have named Hb Allentown [β137(H15)Val→Trp (GTG>TGG) HBB: c.412_413delinsTG, p.Val138Trp] for the place of identification of the variant. Hb Allentown is formed by a rare double nucleotide substitution within the same codon. Additionally, positive identification of rare Hb variants characterized by a single method is discouraged, as the Hb variant was misclassified as Hb S-South End or β6(A3)Glu→Val;β132(H10)Lys→Asn (HBB: c.[20A > T;399A > C]) by the initial laboratory.

Conductivity fluctuation in the high temperature superconductor with planar weight disparity Y0.5Sm0.5Ba2Cu3O7-δ

International Nuclear Information System (INIS)

Barrera, E.W.; Rojas Sarmiento, M.P.; Rincon, L.F.; Landinez Tellez, D.A.; Roa-Rojas, J.

2007-01-01

The synthesis of the Y 0.5 Sm 0.5 Ba 2 Cu 3 O 7-δ superconducting material by the standard solid state reaction is reported. DC resistivity measurements reveal the improvement of the critical temperature (T c ) when substitution of exact 50-50 mix of Yttrium and Samarium is performed. A bulk T c = 101 K was determined by the criterion of the maximum in the temperature derivative of electrical resistivity. Structure characterization by means the x-ray diffraction technique shows the crystalline appropriated distribution of Yttrium and Samarium to create substantial planar weight disparity (PWD) in alternating layers. This PWD increases T c in copper-oxide superconductors. In order to examine the effect of PWD on the pairing mechanism close to T c , conductivity fluctuation analysis was performed by the method of logarithmic temperature derivative of the conductivity excess. We found the occurrence of Gaussian and genuinely critical fluctuations. Our results are in agreement with reports on YBa 2 Cu 3 O 7-δ , but an enhancement of the Gaussian fluctuation regimes was experimentally detected as a result of the PWD. The correlations of the critical exponents with the dimensionality of the fluctuation system for each Gaussian regime were performed by using the Aslamazov-Larkin theory. The genuinely critical exponent is interpreted by the 3D-XY model as corresponding with the dynamical universality class of the E-model. (copyright 2007 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

HF Propagation Effects Caused by an Artificial Plasma Cloud in the Ionosphere

Science.gov (United States)

Joshi, D. R.; Groves, K. M.; McNeil, W. J.; Caton, R. G.; Parris, R. T.; Pedersen, T. R.; Cannon, P. S.; Angling, M. J.; Jackson-Booth, N. K.

2014-12-01

In a campaign carried out by the NASA sounding rocket team, the Air Force Research Laboratory (AFRL) launched two sounding rockets in the Kwajalein Atoll, Marshall Islands, in May 2013 known as the Metal Oxide Space Cloud (MOSC) experiment to study the interactions of artificial ionization and the background plasma and measure the effects on high frequency (HF) radio wave propagation. The rockets released samarium metal vapor in the lower F-region of the ionosphere that ionized forming a plasma cloud that persisted for tens of minutes to hours in the post-sunset period. Data from the experiments has been analyzed to understand the impacts of the artificial ionization on HF radio wave propagation. Swept frequency HF links transiting the artificial ionization region were employed to produce oblique ionograms that clearly showed the effects of the samarium cloud. Ray tracing has been used to successfully model the effects of the ionized cloud. Comparisons between observations and modeled results will be presented, including model output using the International Reference Ionosphere (IRI), the Parameterized Ionospheric Model (PIM) and PIM constrained by electron density profiles measured with the ALTAIR radar at Kwajalein. Observations and modeling confirm that the cloud acted as a divergent lens refracting energy away from direct propagation paths and scattering energy at large angles relative to the initial propagation direction. The results confirm that even small amounts of ionized material injected in the upper atmosphere can result in significant changes to the natural propagation environment.

Formation and characterization of samarium oxide generated from different precursors

International Nuclear Information System (INIS)

Hussein, G.A.M.; Buttrey, D.J.; DeSanto, P.; Abd-Elgaber, A.A.; Roshdy, Heba; Myhoub, Ali Y.Z.

2003-01-01

Sm(NO 3 ) 3 ·6H 2 O and Sm 2 (C 2 O 4 ) 3 ·10H 2 O were used as precursors for the formation of Sm 2 O 3 . Thermal processes involved in the decomposition course of both salts up to 800 deg. C in air were monitored by nonisothermal gravimetry and differential thermal analysis. Intermediates and final solid products were characterized by IR-spectroscopy, X-ray diffraction and scanning electron microscopy. The results showed that Sm(NO 3 ) 3 ·6H 2 O decomposes completely through nine endothermic mass loss processes. The dehydration occurs through the first four steps at 90, 125, 195, and 240 deg. C, culminating in a crystalline nitrate monohydrate, which subsequently decomposes to Sm(OH)(NO 3 ) 2 at 355 deg. C. The latter decomposes rapidly to form a stable and crystalline SmO(NO 3 ) at 460 deg. C, through nonstoichoimetric unstable intermediates. Finally Sm 2 O 3 forms at 520 deg. C. For the oxalate, the dehydration occurs in five steps: the anhydrous oxalate is thermally unstable and immediately decomposes to Sm 2 O 3 at 645 deg. C through two unstable intermediates. The crystalline oxide obtained from the nitrate contains larger pores than the oxide obtained from the oxalate, as indicated from scanning electron microscopy (SEM) results

Influence of Samarium on Learning and Memory Function of Rats

Institute of Scientific and Technical Information of China (English)

无

2006-01-01

Sixty-four Spraque-Dawley(SD)big rats with weaning weight of (195±15) g were randomly divided into 4 groups with 8 males and 8 females each group. One group drunk with de-ionized water served as control and was also used for analysis of the background. The other three groups rats were raised by de-ionized water containing low, middle and high concentrations of Sm for four months, then learning and memory tests were carried out in Y-electric maze. Compared with the control rats, the learning and memory of rats in low and middle groups shows a deterioration trend, exhibiting the function degradation of rats' brain. It may results from the rare earth elements through blood-brain barrier affecting the normal physiological functions of rats' brain. In addition, the activity of superoxide dismutase (SOD) in rats' brain decreases, while the content of malondialdehyde (MDA) concentration increases. The decreased SOD activity and the increased MDA mean the degeneration the ability of anti-oxidation in rats' brain, which are accordance with the degradation of learning and memory function of rats in low and middle Sm groups.

Oriented growth of thin films of samarium oxide by MOCVD

Indian Academy of Sciences (India)

Unknown

Very thin layers of rare earth oxides, such as Sm2O3 and epitaxial Gd2O3, grown by thermal ... As the inorganic salts of the lanthanides, such as their halides, are ... sodium hydroxide, followed by the addition of ethanolic. 1,10-phenanthroline ...

Spectroscopy of samarium isotopes in the sdg interacting boson model

International Nuclear Information System (INIS)

Devi, Y.D.; Kota, V.K.B.

1992-01-01

Successful spectroscopic calculations for the 0 1 + , 2 1 + , and 4 1 + levels in 146-158 Sm are carried out in sdg boson space with the restriction that the s-boson number n s ≥2 and the g-boson number n g ≤2. Observed energies, quadrupole and magnetic moments, E2 and E4 transition strengths, nuclear radii, and two-nucleon transfer intensities are reproduced with a simple two-parameter Hamiltonian. For a good simultaneous description of ground, β, and γ bands, a Hamiltonian interpolating the dynamical symmetries in the sdg model is employed. Using the resulting wave functions, in 152,154 Sm, the observed B(E4;0 1 + →4 γ + ) values are well reproduced and E4 strength distributions are predicted. Moreover, a particular ratio scrR involving two-nucleon transfer strengths showing a peak at neutron number 90 is well described by the calculations

Isotopic Ratios of Samarium by TIMS for Nuclear Forensic Application

Energy Technology Data Exchange (ETDEWEB)

Louis Jean, James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Inglis, Jeremy David [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2017-08-08

The isotopic ratio of Nd, Sm, and Gd can provide important information regarding fissile material (nuclear devices, reactors), neutron environment, and device yield. These studies require precise measurement of Sm isotope ratios, by either TIMS or MC-ICP-MS. There has been an increasing trend to measure smaller and smaller quantities of Sm bearing samples. In nuclear forensics 10-100 ng of Sm are needed for precise measurement. To measure sub-ng Sm samples using TIMS for nuclear forensic analysis.

Testing of the level density segment of the RIPL

International Nuclear Information System (INIS)

Capote, Roberto

2000-01-01

A comparison between RIPL phenomenological state density parameterizations and microscopical state density (SD) codes was performed for nickel and samarium isotopes. All the codes were shown to be complete. More work is needed on calculation of the collective enhancement of the level densities to improve currently used phenomenological recipes. It was shown that phenomenological closed formulae for particle-hole state density fails to describe microscopical calculation for magic nuclei. For deformed nuclei, like Sm-152, the agreement of Williams closed formulae considering Kalbach pairing correction with microscopical SID calculations was very good. (author)

Spectrographic Determination of Trace Constituents in Rare Earths

International Nuclear Information System (INIS)

Capdevila, C.; Alvarez, F.

1962-01-01

A spectrographic method was developed for the determination of 18 trace elements in lanthanum, cerium, praseodimium, neodimium and samarium compounds. The concentrations of the impurities cover the range of 0,5 to 500 ppm. Most of these impurities are determined by the carrier distillation method. Several more refractory elements have been determined by total burning of the sample with a direct current arc or by the conduction briquet excitation technique with a high voltage condensed spark. The work has been carried out with a Hilger Automatic Large Quartz Spectrograph. (Author) 5 refs

Synthesis and physicochemical analysis of Sm (II, III) acetylacetone chelate complexes

International Nuclear Information System (INIS)

Kostyuk, N.N.; Dik, T.A.; Trebnikov, A.G.

2004-01-01

Sm (II, III) acetylacetone chelate complexes were synthesized by electrochemical method. It was shown that anode dissolution of the metal samarium over acetylacetone leads to formation of the Sm (II, III) chelate complexes: xSm(acac)2 · ySm(acac)3 · zH(acac). Factors x, y and z depend on quantity of the electricity, which flew through the electrolysis cell. The compositions of the obtained substances were confirmed by the physicochemical analysis (ultimate analysis, IR-, mass spectroscopy and thermal analysis (thermogravimetric, isothermal warming-up and differential scanning colorimetry). (Authors)

Synthesis and application of a new fluorous-tagged ammonia equivalent

DEFF Research Database (Denmark)

Nielsen, Simon Dalsgaard; Smith, Garrick; Begtrup, Mikael

2010-01-01

A novel fluorous-tagged ammonia equivalent has been developed. It is based on a nitrogen-oxygen bond, which can be cleaved in a traceless manner by a molybdenum complex or samarium diiodide. The application in the synthesis of ureas, amides, sulfonamides, and carbamates is described. The scope of...... of the fluorous N--O linker is exemplified by the synthesis of itopride, a drug used for the treatment of functional dyspepsia. Itopride was synthesized with the aid of fluorous purification methods and the product was isolated in good overall yield, with high purity....

Kondo effect and non-Fermi liquid behavior in metallic glasses containing Yb, Ce, and Sm

Science.gov (United States)

Huang, B.; Yang, Y. F.; Wang, W. H.

2013-04-01

The low temperature properties of metallic glasses containing different concentrations of ytterbium, cerium, and samarium are studied. It is found that the Kondo effect caused by exchange interactions between the conduction and 4f electrons and non-Fermi liquid behavior appear in the strongly disordered alloys. We study the origins for these unique features and demonstrate that the found Kondo effect is inherited from the crystalline counterparts. The results might have significance on investigating the strong electron-electron interaction systems with structural disorder and be helpful for designing new metallic glasses with functional properties.

Short-wavelength soft-x-ray laser pumped in double-pulse single-beam non-normal incidence

International Nuclear Information System (INIS)

Zimmer, D.; Ros, D.; Guilbaud, O.; Habib, J.; Kazamias, S.; Zielbauer, B.; Bagnoud, V.; Ecker, B.; Aurand, B.; Kuehl, T.; Hochhaus, D. C.; Neumayer, P.

2010-01-01

We demonstrated a 7.36 nm Ni-like samarium soft-x-ray laser, pumped by 36 J of a neodymium:glass chirped-pulse amplification laser. Double-pulse single-beam non-normal-incidence pumping was applied for efficient soft-x-ray laser generation. In this case, the applied technique included a single-optic focusing geometry for large beam diameters, a single-pass grating compressor, traveling-wave tuning capability, and an optimized high-energy laser double pulse. This scheme has the potential for even shorter-wavelength soft-x-ray laser pumping.

Neutron activation analysis of the rare earth elements in Nasu hot springs

International Nuclear Information System (INIS)

Ikeda, Nagao; Takahashi, Naruto.

1978-01-01

Eleven rare earth elements (lanthanum, cerium, neodymium, samarium, europium, gadolinium, terbium, holmium, thulium, ytterbium and lutetium) in hot spring waters and sinter deposits in the Nasu area were determined by the neutron activation method. The rare earth elements in hot spring water were preconcentrated in ferric hydroxide precipitate and neutron-irradiated. The rare earth elements were chemically separated into lighter and heavier groups and the activity of each group was measured with a Ge(Li) detector. Distribution of the rare earth elements between the hot spring water and the sinter deposit was also discussed. (auth.)

Sm 3+-doped polymer optical waveguide amplifiers

Science.gov (United States)

Huang, Lihui; Tsang, Kwokchu; Pun, Edwin Yue-Bun; Xu, Shiqing

2010-04-01

Trivalent samarium ion (Sm 3+) doped SU8 polymer materials were synthesized and characterized. Intense red emission at 645 nm was observed under UV laser light excitation. Spectroscopic investigations show that the doped materials are suitable for realizing planar optical waveguide amplifiers. About 100 μm wide multimode Sm 3+-doped SU8 channel waveguides were fabricated using a simple UV exposure process. At 250 mW, 351 nm UV pump power, a signal enhancement of ˜7.4 dB at 645 nm was obtained for a 15 mm long channel waveguide.

Potentiometric studies on some ternary complexes of Nd(III), Sm(III), Gd(III) and Ho(III) with cyclohexanediaminetetraacetic acid as primary ligand

International Nuclear Information System (INIS)

Marathe, D.G.; Munshi, K.N.

1983-01-01

The formation constants of the ternary complexes of neodymium(III), samarium(III), gadlonium(III) and holmium(III) with cyclohexanediaminetetraacetic acid (CyDTA) as primary ligand and dihydroxynaphthalene (DHN), dihydroxynaphthalene-6-sulphonic acid (DHNSA) and cateechol-3,5-disulphonic acid (CDSA) as secondary ligands have been investigated by potentiometric titration technique. The secondary ligands have been investigated by potentiometric titration technique. The values of formation constants of 1:1:1 ternary chelates are reported at three different temperatures, and at a fixed ionic strength, μ = 0.1 M (NaClO 4 ). (author)

Time-resolved fluoroimmunoassay of phytoviruses by monoclonal antibodies. Vremenno-razreshennyj fluoroimmunoanaliz fitovirusos pri pomoshchi monoklonal'nykh antitel

Energy Technology Data Exchange (ETDEWEB)

Saarma, M Yu; Yarvekyul' g, L V; Andreeva, E G; Siniyarv, R K

1989-01-01

Monoclonal antibodies (MAbs) to potato viruses were labelled with lanthanides and used for time-resolved fluoroimmunoassay (TRFIA) of these viruses. TRFIA of potato leafroll virus (PLRV) had the sensitivity less than 1 ng/ml and was therefore approx 10 times more sensitive than ELISA. Possibility of simultaneous quantitative detection of several viruses by different MAbs labelled with europium, samarium and terbium provides TRFIA of fundamental advantage. Data on simultaneous sensitive detection of two viruses - PLRV and PVX (0,5 ng/ml of both) and three viruses - PLRV, PVX and PVM are given.

Luminosity enhancements at SLAC

International Nuclear Information System (INIS)

Coward, D.H.

1984-04-01

Several ideas are discussed that have been proposed to improve the luminosity at the SPEAR and PEP electron-positron storage rings and to insure good luminosity at the SLAC Linear Collider. There have been two proposals studied recently for SPEAR: a Microbeta insertion using Samarium Cobalt permanent magnets, and a Minibeta insertion using conventional quadrupole magnets. The notations Microbeta and minibeta used here are somewhat arbitrary since the front faces of the first quadrupole magnets for both insertions are at nearly the same distance from the interaction point

Nuclear deformation in the configuration-interaction shell model

Science.gov (United States)

Alhassid, Y.; Bertsch, G. F.; Gilbreth, C. N.; Mustonen, M. T.

2018-02-01

We review a method that we recently introduced to calculate the finite-temperature distribution of the axial quadrupole operator in the laboratory frame using the auxiliary-field Monte Carlo technique in the framework of the configuration-interaction shell model. We also discuss recent work to determine the probability distribution of the quadrupole shape tensor as a function of intrinsic deformation β,γ by expanding its logarithm in quadrupole invariants. We demonstrate our method for an isotope chain of samarium nuclei whose ground states describe a crossover from spherical to deformed shapes.

Spectrographic Determination of Trace Constituents in Rare Earths; Determinacion espectrografica de impurezas en tierras raras

Energy Technology Data Exchange (ETDEWEB)

Capdevila, C; Alvarez, F

1962-07-01

A spectrographic method was developed for the determination of 18 trace elements in lanthanum, cerium, praseodimium, neodimium and samarium compounds. The concentrations of the impurities cover the range of 0,5 to 500 ppm. Most of these impurities are determined by the carrier distillation method. Several more refractory elements have been determined by total burning of the sample with a direct current arc or by the conduction briquet excitation technique with a high voltage condensed spark. The work has been carried out with a Hilger Automatic Large Quartz Spectrograph. (Author) 5 refs.

Geochronology and structuring of the Ceara State: Borborema Province northwestern part, NE Brazil

International Nuclear Information System (INIS)

Fetter, A.; Van Schmus, W.R.; Santos, Ticiano J. Saraiva dos; Arthaud, M.; Nogueira Neto, J.

1997-01-01

The work confirms that the geochronological new data U/Pb in zircon and Samarium/Neodymium from the Ceara State furnished a refined chronology of the geological activity in the NW part of the Borborema Province, indicating an evolutive history since 2,78 Ga and 532 Ma. Furthermore, these data facilitated the different crust domain outlines in the region, putting age maximum limits in the pre-brasilianas supracrusts rocks deposition, and evidencing the epoch and duration of the Brasiliano magmatism and metamorphism in the northwest part of the State

The trial of obtaining a high-grade gadolinium concentrate using the fractional precipitation together with the ion exchange

International Nuclear Information System (INIS)

Ozga, W.; Soltysiak, I.

1980-01-01

The modified fractional precipitation of lanthanon-potassium double chromate was used for preliminary separation of gadolinium concentrate containing 60% Gd 2 O 3 , 33,3% Sm 2 O 3 . The 1-st fraction enriched with samarium (60% Sm 2 O 3 ) and 2-nd fraction enriched with gadolinium (80% Gd 2 O 3 with efficiency of 82% recounting on Gd 2 O 3 ) were obtained. Both fractions were separated by the elution with EDTA solution buffered with ammonium acetate. The good results were obtained by ion exchange separation only of the 1-st fraction. (author)

KEY COMPARISON: CCT-K2.1: NRC/VNIIFTRI bilateral comparison of capsule-type standard platinum resistance thermometers from 13.8 K to 273.16 K

Science.gov (United States)

Hill, K. D.; Steele, A. G.; Dedikov, Y. A.; Shkraba, V. T.

2005-01-01

The Consultative Committee for Thermometry Key Comparison 2 (CCT-K2) results were published two years ago (2002 Metrologia 39 551-71). NRC served as the pilot laboratory for CCT-K2 and remains able to provide a scale and measurement system suitable for performing bilateral comparisons linked to the original key comparison results. In March 2003, measurements of two VNIIFTRI 100 Ω capsule-style platinum resistance thermometers (CSPRTs), S/N 356 and 476, were undertaken to relate their local calibration to the results from the CCT-K2 exercise. The NRC Leeds and Northrup (L&N) CSPRT S/N 1872174 provides the link to the CCT-K2 results. The three CSPRTs were compared at the eight defining cryogenic temperatures of the International Temperature Scale of 1990 (ITS-90) in the range from 13.8033 K to 273.16 K. The reader is referred to the full text of the CCT-K2 report for a detailed explanation of the methodology employed for the comparison. Only the details unique to the measurements reported here will be addressed in this article. The NRC/VNIIFTRI bilateral comparison of capsule-style platinum resistance thermometers over the range 13.8 K to 273.16 K has revealed calibrations at VNIIFTRI to be in agreement with the KCRV of CCT-K2 within the expanded uncertainty for all temperatures of the comparison with the exception of the triple point of hydrogen at 13.8033 K. One of the two CSPRTs supplied by VNIIFTRI was found to be discrepant as revealed by differences at the triple point of water and at the lowest temperatures of the comparison, and was therefore excluded from further analysis. The linkage to the CCT-K2 data supports the evaluation of the VNIIFTRI CMCs in Appendix C of the KCDB. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCT, according to the provisions

42 CFR 433.138 - Identifying liable third parties.

Science.gov (United States)

2010-10-01

... State law) to provide for obtaining— (i) From State Workers' Compensation or Industrial Accident... be met. (e) Diagnosis and trauma code edits. (1) Except as specified under paragraph (e)(2) or (l) of... recipients that contain diagnosis codes 800 through 999 International Classification of Disease, 9th Revision...

33 CFR 138.80 - Financial responsibility, how established.

Science.gov (United States)

2010-07-01

... must submit annual, current, and audited non-consolidated financial statements prepared in accordance... certificant, apart from any other affiliated entity, and identify the consolidated financial statement to...-insurance. By filing with the Director, NPFC, the financial statements specified in paragraph (b)(3)(i) of...

1/38 GROUNDS FOR DISPENSING WITH PUBLIC TENDER ...

African Journals Online (AJOL)

Administrator

2010-01-25

Jan 25, 2010 ... value of public procurement (excluding the procurement of public corporations) ... money in government contracting, the fair treatment of contractors and the use ... 6 For detailed discussion, see Bolton Government Procurement ch 3, par 4. ... 8 On 'cost-effectiveness', see Collins English Dictionary 380 and ...

32 CFR 719.138 - Fees of civilian witnesses.

Science.gov (United States)

2010-07-01

...) Method of Payment. The fees and mileage of a civilian witness shall be paid by the disbursing officer of... whose testimony is determined not to meet the standards of relevancy and materiality set forth in...

What we do | Page 138 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Understanding Impunity : the Right to Truth, Justice and Reparation ... There is a general perception that assisted reproductive technologies (ARTs) affect only a ... in China and India : Policy Interventions to address Discrimination against Girls.

Isotope instrument FD-138 for the hydrologic parameter

Energy Technology Data Exchange (ETDEWEB)

Rukuan, Zheng; Zengxin, Wu [Instituts of Enviromental Protection, Beijing, BJ (China); Heyi, Huang [Beijing Nuclear Instrument Factory, BJ (China)

1988-07-01

In order to determine the hydrologic parameters, such as filtration velocity, flow direction and dispersity, {sup 131}I isotope is used as tracer in the groundwater aquifer. This method has advantages over traditional methods in respect of power saving, and is simple, quick and economical.