WorldWideScience

Sample records for saks peeter sikk

  1. Peeter Saks maksab karmavõlga / Paavo Kangur

    Index Scriptorium Estoniae

    Kangur, Paavo, 1966-

    2006-01-01

    Investeerimispanga Suprema Securities juhatuse esimees Peeter Saks oma sportlasekarjäärist, muudatustest investeerimispanga juhtkonnas ning panga tegevusest sportlaste toetamisel. Kommenteerib mäesuusataja Tiiu Nurmberg

  2. Sikke et ord

    DEFF Research Database (Denmark)

    Thrane, Torben

    2001-01-01

    There is an apparently peripheral construction type that falls outside the normally mandatory V2-structure of Danish main clauses, expressions introduced by the emphatic lexical item sikke (plus inflectional variants sikken, sikket). Such expressions defy standard taxonomic descriptions of Danish...

  3. Riskikapital vajab riigi kehtestatud mängureegleid / Peeter Saks

    Index Scriptorium Estoniae

    Saks, Peeter

    2004-01-01

    AS-i Suprema Securities juhatuse esimehe sõnul on Euroopa riskikapitali turul selge nõudlus sobiva seadusliku raamistiku ja hea mainega riigi või piirkonna järele, Eestil on praegu võimalus kujuneda Euroopa üheks riskikapitali keskuseks. Autori arvates peaks esimeseks sammuks olema eraldi riskikapitali seaduse loomine. Vt. samas: Andrus Ansip, Taavi Veskimägi ja Linnar Viik vastavad küsimusele, kas Eesti vajab riiklikku riskikapitali fondi

  4. Peeter Simm kolmandat korda teatris

    Index Scriptorium Estoniae

    2001-01-01

    Rakveres tuli lavale Toomas Raudami ja Peeter Simmi näidend Lõuna-Eesti kinomehaaniku Mati Parkja elust "Kino-Mati. Tema elutee ja juhtumised, mis seal ette tulid". Lavastas Peeter Simm, nimiosas Erik Ruus, kunstnik Hardi Volmer

  5. Armastuse anatoomia / Peeter Laurits

    Index Scriptorium Estoniae

    Laurits, Peeter, 1962-

    2007-01-01

    Mängufilmist "Nuga" Peeter Sauteri ja Vaino Vahingu jutustuste motiividel : režissöör Marko Raat : peaosas Mait Malmsten : Allfilm, 2007. Samuti ka M. Raadi hiljuti valminud dokumentaalfilmist "F.F.F.F. läheb laiali"

  6. Peeter Kreitzberg esimest korda Hiiumaal / Peeter Kreitzberg ; interv. Marika Rõmmel

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Küsimused presidendikandidaat Peeter Kreitzbergile puudutavad osalemist Hiiumaa suurkogul, presidendiks kandideerimist, presidendivalimisi, hädavajalikke muudatusi Eestis, Eesti saari jm. Autor: Keskerakond. Parlamendisaadik

  7. Peeter Kreitzberg : reeturlik Rahvaliit ootas kerget saaki / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Keskerakonna presidendikandidaat Peeter Kreitzberg peab leppest taganenud rahvaliitlasi reeturiteks, tunnistades samas, et riigipea valimiste voorudes Riigikogus võis kaduma minna ka Keskerakonna hääli

  8. Raamatukogudest läks kaduma info tuhandete raamatute kohta / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2011-01-01

    Detsembris 2010 kadusid infosüsteemi URRAM kasutavate raamatukogude arvutitest laenutusandmed, probleemid lugejateeninduses võivad kesta nädalaid. Vt. ka Sikk, Rein. Kultuuriministeeriumi sovetlik digitüng, lk. 2

  9. Tekstiilikunstnike suvi / Peeter Kuutma

    Index Scriptorium Estoniae

    Kuutma, Peeter

    2001-01-01

    ETL ühisnäitus "Aja küsimus" juunis Kuressaare lossis (kujundajad Krista Leesi, Aune Taamal), juulis ja augustis Võru muuseumis (kujundajad Annika Künnap, Peeter Kuutma). Erika Tammpere juhitud projekt "Ruuduvaip" lõppes juulis väljapanekuga Tallinna raekoja keldrisaalis. Kastellaanimaja galeriis 6. juulist rühmituse Vaba Tahe põimevaibanäitus (kujundaja P. Kuutma), mais ja juunis oli rühmituse korraldatud ühisnäitus "Kevadine tuul" Estonia Talveaias.

  10. Peeter Tooming (1939-1997) : polüskoopiline tagasivaade / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2012-01-01

    Peeter Toominga loomingust (visuaalne-modernistlik liin, kontseptuaalne fotograafia, telesaated, ringvaated, fotofilmid). Carl Sarapi 1937. a. ja Peeter Toominga 1987. a. pildistatud fotodest (projekt "50 aastat hiljem")

  11. Tule tagasi, Peeter! / Jaan Ruus

    Index Scriptorium Estoniae

    Ruus, Jaan, 1938-2017

    2006-01-01

    Eesti-Saksa koostööfilm "Kõrini" : režissöör Peeter Simm : operaator Rein Kotov : helilooja Sven Grünberg : osades Maarja Jakobson, Rasmus Kaljujärv, Heio von Stetten, Thomas Schmauser : Ruut Pictures (Eesti) - Saxonia Film (Saksa) 2005

  12. Telliskivist Peeter Suureni / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2005-01-01

    Tutvustus: Fowles, John. Daniel Martin / inglise keelest tõlkinud Viktoria Traat. Tallinn : Varrak, 2005 ; Undset, Sigrid. Põlev põõsas / norra keelest tõlkinud Elvi Lumet. Tallinn : Eesti Raamat, 2005 ; Hughes, Lindsey. Peeter Suur / inglise keelest tõlkinud Lauri Vahtre. Tallinn : Varrak, 2005

  13. Kool pole vabrik / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2003-01-01

    Riigikogu liige Peeter Kreitzberg nimetab Res Publica kavandatavat koolireformi kirvereformiks, mis ei lähtu hariduse põhiprobleemidest. Autor pooldab haridusvõimaluste regionaalset võrdsust ning leiab, et hariduses pole vaja võistlust mõttetult õhutada

  14. Peeter Kreitzberg : võtame vaestelt lapsed ära! / Peeter Kreitzberg ; vahendas Helen Urbanik

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Intervjuu Keskerakonna presidendikandidaadi Peeter Kreitzbergiga : Peeter Kreitzbergi ettekanne konverentsil "Teine võimalus hariduses" sisaldas ettepanekut koguda probleemsete ja ebasoodsas keskkonnas elavate perekondade hooletusse jäetud lapsed riigi pansionidesse

  15. Peeter Tooming (1939-1997) : polüskoopiline tagasivaade / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2009-01-01

    Eesti foto ajaloost. Peeter Toominga loomingust (visuaalne-modernistlik liin, kontseptuaalne fotograafia, telesaated, ringvaated, fotofilmid). Carl Sarapi 1937. aastal ja Peeter Toominga 1987. aastal pildistatud fotodest (projekt "50 aastat hiljem")

  16. Märkusi Peeter Tali arvustuse kohta John Keegani raamatust / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2004-01-01

    Rets. rmt. John Keegan. Sõjakunsti ajalugu. Tallinn : Varrak, 2004. Vastukaja Peeter Tali samateemalise artiklile Eesti Päevalehes 23. juulil 2004. Vt. ka: Peeter Tali vastust 6. aug. Eesti Päevalehes lk. 15 "Peeter Helme märkuste kohta Keegani asjus"

  17. A Reflective Conversation with Ugur Sak: Gifted Education in Turkey

    Science.gov (United States)

    Shaughnessy, Michael F.; Sak, Ugur

    2015-01-01

    In this reflective conversation, Ugur Sak discusses the current "state of the art" of gifted education in Turkey. He reviews the use of enrichment, discusses acceleration and reviews curricular procedures in Turkey. He responds to questions about the identification of gifted students and discusses the age old debate of talent versus…

  18. Rainer Saks : ärgem lohutagem end lootusega, et Herman Simm oli ainus / Rainer Saks ; interv. Rasmus Kagge

    Index Scriptorium Estoniae

    Saks, Rainer

    2008-01-01

    Intervjuu Eesti eriteenistuste endise esikoordinaatori ning praeguse Vabariigi Presidendi kantselei direktoriga, kes vastab küsimustele, mis puudutavad Herman Simmi. Ta möönab, et ei ole põhjust arvata, nagu võiks riigireetmises kahtlustatav Herman Simm olla ainuke, kes riiki petta oskas. Vt. Kes on Rainer Saks?; Kes on Mitrohhin?

  19. Rainer Saks : ärgem lohutagem end lootusega, et Herman Simm oli ainus / Rainer Saks ; interv. Rasmus Kagge

    Index Scriptorium Estoniae

    Saks, Rainer

    2008-01-01

    Intervjuu Eesti eriteenistuste endise esikoordinaatori ning praeguse Vabariigi Presidendi kantselei direktoriga, kes vastab küsimustele riigireetmises kahtlustatava Herman Simmi kohta. Vt. samas: Kes on Rainer Saks? Lühiülevaade elukäigust ja karjäärist

  20. SAK/PLK4 is required for centriole duplication and flagella development.

    Science.gov (United States)

    Bettencourt-Dias, M; Rodrigues-Martins, A; Carpenter, L; Riparbelli, M; Lehmann, L; Gatt, M K; Carmo, N; Balloux, F; Callaini, G; Glover, D M

    2005-12-20

    SAK/PLK4 is a distinct member of the polo-like kinase family. SAK-/- mice die during embryogenesis, whereas SAK+/- mice develop liver and lung tumors and SAK+/- MEFs show mitotic abnormalities. However, the mechanism underlying these phenotypes is still not known. Here, we show that downregulation of SAK in Drosophila cells, by mutation or RNAi, leads to loss of centrioles, the core structures of centrosomes. Such cells are able to undergo repeated rounds of cell division, but display broad disorganized mitotic spindle poles. We also show that SAK mutants lose their centrioles during the mitotic divisions preceding male meiosis but still produce cysts of 16 primary spermatocytes as in the wild-type. Mathematical modeling of the stereotyped cell divisions of spermatogenesis can account for such loss by defective centriole duplication. The majority of spermatids in SAK mutants lack centrioles and so are unable to make sperm axonemes. Finally, we show that depletion of SAK in human cells also prevents centriole duplication and gives rise to mitotic abnormalities. SAK/PLK4 is necessary for centriole duplication both in Drosophila and human cells. Drosophila cells tolerate the lack of centrioles and undertake mitosis but cannot form basal bodies and hence flagella. Human cells depleted of SAK show error-prone mitosis, likely to underlie its tumor-suppressor role.

  1. Cloning, production, and functional expression of the bacteriocin sakacin A (SakA) and two SakA-derived chimeras in lactic acid bacteria (LAB) and the yeasts Pichia pastoris and Kluyveromyces lactis.

    Science.gov (United States)

    Jiménez, Juan J; Borrero, Juan; Diep, Dzung B; Gútiez, Loreto; Nes, Ingolf F; Herranz, Carmen; Cintas, Luis M; Hernández, Pablo E

    2013-09-01

    Mature sakacin A (SakA, encoded by sapA) and its cognate immunity protein (SakI, encoded by sapiA), and two SakA-derived chimeras mimicking the N-terminal end of mature enterocin P (EntP/SakA) and mature enterocin A (EntA/SakA) together with SakI, were fused to different signal peptides (SP) and cloned into the protein expression vectors pNZ8048 and pMG36c for evaluation of their production and functional expression by different lactic acid bacteria. The amount, antimicrobial activity, and specific antimicrobial activity of SakA and its chimeras produced by Lactococcus lactis subsp. cremoris NZ9000 depended on the SP and the expression vector. Only L. lactis NZ9000 (pNUPS), producing EntP/SakA, showed higher bacteriocin production and antimicrobial activity than the natural SakA-producer Lactobacillus sakei Lb706. The lower antimicrobial activity of the SakA-producer L. lactis NZ9000 (pNUS) and that of the EntA/SakA-producer L. lactis NZ9000 (pNUAS) could be ascribed to secretion of truncated bacteriocins. On the other hand, of the Lb. sakei Lb706 cultures transformed with the pMG36c-derived vectors only Lb. sakei Lb706 (pGUS) overproducing SakA showed a higher antimicrobial activity than Lb. sakei Lb706. Finally, cloning of SakA and EntP/SakA into pPICZαA and pKLAC2 permitted the production of SakA and EntP/SakA by recombinant Pichia pastoris X-33 and Kluyveromyces lactis GG799 derivatives although their antimicrobial activity was lower than expected from their production.

  2. Avalik kiri Peeter Puidele / Harald Nurk

    Index Scriptorium Estoniae

    Nurk, Harald, 1918-2014

    1997-01-01

    kommentaare Peeter Puide raamatule "Samuel Brashinskys försvunna vrede" ("Samuel Brashinsky kadunud viha"), mis tekitas Rootsi meedias suurt vastukaja ja millest kirjutas ka Juhan Mägiste 1998. a. Rahvuslikus Kontaktis nr. 1

  3. Peeter Allik, Urmas Viik jt Londonis

    Index Scriptorium Estoniae

    2006-01-01

    Eesti, Läti ja Leedu graafikute näitus "Power and Man. Three Countries. One Exhibition" galeriis Novas Gallery. Eestist osalevad Peeter Allik, Urmas Viik, Jaak Visnap, Kadri Alesmaa, Aili Vahtrapuu, Inga Heamägi

  4. Peeter Sauter kirjutas oma "Printsi ja kerjuse" / Peeter Sauter ; interv. Margus Kasterpalu

    Index Scriptorium Estoniae

    Sauter, Peeter, 1962-

    1999-01-01

    Vabaõhuetendus "Prints ja kerjus" Linnateatri lavaaugus, Mark Twaini romaani ainetel kirjutanud Peeter Sauter, lavastaja Jaanus Rohumaa, kunstnik Mae Kivilo, helilooja Margo Kõlar, osades Indrek Sammul ja Tõnno Linnas

  5. Peeter ei võta lapsi ära / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Vastukaja ajalehes "Eesti Ekspress" 29. märtsil ilmunud artiklile "Peeter Kreitzberg: võtame vaestelt lapsed ära!" ja ajalehes "SL Õhtuleht" ilmunud Imbi Paju artiklile "Põhjala igavus ja Eesti hiilgus"

  6. Osmanlı Devleti’nde Mevlevî Olmayanların Sikke Giymesine Karşı Alınan Önlemler

    Directory of Open Access Journals (Sweden)

    Serdar Ösen

    2013-03-01

    Full Text Available Abstract:Generally known as a coin, sikke has different meanings such as style, law, attitude and decency in Mevlevi order, Morever it is also called a kind of hat worn by Mawlawis. Known as ‘Külah-ı Mevlevî’, sikke took different shapes from the beginning of Mawlawi order until the 19th century. Shapes and forms of sikke were various according the ones who wears them. Wearing sikke completely shows worthiness and privilege. It is a kind of symbol of people making great strides in Mewlewiyeh with patience. Beacuse of its value, dressing it is carried out by the sheikh who accompanies the ceremony.During the reign of Sultan Mahmut II, Esat Pasha, the governor of Konya and previously the governor of Adana, witnessed a lot of people wearing sikke. This study examines the precautions taken by Esat Pasha, the behind reasons of interesting in wearing sikke, and the ban on wearing sikke by those people who were not Mawlawi, together with the ways to put under control those who produced sikke.ÖzetGenel olarak madeni para anlamındaki kullanımıyla bilinen sikke, tarz, kanun, siret ve namus gibi anlamlara da sahip olmakla birlikte Mevlevîlikte Mevlevîlerin başlarına giydikleri başlığa verilen isimdir. Külah-ı Mevlevî’de denilen sikkeler, Mevlevîliğin ilk dönemlerinden 19. yüzyıla gelinceye kadar farklı biçimlere bürünmüştür. Sikkelerin biçimi ve şekilleri giydirilen kişilerin konumlarına göre değişiklik göstermekteydi. Sikke giymek, başlı başına bir liyakat, hak ve mazhariyet idi. Sikke, belli aşamalardan sabırla ve başarıyla geçenlerin nâil olabildikleri bir mevkiinin sembolüdür. Bu anlam ve değerinden dolayı, giydirilmesi de, şeyhin eliyle ve düzenlenen özel törenle gerçekleşirdi.Sultan II. Mahmut döneminde Adana Valisi iken Konya Valiliğine atanan Esat Paşa Konya’ya geldikten bir kaç gün sonra tebdilen yaptığı çarşı pazar gezilerinde Konya sokaklarında başına Mevlevî sikkesi

  7. Peeter I residentsid / Jüri Kuuskemaa

    Index Scriptorium Estoniae

    Kuuskemaa, Jüri, 1942-

    2005-01-01

    Peeter I linnaresidents Tolli t. 4 Tallinnas, maja (1662, 1714) ning lossi- ja pargiansambel (1718, arhitekt Niccolo Michetti, 1923. aasta sügisest ehitusel vastutav Mihhail Zemtsov, stukk Antonio Quadri, Salomon Zeltrecht, Matthias Seidtinger, Heinrich von Bergen, laemaal "Diana ja Aktaion" - Ernst Wilhelm Londicer noorem?, laemaaling merepoolses tiibhoones - Johann Heinrich Fick) Kadriorus. Bibliograafia lk. 454

  8. Nas tak malo... / Peeter Kreitzberg ; interv. Andrei Babin

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Keskerakonna presidendikandidaat Peeter Kreitzberg oma poliitikuteest, ühinemisest EL-i ja NATO-ga, hinnang L. Meri tegevusele, teistest presidendikandidaatidest. Autor: Keskerakond. Parlamendisaadik

  9. Osmanlı Devleti’nde Mevlevî Olmayanların Sikke Giymesine Karşı Alınan Önlemler / Precautions Taken Against The Sikke Wearing People Who Were not Mawlawi in The Ottoman Period

    Directory of Open Access Journals (Sweden)

    Serdar Ösen

    2013-03-01

    Full Text Available Abstract: Generally known as a coin, sikke has different meanings such as style, law, attitude and decency in Mevlevi order, Morever it is also called a kind of hat worn by Mawlawis. Known as ‘Külah-ı Mevlevî’, sikke took different shapes from the beginning of Mawlawi order until the 19th century. Shapes and forms of sikke were various according the ones who wears them. Wearing sikke completely shows worthiness and privilege. It is a kind of symbol of people making great strides in Mewlewiyeh with patience. Beacuse of its value, dressing it is carried out by the sheikh who accompanies the ceremony. During the reign of Sultan Mahmut II, Esat Pasha, the governor of Konya and previously the governor of Adana, witnessed a lot of people wearing sikke. This study examines the precautions taken by Esat Pasha, the behind reasons of interesting in wearing sikke, and the ban on wearing sikke by those people who were not Mawlawi, together with the ways to put under control those who produced sikke. Özet Genel olarak madeni para anlamındaki kullanımıyla bilinen sikke, tarz, kanun, siret ve namus gibi anlamlara da sahip olmakla birlikte Mevlevîlikte Mevlevîlerin başlarına giydikleri başlığa verilen isimdir. Külah-ı Mevlevî’de denilen sikkeler, Mevlevîliğin ilk dönemlerinden 19. yüzyıla gelinceye kadar farklı biçimlere bürünmüştür. Sikkelerin biçimi ve şekilleri giydirilen kişilerin konumlarına göre değişiklik göstermekteydi. Sikke giymek, başlı başına bir liyakat, hak ve mazhariyet idi. Sikke, belli aşamalardan sabırla ve başarıyla geçenlerin nâil olabildikleri bir mevkiinin sembolüdür. Bu anlam ve değerinden dolayı, giydirilmesi de, şeyhin eliyle ve düzenlenen özel törenle gerçekleşirdi. Sultan II. Mahmut döneminde Adana Valisi iken Konya Valiliğine atanan Esat Paşa Konya’ya geldikten bir kaç gün sonra tebdilen yaptığı çarşı pazar gezilerinde Konya sokaklarında başına Mevlev

  10. Obmen ljubeznostjami / Arnold Rüütel, Peeter Kreitzberg

    Index Scriptorium Estoniae

    Rüütel, Arnold

    2001-01-01

    Presidendikandidaadid Rüütel ja Kreitzberg presidendivalimistega kaasnevatest pingetest. Refereeritud Arnold Rüütli intervjuud "Rüütel: Rahvaliit ei karda Kreitzbergi konkurentsi" ja Peeter Kreitzbergi intervjuud "Peeter Kreitzberg: Reeturlik Rahvaliit ootas kerget saaki", Eesti Päevaleht (2001/Aug/30)

  11. Architects Urmas Muru and Peeter Pere / Urmas Muru, Peeter Pere ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    Muru, Urmas, 1961-

    2009-01-01

    Arhitektide Urmas Muru ja Peeter Perega nende arhitektuurini jõudmise juhuslikkusest, lemmiktegevusest, tööst Tööstusprojektis, tegelemisest kunstiga (maalikunst, installatsioon, arhitektuurne joonistamine, performance`id), büroo Muru & Pere töödest, fassaadide viimistlusest, materjalidest, säästmisest

  12. PENGARUH PEMBELAJARAN AKUNTANSI BERBASIS SAK IFRS DAN SELF-EFFICACY TERHADAP KESIAPAN MAHASISWA MENJADI GURU AKUNTANSI

    Directory of Open Access Journals (Sweden)

    Raeni Raeni

    2013-06-01

    Full Text Available The research was inspired by students’ readiness to be Accounting teachers with the rapid progress of science and technology and also free-market for workers. The objective of the study was to test the influence of Accounting learning based on SAK IFRS and self-efficacy toward students’ readiness to be Accounting teachers. The population of the research were Accounting education students in classess of 2010 until 2012. Thus, it used proportionate stratified random sampling. The respondents were 85 students in class 2010, 123 students in class 2011 and 154 students in class 2012. Then, the data were analyzed by percentage descriptive and doubled linear regression. The result of regression analysis showed that 1 Accounting learning based on SAK IFRS and self-efficacy contibuted positively and significantly for 52.4% toward students’ readiness to be Accounting students, 2 there was a positive and significant influence of Accounting learning based on SAK IFRS for 26.2% toward students’ readiness to be Accounting teachers, 3 there was a positive and significant influence of self-efficacy for 16.32% toward students’ readiness to be Accounting teachers. The familiarity level for learning Accounting based on SAK IFRS was high with the progress of science and technology and also full adoption from IFRS.

  13. PENGARUH PEMBELAJARAN AKUNTANSI BERBASIS SAK IFRS DAN SELF-EFFICACY TERHADAP KESIAPAN MAHASISWA MENJADI GURU AKUNTANSI

    Directory of Open Access Journals (Sweden)

    Raeni Raeni

    2016-01-01

    Full Text Available The research was inspired by students’ readiness to be Accounting teachers with the rapid progress of science and technology and also free-market for workers. The objective of the study was to test the influence of Accounting learning based on SAK IFRS and self-efficacy toward students’ readiness to be Accounting teachers. The population of the research were Accounting education students in classess of 2010 until 2012. Thus, it used proportionate stratified random sampling. The respondents were 85 students in class 2010, 123 students in class 2011 and 154 students in class 2012. Then, the data were analyzed by percentage descriptive and doubled linear regression. The result of regression analysis showed that 1 Accounting learning based on SAK IFRS and self-efficacy contibuted positively and significantly for 52.4% toward students’ readiness to be Accounting students, 2 there was a positive and significant influence of Accounting learning based on SAK IFRS for 26.2% toward students’ readiness to be Accounting teachers, 3 there was a positive and significant influence of self-efficacy for 16.32% toward students’ readiness to be Accounting teachers. The familiarity level for learning Accounting based on SAK IFRS was high with the progress of science and technology and also full adoption from IFRS.

  14. Tuuritav Peeter Võsa : Ma ei mõista, kuidas kaks naabrit teineteisele s***a loobivad! / Peeter Võsa ; interv. Rainer Kerge

    Index Scriptorium Estoniae

    Võsa, Peeter, 1967-

    2007-01-01

    Peeter Võsa Võsa tuur 2007 : "Võsa Pets paneb asjad paika!". Intervjuu teemad - Peeter Võsa on politseiga riius; õnnelik, et ei pääsenud Riigikokku; mõtleb "Võsareporteri" tulevikust ja muustki

  15. Steven Spielberg hädas Peeter Paaniga / Timo Diener

    Index Scriptorium Estoniae

    Diener, Timo

    2004-01-01

    Steven Spielbergi raskused J.M. Barrie "Peeter Paani" ekraniseerimisel, tulemuseks mängufilm "Hook" : Ameerika Ühendriigid 1991. Järgneb 16. aug. 2004, lk. 38 pealkirja all "Rahulolematu Steven Spielberg"

  16. Estonian Society and Political Pictures : 6 Case Studies / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2002-01-01

    Kuus lugu Eesti dokumentaal- ja poliitilisest fotograafiast - põgenemine Läände, eestlased Teises maailmasõjas, Jüri Liimi fotod 1990. aastatest, Carl Sarapi ja Peeter Toominga fotolood, Marko Laimre "Jaotatud territooriumid"

  17. Peeter ja Marta / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare

    2004-01-01

    Omaaegse Eesti Noorsoo Kasvatuse Seltsi tütarlaste gümnaasiumi juhatajast Peeter Põllust ja Marta Sillaotsast, keda P. Põld 1912. a. kutsus tööle oma õppeasutuse inspektrissiks ehk koolijuhataja abi ametisse

  18. Sakīna: contribución a su estudio

    Directory of Open Access Journals (Sweden)

    Tornero, Emilio

    2013-06-01

    Full Text Available This article explores the postkoranic evolution of the term sakīna. First, it examines what previous research has said about that. It then presents, translates, and analizes five texts—which had not been taken into consideration previously— pertaining to the Islamic and philosophical fields in which this term occurs. The texts have been taken from Ibn Ḥabīb, al-Tawḥīdī, the Arabic translation of the Golden Verses, and the two Commentaries on the Golden Verses attributed respectively to Iamblichus and Proclus. The article shows how the Koranic sakīna has evolved in these texts: it connotes pacification of violent animals in Ibn Habib, in al-Tawhidi it denotes a state close to Divinity of characters similar to Sufis: in the Golden Verses, the term sakīna is used to translate daímōn, thanks to which evils originating from innate discord among humans are eliminated; finally, the Commentaries on the Golden Verses contain explanations of this term that are both religious and rationalist.Estudio del término sakīna en su evolución postcoránica en el que se muestra, en primer lugar, lo que la investigación ha dicho sobre él, para, a continuación, presentar, traducir y analizar cinco textos pertenecientes al ámbito islámico y al filosófico en donde aparece dicho término y que no habían sido tenidos en cuenta hasta ahora. Estos textos proceden de: Ibn Ḥabīb, al-Tawḥīdī, traducción árabe de los Versos áureos, y Comentarios de Jámblico y de Proclo a estos Versos áureos. La sakīna coránica evoluciona en estos autores pasando a connotar una pacificación en los animales violentos en Ibn Habib y un estado cercano a la divinidad de caracteres próximos al de los sufíes en al-Tawhidi, mientras que en los Versos áureos se emplea sakīna para traducir daímōn, con sus efectos de eliminación de los males originados por la discordia innata a los hombres. En los Comentarios a los Versos áureos se dan explicaciones, de

  19. PEMAHAMAN GURU AKUNTANSI TENTANG SAK-ETAP, PRESTASI BELAJAR DAN PENYERAPAN LULUSAN SESUAI BIDANG AKUNTANSI: BUKTI EMPIRIS DARI KOTA MADIUN

    Directory of Open Access Journals (Sweden)

    Muji Rahayu

    2015-10-01

    Full Text Available Penelitian ini bertujuan untuk menguji pengaruh pamahaman guru akuntansi tentang SAK-ETAP terhadap prestasi belajar yang pada akhirnya mempengaruhi penyerapan lulusan sesuai bidang akuntansi. Dengan menggunakan sampel 64 persepsi guru akuntansi se-kota Madiun, hasil pengujian regresi berganda menunjukkan bahwa pemahaman guru akuntansi tentang SAK-ETAP berpengaruh signifikan terhadap prestasi belajar siswa yang pada akhirnya mempengaruhi penyerapan lulusan sesuai bidang akuntansi.

  20. A Myb transcription factor of Phytophthora sojae, regulated by MAP kinase PsSAK1, is required for zoospore development.

    Directory of Open Access Journals (Sweden)

    Meng Zhang

    Full Text Available PsSAK1, a mitogen-activated protein (MAP kinase from Phytophthora sojae, plays an important role in host infection and zoospore viability. However, the downstream mechanism of PsSAK1 remains unclear. In this study, the 3'-tag digital gene expression (DGE profiling method was applied to sequence the global transcriptional sequence of PsSAK1-silenced mutants during the cysts stage and 1.5 h after inoculation onto susceptible soybean leaf tissues. Compared with the gene expression levels of the recipient P. sojae strain, several candidates of Myb family were differentially expressed (up or down in response to the loss of PsSAK1, including of a R2R3-type Myb transcription factor, PsMYB1. qRT-PCR indicated that the transcriptional level of PsMYB1 decreased due to PsSAK1 silencing. The transcriptional level of PsMYB1 increased during sporulating hyphae, in germinated cysts, and early infection. Silencing of PsMYB1 results in three phenotypes: a no cleavage of the cytoplasm into uninucleate zoospores or release of normal zoospores, b direct germination of sporangia, and c afunction in zoospore-mediated plant infection. Our data indicate that the PsMYB1 transcription factor functions downstream of MAP kinase PsSAK1 and is required for zoospore development of P. sojae.

  1. Introduction of flocculation into industrial yeast, Saccharomyces cerevisiae saké, by protoplast fusion

    OpenAIRE

    Lima, Nelson; MOREIRA, C.; Teixeira, J. A.; M. Mota

    1995-01-01

    Protoplast fusion was applied to obtain intraspecific fusion in yeast strains in order to overcome restrictions imposed by the natural mating system. Acriflavine was used to construct petite mutants from non-flocculent industrial Saccharomyces cerevisiae saké strain. UV radiation was used to construct ura- mutants from a respiratory competent and highly flocculent S. cerevisiae NCYC869 strain. Fusion products were selected by complementation on minimal medium. The frequency of appearance of p...

  2. Kompuroiden korporatismissa, : Eheytyneen SAK:n ristipaineet suomalaisessa korporatismissa 1968-1978

    OpenAIRE

    Savtschenko, Ritva

    2015-01-01

    Summary The study takes a look at the factors that influenced the operating culture of the Central Organization of Finnish Trade Unions (SAK) during the first decade of incomes policy from the point of view of corporatism. The effects of the corporatist system are studied from the perspective of co-operation, resistance and democracy. The theoretical part looks at the relationship between the theory of corporatism and the trade union movement. The empirical part looks at the effect of th...

  3. OP U WOORD SAL EK DIE NET LAAT SAK".* Gemeente van Jesus ...

    African Journals Online (AJOL)

    Test

    Sy lof te sing, is dit mooi, al rys die lofsang ook nie by almal uit die diepte van die hart nie. Dit is nog geen rede om ontmoedig te word nie. Waar die net laat sak word en vol vis is as hy opgetrek word, is dit 'n heerlike werk. Mag dit gebeur dat die net minder inhou as wat ons graag wil sien of as wat ons verwag, dan nog mag ...

  4. Täienduskoolitus / Malle Saks, Terje Varul, Helin Puksand, Marje Kuslap

    Index Scriptorium Estoniae

    2008-01-01

    Küsimustele: mis (või kes) pani teid laste kõrval ka kolleege harima, kuidas te ennast selles rollis tunnete ja mida see teile kui õpetajale andnud on, millist koolitust ise kõige rohkem vajaksite ja/või milline tore koolitatava-kogemus kõigepealt meenub? - vastavad täienduskoolituse lektorid: Tartu Erakooli matemaatikaõpetaja M. Saks, Kolga Keskkooli eesti keele ja kirjanduse õpetaja T. Varul, Tallinna Mustamäe Gümnaasiumi emakeeleõpetaja ja logopeed H. Puksand, Rakvere Eragümnaasiumi klassiõpetaja M. Kuslap

  5. Maakodu võimalused tuleviku linnas / Peeter Riba

    Index Scriptorium Estoniae

    Riba, Peeter, 1967-

    2005-01-01

    Ajakirjanik Peeter Riba oma 1904. a. Tähtvere vallas Tartumaal ehitatud talumaja renoveerimisest ja restaureerimisest ning viljapuuaia noorendamisest. Majas on eestiaegne mööbel, orientaalseid asju, aias on kasutatud maakive, väravate tegemisel pajuoksi. 10 värv. ill

  6. Peeter Simmi uus film jõuab kinno

    Index Scriptorium Estoniae

    2006-01-01

    Tallinna, Tartu ja Pärnu kinodes linastub homsest Eesti-Saksa koostööfilm "Kõrini" : režissöör Peeter Simm : osades Maarja Jakobson, Rasmus Kaljujärv, Heio von Stetten, Thomas Schmauser : Ruut Pictures (Eesti) - Saxonia Film (Saksa) 2005

  7. SmSak, the second Polo-like kinase of the helminth parasite Schistosoma mansoni: conserved and unexpected roles in meiosis.

    Directory of Open Access Journals (Sweden)

    Thavy Long

    Full Text Available Polo-like kinases (Plks are a family of conserved regulators of a variety of events throughout the cell cycle, expanded from one Plk in yeast to five Plks in mammals (Plk1-5. Plk1 is the best characterized member of the Plk family, homolog to the founding member Polo of Drosophila, and plays a major role in cell cycle progression by triggering G2/M transition. Plk4/Sak (for Snk (Serum-inducible kinase akin kinase is a unique member of the family, structurally distinct from other Plk members, with essential functions in centriole duplication. The genome of the trematode parasite Schistosoma mansoni contains only two Plk genes encoding SmPlk1 and SmSak. SmPlk1 has been shown already to be required for gametogenesis and parasite reproduction. In this work, in situ hybridization indicated that the structurally conserved Plk4 protein, SmSak, was largely expressed in schistosome female ovary and vitellarium. Expression of SmSak in Xenopus oocytes confirmed its Plk4 conserved function in centriole amplification. Moreover, analysis of the function of SmSak in meiosis progression of G2-blocked Xenopus oocytes indicated that, in contrast to SmPlk1, SmSak cannot induce G2/M transition in the absence of endogenous Plk1 (Plx1. Unexpectedly, meiosis progression was spontaneously observed in Plx1-depleted oocytes co-expressing SmSak and SmPlk1. Molecular interaction between SmSak and SmPlk1 was confirmed by co-immunoprecipitation of both proteins. These data indicate that Plk1 and Plk4 proteins have the potential to interact and cross-activate in cells, thus attributing for the first time a potential role of Plk4 proteins in meiosis/mitosis entry. This unexpected role of SmSak in meiosis could be relevant to further consider the function of this novel Plk in schistosome reproduction.

  8. Sotsiaaldemokraatia on tõusev trend / Peeter Kreitzberg ; interv. Olari Koppel

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2004-01-01

    Parlamendiliige Peeter Kreitzberg oma teest poliitikasse, hinnangust valitsuse haridusreformile, presidendiks kandideerimisest, Keskerakonna ja tema liidri Edgar Savisaare poliitikast, sotsiaalliberaalidest, Eesti erakondade tulevikust

  9. Mis saab ESTERMist? / Tiina Soon, Peeter Päll, Ivi Papstel ; interv. Aili Künstler

    Index Scriptorium Estoniae

    Soon, Tiina

    2008-01-01

    Eesti Õiguskeskuse loodud andmebaasist ESTERM. Vastavad EKI terminoloogiaosakonna juhataja Tiina Soon, EKI keelekorraldusosakonna vanemteadur Peeter Päll, Justiitsministeeriumi avalike suhete talituse juhataja Ivi Papstel

  10. Peeter Suure sadam. Uus sõjasadam Tallinnas / Robert Treufeldt

    Index Scriptorium Estoniae

    Treufeldt, Robert, 1965-

    2015-01-01

    Pärast Jaapani sõda otsustati rajada Läänemere tähtsuselt teine laevastikubaas Tallinna. Muul ja selle ehituslinnak olid tõenäoliselt esimesed, mida sõjasadamas rajama hakati. 12. juulil 1912 korraldati seal sõjasadama nurgakivi panek. Kohale saabunud keiser Nikolai II paigaldas oma käega põhjakivi ja nimetas uue laevastikubaasi Peeter Suure Sadamaks. Elamislinnakust, miinisadamast, karavanisadamast, remondisadamast, lennusadamast jm.

  11. Peeter I majamuuseumi uus elu / Jüri Kuuskemaa

    Index Scriptorium Estoniae

    Kuuskemaa, Jüri, 1942-

    2005-01-01

    Hoone ajaloost, 2004. a. läbiviidud korrastustöödest, leidudest, muudatustest. Suuremas keldris eksponeeritakse skulptuure (Salomon Zeltrechti ja tema abiliste poolt aastail 1723-29 tehtud kivibüstid, August Weizenbergi portreebüst Peeter I-st). Projekt: OÜ Inrestauraator. Teostus: AS Tarrest. Muinsuskaitseline järelevalve: Linnaehituse AS. Barokkmööbli restaureeris Rein Laur. Ill.: välisvaade, 3 sisevaadet

  12. Kes saab kuningriigi ja pool printsessi? / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2005-01-01

    Sotsiaalliberaal Peeter Kreitzberg analüüsib praegu Tallinna võimukoalitsioonis toimuvat ning leiab, et praeguse olukorra jätkudes Reformierakond oma reitingut ei säilita ja et Keskerakonna eesmärk on ka võimuvahetus Toompeal. Autori sõnul on nii Res Publicat kui ka Keskerakonda häirinud pidevalt mure sotsiaalliberaalide võimu pärast Riigikogus

  13. PÖFF zakrojetsa filmom "Dostalo!" / Peeter Simm ; interv. Eteri Kekelidze

    Index Scriptorium Estoniae

    Simm, Peeter, 1953-

    2005-01-01

    IX PÖFFil esilinastub Eesti-Saksa koostööfilm "Kõrini" : stsenaristid Valentin Kuik, Peeter Simm, Hans Werner Honert, Thomas Steinke : režissöör Peeter Simm : operaator Rein Kotov : Ruut Pictures (Eesti) - Saxonia Film (Saksa) 2005

  14. Mille üle vaieldakse Eesti hariduses? / Peeter Kreitzberg ; vahendas Sirje Tohver

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Peeter Kreitzbergi kõne 24.-27.05.2001 Tallinna Pedagoogikaülikooli ja Haridusfoorumi korraldatud EFFE (European Forum for Freedom in Education) konverentsil Tallinnas : Eesti hariduse arengu olulisematest küsimustest

  15. Priit Pääsukese "Must Peeter" püüab aasta filmi tiitlit

    Index Scriptorium Estoniae

    2008-01-01

    Eesti Filmiajakirjanike Ühing (EFÜ) nimetas 2008.a. filmi auhinna nominendid : Mait Laasi "Aja meistrid", Priit ja Olga Pärna "Elu ilma Gabriella Ferrita", Kadri Kõusaare "Magnus", Priit Pääsukese "Must Peeter", Marko Raadi "Toomiku film"

  16. The Moscow Times kajastab Peeter Simmi filmi "Georg" valmimist / Ave Randviir

    Index Scriptorium Estoniae

    Randviir, Ave, 1981-

    2006-01-01

    Seoses sellega, et Peeter Simmi mängufilmi "Georg" võtted toimusid ka Moskvas, kirjutas ajakirjanik Aleksander Braterski pikemalt ka Georg Otsast ning P. Simm räägib samas ka oma filmi kontseptsioonist

  17. Kuidas ohjeldada netikommentaatoreid? / Mart Laanpere, Peeter Normak, Jaanus Lillenberg, Kristi Kasper-Semidor

    Index Scriptorium Estoniae

    2010-01-01

    Küsimusele vastavad TLÜ haridustehnoloogia keskuse juhataja Mart Laanpere, TLÜ informaatika instituudi direktor Peeter Normak, Postimees Online’i arendus- ja turundusjuht Jaanus Lillenberg ja haridusveebi Koolielu toimetaja Kristi Kasper-Semidor

  18. Uus raadiojaam tuleb venekeelne / Rasmus Rekand ; kommenteerinud Peeter Sookruus ja Ilmar Kompus

    Index Scriptorium Estoniae

    Rekand, Rasmus

    2010-01-01

    Tartu raadiosageduse 101,2 MHz ringhäälinguluba anti AS-le Taevaraadio, kes hakkab edastama venekeelset raadioprogrammi. Kommentaarid kultuuriministeeriumi esindajalt Peeter Sookruusilt ja Sky Media juhatajalt Ilmar Kompuselt

  19. Toit ja restoran peavad rääkima sama lugu / Peeter Pihel ; intervjueerinud Priit Pruul

    Index Scriptorium Estoniae

    Pihel, Peeter

    2015-01-01

    Intervjuu Rootsi parima restorani Fäviken Magasineti sous chef'i ehk peakoka parema käe Peeter Piheliga olulisest tänapäeva restoranide kommunikatsioonis, kommunikatsiooni korraldusest Fäviken Magasinetis

  20. Millise tuleviku You Tube meile toob? / Peeter Marvet ; interv. Pullerits, Priit

    Index Scriptorium Estoniae

    Marvet, Peeter, 1970-

    2008-01-01

    Tehnokratina tuntud Peeter Marvet, uue meedia juhtiv asjatundja Eestis, on viimastel aastatel jälginud noorte ja internetiga toimuvat kogu maailmas, mistõttu Postimees palus tema hinnangut, milline võiks olla veebi roll Soome koolimõrvades

  1. Noor filoloog uuris karupoeg Puhhi ja Peeter Paani seiklusi / Anu Mõistlik

    Index Scriptorium Estoniae

    Mõistlik, Anu, 1980-

    2003-01-01

    Maarit Maimetsa bakalaureusetöö uurib kolme inglise lasteraamatu fantaasiaelemente: Lewis Carrolli "Alice imedemaal", James Matthew Barrie' "Lood Peeter Paanist" ja Alan Alexander Milne'i "Jutustus karupoeg Puhhist"

  2. Visuaalantropoloogia - inimlik mõõde asjade maailmas / Jay Ruby ; interv. Peeter Linnap

    Index Scriptorium Estoniae

    Ruby, Jay

    2006-01-01

    Ameerika visuaalkultuuri teoreetik Jay Ruby on paari viimase aastakümne jooksul keskendunud pildilise kommunikatsiooni etnograafilisele käsitlemisele Ameerika maaühiskonnas. Peeter Linnapi intervjuu Jay Rubyga Tartu Kõrgemas Kunstikoolis 23. V

  3. Suur Peeter ja väike Piret sõidavad Pariisi

    Index Scriptorium Estoniae

    2008-01-01

    IBBY-France valis Euroopa kultuuridevahelise dialoogi aastat tähistavale näitusele "Ringreis Euroopas läbi 27 pildiraamatu" Eestit esindama Peeter Volkonski ja Piret Raua lasteraamatu "Onu Volgi värsiraamat"

  4. Rõõmus jõulukoosviibimine New Yorgi Eesti Majas / Airi Vaga ; fotod: Peeter Teedla

    Index Scriptorium Estoniae

    Vaga, Airi, 1940-

    2006-01-01

    New Yorgi Eesti Haridusseltsi korraldusel, tervitused ütles seltsi esimees Peeter Teedla, järgnes palvus, sõnavõtt ja New Yorgi Eesti Naiskoori esinemine, õhtu solist oli sopran Mariliina Vilimaa.

  5. Kolmapäeval esietendub Peeter Jalaka "Võluflööt"

    Index Scriptorium Estoniae

    2006-01-01

    8. märtsil esietendub Von Krahli Teatris W. A. Mozarti "Võluflööt" uues versioonis. Lavastuse muusika on W. A. Mozartilt, kontseptsioon ja lavastus Peeter Jalakalt, tantsude seade Sasha Pepeljajevilt

  6. Kunstiteoste tellimise seadus lõpusirgel / Peeter Kreitzberg ; intervjueerinud Reet Varblane

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2010-01-01

    Kunstiteoste tellimise seaduseelnõu esimene lugemine riigikogus oli 19. mail. Riigikogu kultuurikomisjoni esimees Peeter Kreitzberg Eesti Kunstnike Liidu parandusettepanekutest ja ettepanekutest, millised komisjon võttis enne seaduseelnõu teisele lugemisele saatmist arvesse

  7. Evaluation of a Victim-Centered, Trauma-Informed Victim Notification Protocol for Untested Sexual Assault Kits (SAKs).

    Science.gov (United States)

    Campbell, Rebecca; Shaw, Jessica; Fehler-Cabral, Giannina

    2018-03-01

    Throughout the United States, hundreds of thousands of sexual assault kits (SAKs) have not been submitted by the police for forensic DNA testing, which raises complex issues regarding how victims ought to be notified about what happened to their kits. In this project, we evaluated a victim-centered, trauma-informed victim notification protocol that was implemented in Detroit, Michigan. Most victims (84%) did not have a strong negative emotional reaction to notification, and most (57%) decided to reengage with the criminal justice system. Victims of nonstranger sexual assaults were less likely to reengage postnotification compared with victims of stranger rape.

  8. Hirmu pildid : puuduvatest valdkondadest Eesti visuaalkultuuris / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2007-01-01

    Pildid, mis tekitavad hirmu. Kontroll informatsiooni üle ja selle filtreerimine. Eesti pildihirmu spetsiifikast. 19 sajand - algus visuaalsele peitemängule Eestis. Ühiskondliku ebavõrdsuse varjamisest ja kuvamisest Eestis. 1940. aastate õudused: eestlaste suurim diasporaa pildis. Karl Nikolai Hintzeri ja Donald Koppeli sõjafotodest. Sööst tundmatusse: Eric Soovere põgenemisfotod 1944-1949. Küüditamise fotod: Ants Leitmäe Siber 1949-1959. Metsavendade fotod. 1990. aastate algus - selge pilgu naasmine kujutamisse. Kollektiivse kaotuse trauma Peeter Toominga/Carl Sarapi projektis "55 aastat hiljem" (1937/1992). Jüri Liimi lõpukaadrid ENSVst (1990-1992). Hirmu pildid skoopilise kontrolli ajastul - pronksiöö paradoksaalseid kuvandeid 2007.a. Järgneb 2007, nr. 26, lk. 30-35

  9. Jõhvi kiriku eelmise altari küljes kuni aastani 1900 olnud Balti aadli vapid on taastatud ja kirikusaali seintele kinnitatud / Peeter Kaldur

    Index Scriptorium Estoniae

    Kaldur, Peeter

    2005-01-01

    29. IX vapid õnnistati, avati vappide osadega vitriinid. Vappide avamisele eelnenud konverentsil tutvustas vappe Vallo Reimaa, Porkuni linnusest rääkis Jevgeni Kaljundi, Jõhvi kiriku orelist Peeter Kaldur, E. Bornhöhe Jõhvi perioodist Peeter Olesk

  10. Ettevalmistustööd Vabaduse platsil oleva Peeter I ausamba äraviimiseks. Foto on tehtud 29. aprilli päeval 1922. a.

    Index Scriptorium Estoniae

    2007-01-01

    Eesti Filmiarhiivi fotokogu foto, mis on tehtud 29. aprilli päeval 1922. a., kui tehti ettevalmistustöid Vabaduse platsil oleva Peeter I ausamba äraviimiseks. Peeter I kuju oli püstitatud 1910. aastal

  11. A new transcription factor for mitosis: in Schizosaccharomyces pombe, the RFX transcription factor Sak1 works with forkhead factors to regulate mitotic expression.

    Science.gov (United States)

    Garg, Angad; Futcher, Bruce; Leatherwood, Janet

    2015-08-18

    Mitotic genes are one of the most strongly oscillating groups of genes in the eukaryotic cell cycle. Understanding the regulation of mitotic gene expression is a key issue in cell cycle control but is poorly understood in most organisms. Here, we find a new mitotic transcription factor, Sak1, in the fission yeast Schizosaccharomyces pombe. Sak1 belongs to the RFX family of transcription factors, which have not previously been connected to cell cycle control. Sak1 binds upstream of mitotic genes in close proximity to Fkh2, a forkhead transcription factor previously implicated in regulation of mitotic genes. We show that Sak1 is the major activator of mitotic gene expression and also confirm the role of Fkh2 as the opposing repressor. Sep1, another forkhead transcription factor, is an activator for a small subset of mitotic genes involved in septation. From yeasts to humans, forkhead transcription factors are involved in mitotic gene expression and it will be interesting to see whether RFX transcription factors may also be involved in other organisms. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

  12. Hinnatuima ajakirjandusauhinna võitis Peeter Raidla / Raimo Ülavere

    Index Scriptorium Estoniae

    Ülavere, Raimo, 1970-

    2006-01-01

    Äripäeva ajakirjanik Peeter Raidla võitis Ain Hanschmidti rikastumist kajastava artikli eest Bonnieri uuriva ajakirjanduse preemia. Vt. samas: Bonnieri uuriva ajakirjanduse preemia võitjad; Peeter Raidla - staazhikas uuriv ajakirjanik; Parim uudis ja olemuslugu Postimehe ajakirjanikelt; Gert D. Hankewitz. Raidla: ma ei mõelnud lugu kirjutades auhinnale; Erik Prozes. Aasta parimad pressifotod tegid Äripäeva fotograafid; Parim maakonnauudis rääkis Kohtla-Järve suurettevõtjast; Parima kujundusega on SL Õhtuleht

  13. Peeter Saul pakub retsepti, kuidas vältida vikatimeest / Eve Heinla

    Index Scriptorium Estoniae

    Heinla, Eve, 1966-

    2008-01-01

    Eesti inimarengu 2007. aasta aruande järgi on eestlase keskmine eluiga lühike. Kommenteerivad Tallinna Ülikooli professor Mati Heidmets, perearst Madis Tiik, meestearst Margus Punab, Riigikogu sotsiaalkomisjoni esimees Heljo Pikhof ja dirigent Peeter Saul. Lisaks tabel: Keskmine oodatav eluiga Euroopa riikides

  14. Keelduvast liikumisest. I-III / Sergei Eisenstein ; tõlk. Peeter Raudsepp

    Index Scriptorium Estoniae

    Eisenstein, Sergei, 1898-1948

    2007-01-01

    Käsitlusi Vsevolod Meierholdi biomehaanikast (näitlejate treeningsüsteem). Lisaks tõlkija Peeter Raudsepa eessõna. Tõlgitud raamatust "Sergei Eizenstein. Izbrannõje proizvedenija v shesti tomahh. Tom 4", Moskva, 1966. Kolmandas osas katkend artiklist "Biomechanics: Understanding Meyerhold's System of Actor Training". Tõlgitud väljaandest "Movement for Actors"

  15. Vikergallup : eesti kirjandus 2012 / Vahur Afanasjev, Joanna Ellmann, Peeter Helme ... [jt.

    Index Scriptorium Estoniae

    2013-01-01

    Erinevate kriitikute arvamus 2012. aastal Eestis ilmunud nüüdiskirjandusest. Aasta parimaks uudisteoseks nimetati Peeter Sauteri "Märkmeid vaeste kirjanike majast", parimaks debüüdiks Mait Vaigu luulekogu "Kõigil on alati õigus", parimaks tõlkeraamatuks Georges Pereci romaan "Elu, kasutusjuhend" ja Pentti Saarikoski koondkogu "Luuletused"

  16. Peeter Jalakas : Elamine on väga isiklik asi / Anu Aaremäe

    Index Scriptorium Estoniae

    Aaremäe, Anu

    2007-01-01

    Stephen Hawkingi raamatu "A Brief History of Time" aineline lavastus "Õnne valem", helilooja Gavin Bryars, autor ja lavastaja Peeter Jalakas, Tallinna tollilaos. Von Krahli Teatri lavastaja etenduse sünnist, endast, ökoloogilisest mõtlemisest, teatri tulevikuplaanidest

  17. Vzgljanuv na sebja objektivno i zhestko / Peeter Simm ; interv. Ella Agranovskaja

    Index Scriptorium Estoniae

    Simm, Peeter, 1953-

    2007-01-01

    Anapas SRÜ ja Baltimaade XV avatud filmifestivalil "Kinoshokk 2006" peapreemia saanud Peeter Simmi mängufilmil "Kõrini!" on esitatud Venemaa filmiauhinnale "Nike". Filmi sünniloost, koostööst stsenarist-produtsent Hans-Werner Honertiga ja muust

  18. Ekspert Peeter Torop : Lihula mälestussammas pole natslik / Kadri Paas

    Index Scriptorium Estoniae

    Paas, Kadri, 1982-

    2004-01-01

    Politsei tellis Lihula mälestusmärgi ekspertiisi Tartu Ülikooli semiootikaprofessorilt Peeter Toropilt, kes ei leidnud mälestusmärgilt ühtki natsliku sümboolika tunnust. Vt. samas: Siim Randla. Politsei jätab ekspertiisi tulemused enda kasutada; Valitsus jääb Lihula suhtes oma arvamuse juurde

  19. Peeter Kreitzberg välistab koostöö reformiparteiga / Toomas Sildam

    Index Scriptorium Estoniae

    Sildam, Toomas, 1961-

    2003-01-01

    Peeter Kreitzberg nimetab ERL-i valitsusest lahkumise otsust arusaadavaks. Ta ei välista, et pärast Res Publica ja Reformierakonna vähemusvalitsuse lagunemist moodustub koalitsioon, kuhu võivad kuuluda mis tahes erakonnad, aga mitte Reformierakond

  20. Kunst on vaimu avardumise üks keskseid koldeid / Peeter Maria Laurits ; interv. Laura Kuusk

    Index Scriptorium Estoniae

    Laurits, Peeter, 1962-

    2006-01-01

    Peeter Laurits oma loomingust, näitustest "Voolav labürint" (koostöö Katzi ja Hollandi Pavlov Medialabiga) SEB Ühispanga galeriis, "Meistriteoste varjus" (koos Laurentsiusega) Kadrioru Kunstimuuseumis, isikunäitusest "Vana labürint" ArtDepoos, autorikaitsest jm.

  1. "Dostali!" - s segodnjashnego dnja / Peeter Simm, Artur Talvik ; interv. Boris Tuch

    Index Scriptorium Estoniae

    Simm, Peeter, 1953-

    2006-01-01

    Tallinnas ning Tartu ja Pärnu kinodes esilinastub Eesti-Saksa koostööfilm "Kõrini" : režissöör Peeter Simm : osades Maarja Jakobson, Rasmus Kaljujärv, Heio von Stetten, Thomas Schmauser : Ruut Pictures (Eesti) - Saxonia Film (Saksa) 2005

  2. Stenbocki maja rekonstrueerimine : Eesti Vabariigi Valitsuse ja Riigikantselei hoone / Peeter Tambu

    Index Scriptorium Estoniae

    Tambu, Peeter

    2000-01-01

    Arhitektuurne projekt: Kalle Rõõmus AB. Arhitekt Ülle Orav. Sisekujundus: Vaikla Stuudio, sisekujundajad Ain Koit, Raja Gonestov, Angeelika Pärna, Peeter Tambu, Argo Vaikla, Katrin Vaikla. Konstruktiivne osa: ESP. Arhitektuuriajaloolised eritingimused Rasmus Kangropool, eksperdid Mart Kalm, Leila Pärtelpoeg. Hoone ajaloost. Arhitektuurne ja sisekujundusprojekt, ehitus 1996-2000, sisustusprojekt 2000. 8 ill

  3. The Aspergillus fumigatus SchASCH9 kinase modulates SakAHOG1 MAP kinase activity and it is essential for virulence

    Science.gov (United States)

    Alves de Castro, Patrícia; dos Reis, Thaila Fernanda; Dolan, Stephen K.; Manfiolli, Adriana Oliveira; Brown, Neil Andrew; Jones, Gary W.; Doyle, Sean; Riaño-Pachón, Diego M.; Squina, Fábio Márcio; Caldana, Camila; Singh, Ashutosh; Del Poeta, Maurizio; Hagiwara, Daisuke; Silva-Rocha, Rafael; Goldman, Gustavo H.

    2016-01-01

    Summary The serine-threonine kinase TOR, the Target of Rapamycin, is an important regulator of nutrient, energy and stress signaling in eukaryotes. Sch9, a Ser/Thr kinase of AGC family (the cAMP-dependent PKA, cGMP- dependent protein kinase G and phospholipid-dependent protein kinase C family), is a substrate of TOR. Here, we characterized the fungal opportunistic pathogen Aspergillus fumigatus Sch9 homologue (SchA). The schA null mutant was sensitive to rapamycin, high concentrations of calcium, hyperosmotic stress and SchA was involved in iron metabolism. The ΔschA null mutant showed increased phosphorylation of SakA, the A. fumigatus Hog1 homologue. The schA null mutant has increased and decreased trehalose and glycerol accumulation, respectively, suggesting SchA performs different roles for glycerol and trehalose accumulation during osmotic stress. The schA was transcriptionally regulated by osmotic stress and this response was dependent on SakA and MpkC. The double ΔschA ΔsakA and ΔschA ΔmpkC mutants were more sensitive to osmotic stress than the corresponding parental strains. Transcriptomics and proteomics identified direct and indirect targets of SchA post-exposure to hyperosmotic stress. Finally, ΔschA was avirulent in a low dose murine infection model. Our results suggest there is a complex network of interactions amongst the A. fumigatus TOR, SakA and SchA pathways. PMID:27538790

  4. Quadruple or quintuple conversion of hlb, sak, sea (or sep), scn, and chp genes by bacteriophages in non-beta-hemolysin-producing bovine isolates of Staphylococcus aureus.

    Science.gov (United States)

    Kumagai, Rina; Nakatani, Kazue; Ikeya, Nanami; Kito, Yukiko; Kaidoh, Toshio; Takeuchi, Shotaro

    2007-05-16

    In 13 of 43 non-beta-hemolysin-producing bovine isolates of Staphylococcus aureus, two truncated beta-hemolysin (hlb) genes were demonstrated by PCR and sequencing, and one truncated hlb gene was located beside the integrase (int) gene of phage origin. The staphylokinase (sak) gene was detected in all 13 isolates in which the truncated hlb genes were detected by PCR. Enterotoxin A (sea) and enterotoxin P (sep) genes were also detected in 5 and 2 of the 13 isolates, respectively. Moreover, the scn and chp genes encoding staphylococcal complement inhibitor (SCIN) and chemotaxis inhibitory protein of S. aureus (CHIPS) were detected in 13 and 4 of the 13 isolates, respectively. The bacteriophage induced by mitomycin C treatment was able to lysogenize one beta-hemolysin-producing isolate of S. aureus, and the sak and scn genes were detected from the lysogenized isolate. These results suggest quadruple or quintuple conversion of hlb, sak, sea (or sep), scn, and chp genes by bacteriophages among non-beta-hemolysin-producing bovine isolates of S. aureus.

  5. Tervishoiudebatt : Eesti - kas Euroopa haige mees? / Ain-Elmar Kaasik, Peeter Mardna, Ain Aaviksoo ; interv. Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Kaasik, Ain-Elmar, 1934-

    2007-01-01

    Mida teha, et eestlaste enneaegset suremust vähendada ja tervist parandada. Vestlusringis olid TÜ emeriitprofessor Ain-Elmar Kaasik, tervishoiuametnik Peeter Mardna ja Praxise tervishoiuprogrammi juht Ain Aaviksoo

  6. Berliini filmifestivalil näeb ka Peeter Simmi filmi "Head käed" / Triin Tael

    Index Scriptorium Estoniae

    Tael, Triin

    2002-01-01

    Berliini 52. filmifestival algas eile sakslase Tom Tykweri mängufilmiga "Taevas". Esmakordselt on festivali "Panorama" kavas eesti mängufilm, milleks on Peeter Simmi "Head käed". Eesti filmid on esil ka festivali suurel filmiturul

  7. Mida arvatakse omavalitsustes koolivõrgu optimeerimisest? / Mart Järvik, Maris Liiders, Peeter Aas, Kaarin Veinbergs

    Index Scriptorium Estoniae

    2012-01-01

    Arvamust avaldasid Järvakandi vallavanem, Raplamaa omavalitsuste liidu esimees Mart Järvik, Harju maavalitsuse haridus- ja sotsiaalosakonna juhataja Maris Liiders, Põlva maavalitsuse haridus- ja sotsiaalosakonna juhataja Peeter Aas, Ida-Viru maavalitsuse haridus- ja sotsiaalosakonna juhataja Kaarin Veinbergs

  8. "Savisaare käitumine on mulle täiesti arusaamatu!" / Peeter Kreitzberg ; interv. Kadri Paas

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2003-01-01

    Peeter Kreitzberg põhjendab oma kandideerimist Keskerakonna esimehe kohale ning tunnistab, et ei saa aru Edgar Savisaare käitumisest Euroopa Liidu küsimuses. Tema sõnul vajab Keskerakond kaasaegsemat tegevusstiili

  9. Vaidlused koolivõrgu teemal jätkuvad / Peeter Kreitzberg ; küsitlenud Karl Kello

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2009-01-01

    Riigikogu kultuurikomisjonil on olnud 30. korral arutluse all põhikooli- ja gümnaasiumiseaduse eelnõu. Küsimusele, kuidas kommenteerite n-ö koolivõrgu istungit, vastab Riigikogu kultuurikomisjoni esimees Peeter Kreitzberg

  10. Estonia : [2011] / Allan Sikk

    Index Scriptorium Estoniae

    Sikk, Allan, 1975-

    2012-01-01

    Ülevaade Eesti poliitika olulisematest sündmustest 2011. aastal, mille hulgas on nii Riigikogu kui ka presidendi valimised, märgitakse skandaali ja korruptsiooni seoses viisavaba liikumise võimaldamisega Shengeni viisaruumis, muutused põhiseaduses seoses Kaitsejõudude ülemjuhataja koha kaotamisega

  11. Estonia : [2013] / Allan Sikk

    Index Scriptorium Estoniae

    Sikk, Allan, 1975-

    2014-01-01

    Ülevaade Eesti poliitilisest elust 2013. aastal. Käsitletakse kohalikke valimisi, muutusi valitsuse kooseisus, Riigikogu tegemisi, aga ka rahvakogu ettepanekuid, Reformierakonna rahastusskandaali jt sündmusi.

  12. Estonia : [2012] / Allan Sikk

    Index Scriptorium Estoniae

    Sikk, Allan, 1975-

    2013-01-01

    Ülevaade Eesti valitsuses 2012. aastal toimunud muutustest, sisepoliitika olulisematest arengutest (protestid ACTA vastu, Rahvakogu kokkutulek, Silvergate, opositsiooni tegevus, arutelud ESM-i ümber, venekeelsest koolist Eestis)

  13. Estonia : [2010] / Allan Sikk

    Index Scriptorium Estoniae

    Sikk, Allan, 1975-

    2011-01-01

    Ülevaade Eesti poliitika olulisematest sündmustest 2010. aastal, mille hulgas märgitakse skandaale erakondade rahaasjades, korruptsiooni seoses maamüügitehingutega, muutusi valimisseaduses seoses valimistega Euroopa Parlamenti

  14. Restoran Noa Miidurannas = Noa Restaurant in the Miiduranna area of Tallinn / Peeter Loo, Jan Skolimowski, Kaspar Kruuse, Tarmo Piirmets ; kommenteerinud Raivo Kotov

    Index Scriptorium Estoniae

    2015-01-01

    Noa restoran Miidurannas Ranna tee 3, valminud 2014. Arhitektid Peeter Loo, Jan Skolimowski, Kaspar Kruuse (Kamp Arhitektid), sisearhitekt Tarmo Piirmets (Pink). Eesti Kultuurkapitali Arhitektuuri sihtkapitali arhitektuuripreemia 2014

  15. Eesti Vabariik sai Tartu rahuga 1920. aastal maksimumi / Peeter Järvelaid ; intervjueerinud Erkki Bahovski

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    2016-01-01

    Eesti avalikkus tähistas jaanuaris Jaan Poska 150. sünniaastapäeva. Intervjuu Jaan Poska mälestusfondi nõukogu esimehe, Tallinna Ülikooli õigusajaloo ja võrdleva õiguse korralise professori Peeter Järvelaidiga Jaan Poska rollist Eesti iseseisvumisel ja Tartu rahuläbirääkimistel ning tema kogemusi, millest õppida praeguses välispoliitikas

  16. Vanemapalk õiglasemaks! / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2005-01-01

    Ilmunud ka Vali Uudised 9. märts lk. 2, Põhjarannik 9. märts lk. 2, Severnoje Poberezhje 9. märts lk. 2, Pärnu Postimees 9. märts lk. 2, Sakala 9. märts lk. 2, Vooremaa 10. märts lk. 2, Hiiu Leht 11. märts lk. 2, Virumaa Teataja 17. märts lk. 7. Autor toob ära sotsiaaldemokraatide poolt väljapakutavad vanemapalga põhimõttelised muudatused

  17. See on sitt, see on nikk. Kust tuleb porno? : [Ropendamine kirjanduses] / Peeter Sauter

    Index Scriptorium Estoniae

    Sauter, Peeter, 1962-

    1995-01-01

    Vastukaja : Tamm, E. Kas eetiline kriis? // Eesti Ekspress. - 1995. - 25.nov. - Lk.A5; Miks me avaldame Peeter Sauterit? // Eesti Ekspress. - 1995. - 25.nov. - Lk.A5. - Allk.: Areeni toimetus; Jaas, Katrin. Kummutagem tabud! // Eesti Ekspress. - 1995. - 1.dets. - Lk.A5; Männard, Tarmo. Virisemine etteantud teemal // Eesti Ekspress. - 1995. - 8.dets. - Lk.A5; Kohv, Hillar. Porno pole UFO // Eesti Ekspress. - 1995. - 8.dets. - Lk.A5; Sirkel, Mati. Tahan tabu tagasi // Eesti Ekspress. - 1995. - 8.dets. - Lk.A5

  18. Kas erivajadustega lapsed saavad õigel ajal abi? / Ene Mägi, Urve Raudsepp-Alt, Ale Sprenk, Peeter Aas

    Index Scriptorium Estoniae

    2009-01-01

    Küsimusele vastavad: Tallinna Ülikooli Kasvatusteaduste Instituudi eri- ja sotsiaalpedagoogika osakonna juhataja Ene Mägi, Tallinna Haridusameti üldhariduse osakonna peaspetsialist Urve Raudsepp-Alt, Krabi põhikooli direktor Ale Sprenk, Põlva Maavalitsuse haridus-, kultuuri- ja sotsiaalosakonna juhataja Peeter Aas

  19. Uued CO₂ kasukad vanadele majadele / Elari Udam ; intervjueerinud Margit Mutso ; kommenteerinud Peeter Pere, Oliver Orro, Jaak Huimerind

    Index Scriptorium Estoniae

    Udam, Elari, 1968-

    2011-01-01

    Vabade CO₂ kvootide müügist laekunud raha eest renoveeritakse energiatõhusaks 480 Eesti hoonet. Projekti juhib Riigi Kinnisvara AS. Teemat selgitab RKASi juhatuse liige ja haldusdirektor Elari Udam, kommenteerivad Eesti Arhitektide Liidu esimees Peeter Pere, aseesimees Jaak Huimerind ja arhitektuuriajaloolane Oliver Orro

  20. Tüür, Erkki-Sven: Requiem in memoriam Peeter Lilje / Christoph Schlüren

    Index Scriptorium Estoniae

    Schlüren, Christoph

    1996-01-01

    Uuest heliplaadist "Tüür, Erkki-Sven: Requiem in memoriam Peeter Lilje. Passion. Illusion. Architectonics VI. Crystallisatio. Kaia Urb (sopran), Tiit Kogermann (tenor), Estnische Philharmonischer Kammerchor, Kammerorchester Tallinn, Tõnu Kaljuste. ECM/Polygram CD 449 459-2 (WD:64'19'')DDD

  1. Vanemuise teatri juurdeehituse kutsutud arhitektuurikonkurss = Invitational architecture competition for the addition to the Vanemuine theatre / Peeter Pere

    Index Scriptorium Estoniae

    Pere, Peeter, 1957-

    2009-01-01

    Arhitektuurikonkursi žürii liige Peeter Pere võistluse eesmärgist, konkursil 1. preemia pälvinud Jüri Okase ja Marika Lõokese (Okas & Lõoke) võistlustööst ja konkursil osalenud arhitektuuribüroode Kolm Pluss Üks, Kavakava ja Lunge & Ko võistlustöödest

  2. The effects of pre-harvest napthalene acetic acid and aminoethoxyvinylglycine treatments on storage performance of ‘ Ak Sakı’ apple cultivar grown in Erzincan conditions

    Directory of Open Access Journals (Sweden)

    Burhan OZTÜRK

    2013-06-01

    Full Text Available This study was carried out to determine the effects of pre-harvest aminoethoxyvinylglycine (AVG, 150, 225 ve 300 mg/L and naphthaleneacetic acid (NAA, 20 mg/L treatments in different doses on storage performance of ‘Ak Sakı’ apple cultivar (Malus domestica Borkh. in 2012. The changes on some fruit quality parameters were measured at 2±1 oC temperature and with 90±5 % relative humidity at 45 days interval during storage. The lowest weight loss was obtained from 300 mg/L AVG treated fruits during the storage. In the all analysis date, the highest L* value was obtained from 300 mg/L AVG treated fruits, and the lowest hue angle value was reported from the fruits of control treatment. The flesh firmness was determined that the best kept in the 225 and 300 mg/L AVG treated fruits during the storage. The flesh firmness significantly reduced with NAA treatment at the end of storage. The highest soluble solids concentration (SSC was obtain from control fruit during the storage, whereas the lowest SSC was observed in fruit treated with 300 mg/L AVG. In the all analysis date, the highest titratable acidity was obtained in fruits treated with 225 and 300 mg/L AVG. The starch degradation was delayed with AVG treatments.

  3. Kuva-yi Milliye Müzesindeki Sırp Kralı II. Stefan Uroš Milutin (1282-1321 Dönemine Ait Gümüş Sikke A Silver Coin of Serbian King Stephan Uros II Milutin (1282-1321 from Kuva-yi Milliye Museum

    Directory of Open Access Journals (Sweden)

    Ceren ÜNAL

    2012-12-01

    Full Text Available Museum of Kuva-yi Milliye in Balıkesir which is located in thenorth-western part of Turkey was established in 1996. The Museum ofKuva-yi Milliye has approximately 2.500 coins from different culturesand ages. As a result of some research, done between 2011-2012August, one rare silver coin which dated back to Medieval era of Serbiawas detected.There is a silver dinar of Serbian king Stephen Uroš II Milutin(1282-1321 in Kuva-yi Milliye Museum which might have come toAnatolia with the international trade route. Serbian silver dinar wasfound together with a group of Venetian silver coins and it was wronglyclassified to Byzantine Empire which was an effective culture in thatera. Most probably, Serbian silver coin which was dated back to the endof the 13th century, might have come to the Anatolia with a trade ofVenetia. The coin which is protected in the Museum is the reflection of arich culture of Anatolia which is the center of overseas trade betweenEast and West.When Byzantine Empire began to lose its power in 12th century,the idea of independence between Balkan communities developed.Serbian Kingdom which was established in 12th century was gettingstronger gradually and its borders were extended. Therefore, SerbianKingdom reached a balance situation between the West and ByzantineEmpire. As the Serbian Kingdom, was located on the overland journeybetween the West and the East, it had effective relations with itswestern alliances. Because of its strategical location, Byzantine Empirehad to have good relations with them.This rare silver dinar most probably came to Anatolia with theVenetian merchants who were dominant in the sea trade in that era. Itwill be presented with the help of the historical background of theBalkans and Serbia. Türkiye’nin kuzeybatısında, Balıkesir ilinde yer alan Kuva-yi Milliye Müzesi 1996 yılında kurulmuştur. Kuva-yi Milliye Müzesi’nde yaklaşık olarak 2.500 adet farklı kültürler ve dönemlere ait sikke

  4. 1. IX 2004. a. renoveerituna tööd alustanud Maidla mõisakool / Peeter Püssim, Vaike Pungas, Johann Paul Dürschmidt...[jt.

    Index Scriptorium Estoniae

    2005-01-01

    10 ill.; restaureerimistööde peatöövõtja AS Restor; arhitekt Peeter Püssim, sisekujundaja Vaike Pungas (OÜ Mõisaprojekt); 1767. a. valminud häärberi arhitekt ja ehitusmeister oli Johann Paul Dürschmidt, stukimeister Johann Schultz, müürseppmeister Johann Christian Kolbe, sepised tegi F. Pfau

  5. Reval Hotel Lietuva Vilniuses : Konstitucijos pr. 20 / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2004-01-01

    Vilniuse hotelli "Lietuva" renoveerimine. Arhitektuurse projekti koostaja Rootsi arhitektuuribüroo AB SWECO (arhitektid Aare Saks, Nils Palm. Sisekujundus: Vaikla Disain AS (Katrin ja Argo Vaikla, Liis Lindvere, Peeter Loo). Kommenteerivad Argo ja Katrin Vaikla. 3 ill

  6. Mida arvate ideest, et kõrgkoole võiks juhtida ülikoolivälistest inimestest koosnev nõukogu? / Jaak Aaviksoo, Maris Mälzer, Peeter Kreitzberg, Peep Sürje

    Index Scriptorium Estoniae

    2010-01-01

    Küsimusele vastavad Tartu Ülikooli eelmine rektor Jaak Aaviksoo, Eesti Üliõpilaskondade Liidu esimees Maris Mälzer, Riigikogu kultuurikomisjoni esimees Peeter Kreitzberg ja Tallinna Tehnikaülikooli rektor Peep Sürje

  7. Amnestyl on topeltstandardid / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Ilmunud ka: Linnaleht : Tartu 6. juuni 2008, lk. 4. Äsja ilmunud Amnesty Internationali raportist, kus tõdetakse, et Eestis diskrimineeritakse keelelisi vähemusi. Võrdlus vanade EL-i liikmesriikidega

  8. Venemaal sotsiaaldemokraatiat otsimas / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Euroopa Sotsiaaldemokraatliku Partei (ESP) ja Alfred Moseri fondi koostöös toimunud visiidist Venemaale, kus osalesid mitme Lääne sotsiaaldemokraatliku partei esindajad, kohtumisest endise Jabloko esimehe Grigori Javlinski, Venemaa Sotsiaaldemokraatliku Partei looja Mihhail Gorbatshovi ja selle praeguse esimehe Vladimir Kishenini ning partei Õiglane Venemaa juhi Sergei Mironoviga

  9. Populaarsemad raamatud : [Sõnum] / Ita Saks

    Index Scriptorium Estoniae

    Saks, Ita, 1921-2003

    1996-01-01

    Aasta populaarseimad raamatud läti kirjanduses: Vizma Belshevica 'Bille', Regina Ezera 'Lohe Muna' ja Karlis Levinshi 'Muinasjutujärve ääres'; populaarseimad publitsistikaraamatud on Guntis Ulmanise 'Sinult ju palju ei nõuta' ja Dainis Ivansi 'Juhuslik sõdalane'

  10. Obtaining a Well-Aligned ZnO Nanotube Array Using the Hydrothermal Growth Method / Labi Sakārtotu Zno Nanocauruļu Kopu Iegūšana, Izmantojot Hidrotermālo Metodi

    Directory of Open Access Journals (Sweden)

    Krasovska M.

    2015-10-01

    Full Text Available Dotajā darbā tika noteikti optimāli parametri labi sakārtotu ZnO nanocaurulīšu kopu iegūšanai, izmantojot hidrotermālo metodi ar temperatūras pazemināšanu, jeb t.s. selektīvu paškodināšanas metodi (self-selective etching, ir uzsvērtas šās metodes priekšrocības salīdzinājumā ar ķīmiskās kodināšanas metodi, kā arī tika aprakstīta dažādu augšanas faktora (tādu, ka darba šķīduma koncentrācija, augšanas temperatūra un laiks, iedīgļu slāņa iegūšanas veids un iegūšanas parametri ietekme uz iegūtu nanostraktūra morfoloģiju.

  11. Eesti ülikoolid janunevad muutuste järele : ülikool tegi plaane järgnevaks kuueks aastaks / Marju Himma ; kommenteerivad Peeter Kreitzberg, Tõnis Rüütel, Olga Tšerjomuškina ja Raivo Vare

    Index Scriptorium Estoniae

    Himma, Marju

    2008-01-01

    7. novembril 2008 toimunud Tartu Ülikooli arengukonverentsist. Arvamust avaldavad Riigikogu kultuurikomisjoni esimees Peeter Kreitzberg, Tartu Ülikooli geograafiatudeng Tõnis Rüütel, Eesti Üliõpilaskondade Liidu aseesimees Olga Tšerjomuškina ja Tartu Ülikooli kuratooriumi liige Raivo Vare. Konverentsil esines ka president Toomas Hendrik Ilves

  12. Tolko poetom hotel bõt : Rastrogannost; Dozhdlivõi den; Jaanov ogon; Setumaa I-II; Tolko poetom. Haralskije zhizneopissanija : Aire Valgus; Aare Valgus; Peeter Petrov; Vaike Metsleht; Valdur Laiapea; Hillar Aruda, ekonomist; Pärja Lumendi; Valjo Z

    Index Scriptorium Estoniae

    Traat, Mats, 1936-

    1996-01-01

    Orig.: Heldimus; Sajupäev; Jaanituli; Setumaa I-II; Ainult poeet. Harala elulood: Aire Valgus; Aare Valgus; Peeter Petrov; Vaike Metsleht; Valdur Laiapea; Hillar Aruda, ökonomist; Pärja Lumendi; Valjo Zeiger; Pavlo Moskalenko; Johannes Iva; Viljar Laanemägi; Olga Kaljusaar; Aimi Vaimets; Einard Kalm (1923-1984); Sonetid vaikimisest I; Kui

  13. Tuumajaam - kott peas, meel hea / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2007-01-01

    Rootsis on palju investeeritud inimeste teavitamisse tuumajaamade ja tuumaenergia kohta, Rootsi tuumajaamad on avalikud turismiobjektid, tuumaenergia kasutuselevõtt otsustati 1980. aastal referendumiga, ka jäätmehoidla kohavaliku kohta korraldatakse referendum. Samas Eestis ei tea avalikkus, kui ohutu või ohtlik on riigi osalemine Ignalina tuumaprojektis

  14. Eesti kirjab EXPO paviljoni rahvamustritega / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2009-01-01

    Eesti paviljoni projekteerimine Hiinas Shanghais 1. maist 31. oktoobrini 2010 toimuvaks maailmanäituseks EXPO 2010 on lõppemas. Oktoobris algavast paviljoni ehitamisest ja sisustamisest ning Eestist EXPO-l osaleda soovijatest. Eesti osalemise peasõnum: "Me elame siin ja meil on siin hea elada". Eesti paviljoni konkursi võidutöö "Savecity.org" autoritest nimetatud: Illimar Truverk, Andres Labi, Janno Roos, Ionel Lehari

  15. Obtaining a Well-Aligned ZnO Nanotube Array Using the Hydrothermal Growth Method / Labi Sakārtotu Zno Nanocauruļu Kopu Iegūšana, Izmantojot Hidrotermālo Metodi

    Science.gov (United States)

    Krasovska, M.; Gerbreders, V.; Paskevics, V.; Ogurcovs, A.; Mihailova, I.

    2015-10-01

    Optimal growing parameters have been found using the hydrothermal method to obtain well-aligned vertical ZnO nanorod and nanotube arrays. The influence of different growing factors (such as temperature, growing solution concentration, method of obtaining seed layer and condition) on nanotube morphology and size is described in the paper. Well-structured ZnO nanotubes have been obtained by using a selfselective etching method with lowering temperatures of growth during the hydrothermal process. It is shown that the optical properties of the nanostructure arrays obtained are sensitive to the medium in which they are placed, which is why they can be used as sensors for pure substance detection and in different solutions for impurity determination. Dotajā darbā tika noteikti optimāli parametri labi sakārtotu ZnO nanocaurulīšu kopu iegūšanai, izmantojot hidrotermālo metodi ar temperatūras pazemināšanu, jeb t.s. selektīvu pa\\vskodināšanas metodi (self-selective etching), ir uzsvērtas šās metodes priekšrocības salīdzinājumā ar ķīmiskās kodināšanas metodi, kā arī tika aprakstīta dažādu augšanas faktora (tādu, ka darba šķīduma koncentrācija, augšanas temperatūra un laiks, iedīgļu slāņa iegūšanas veids un iegūšanas parametri) ietekme uz iegūtu nanostraktūra morfoloģiju. Tika konstatēts, ka noteicošu lomu ZnO nanocaurulīšu audzēšanas procesā spēlē iedīgļu slāņa graudu izmēri, kas savā staipā nosaka augošu nanostieņu izmērus un to tendenci pie pa\\vskodināšanas. Rentgenogrannnas parāda, ka iegūtām pie noteiktiem parametriem ZnO nanostruktūrām piemīt augsta kristāliskuma pakāpe un sakārtotība vertikālā virzienā. Optiskie mērījumi parāda, ka ZnO nanocauralītes ir jutīgas gan pret tīrām vielām (ūdens, spirts), gan pret dažādiem šķīdumiem, kas ļauj izmantot tos kā pie­jaukumu sensora. Salīdzinājumā ar ZnO nanostieņiem caurulīšu jūtība pieaug, jo pieaug nanostrakt

  16. Flanöör nõukogude provintsipealinnas. Üks vaatenurk Peeter Sauteri romaanile „Indigo”. The Flaneur in a Soviet Provincial Capital: A Perspective on Peeter Sauter’s Novel Indigo

    Directory of Open Access Journals (Sweden)

    Ivo Heinloo

    2012-04-01

    Full Text Available In the second half of the 20th century, there have been breakthroughs in the field of urban studies: the city environment is no longer perceived as something static, but rather as something dynamic. Likewise, the city is no longer regarded as a „thing” or a „form”; rather, the object of research is the ways in which the city is represented and constructed. In connection with these changes, the concept of the flaneur has come into use (or has been readopted, in the meaning of a subject who lives in the city and makes use of cityspace. For some time the concept of the flaneur has no longer signified the type of the wealthy stroller in the Parisian cityscape. It has been thought that the flaneurs of today are skateboarders and teenagers passing time in shopping malls. In the context of Estonian culture, traits of the flaneur have been recognized in the happenings and performances of the 1970s art scene, which, in ways similar to the literature of the time, took as their goal facilitating the overcoming of alienation from the urban environment. The character of the flaneur can also be found in Soviet-era Estonian literature. Peeter Sauter’s Indigo (1990 can be regarded as one such „flaneur-novel”. Indigo has been recognized as a literary breakthrough, one of the high points of the renewal of prose that took place during the 1990s. The protagonist of Indigo, who is named O, has several traits that connect him with the flaneur, including a symbiotic relation to the city, a preference for the public over the private sphere, a distantiated relation to his fellow citydwellers, and voyeuristic tendencies. At times, the Tallinn cityscape is described in detailed precision. The protagonist often expresses a deep devotion to his home city, and he distinctly prefers aimless wandering of the city streets to spending time in his home environment. O is likewise in conflict with the self-representation of power that dominates the city streets, and

  17. Benoît Peeters. Derrida : Buenos Aires, Fondo de Cultura Económica, 2013, 681 páginas

    OpenAIRE

    Mallol, Anahí Diana

    2014-01-01

    ¿Cómo situarse para escribir la biografía de un filósofo, cómo delinear ese espacio de contacto y a la vez de divergencia entre la vida y la obra, la experiencia y el pensamiento, el cuerpo y la escritura? Estos son los interrogantes, a la vez que fácticos teóricos, a partir de los cuales se anudan y se desgranan los capítulos de este libro. Dice Benoît Peeters, al comienzo: “No intentaré en este libro brindar una introducción a la filosofía de Jacques Derrida, ni mucho menos una nueva int...

  18. Pictorial Estonia / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2003-01-01

    Eesti pildilisest kujutamisest albumites, postkaartidel, kodulehekülgedel ja filmides, kus domineerib "fassaadi-imagoloogia", mille raamkonstruktsiooniks on utoopiline, mitte heterotoopoline ruumi mõiste

  19. Biography of Peeter Torop

    Index Scriptorium Estoniae

    2010-01-01

    Sünd. 28. nov. 1950 Tallinnas, õppis Tartu 5. Kk. (nüüd Tamme Gümnaasium). 1969-74 õppis TÜ-s vene filol. Töötanud vene kirjanduse kat. kuni 1992, mil tema initsiatiivil moodustati semiootika kateeder

  20. Kõrge tunnustus Peeter Mehistole

    Index Scriptorium Estoniae

    2008-01-01

    Inglismaal välja antud raamatu "Uncovering CLIL: Content and Language Integrated Learning in Bilingual and Multilingual Education" (Macmillan, Oxford) eest Edinburgi hertsogi Inglise Keeles Kõnelejate Ühingu auhind- parim õpetajatele kirjutatud raamat 2008

  1. Rahvusvahelised suhted / Peeter Kapten

    Index Scriptorium Estoniae

    Kapten, Peeter

    2004-01-01

    Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 44-45; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 44-45. Ülevaade AS-i Eesti Raudtee rahvusvahelistest suhetest ja koostööst rahvusvaheliste raudteeorganisatsioonidega

  2. Mõte / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2008-01-01

    Riigikogu liige on arvamusel, et Euroopa haridus ei vaja mitte niivõrd omavahelist võistlust kuivõrd koostöö tugevdamist, ühtse haridusruumi loomist. Siiski peaks iga riik panustama endale sobiva hariduspoliitika ja haridussüsteemi määratlemisse

  3. Reformihullus / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Ilmunud ka: Pärnu Postimees 11. sept., lk. 3; Kesknädal 11. sept., lk. 3; Põhjarannik 11. sept., lk. 3; Severnoje Poberezhje 12. sept., lk. 2; Sakala 13. sept., lk. 2; Koit 13. sept., lk. 5; Vooremaa 11. sept., lk. 3; Valgamaalane 11., lk. 3; Hiiu Leht 14. sept., lk. 2; Nädaline 15. sept., lk. 2; Järva Teataja 18. sept., lk. 2; Lääne Elu 18. sept., lk. 4; Meie Maa 3. okt., lk. 4. Põhiliselt üksnes haldusterritoriaalsete piiride muutmisele keskendunud reformi ei saa nimetada haldusreformiks. Autor: Keskerakond. Parlamendisaadik

  4. Tõlkesund / Peeter Torop

    Index Scriptorium Estoniae

    Torop, Peeter, 1950-

    2002-01-01

    Bibl. lk. 205-206. Kokkuvõte "Forced translation", lk. 362. Sundtõlkimisest Nõukogude Eestis. Ka August Sanga ja Ants Orase tõlketegevusest ning Ch. Baudelaire'i tõlkekogumiku "Kurja lilled" ettevalmistamisest (koost. A. Sang)

  5. Sakramentaalne vaade / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2006-01-01

    Kaasajal on materilism muutunud ametlikust ideoloogiast inimeste sisimaks eluvaateks. Materialismi võidukäiguga kaasneb hiilivalt ateism. Eeskujulikus turumajanduses on kadunud võime näha asjadest läbi. "Argisakramentidest" ja sakramentaalsest maailmanägemisest

  6. Kevad Veneetsias / Peeter Pere

    Index Scriptorium Estoniae

    Pere, Peeter, 1957-

    2013-01-01

    Arhitektuuriga haakuvatest töödest 55. Venezia biennaalil. Walter de Maria (USA), Robert Goberi (USA), Andra Ursuta (Rumeenia), Jasper Justi (Taani), Lara Almarcequi (Hispaania) ja Dénes Farkase (Eesti) töödest

  7. Harmonisasi SAK dan Aturan Pajak: Mungkinkah?

    Directory of Open Access Journals (Sweden)

    Heri Sukendar Sukendar

    2014-11-01

    Full Text Available This paper is intended to illustrate the fact that the case today, especially in Indonesia's commitment to convergency of IFRS, where the decision was certainly not out of global importance that in order to improve the information from the financial statements of companies in Indonesia. In addition, the IFRS Convergence is one of the Indonesian government agreements as a member of the G20 forum, the results of the meeting of G20 leaders in Washington DC forum, 15 November 2008. On the other hand, the tax rules that apply are still using the old accounting standards and do not follow the development of increasingly different. Previous differences between GAAP and tax rules are limited to the "deductible and non-deductible" which is resolved through fiscal reconciliation mechanism with positive correction and correction negatipnya. The widening gap today would be a separate issue for IAI as the organization of the accounting profession. Tax Accountant compartment formation in March 2014 is a serious evidence of the organization as an anticipation, particularly in an effort to bridge the gap widening

  8. Kas oleksite nõus koolidirektorina võtma endale karistusõigust, seega õigust õpilasi trahvida? / Ojaveer, Ott; Tannberg, Ene; Kikas, Peeter; Braziulane, Alina; Samm, Toomas; Reinson, Jaan; Asser, Hiie; Kokk, Undel; Serk, Ants; Ahven, Ruth

    Index Scriptorium Estoniae

    2008-01-01

    Küsimusele vastavad Hugo Treffneri gümnaasiumi direktor Ott Ojaveer, Miina Härma gümnaasiumi direktor Ene Tannberg, Tartu kunstigümnaasiumi direktor Peeter Kikas, Vene lütseumi direktor Alina Braziulane, Mart Reiniku gümnaasiumi direktor Toomas Samm, Descantes'i lütseumi direktor Jaan Reinson, Annelinna gümnaasiumi direktor Hiie Asser, Karlova gümnaasiumi direktor Undel Kokk, Kivilinna gümnaasiumi direktor Ants Serk, Veeriku kooli direktor Ruth Ahven

  9. Reval Hotel Lietuva / Argo Vaikla

    Index Scriptorium Estoniae

    Vaikla, Argo, 1966-

    2004-01-01

    Vilniuse hotelli "Lietuva" renoveerimine. Arhitektuurne renoveerimisprojekt: Aare Saks, Nils Palm (SWECO FFNS Arkitekter AB, Rootsi), Rolandas Palekas (UAB Viltekta). Sisekujundus: Katrin ja Argo Vaikla, Liis Lindvere, Peeter Loo (Vaikla Disain AS). Ehitaja: Merko Statyba UAB. Projekt 2002, valmis 2003. I korruse plaan, välisvaade, 4 sisevaadet

  10. Kõrgõzstanis piiratakse presidendi võimu / Rein Sikk

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2010-01-01

    Kõrgõzstanis pannakse rahvahääletusele uus põhiseadus. Presidendi võimu piiratakse, praegune ajutine riigipea Roza Otunbajeva astus parteist välja ega saa 2011. a. toimuvatel presidendivalimistel osaleda. Kukutatud presidendi Kurmanbek Bakijevi vastu on esitatud massimõrva süüdistus

  11. USA-s kerkib Eesti toel kommunismiohvrite memoriaal / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2006-01-01

    Washingtonis 2007. aastal valmiv memoriaal kujutab endast skulptuuri kivipjedestaalil, mis asetseb sillutatud väljakul. Pronkskuju autor on ameerika skulptor Thomas Marsh. Eesti toetas monumendi rajamist 65500 krooniga

  12. Mäo kolmnurka kerkib mini-Eesti / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2010-01-01

    Järvamaale Mäo kolmnurka kavandatavast Eestimaad vähendatuna näitavast teemapargist mini-Eesti, mis peaks valmima 2014. aastaks. Kavandatavast Narva vanalinna rekonstruktsioonist maketina, mis peaks tulema umber 200 korda 400 meetri suurune

  13. Maailmarändur vaimustus eesti folkloorist / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2010-01-01

    Inglise tantsuõpetajast Chris Davisest, kes on käinud Viljandi pärimusmuusika festivalil, meeste rahvatantsupeol Rakveres ja mujal Eestis ning peab eestlasi maailma parimateks vaimuvara hoidjateks. Chris Davis õpetab inglise rahvatantse oma kodumaal ja nüüd ka Eestis ning liitus kaerajaani Euroopasse viimise kampaaniaga

  14. Eestlane tahab muulase lahkumist : eestlane ihkab rahvusriiki / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2000-01-01

    Järg Sep/12;13;14 lk. 4. Saar Polli integratsioonimonitooring. Ligi pooled eestlastest peavad muulaste riigist lahkumist Eestile kasulikuks. Diagr.: Mitte-eestlaste osakaal väheneb. Geneetiline mitmekesisus on rahvale kasulik. Muulaste lahkumise järel peaks Eesti tööjõudu sisse tooma hakkama. Diagr.: Kas tahate elada kiratsevas Eestis

  15. Japan is far... / Peeter Miller

    Index Scriptorium Estoniae

    Miller, Peeter

    2007-01-01

    Eesti suursaadik Jaapanis Eesti ja Jaapani suhete ajaloost, Jaapani keisri Akihito ja keisrinna Michiko ametlikust visiidist Eestisse 2007. a. mais. Juuresolevatel fotodel president Toomas Hendrik Ilves ja proua Evelin Ilves kõrgeid külalisi vastu võtmas

  16. [Raamat] / Peeter Künstler

    Index Scriptorium Estoniae

    Künstler, Peeter, 1958-2009

    2003-01-01

    Tutvustus: Bierce, Ambrose Gwinnett. Teadmata kadunud : [novellid / tõlkinud Urve Hanko].Tallinn : Eesti Raamat, 2003; Poe, Edgar Allan. Eleonora ja teisi novelle / [tõlkinud ja järelsõna: Urve Hanko]. Tallinn : Eesti Raamat, 2002

  17. Kolmanda raamatu kiituseks / Peeter Olesk

    Index Scriptorium Estoniae

    Olesk, Peeter, 1953-

    2009-01-01

    Tutvustus: Isaacson, Walter. Einstein : tema elu ja universum / tõlkinud Matti Piirimaa. Tallinn : Eesti Raamat, 2009; Fortey, Jacqueline. Kuulsad teadlased (Silmaring) / tõlkinud Ülle Haav ja Helen Haav. Tallinn : Koolibri, 2009; Vaim ja aeg (Lehed ja tähed : looduse ja teaduse aastaraamat, 5) / koostanud Indrek Rohtmets ja Toomas Kukk. Tallinn : Loodusajakiri, 2009

  18. Kivistatud kurjad teod / Peeter Pere

    Index Scriptorium Estoniae

    Pere, Peeter, 1957-

    2011-01-01

    Kommunismiohvrite memoriaali ideekavandite võistlusest, võidutöödest. I-II preemia - märgusõna Vest (autorid Armin Valter, Joel Kopli). I-II preemia - märgusõna Mälutulbad (autor Koit Ojaliiv). Eripreemiad - märgusõna Otsuste rand (autorid Roland Reemaa, Laura Linsi), märgusõna Introvert (autorid Urmas Paul, Martin Lepplaan, Evelin Reimand, Martin Noorväli), märgusõna Padakonn (autorid Vadim Fomitsev, Mart Liho, Ekke Väli)

  19. Antifashism versus antitotalitarism / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2005-01-01

    Vastukaja Slavoj Zhizheki artiklile "Kaks totalitarismi" 19. märtsi Eesti Päevalehes. Autor rõhutab Saksa ajaloolase Ernst Nolte väidet, et kõikide totalitaarsete süsteemide ühisjoon, mida Zhizhek oma artiklis ei nimetanud, on võitlus transtsendentsuse vastu

  20. Out of shadow / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2007-01-01

    "Out of shadow" oli näitus Baltimaade 1990. aastate kunstist Ameerika publikule - sõnumiks iseseisvumisjärgsete aastate materiaalse, sotsiaalse ning vaimuelu peegeldused/tõlgendused visuaalses kunstis

  1. Kirjastusest varastati aardekaart / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    1999-01-01

    Virgela kirjastusest kadus Vene kindrali Robert von Ungern-Sternbergi võitlusteed kajastav polkovnik Artur Otsa originaalkäsikiri, (vahel oli ka kaart aardeleiu asukohast Mongoolias), mille alusel valmis Olev Remsu raamat "Ungern-Sternberg, Ts'ingis-khaan sõjaretkel"

  2. Vana kinematograafia kaitseks / Peeter Riba

    Index Scriptorium Estoniae

    Riba, Peeter, 1967-

    1999-01-01

    Raoul Ruiz'i 1997.a. ilmunud raamatu "Filmikunsti poeetika" ("Poétique du cinéma") arvustus. Lisa : Artikkel Raoul Ruiz'i (1941-2011) kohta Ephraim Katzi entsüklopeediast "The Film Encyclopedia": Harper Perennial, 1998

  3. Probleemtooted vajavad registreerimist / Peeter Eek

    Index Scriptorium Estoniae

    Eek, Peeter, 1963-

    2006-01-01

    2005. aasta suvel jäätmeseadusse tehti täiendus, millega nähti ette probleemtoodete registri loomine. Eelnõu kinnitati Vabariigi Valitsuse määrusena jaanuaris 2006. Tänased turuosalised on kohustatud ennast registreerima kas eraldi või kollektiivselt ehk nn. tootjavastutusorganisatsioonide (TVO) kaudu. Ilmunud ka Lääne Elu : Keskkonnaleht 18. märts 2006, lk. 3 ; Vooremaa 21. märts 2006, lk. 5 ; Koit : Keskkond 28. märts 2006, lk. 15 - 16 ; Järva Teataja : Järvamaa Keskkond 13. aprill 2006, lk. 3 ; Virumaa Teataja : Roheline Maakond 4. mai 2006, lk. 2 ; Võrumaa Teataja : Võrumaa Keskkonnaleht 25. mai 2006, lk. 3 ; Nädaline : Keskkonnaleht 23. sep. 2006, lk. 8 ; Hiiu Leht : Hiiumaa Looduse Leht 19. Dets. 2006, lk. 1

  4. Palace kaotas kasutusloa / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2004-01-01

    Väidetavalt surus Tallinna linnapea Edgar Savisaar linnavalitsuse nõupidamisel erakonnakaaslase Viktor Kaasiku tahte kohaselt läbi hotelli Palace kasutusloa tühistamise. Vt. samas: Kuidas nõupidamine kasvas üle istungiks; Uus ekspertiis järgmisel nädalal

  5. Surma subtiilne kohalolek / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2005-01-01

    Surimaskinäitus "Das letzte Bildnis. Totenmasken aus drei Jahrhunderten" Berliinis skulptor Georg Kolbe (1877-1947) majamuuseumis kuni 13. II. Surimaskide loojatest nimetatud Georg Kolbe, Arno Breker

  6. Younger Estonian Prose / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2008-01-01

    Iga kahe aasta tagant korraldatavast romaanivõistlusest ning uutest ja noortest autoritest, pikemalt Indrek Harglast, Lew R. Bergist, Jaan Apsist, Joonas Sildrest, Diana Leesalust, Marion Andrast, Tiina Laanemist, Olle Laulist, Chaneldiorist, Vahur Afanasjevist, Mehis Heinsaarest, Mart Kangurist, Ivar Ravist, Jaak Rannast

  7. Kolga-Jaani kihelkond ja Vabaduse Risti vennad / Jaak Pihlak

    Index Scriptorium Estoniae

    Pihlak, Jaak

    2003-01-01

    Viljandimaaga seotud järgmiste Vabadusristi kavaleride elulood: Jakob Aaren, Joosep Aas, Anton Anni, Jakob Ant, Peeter-Viktor Kanasaar, Julius Kasper, Martin-Alexander Kepmann, Georg Kesküla, Peeter Kolts, Joosep Korts, August Kull, Georg Kütt, Georg Liiv, Eduard Meijel, August Moks, Theodor Mölter, Arnold-Rudolf Orik, August Paia, Aleksander Pajur, Oskar Parvet, Tõnis Pedak, August Pent, Heinrich Puidak, Jaan Päsna, Elmar Rei, Ernst Saar, Jüri Saks, August Schönberg, August-Johannes Teose, Hans Timpson, Anton Unt, Julian Vares, Paul Vares

  8. Kas holokaust võib korduda? / Elhonen Saks

    Index Scriptorium Estoniae

    Saks, Elhonen, 1927-

    2000-01-01

    Eestit külastas USA Kongressi Esindajatekoja välissuhete komisjoni liige Tom Lantos. Dokumentaalfilm "Viimased päevad" ("The Last Days") Eesti välisministeeriumi pressikeskuses. režissöör James Moll : Ameerika Ühendriigid 1998. Survivors of the Shoah Visual History Foundation algatus. Filmi esitusel osalesid ka L. Meri ja T. H. Ilves.

  9. Kto zashtshitit ot grabitelskogo SMS-kredita? / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Kiirlaenudest ja nendega seonduvatest probleemidest Eestis, seaduseelnõust, mis suurendab SMS-laenu võtnute võimalusi kaitsta oma õigusi laenuandjate ees ning olukorra ohjeldamisest Rootsis ja Soomes

  10. Äraaetud hobused lastakse maha / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Tööaja direktiivi muutmise eelnõust, mis suurendaks töötajate tööaja piiranguid. Ilmunud ka Põhjarannik 19. juuni 2008, lk.2 ; Vooremaa 21. juuni 2008, lk. 2 ; Virumaa Teataja 27. juuni 2008, lk. 11 ; Pärnu Postimees 27. juuni 2008, lk. 15 ; Järva Teataja 1. juuli 2008, lk. 2 ; Koit 3. juuli 2008, lk. 6 ; Nädalaleht 20. juuni 2008, lk. 7

  11. Pikk tee märkamiseni / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Õpilaste koolisuhetest ning koolivägivallast. Ilmunud ka Vooremaa 9. okt. 2008, lk. 2 ; Võrumaa Teataja 11. okt. 2008, lk. 2 ; Koit 11. okt. 2008, lk. 6 ; Meie Maa 13. okt. 2008, lk. 2 ; Pärnu Postimees 10. okt. 2008, lk. 15 ; Virumaa Teataja 15. okt. 2008, lk. 11

  12. Toiduvilja koht pole kütusepaagis / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Ilmunud ka: Nädaline 22. mai, lk. 4, Pärnu Postimees 22. mai, lk. 15, Võrumaa Teataja 22. mai, lk. 2, Vooremaa 22. mai, lk. 2, Valgamaalane 22. mai lk. 2, Hiiu Leht 23. mai, lk. 2, Kuulutaja 23. mai lk. 4, Koit 24. mai lk. 6, Järva Teataja, Harju Elu 27. mai lk. 2, Vali Uudised 28. mai lk. 2, Meie Maa 29. mai lk. 2, Lääne Elu 5. juuni lk. 2, Virumaa Teataja 6. juuni, lk. 11, Sakala 6. juuni lk. 2, Molodjozh Estonii 9. juuni lk. 7. Euroopa Parlamendi liige annab ülevaate EL biokütusepoliitikast

  13. Laste hulk ei sõltu toonekurgede arvukusest / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2006-01-01

    Perekonnaseaduse eelnõust ja samasooliste abielust. Sama ka Harjumaa 24. jaan. 2006, lk. 2 ; Võrumaa Teataja 24. jaan. 2006, lk. 2 ; Vali Uudised 25. jaan. 2006, lk. 2 ; Meie Maa 25. jaan. 2006, lk. 2 ; Hiiu Leht 27. jaan. 2006, lk. 2 ; Kuulutaja 27. jaan. 2006, lk. 4 ; Lõunaleht 26. jaan. 2006, lk. 2 ; Vooremaa 26. jaan. 2006, lk. 2 ; Pärnu Postimees 2. veeb. 2006, lk. 11 ; Sakala 2. veeb. 2006, lk. 2 ; Valgamaalane 25. aprill 2006, lk. 2 ; Hiiu Leht 9. mai 2006, lk. 2 ; Sotsiaaldemokraat 16. veeb. 2006, lk. 5

  14. Ebavõrdsus hukutab Eesti arengu / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2004-01-01

    Ilmunud ka: Pärnu Postimees, 22. jaan. 2004, lk. 11; Võrumaa Teataja, 24. jaan. 2004, lk. 2; Meie Maa, 24. jaan. 2004, lk. 2; Hiiu Leht, 27. jaan. 2004, lk. 2; Põhjarannik, 31. jaan. 2004, lk. 2; Severnoje Poberezhje, 31. jaan. 2004, lk. 2; Koit, 3. veebr. 2004, lk. 6; Hiiumaa, 3. veebr. 2004, lk. 2. Autor vaatleb riigi osa ebavõrduse ilmingute likvideerimisel Eestis ja leiab, et ebavõrdsus on meie arengu peamine takistus, mille kõrvaldamine on sotsiaaldemokraatide peamine eesmärk

  15. Necip Fazıl Kısakürek’in “Kaldırımlar” Şiiri Üzerine Dil Bilimsel Bir Çözümleme A Linguistic Analysis On Necip Fazıl Kısakurek’s Poem Called As ‘Kaldırımlar’

    Directory of Open Access Journals (Sweden)

    Yusuf TEPELİ

    2013-03-01

    önüyle şiirin başarısında ve kalıcılığında büyük paya sahiptir. Şiir dilden ayrı düşünülemeyeceği için şiir eleştirisi de dilden bağımsız gerçekleştirilemez. Şiirin yansıttığı duyguları, okuyucuya yaşattığı atmosferi birtakım öznel değerlendirmelerle aktarmak yerine tamamen metnin kendi söz varlığına dayanan, bilimsel bir yöntemle açıklamak ihtiyacı bu çalışmanın yapılmasında etkili olmuştur. Bu çalışma için Necip Fazıl Kısakürek’in şiirinin tercih edilmesinde şairin sapmalar ve aktarmalarla özgün imgeler yaratması, ses ögelerinden bolca yararlanması, konuşulan dilin verdiği rahat söyleyişi yakalaması etkili olmuştur. Şair kişinin yoğun iç hesaplaşmalarının, ruh çalkantılarının yansımalarını dış dünyanın gerçekliğiyle aktardığı mistik şiirler kaleme almıştır. “Kaldırımlar” şiiri tüm bu nitelikleri içermesi bakımından bizlere ideal bir dil malzemesi sağlamaktadır.Bu çalışmada, Necip Fazıl Kısakürek’in Kaldırımlar adlı şiiri dilbilimsel bakışla çözümlenmeye çalışılmıştır. Bunun için Doğan Aksan'ın "Şiir Dili ve Türk Şiir Dili" adlı eseri temel alınarak, Aksan’ın değişik şiir örnekleri üzerinde gösterdiği şiir inceleme yöntemi bir Kaldırımlar şiiri üzerinde uygulanmıştır.İki bölümden oluşan çalışmanın ilk bölümünde kısaca sözcük türleri üzerinde durulmuş, ikinci bölümde ise metnin söz varlığını oluşturan sözcüklerin dil bilimsel/ anlam bilimsel/ gösterge bilimsel incelemesi yapılmış, bulgular tablolaştırılarak aktarılmıştır. Metinde geçen sözcükler tür, anlam yönü, ses ögeleri bakımından incelenmiş, bunların duygu değerleri, geçiş sıklıkları ve birbirleriyle ilişkileri tespit edilerek çözümlemeye gidilmiştir.

  16. Valdmanni rahaseis peo peal / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2007-01-01

    Tallinna linnavalitsuse kommunaalameti juhataja Ain Valdmanni on mitmel korral tabanud korruptsioonisüüdistused. Vt. samas: Valdmanni ärid linna klientidega; Kronoloogia: Ain Valdmann on võtnud kaheksa aasta jooksul suuri laene

  17. Kahemõõtmelised majad / Peeter Laurits

    Index Scriptorium Estoniae

    Laurits, Peeter, 1962-

    2002-01-01

    Pille Epneri ja Liina Jänese kureeritud ning Kristjan Holmi ja August Künnapu kujundatud näitus "Kahemõõtmelised majad: arhitektuurifoto Eestis 1860. aastatest tänapäevani" Rotermanni soolalaos 20. 06.-08. 09. 2002. Martin Pedaniku kujundatud kataloog sisaldab P. Epneri ja L. Jänese uurimust eesti arhitektuurifotost

  18. Erakondade erastatud Eesti: kuidas edasi? / Peeter Jalakas

    Index Scriptorium Estoniae

    Jalakas, Peeter, 1961-

    2009-01-01

    Autori hinnangul meenutavad Eesti erakonnad üha enam äriühinguid, mille tõttu valitseb riigis erakondlik egoism ning kodanike rahulolematus - olukorra parandamiseks oleks vaja muuta olemasolevat valitsemissüsteemi ning luua kahekojaline parlament

  19. Peeter Paani peidupaik / Peter Broeng, Piret Veigel

    Index Scriptorium Estoniae

    Broeng, Peter

    2005-01-01

    Shabby chic stiilis sisustatud norra kunstniku ja stilisti Tor Halvorseni Bjornslokkeni talust, kus T. Halvorsen korraldab isiksust ja loovust arendavaid seminare. Elamuks on ümberehitatud ait. Looduslike viimistlusmaterjalide kõrval näeb barokseid küünlajalgu, siidkangaid, modernse joonega disainiklassikat. 12 värv. ill

  20. Web aitab nutikamaid firmasid / Peeter Stamberg

    Index Scriptorium Estoniae

    Stamberg, Peeter

    2003-01-01

    Interneti-lahendustesse investeerimine on aidanud paljudel ettevõtetel oma tulemusi parandada. Autor teeb ülevaate ajakirjas BusinessWeek avaldatud edukamatest internetiprojektidest. Lisa: Internetiäri teine laine

  1. Mis on fototeooria? II / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2001-01-01

    Kaasaegsete fototeooriate tunnusjooni. New Left ja fotograafiline pildiesitlus. Reklaam kui kodanlik-liberaalne ideoloogia. Vasakpoolsetest metoodikatest: "väljendus ja tähendus". Opositsiooniliste teooriate saavutustest. Viimased arengud fototeoorias.

  2. Moskvasse? - Tänan, ei! / Peeter Tulviste

    Index Scriptorium Estoniae

    Tulviste, Peeter, 1945-2017

    2005-01-01

    Autor analüüsib Venemaa poolt Eesti vastu õhkuva vale, vaenu ja laimu põhjuseid ning kiidab heaks president Arnold Rüütli otsuse mitte osaleda 9. mai pidustustel Moskvas. Ilmunud ka Koit, 2005/Mar/12, lk. 6 ; Nädaline, 2005/Mar/15, lk. 5 ; Pärnu Postimees, 2005/Mar/17, lk. 11 ; Hiiu Leht, 2005/Mar/18, lk. 2 ; Meie Maa, 2005/Mar/18, lk. 2

  3. Raamatud popiks - filmide abiga / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2011-01-01

    HBO telesari "Troonide mäng", mis on George R. R. Martini "Jää ja tule laulu" sarja esimese raamatu teleekraniseering, on tõstnud huvi raamatute vastu. Ka teistest näidetest, mil telesarja või filmi abil on kirjanikest saanud superstaarid

  4. Euroopa kultuuriruumis matkates / Peeter Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    2002-01-01

    Rektor Gustav Ewers 19. sajandi alguse Tartu kultuuriruumis, lk. 140-155 ; Mozartist ja akadeemilise biograafia kirjutamise metoodikast, lk. 155-157 ; Tegudemees Carl Gustav Jochmann (1789-1830), lk. 158-159 ; Professor Martensi tagasitulek, lk. 160-163 ; Hans-Georg Gadameri jõudmine eesti keelde, lk. 163-165 ; Unustatud geeniuse tagasitulek, lk. 166-168 ; Kannab Eestit südames: Boris Meissner 85, lk. 168-170 ; Professor Heikki Ylikangas, üks tõeline soomlane - 65, lk. 170-172 ; Ungari 1956 ühe hõimukaaslase saatuse kaudu, lk. 173-179

  5. Intervjuu Theo van Leeuweniga / intervjueerinud Peeter Linnap

    Index Scriptorium Estoniae

    Leeuwen, Theo van, 1947-

    2011-01-01

    Hollandi visuaalsemiootik pildist kui keelest, kunstiajaloo ja lingvisti teadmiste ühendamise vajadusest, koostööst Gunther Kressiga, kunstiliste ja mittekunstiliste pildivormide suhetest, PowerPointist kui semiootilisest ja kultuurilisest ressursist

  6. Halloween sunnib investori ostulainele / Peeter Koppel

    Index Scriptorium Estoniae

    Koppel, Peeter

    2004-01-01

    Ilmunud ka: Delovõje Vedomosti 29. sept. lk. 2. Aktsiaturgudel levinud ja tõestust leidnud legendi kohaselt tähistab 30. oktoober ka päeva, mille vahetus ümbruses turule sisenejad on vähemalt ajalugu vaadates olnud suhteliselt edukad. Diagramm. Kommenteerib Romet Kreek

  7. Nesseri kuri maailm / Peeter Künstler

    Index Scriptorium Estoniae

    Künstler, Peeter, 1958-2009

    1996-01-01

    Arvustus: Nesser, Hõkan. Borkmanni punkt / Tlk. Vladimir Beekman. Tln. : Eesti Raamat, 1996; Nesser, Hõkan. Jämeda silmaga võrk / Tlk. Vladimir Beekman. Tln. : Eesti Raamat, 1996; Nesser, Hõkan. Tagasitulek / Tlk. Vladimir Beekman. Tln. : Eesti Raamat, 1996

  8. Mälu, kallis vara / Peeter Maimik

    Index Scriptorium Estoniae

    Maimik, Peeter, 1944-2010

    2009-01-01

    Poola ohvitseride mõrvamisest NKVD poolt 1940. aastal Katõnis, Andrzej Wajda selleteemalisest filmist "Katõn" ja ajaloolise mälu säilitamise olulisusest. Inimsusevastaste kuritegude uurimise rahvusvahelise komisjoni uurimistööst, mis käsitleb Saksa ja Nõukogude okupatsioone Eestis

  9. Koolijuhi amet muutub stabiilseks / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2008-01-01

    Seadusest, mis annab koolidirektoritele tagasi tähtajatu töölepingu. Ilmunud ka Võrumaa Teataja 15. aprill 2008, lk. 2 ; Koit 15. aprill 2008, lk. 6 ; Pärnu Postimees 16. aprill 2008, lk. 15 ; Oma Saar 15. aprill 2008, lk. 5 ; Hiiu Leht 15. aprill 2008, lk. 2 ; Harju Ekspress 18. aprill 2008, lk. 6 ; Vooremaa 17. aprill 2008, lk. 2 ; Meie Maa 17. aprill 2008, lk. 2 ; Lääne Elu 15. aprill 2008, lk. 2 ; Kuulutaja 18. aprill 2008, lk. 4 ; Põhjarannik 18. aprill 2008, lk. 2

  10. Mis toimub poeriiulite taga? / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2008-01-01

    Andmebaasi SINfOS kantakse kõik Eestis müüdavad toidu- ja esmatarbekaubad. Vt samas: intervjuu AS-i A-Selver tegevdirektori Iivi Saarega. Lisa: SINFOS küsib; SINFOS Euroopas ja Eestis; GS1 Estonia kujunemislugu; GS1 Estonia rahalised allikad; Tulekul on uus vöötkoodistandard; Tasuline liitumine

  11. Harrastusluuletajate osadus kasvab / Peeter Künstler

    Index Scriptorium Estoniae

    Künstler, Peeter, 1958-2009

    1997-01-01

    Arvustus: Rahman, Jan. Vasõst vask; Serpent, Francois. Ka Jumal on inimene; Märka, Veiko. Tühja aju korinad; Rüütle, Indrek. Lahkumine Puhjast (kõik Eesti Kostabi Seltsi Kaasaegse Kirjanduse Keskuse väljaanded, 1997)

  12. Intervjuu John Taggiga / intervjueerinud Peeter Linnap

    Index Scriptorium Estoniae

    Tagg, John, 1949-

    2011-01-01

    Inglise kunsti- ja kirjandusteaduste professor 1980. aastate Inglismaa Thatcheri-aegsetest radikaalsetest reformidest, dokumentaalfotograafia taotlustest, kaasnähtustest ja võimu ning tähenduse problemaatikast, fotograafilisest tehnoloogiast kui võimu teostamisest visuaalide abil. Ka oma populaarsemast teosest "The Burden of Representation" (Esitluse koorem)

  13. Vastse juubilari ajalood / Peeter Künstler

    Index Scriptorium Estoniae

    Künstler, Peeter, 1958-2009

    1997-01-01

    Arvustus: Remsu, Olev. Artur Magnussoni suur sõjasuvi : [lühiromaan]. Tallinn : Eesti Raamat, 1997; Remsu, Olev. Tšingis-khaan on Ungern-Sternberg : [näidend]. Tallinn : Perioodika, 1997. (Loomingu rmtk.; 35)

  14. Mis on fotograafia teooria? / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2001-01-01

    Eri kultuurivaldkondade esindajate uurimused fotograafiast. Neli diskursust fotograafia käsitamisel. Teooriate ajaloost: foto-kui-ime periood, fotograafia leiutamine - pragmaatika ja fantaasiad, modernism fotograafia teooriates, semiootika ja fotograafia.

  15. Mis on fotograafia teooria? / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2007-01-01

    Eri kultuurivaldkondade esindajate uurimused fotograafiast. Neli diskursust fotograafia käsitamisel. Teooriate ajaloost: foto-kui-ime periood, fotograafia leiutamine - pragmaatika ja fantaasiad, modernism fotograafia teooriates, semiootika ja fotograafia. Kaasaegsete fototeooriate tunnusjooni. New Left ja fotograafiline pildiesitlus. Reklaam kui kodanlik-liberaalne ideoloogia. Vasakpoolsetest metoodikatest: "väljendus ja tähendus". Opositsiooniliste teooriate saavutustest. Viimased arengud fototeoorias. Ilmunud ka ajalehes "Sirp", 2001, 10. ja 17. august

  16. Distsiplinaarne fotograafia ja interdistsiplinaarne kunstiparadiis / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2003-01-01

    Vastuseks H. Soansi ja A. Härmi artiklile "Mõned teravad polaroidid" (Sirp, 2003, 13. VI, lk. 17). Eesti 90-ndate ja praegune fotograafia. Fotograafia: mono- ja interdistsiplinaarne. Fototeooriate regulaarne surm

  17. Saurix rõhub kvaliteedile / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti : Desjatiletnije firmõ 2. veebr. lk. 2. AS Saurix Petroleum sai oma püüdluste kinnituseks kaks ISO sertifikaati kvaliteedi- ja keskkonnajuhtimissüsteemi eest. Vt. samas: Salapärase palgamaksja taga on Saurixi omanikud. Diagrammid: Aleksei Tshuletsi käes on lõviosa aktsiatest; Saurix Petroleum prognoosib kasumi langust

  18. Kivikuulide saladus / Marielle Liivet, Peeter Ernits

    Index Scriptorium Estoniae

    Liivet, Marielle

    2001-01-01

    Costa Rica dzunglitesse peitunud hiiglaslikke kivikuule kasutati ilmselt meremeeste koolitamisel. Costa Rica ülikooli õppejõud eestlane Ivar Zapp on kirjutanud neist raamatu "Atlantis in America". Joonis : Orientiirid meresõitjatele

  19. Tihii omut / Peeter Rebane ; interv. Aleksandra Manukjan

    Index Scriptorium Estoniae

    Rebane, Peeter, 1973-

    2004-01-01

    Uuest kohvikust ja gei-klubist "Angel" Tallinnas. Stiilse atmosfääri loomisel olid abiks stilist Gerly Tinn, graafikadisainer Rain Pikand ja reklaamifirma Division. Sisekujunduse tegi disainer John Gregg Suurbritanniast

  20. Baltluse sarm / Peeter Künstler

    Index Scriptorium Estoniae

    Künstler, Peeter, 1958-2009

    1999-01-01

    Arvustus: Bergengruen, Werner. Surm Tallinnas / saksa keelest tõlkinud Rein Sepp, Mati Sirkel. Tallinn : Varrak, 1999. Schultz-Bertram, Georg Julius. Tartu tudengid viiskümmend aastat tagasi / saksa keelest Viktor Sepp. Tallinn : Perioodika, 1999. (Loomingu Raamatukogu; 17)

  1. Joonestamine lõimib õppeaineid / Peeter Sokolov

    Index Scriptorium Estoniae

    Sokolov, Peeter

    2012-01-01

    Joonestamine seob endaga kujutava geomeetria, insenerigraafika, matemaatika, füüsika, tugevusõpetuse ja veel palju õppeaineid. Kuna joonestamise CAD-i programmid on interdistsiplinaarsed, aitab joonestama õppimine aru saada ka teistest õppeainetest

  2. Eesti fotograafiast 1900-1940 / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2010-01-01

    Allikatest ja hitoriograafiast. Eesti fotoajaloo historiograafilised lätted. Fotokunstnike sõnastatud taotlustest 1920.-1930.aastatel. Fotokunsti staatusest de facto - kunstikriitika seisukohti. "Uue" kunstiliigi evolutsioonimehhaanikast. Isiksusi Eesti fotograafias 20. sajandi 1. poolel. Fotograafide organisatsioonid. Fotode pildiline keskkond. Ajakirjandusfotost enne II maailmasõda. Montaaž.

  3. Miks mitte parima hariduskorraldusega riigiks? / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2006-01-01

    Ilmunud ka: Pärnu Postimees, Meie Maa, Virumaa Nädalaleht 1. sept. lk. 15,2,13, Põhjarannik, Severnoje Poberezhje 2. sept. lk. 2, Valgamaalane, Järva Teataja, Virumaa Teataja, Võrumaa Teataja, Vooremaa 5. sept. lk. 2,2,11,2,2, Sõnumitooja 6. sept. lk. 2, Hiiu Leht 12. sept. lk. 2. Autori sõnul peaks majanduslike eesmärkide asemel esikohale asetama haridusalased eesmärgid, selleks pakub ta välja omapoolsed lahendused

  4. Lõpetame raiskamise, mitte kulutamise / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2008-01-01

    Keerulisest majandusolukorrast välja tulemiseks tuleb lõpetada raiskamine, kuid mitte kulutamine. Autori sõnul põhjustab raiskamist alus- ja põhiharidusse piisavate kulutuste tegemata jätmine pika aja jooksul; raiskamist tähendab pisikestel omavalitsustel põhinev haldusstruktuur. Eesti vajab Riigikogu tulevikukomisjoni

  5. Kas maavanemale tuleb nutsu anda? / Peeter Ernits

    Index Scriptorium Estoniae

    Ernits, Peeter, 1953-

    2007-01-01

    Bussitranspordi korraldamisel on tegu turuvõitlusega, enamikus maakondades on vastamisi kaks konkurenti Go Bus ja Atko. Pole maakonda, kus kaotaja ei oleks riigihanget kohtus vaidlustanud. Vt. samas: Sirje Niitra. Go Busi töö on häiritud; Intervjuu majandus- ja kommunikatsiooniminister Juhan Partsiga

  6. Stress testing - ettevaatliku investori abimees / Peeter Teder

    Index Scriptorium Estoniae

    Teder, Peeter

    2005-01-01

    Autor selgitab stress testingut kui investeerimisportfelli varade väärtuse hindamist ning tutvustab selle võimalusi ja ohtusid. Diagrammid: Portfelli testimis-stsenaariumiks sobivad hästi börsikrahhid. Vt. samas: Stress testing toimib ka mujal

  7. Moslemi Vennaskond - hunt lambanahas / Peeter Espak

    Index Scriptorium Estoniae

    Espak, Peeter, 1979-

    2011-01-01

    Autori hinnangul jääb loota et USA kaasabil suudetakse võimul hoida Egiptuse konstitutsiooni ja üleüldist seaduslikkust austav valitsus, kes välistaks edaspidi kõikide usuliselt motiveeritud parteide võimuletuleku

  8. Inimkäsitlusi filosoofias / Peeter Pints

    Index Scriptorium Estoniae

    Pints, Peeter

    1997-01-01

    Käsitlemist leiavad Confucius, Sokrates, Augustinus, M. Luther, B. Pascal, N. Macchiavelli, Erasmus Rotterdamist, T. Hobbes, J. Locke, Ch.L. Montesqieu, J.J. Rousseau, Cl. Helvetius, I. Kant, J. Condorcet, F.W. Hegel, L. Feuerbach, K. Marx, H. Maine de Biran, F.W. Schelling, M. Stirner, A. Schopenhauer, L. Morgan, E. Taylor, L. Levy-Bruhl, W. McDougall, H. Spencer, O. Spengler, Cl. Levy-Strauss, S. Kierkegaard, M. Weber

  9. Equationally Compact Acts : Coproducts / Peeter Normak

    Index Scriptorium Estoniae

    Normak, Peeter

    1998-01-01

    In this article equational compactness of acts and its generalizations are discussed. As equational compactness does not carry over to coproducts a slight generalization of c-equational campactness is introduced. It is proved that a coproduct of acts is c-equationally compact if and only if all components are c-equationally campact

  10. Armastuse feng shui / Peeter Rüberg

    Index Scriptorium Estoniae

    Rüberg, Peeter

    2000-01-01

    Järg Jan/13;20;27/Feb/3;10;17;23/Mar/2;9;16 ;30/Apr/13/May/4;11 lk. 22;38;56;70;87;102;118;134;150;166;198;230;278 ;296Vanal hiina kodu- ja elukunstil on igaks armuelu juhtumiks varuks praktilisi nõuandeid ja võtteid

  11. Aldera Invest siseneb pealinna hotelliturule / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 6. apr. lk. 4. Eestis tegutsevale Vene ärimehele Ruslan Rastoshtshenkovile kuuluv kinnisvarafirma Aldera Invest on Tallinna kinnisvaraturul tõusnud arvestavaks tegijaks. Vt. samas: Aldera Investi arendatavad kinnisvaraprojektid Tallinnas; Andres Koger: Aldera Investi mehed eelistavad varju jääda; Rastoshtshenkovi kinnisvaraväline äri

  12. Moskvasse? - Tänan, ei! / Peeter Tulviste

    Index Scriptorium Estoniae

    Tulviste, Peeter, 1945-2017

    2005-01-01

    Ilmunud ka Põhjarannik (2005/Mar/11) lk. 2 ; Severnoje Poberezhje (2005/Mar/11) lk. 2 ; Elva Postipoiss (2005/Mar/12) lk. 2 ; Võrumaa Teataja (2005/Mar/12) lk. 2 ; Koit (2005/Mar/12) lk. 6 ; Nädaline (2005/Mar/15) lk. 5 ; Pärnu Postimees (2005/Mar/17) lk. 11 ; Hiiu Leht (2005/Mar/18) lk. 2 ; Meie Maa (2005/Mar/18) lk. 2. Autor analüüsib Venemaa poolt Eesti vastu õhkuva vale, vaenu ja laimu põhjuseid ning kiidab heaks president Arnold Rüütli otsuse mitte osaleda 9. mai pidustustel Moskvas

  13. Morita duality for monoids / Peeter Normak

    Index Scriptorium Estoniae

    Normak, Peeter

    1990-01-01

    In this paper Morita duality for monoids is introduced. Necessary and sufficient conditions for two monoids S and T to be Morita dual are given. Moreover, it is shown that if S and T are Morita dual monoids, then S and U are Moriaddition, every finite monoid having Morita duality is selfdual and even reflexive.

  14. Mine, Mailis, õige...Helsingisse! / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2007-01-01

    Autor kritiseerib Keskerakonna valimislubadusi ametnike palkade tõstmiseks ja kooliõpilaste kultuurireisideks ning leiab, et hariduse ühtlane kättesaadavus ja hariduslike võimaluste võrdsus peaks olema meie tähtsaim strateegiline eesmärk

  15. Intervjuu prof. Geoffrey Batcheniga / intervjueerinud Peeter Linnap

    Index Scriptorium Estoniae

    Batchen, Geoffrey, 1956-

    2011-01-01

    Fotograafia leiutamise ühiskondlikust vajadusest 19. sajandil - tahtest fotografeerida, et aega kas või ajutiselt fikseerida, Foucault', Derrida ja Barthes'i fotograafiat puudutavatest tekstidest, nende analüüsist ja kontekstualiseerimisest teiste kultuurinähtustega ka autori teostes, eriti raamatus "Burning with Desire"

  16. Narkomaania Eestis 2002. aastal / Peeter Lasting

    Index Scriptorium Estoniae

    Lasting, Peeter

    2003-01-01

    3. septembril 2003. a. Sotsiaalministeeriumis toimunud infotunnist, kus ajakirjanikele tutvustati lõppevat PHARE projekti "Euroopa Liidu PHARE toetus riikliku narkostrateegia ja programmi välja arendamiseks ning elluviimiseks". Lisatud statistilised tabelid amfetamiini ja ectasy kasutamise kohta aatatel 1995-1999, B- ja C-viirushepatiiti haigestumuse kohta aastatel 1995-2000 ning uimastitega seotud surmajuhtumite osakaalu kohta aastatel 1997-2001

  17. Cine de las Americas / Peeter Riba

    Index Scriptorium Estoniae

    Riba, Peeter, 1967-

    2004-01-01

    Tallinna VIII Pimedate Ööde Filmifestivali filme - Ladina-Ameerika mängufilmid "Jumalate linn" ("Cidade de Deus") : režissöör Fernando Meirelles : Brasiilia 2002 ; "Pardihooaeg" ("Temporada de patos") : režissöör Fernando Eimbcke : Mehhiko 2004 ; "Teiselpool tänavat" ("O outro lado da rua") : režissöör Marcos Bernstein : Brasiilia 2004

  18. Õnnelik Cecilia / Peeter Rebane

    Index Scriptorium Estoniae

    Rebane, Peeter, 1973-

    2005-01-01

    Pärnu 19. dokumentaal- ja antropoloogiafilmide festivalil nähtavatest dokumentaalfilmidest jõuab teleekraanile seitse filmi armastusest ja abielust. Filme arvustavad Eesti kultuuri- ja ühiskonnategelased. Dokumentaalfilm "Isainstinkt", režissöör Murray Nossel

  19. Põlvkonnaromaan saksa nooremas kirjanduses / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2006-01-01

    Ülevaade järgmistest teostest: Christian Krachti "Faserland" (1995), Florian Illiesi ""Golfi" generatsioon" (2001), Annegret Kunkeli (tegel. Sophie Dannenberg) "Revolutsiooni pleekinud süda", Uwe Tellkampi "Jäälind", Karen Duve "See ei ole armastuslaul", Andreas Maieri "Kirillov"

  20. Saladusliku Sandu Hubani miljonid / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2005-01-01

    Eesti ühe edukaima hokiklubi Välk 494 rahastaja Sandu Hubani alias Aleksandr Gubani tegevusest, ettevõtlusest ja äritegevusest. Lisad: Hubani osalused firmades; Ettevõtted, millega Huban enam seotud ei ole; Välk 494 seob Hubani ja tema äripartnereid. Kommenteerivad Meelis Birk, Enriko Lukecha, Aivo Pärn

  1. Vaimud kolivad ekraani taha / Peeter Riba

    Index Scriptorium Estoniae

    Riba, Peeter, 1967-

    2003-01-01

    Režissöör Gore Verbinski lavastatud õudusfilm "Ring" ("The Ring") : Ameerika Ühendriigid 2002. Võrdlus jaapanlase Hideo Nakata filmiga 1998. aastast "Ringu" ("Telefonihelin"), mille uusversiooniks Verbinski filmi võib pidada

  2. Peeter Kreitzberg : kui poliitika trügib sporti / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2005-01-01

    Vestlus Eesti Spordiseltsi Kalev esimehega kriitikast seltsi juhtkonna juhtimisstiili kohta, kinnisvaratehingutest ja erakorralise üldkoosoleku kokkukutsumisest. Samas ka lühiintervjuu Riho Soonikuga

  3. Peeter Kreitzberg : võtame vaestelt lapsed ära! / Peeter Kreitzberg ; interv. Helen Urbanik

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Endine haridusminister tuli märtsi keskel konverentsil "Teine võimalus hariduses" välja ettepanekuga, et lastele peaks koolis käimine olema kohustuslik 18. eluaastani, riigi pansionidesse ja internaatidesse tuleks panna need lapsed, kelle pered ei jaksa neid üleval pidada. Autori täiendus 3. mai Eesti Ekspressi kirjade rubriigis (lk. A6) pealkirja all: Pakkusin vanematele võimalust, mitte vaeste laste konfiskeerimist. Autor: Keskerakond. Parlamendisaadik

  4. Peeter Kreitzberg : Ma ei ole Savisaare käskjalg / Peeter Kreitzberg ; interv. Maarius Suviste

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Presidendikampaaniast ja presidendi missioonist. Kriitikat president Lennart Meri tegevuse kohta. Miks Eesti ei ole naispresidendikandidaati. Keskerakonna imago ja Edgar Savisaar. Eesti: probleemid ja tulevik. Autor: Keskerakond. Parlamendisaadik

  5. Eesti Suusapäevad Jay Peak´is / Peeter Teedla ; fotod: Peeter Teedla

    Index Scriptorium Estoniae

    Teedla, Peeter

    2006-01-01

    märtsikuu esimesel nädalalõpul idaranniku eestlaste suusapäevad, osavõtjaid 156, paljud perekondade ja väikeste lastega, organiseerijaks Kristin Raamot. Peeti murdmaasuusatamise - ja slaalomivõistlused

  6. Saaremaa lad brings FBI conference to Estonia / Kalle Laanet ; interv. Rein Sikk

    Index Scriptorium Estoniae

    Laanet, Kalle, 1965-

    2007-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad tema õpinguid FBI akadeemias, Tallinnas toimuvat FBI konverentsi ning Eesti sisejulgeolekut. Lisa: Estonian Police statistics; Registered crimes in Estonia; From police officer to minister; What happened in April?

  7. Digiretsepti hoitakse koomas. Kas tuleb välja? / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2010-01-01

    Haigekassa, sotsiaalministeeriumi, arstide ja apteekrite osalusel toimus digiretseptiteemaline koosolek. Prognoosid digiretseptisüsteemi mahtude kohta pole olnud piisavad, võrreldes praegusega peaksid serverid suutma eneses hoida 5-8 korda suuremat andmemahtu. Sotsiaalministeerium tellib auditi kogu süsteemile. Apteekrite ja arstide arvamusi

  8. Sonda Sassi sõda tõi metsnikele lisapensioni / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2005-01-01

    Endine metsaülem Aleksander Sinimäe võitles endistele metsaülematele, metsnikele ja metsavahtidele välja lisapensioni. Kommenteerib õiguskantsleri asetäitja-nõunik Aare Reenumägi. Lisa: Reiljan: pensioni tulebki maksta

  9. Pragmatism, feminism ja lingvistiline pööre / Nancy Fraser ; tõlk. Merilin Sikk

    Index Scriptorium Estoniae

    Fraser, Nancy

    2006-01-01

    Üks feministliku teoretiseerimise olulisemaid ja raskemaid ülesandeid on ühendada soolise tähistamise diskursiivsed analüüsid institutsioonide ja poliitökonoomia strukturaalsete analüüsidega, väidab autor

  10. Miks märts võttis meilt nii palju suurkujusid? / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2016-01-01

    Märtsis lahkus meie seast ridamisi suurmehi. Kas tänavune märts oli surmade poolest kurjakuulutavalt eriline. Sel teemal vastavad küsimustele hingearst Jüri Ennet, perearst Diana Ingerainen, folklorist Marju Kõivupuu ja kirikuõpetaja Jaan Tammsalu

  11. Hooldekodu sulgemine suretab Vao küla välja / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2010-01-01

    Väike-Maarja vald käib sotsiaalministriga kohut Aavere hooldekodu likvideerimise pärast. Vallas leitakse, et ühelt poolt püüab ministeerium küll seista väetite hooldekodu elanike eest, teisalt aga jätab otsus Vaos ja lähikonnas umbes 30 inimest tööta, rääkimata küla hukule määramisest

  12. The new synagogue has given the Jewish community something to sing and dance about / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2007-01-01

    Tallinnas Karu tänaval avati 16. mail 2007 uus juudi sünagoog, avamistseremoonial viibisid Iisraeli asepeaminister Shimon Peres, Eesti president Toomas Hendrik Ilves, peaminister Andrus Ansip, Venemaa pearabi Berl Lazar, Iisraeli pearabi Yona Metzger ja sünagoogi suurrahastaja Aleksander Bronštein. President Toomas Hendrik Ilves viitas oma kõnes paralleelidele eestlaste ja juutide ajaloos

  13. Viru-Jaagupi soovib pastori kogu tagasi / Rein Sikk, Aarne Mäe

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2004-01-01

    Viru-Jaagupiga seotud inimesed arutavad võimalust tuua Lääne Maakonna Keskraamatukogust tagasi osa pastor Madis Oviiri raamatukogust ja käsikirjadest, mis kingiti raamatukogule, sest Lääne-Virus ei suudetud unukaalse pärandi hoidmist tagada. Sama ka: Lääne Elu, 14. okt., lk. 4

  14. About applying the principles of sustainable development to tourism industry / Piret Ilver, Juta Sikk

    Index Scriptorium Estoniae

    Ilver, Piret

    2006-01-01

    Eesti säästva arengu seadusele tuginedes on välja töötatud riiklik turismi arengukava ning säästev areng on muutunud turismipoliitikas prioriteetseks seisukohaks, põhimõtteks, et turism saab areneda ainult siis, kui austatakse looduslikke ja kultuurilisi tingimusi

  15. Faktooring käibevahendite finantseerimise vahendina / Ivar Sikk, Kaido Kallas

    Index Scriptorium Estoniae

    Sikk, Ivar

    2002-01-01

    Faktooring on väga paindlik käibevahendite finantseerimise vahend, mis sobib kõikidele ettevõtetele, kes pakuvad või soovivad pakkuda oma kauba või teenuse ostjatele maksetähtaega. Tabelid. Joonised

  16. Ratastooli-Phil lõikas ministri jalad ära / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2003-01-01

    Sotsiaalminister Marko Pomerantsi ja Phare programmi koostööna läbi viidud üritusest "Puuetega inimeste tööhõive edendamine", kus osales ka inglise puuetega inimeste õiguste eest võitleja Phil Friend

  17. Ekspertiis tunnistas Vigala kiriku ülevärvitud altari kahjustatuks / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2005-01-01

    Kanuti ennistuskoja eksperthinnang Vigala kiriku ülevärvitud kantsli ja altari seisundi kohta. Altar ja kantsel on valmistatud Christian Ackermanni töökojas 17/18. sajandil. Altari ülevärvimise skandaal

  18. Kalurid : valitsus räimepüügile / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2005-01-01

    Ilmunud ka: Infopress 3. juuni nr. 22 lk. 29. Tormikahjusid kompenseeritakse üksnes omavalitsuse osalusega sadamas ning olenemata osaluse suurusest. Mõne valla osalus on alla 1%. Pärnumaa Audru vallavanema Rein Talisoo arvamus riigiabi jagamise kohta, Lindi sadama juhatuse esimees Jüri Kivirand Lindi sadama kahjudest. Kommenteerib Jaan Õunapuu

  19. Sokivabrik Suva põrutab soomlaste etnomustritega Soomet vallutama / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2009-01-01

    AS Suva sokkide müügiedust, tootearendusest. Vabriku disainer on Leila Tamm. Suurt tähelepanu pälvinud rahvusmustritega etnosari sündis koostöös Eesti Kunstiakadeemia tekstiilieriala üliõpilastega. Kalevala sarja sokkidega minnakse Soome turule

  20. Ohio koolitüdruku parim reis viis ta Eesti saatkonda / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2006-01-01

    Eesti saatkonnas Washingtoni töötab administraatorina USA rahukorpuse liikmena Eestis töötanud Blaine Carvalho. Suursaadik Jüri Luik ei kahtle, et USA presidendi George W. Bushi visiidil Eestisse tõstatatakse viisavabaduse küsimus

  1. Kangur Ivan ajab triipu, naised lähevad arust ära / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2011-01-01

    Ivan Uvarovist, kes koob oma pisikeses töökojas Rakveres rahvarõivamustritega puuvillast triibukangast, mille järele on suur nõudmine. Ivan Uvarov on töötanud 30 aastat kangastelgede mehaanikuna

  2. Võsu rahvas näitleb, Albu ootab teatreid / Avo Seidelberg, Rein Sikk

    Index Scriptorium Estoniae

    Seidelberg, Avo

    2007-01-01

    Võsu Rahva Teatris etendus näitemäng "Vanim amet" autor ja lavastaja kohalik näitekirjanik ja lavastaja Luule Aasmäe. Albu mõisa rehehoones hakatakse lavastama Eduard Vilde romaani "Prohvet Maltsvet". Teksti kirjutasid Urmas Lennuk ja Mart Koldits, viimane on ka tüki lavastaja

  3. Tallo: IT-ala vajab arhitekti kätt / Ivar Tallo ; intervjueerinud Rein Sikk

    Index Scriptorium Estoniae

    Tallo, Ivar, 1964-

    2010-01-01

    Autor analüüsib ebaõnnestumisi avaliku sektori IT-projektides ning ütleb, et kõige suurem kaotus on olnud usalduse kaotus uute e-lahenduste vastu. Riigis peaks olema üks inimene, kes vastutaks kogu avaliku sektori IT eest

  4. Brudstrukturer i dansk

    DEFF Research Database (Denmark)

    Thrane, Torben

    2001-01-01

    Investigation of a peripheral construction type in Danish (expressions introduced by 'sikke'), and a proposal for a uniform analysis.......Investigation of a peripheral construction type in Danish (expressions introduced by 'sikke'), and a proposal for a uniform analysis....

  5. Eestlased graafikanäitustel / Benjamin Vasserman

    Index Scriptorium Estoniae

    Vasserman, Benjamin

    1999-01-01

    IV Kochi graafikatriennaalil Jaapanis 13. III-18. IV osales Eestist Benjamin Vasserman tööga "Vaheldus I". Peapreemia: Eduardo Roca Zalazar. XIV rahvusvahelisel graafikanäitusel "Premio Internationale Biella per I'Incisione" Itaalias 23. IV-23. V osalesid Eestist Peeter Allik, Reti Saks, Benjamin Vasserman. Näituse nimeline preemia: Seung Yeon Kim. 26. VIII avati Fredrikstadis 12. Norra rahvusvaheline graafikatriennaal. 5. nov. avatakse X Varna graafikabiennaal Bulgaarias, 15. XII ئ III Egiptuse graafikatriennaal Gizas. "International Print Triennial Cracow 2000" näitustest

  6. Uued muutused nõuavad enam selgitustööd / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Euroopa Liidu otsustest ja nende tähtsusest ning selgitamise vajadusest. Ilmunud ka Koit 22. jaan. 2008, lk. 6, pealkiri kujul: Muutused nõuavad poliitikutelt järjest enam selgitustööd, Meie Maa 22. jaan. 2008, lk. 2 ; Sakala 24. jaan. 2008, lk. 2 ; Valgamaalane 22. jaan. 2008, lk. 2 ; Virumaa Teataja 25. jaan. 2008, lk. 11 ; Lääne Elu 24. jaan. 2008, lk. 2 ; Pärnu Postimees 5. veeb. 2008, lk. 19

  7. Ohutusnõuded laste mänguasjadele muutuvad senisest karmimaks / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Euroopa Komisjoni avaldatud kauaoodatud mänguasjade ohtuse direktiivi eelnõust, mis reguleerib siin müüdavate mängukannide ohutusnõudeid. Ilmunud ka Meie Maa 23. okt. 2008, lk. 2, pealkiri kujul: nõuded laste mänguasjadele muutuvad karmimaks ; Põhjarannik 23. okt. 2008, lk. 2 ; Järva Teataja 25. okt. 2008, lk. 2, pealkiri kujul: lelude ohutusnõuded karmistuvad ; Kuulutaja 24. okt. 2008, lk. 4 ; Oma Saar 6. nov. 2008, lk. 5 ; Pärnu Postimees 7. nov. 2008, lk. 15 ; Valgamaalane 11. nov. 2008, lk. 2

  8. Kes kaitseb röövelliku kiirlaenu eest? / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Kiirlaenudest ja nendega seonduvatest probleemidest Eestis, seaduseelnõust, mis suurendab SMS-laenu võtnute võimalusi kaitsta oma õigusi laenuandjate ees ning olukorra ohjeldamisest Rootsis ja Soomes. Ilmunud ka Pärnu Postimees 31. okt. 2008, lk. 11, pealkiri kujul: kaitse röövelliku kiirlaenu vastu ja tarbijakaitsepoliitika ; Lõunaleht 6. nov. 2008, lk. 4, pealkiri kujul: kes kaitseb röövelliku kiirlaenu eest ehk tarbijakaitsepoliitika lakmustest ; Vali Uudised 7. nov. 2008, lk. 2 ; Harju Ekspress 7. nov. 2008, lk. 8, pealkiri kujul: kes kaitseb röövelliku kiirlaenu vastu ehk tarbijakaitsepoliitika lakmustest ; Türi Rahvaleht 14. nov. 2008, lk. 4 ; Virumaa Teataja 14. nov. 2008, lk. 11, pealkiri kujul: kiirlaenud on test tarbijakaitsepoliitikale ; Kuulutaja 14. nov. 2008, lk. 4, pealkiri kujul: kes kaitseb kiirlaenu vastu ; Vooremaa 18. nov. 2008, lk. 2 ; Sõnumitooja 26. nov. 2008, lk. 2 ; Koit : Tarbijaleht 27. nov. 2008, lk. 10

  9. Onu Miltie mälestuseks ehk Mis seob New Orleansi ja Keilat? / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    16. novembril sai kaks aastat liberaalse majanduse guru Milton Friedmani surmast. Friedmani šokidoktriinist, katastroofikapitalismist ja pimedast usust erakapitali, ajal, mil Keila linnaisad olid otsustanud, et haridust hakkab munitsipaalkooli asemel edendama sihtasutus

  10. Valitsusliit jätab lasteaiaõpetajad virelema / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2004-01-01

    Koolieelsete lasteasutuste seaduse muutmise seaduseelnõu hääletati Riigikogu menetlusest välja, vanemahüvitistest. Ilmunud ka Pärnu Postimees 23. sept. 2004, lk. 15 ; Hiiu Leht 24. sept. 2004, lk. 2 ; Sakala 24. sept. 2004, lk. 2 ; Vali Uudised 24. sept. 2004, lk. 2 ; Nädaline 23. sept. 2004, lk. 4 ; Põhjarannik 24. sept. 2004, lk. 2 ; Türi Rahvaleht 24. sept. 2004, lk. 4, Meie Maa 28. sept. 2004. lk. 2 ; Koit 30. sept. 2004, lk. 6 ; Vooremaa 7. okt. 2004, lk. 2 ; Valgamaalane 16. okt. 2004, lk. 2

  11. Meie pühitsetud lipp / Peeter Laurits

    Index Scriptorium Estoniae

    Laurits, Peeter, 1962-

    2006-01-01

    Mel Gibsoni mängufilm "Kristuse kannatused" ("The Passion of the Christ") : Ameerika Ühendriigid 2004. Selle filmi näitel esitab kunstnik oma vaatekoha kristliku kiriku moraali, eetika ja poliitika kohta, kaheldava õiguse kohta õpetada eesti koolis usuõpetust. Sama artikkel ka kogumikus "Esseed. Ajalehes Postimees ilmunud esseed 2005-2007", Postimees 2007, lk. 59-63 : ill

  12. USA ajalehtede tiraazhid vähenevad / Peeter Teder

    Index Scriptorium Estoniae

    Teder, Peeter

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 8. nov. lk. 33. Peaaegu kõik USA suuremad ajalehed kannatasid viimasel aastal tiraazhide vähenemise all. Diagramm: New York Timesi aktsia hind. Vt. samas: Ajakirjandus raskuste lävel

  13. Positivistliku inimese negatiividest : fotograafilise portree tunnusjooni XIX sajandil / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2001-01-01

    Liikide teke ja areng XIX sajandi visuaalkultuuris. XIX sajandi panoptikum. Skoopiline printsiip kriminoloogias. Benettoni vs. Bismarcki stsenaarium etnograafilises fotoportrees. Etnoportree Eestis. Fotograafia naturaliseerimine. Ilmunud ka raamatus: Linnap, P. Silmakirjad. Tartu, 2007, lk. 70-74

  14. Ravnopravnõi Peeter / Vello Tafenau ; interv. Tatjana Opekina

    Index Scriptorium Estoniae

    Tafenau, Vello, 1952-

    2007-01-01

    Riigikogu rahanduskomisjoni aseesimees vastab küsimustele, kuidas ERL viib oma valimisprogrammi potentsiaalsete valijateni, kas Eesti on lõpuks teel sotsiaalse riigi poole, kuidas ERL-il õnnestus säilitada aastatel 2003-2005 koalitsioonis olles oma nägu, kuidas muuta ERL-i ideed profülaktilisest suunast meditsiinis tegelikkuseks, kuidas praegustes tingimustes parandada majandussuhteid Venemaaga, kas Erakonna Eestimaa Rohelised tulek ei meenuta Res Publica tulekut

  15. Zombilood / Robert Kirkman ; intervjueerinud Margit Tõnson, Peeter Helme

    Index Scriptorium Estoniae

    Kirkman, Robert

    2010-01-01

    Režissöör George A. Romero kultusfilmid zombidest "Elavate surnute öö", "Surnute koidik", "Surnute päev" jpt. on inspiratsiooniks koomiksikirjutaja Robert Kirklandile. Režissöör Frank Darabont on teinud tema tuntuimast koomiksiseeriast "The Walking Dead" teleseriaali "Kõndivad surnud". Zombiteema kasvavast populaarsusest ning intervjuu koomiksikirjutajaga

  16. Massiinimeste võidukäik Eesti kultuuriruumis / Peeter Rebane

    Index Scriptorium Estoniae

    Rebane, Peeter, 1973-

    2007-01-01

    Autor rõhutab, et sõnavabadusega kaasneb ka kohustus kuulata teiste kodanike arvamust, neid mitte ette hukka mõista, jääda enesekriitiliseks. Ta heidab osale Eesti haritlastest ette, et nad keskenduvad vaid oma tõe kuulutamisele. Enne oponentide ideede hukkamõistu ja massimeedia vahendusel poriga loopimist peaksid need haritlased oma oponendid eelarvamustevabalt ära kuulama

  17. Vranja v filme ne budjet / Peeter Simm ; interv. Vladimir Odintsov

    Index Scriptorium Estoniae

    Simm, Peeter, 1953-

    2006-01-01

    Režissöör oma tööst uue mängufilmiga "Georg", mis on Eesti, Venemaa ja Soome ühisprojekt lauljast Georg Otsast (stsenaristid Mati Põldre, Aleksandr Borodjanski, nimiosas Marko Matvere). Filmi võtted algavad septembris

  18. Eesti proosa 2007 - kultuuri ja tsivilisatsiooni vahel / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2010-01-01

    2007. a. ilmunud proosaraamatutest: Tiina Laanemi "Väikesed vanamehed", Ene Mihkelsoni "Katkuhaud", Toomas Vindi "Mäluauguga naine", Vahur Afanasjevi "Kaadrid otsustavad", Armin Kõomäe "Nägu, mis jäi üle" (ilmus 2006. a.), Jaan Kaplinski "Seesama jõgi", Tõnu Õnnepalu "Flandria päevik", Maimu Bergi "Unustatud inimesed", Mehis Heinsaare "Rändaja õnn", Mihkel Muti "Siseemigrant", Aarne Biini "Linna valitsemine", Ivar Silla "Tantsiv linn" ja Epp Annuse "Sina, Matilda"

  19. Eesti proosa 2007 - kultuuri ja tsivilisatsiooni vahel / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2008-01-01

    Ülevaade 2007. aasta eesti proosast. Käsitletakse järgimisi autoreid ja nende teoseid: Ene Mihkelson "Katkuhaud", Jaan Kaplinski "Seesama jõgi", Toomas Vint "Mäluauguga naine", Mehis Heinsaar "Rändaja õnn", Maimu Berg "Unustatud inimesed", Mihkel Mutt "Siseemigrant", Vahur Afanasjev "Kaadrid otsustavad", Epp Annus "Sina, Matilda", Ivar Sild "Tantsiv linn", Tiina Laanem "Väikesed vanamehed", Olle Lauli "Niguliste õpilased", Aarne Biin "Linna valitsemine", Jaan Aps ja Joonas Sildre "Hinglõõm". Ka Armin Kõomäe loomingust. Artikli aluseks on Eesti Kirjanduse Seltsi 2007. a. eesti kirjanduse ülevaatekoosolekul peetud ettekanne

  20. Mida on oodata lähiaastate hariduspoliitikas / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2007-01-01

    Ilmunud ka: Severnoje Poberezhje, 29. mai 2007, lk. 2; Virumaa Teataja, 31. mai 2007, lk. 15; Sakala, 31. mai 2007, lk. 2; Järva Teataja, 31. mai 2007, lk. 2; Harjumaa, 1. juuni 2007, lk. 2; Kuulutaja, 1. juuni 2007, lk. 2; Meie Maa, 1. juuni 2007, lk. 2; Nädalaleht, 1. juuni 2007, lk. 3; Vooremaa, 7. juuni 2007, lk. 2; Sõnumitooja, 13. juuni 2007, lk. 2; Lääne Elu, 16. juuni 2007, lk. 6; Lõunaleht, 21. juuni 2007, lk. 4; Pärnu Postimees, 24. juuli 2007, lk. 15. Riigikogu kultuurikomisjoni esimees Eesti hariduspoliitika eesmärkidest

  1. Eesti keel barbarite suus / David J. Peterson ; intervjueerinud Peeter Helme

    Index Scriptorium Estoniae

    Peterson, David J.

    2011-01-01

    USA telekanali HBO telesarjas "Troonide mäng" (mis on George R. R. Martini "Jää ja tule laulu" sarja esimese raamatu "Troonide mäng" teleekraniseering) tegeles dothraki keele loomisega keeleteadlane David J. Peterson

  2. Tartu uued ja uhked kortermajad / Peeter Tambu, Katrin Noppel

    Index Scriptorium Estoniae

    Tambu, Peeter

    2008-01-01

    Kortermajad Aleksandri 35 (Salto Arhitektuuribüroo OÜ), Siili 6 (Thomas Pucher&Alfred Bramberger Architects (Austria)) ja Ain Padriku ning Vilen Künnapu projekteeritud Tigutorn Tartus. Kommenteerib Christel Blaubrük AS Pini Kinnisvarast

  3. Kolmemõõtmeline Eesti kunst Szentendre Kunstiveskis / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2003-01-01

    Eesti tarbekunsti näitus "Ülestähendused". Avamisel näidati Jaanus Orgusaare rõivaste, jalanõude ja peakatete kollektsiooni. Kuraatoriteks-kujundajateks rühmitus F.F.F.F. (Ketli Tiitsar, Kristi Paap, Kaire Rannik, Maria Valdma). Keldrisaalis slaidiprogramm eesti harrastuskunstnike loomingust. Péter-Pali galeriis Anu Raua põimevaipade näitus

  4. Igavesti uuesti üllatav romaanivõistlus / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2009-01-01

    2008. a. romaanivõistlusel 1. auhinda välja ei antud. 2. auhinna võitis Milvi Martina Piiri romaan "Liblikad janus". 3. auhinna võitjaid oli kaks: Birk Rohelend romaaniga "Minu sõraline sõber" ja Marion Andra "Algolagnia". Ergutusauhinna võitnud romaanid: Liina Lüecke "Sügismüsteerium", Robert Kurvitza "Püha ja õudne lõhn", Robert Randma "Sigaret" ja Helju Petsi "Õnneõiteta sirelid"

  5. Romaanivõistlus 2008 - naised ruulivad! / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2009-01-01

    2008. a. romaanivõistlusel 1. auhinda välja ei antud. 2. auhinna võitis Milvi Martina Piiri romaan "Liblikad janus". 3. auhinna võitjaid oli kaks: Birk Rohelend romaaniga "Minu sõraline sõber" ja Marion Andra "Algolagnia". Ergutusauhinna võitnud romaanid: Liina Lüecke "Sügismüsteerium", Robert Kurvitza "Püha ja õudne lõhn", Robert Randma "Sigaret" ja Helju Petsi "Õnneõiteta sirelid"

  6. Kitsas tupikorus õilmitseb jätkuvalt vabadusehing / Peeter Kuimet

    Index Scriptorium Estoniae

    Kuimet, Peeter

    2007-01-01

    Põhja-Afganistani tadzhikkide juht Ahmad Shah Massoud võitles Panshiri orus nii Nõukogude vägede kui ka taliibide vastu. Massoudi hukkumisest 2001. aastal, hauakambri rajamisest ja kaasvõitlejate tegevusest. Lisa: Panshiri Lõvi

  7. Minni Kursk-Olesk 50-aastane / Peeter Tarvel

    Index Scriptorium Estoniae

    Tarvel, Peeter

    2002-01-01

    M. Kursk-Olesk'i 50. juubelile pühendatud artikkel sisaldab eluloolisi andmeid, ülevaadet tegevusest sotsiaaldemokraatlikus parteis ja ühiskondlikes organisatsioonides. Varem ilm.: Rahva Sõna, 4. märts 1929, lk. 5

  8. Lahkus ajaloofilosoof Reinhart Koselleck / Peeter Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    2006-01-01

    3. veebruaril 2006 surnud saksa ajaloofilosoofi, kuue teaduste akadeemia tegev- ja kirjavahetajaliikme, mitme ülikooli audoktori nekroloog. 2003. aastal esines ta meeldejäävate loengutega Eestis, Pärnu linn kinkis professorile akadeemilise palveränduri märgi

  9. Suremise viisid : intervjuu Christian Boltanskiga / interv. Peeter Linnap

    Index Scriptorium Estoniae

    Boltanski, Christian, 1944-

    2007-01-01

    Prantsuse kunstnik ja fotograaf oma 1990ndate töödest, 1999. aastal Soomes toimunud näitusest "Augustiöö", mille teemaks oli surm ja maalimisest kui ruumi loomise kunstist ning põhjustest miks ta nimetab end 20. sajandi lõpu maalikunstnikuks. Lisaks valik Christian Boltanski autobiograafilisest küsitlusest "Mida nad minust mäletavad?"

  10. Intervjuu Christian Boltanskiga : suremise viisid / intervjueerinud Peeter Linnap

    Index Scriptorium Estoniae

    Boltanski, Christian, 1944-

    2011-01-01

    Prantsuse kunstnik ja fotograaf oma 1990ndate töödest, 1999. aastal Soomes toimunud näitusest "Augustiöö", mille teemaks oli surm ja maalimisest kui ruumi loomise kunstist ning põhjustest miks ta nimetab end 20. sajandi lõpu maalikunstnikuks. Lisaks valik Christian Boltanski autobiograafilisest küsitlusest "Mida nad minust mäletavad?"

  11. Inimeste pension kadus LHV riskimängudes / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 17. jaan. lk. 8-9. Investeerimisfirma LHV investeeris pensionifondide raha firmasse Versio Holding, mille raskustest oldi teadlik ja mille tagajärjel kaotati 90% investeeringust. Küsimustele vastavad LHV Täiendava Pensionifondi juht Tõnno Vähk ja finantsinspektsiooni järelvalve divisjoni juht Andre Nõmm. Vt. samas: Kronoloogia; Diagramm. Vastuseks vt. Äripäev 3. apr. lk. 23

  12. Miks Osama bin Ladenit pole siiani tabatud? / Peeter Ernits

    Index Scriptorium Estoniae

    Ernits, Peeter, 1953-

    2008-01-01

    Afganistanis viibinud ajakirjaniku eesmärgiks oli teada saada, miks vaatamata kõigile püüdlustele vägivald Afganistanis siiski ei vähene ning kus varjab ennast Al Qaeda liider Osama bin Laden. Lisad: Osama bin Laden; 11. september 2001

  13. Intervjuu prof. Thomas W. J. Mitchelliga / intervjueerinud Peeter Linnap

    Index Scriptorium Estoniae

    Mitchell, Thomas W.J., 1942-

    2011-01-01

    Ameerika pilditeoreetik oma uurimustest, kirjanduse ja kunsti omavahelistest seostest, piltide mõjuvõimust, retoorikast ja funktsioonidest. Ka oma peamistest teostest "Iconology : Image, Text, Ideology", "Picture Theory" ja "What Do Pictures Want?"

  14. Politsei rakendaks roolijoodikutele aresti / Tõnis Sulu ; interv. Peeter Kuimet

    Index Scriptorium Estoniae

    Sulu, Tõnis

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 14. juuni lk. 6. Liikluspolitsei liiklusjärelevalve talituse juht räägib liiklusõnnetuste statistikast ja karistuspoliitikast, pidades vajalikuks joobes juhtide arestimajja paigutamist. Kommenteerib Sirje Lilleorg. Vt. samas: Liiklusekspert: Eesti vajab reaalselt toimivat veapunktisüsteemi. Liikluspsühholoog Gunnar Meinhardi arvamus

  15. Resistance ja Rootsi turvaühiskond / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2001-01-01

    "Vastupanukunsti" näitus "The Path of Resistance : MoMa meets Moderna" Stockholmi Moodsa Kunsti Muuseumis, kuraatorid Susan Kismaric ja Joshua Siegel. Resistance'i kunsti raames käsitletakse ka nn. poliitilist kunsti

  16. Evangeeliumi tähendus algkristlaste juures / Peeter Roosimaa

    Index Scriptorium Estoniae

    Roosimaa, Peeter

    2006-01-01

    Sõna evangeelium kasutamisest Uues Testamendis, antiikmaailmas ja algkristlaste juures. Evangeeliumist kui lepinguga seotud mõistest. Evangeeliumi seosest uue lepingu ja uue seadusega. Evangeeliumi mõiste kasutuselevõtust. Siinai-lepingust ja uuest lepingust

  17. Pärnu mnt 10 maja lugu / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2009-01-01

    Tallinna Vastastikuse Krediit-Ühisuse 1912. aastal Pärnu mnt 10 ehitatud majast, mis on alates Eesti taasiseseisvumisest 1991. aastal pakkunud rohkesti kõneainet nii rendi- kui müügiobjektina, jätkuvate kohtuvaidluste teema. ASi Elias moodustamisest ja tegevusest Pärnu mnt 10 hoones ning kinnistu müügist OÜle Vemarro

  18. Kanada invasioon pakub üllatusi / Peeter Riba

    Index Scriptorium Estoniae

    Riba, Peeter, 1967-

    2003-01-01

    PÖFFil linastuvaid Kanada mängufilme - Richard Kwietniowski "Mängur Mahowny" ("Owning Mahowny"), Denys Arcand'i "Barbarite sissetung" ("Les Invasions barbares"), Wiebke von Carolsfeldi "Marion Bridge" ja Thom Fitzgeraldi "Üritus" ("The Event")

  19. Ämblik teeb investori elu kergemaks / Peeter Koppel

    Index Scriptorium Estoniae

    Koppel, Peeter

    2002-01-01

    Ilmunud ka: Molodjozh Estonii 12. november lk. 7, Delovõje Vedomosti 13. november lk. 33. Investorite tähelepanu all on börsil kaubeldavad investeerimisfondid (ETF), millest osa kannab näiteks ämbliku, teemandi või kuubiku nime

  20. Eestit kattev NATO vihmavari kipub mitmest kohast lekkima / Peeter Kuimet

    Index Scriptorium Estoniae

    Kuimet, Peeter

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 8. nov. 2007, lk. 2. Hollandis Noordwijkis toimunud NATO kaitseministrite mitteametlikul kohtumisel anti põhimõtteline nõusolek vähendada osa NATO kiirreageerimisüksusesse NRF kuuluvate üksuste arvu. Eesti kaitseväe juhataja Ants Laaneotsa sõnul on see kärpimine Eestile problemaatiline. Lisa: NATO Responce Force

  1. Novel competition 2008 - women's and genre literature / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2009-01-01

    2008. a. romaanivõistlusel 1. auhinda välja ei antud. 2. auhinna võitis Milvi Martina Piiri romaan "Liblikad janus". 3. auhinna võitjaid oli kaks: Birk Rohelend romaaniga "Minu sõraline sõber" ja Marion Andra "Algolagnia". Ergutusauhinna võitnud romaanid: Liina Lüecke "Sügismüsteerium", Robert Kurvitza "Püha ja õudne lõhn", Robert Randma "Sigaret" ja Helju Petsi "Õnneõiteta sirelid"

  2. Investeerimisgurud jahivad tugevaid kaubamärke / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2004-01-01

    Indrek Rahumaa ja Andres Rätsep on loonud mõjuvõimsa investeerimisfirma Alta Capital ning investeerinud tuntud kaubamärkidesse. Kommenteerivad Tõnu Laak ja Tarmo Sumberg. Lisa: Klementist alanud investeeringud on jõudnud Lätti

  3. Andrus Ansipi-Edgar Savisaare õppekava / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2005-01-01

    Ilmunud ka: Virumaa Nädalaleht 7. oktoober lk. 5. Riigikogu liige on seisukohal, et valitsuse juht ei tohi olla ankurdatud võimaliku mineviku külge, mis teeb võimatuks eetilise hinnangu andmise oma kabinetiliikmete tegudele. Autor rõhutab, et Eesti poliitiline areng ei sõltu mitte niivõrd õigusest, kuivõrd õiglusest, aususest ja otsekohesusest

  4. Lennukitootjad tüürivad rekordaasta poole / Peeter Teder

    Index Scriptorium Estoniae

    Teder, Peeter

    2005-01-01

    Lennukiehitajad Boeing ja Airbus on kahe peale sõlminud lepinguid 1000 lennuki ehitamiseks ja sellele lisaks käivad läbirääkimised veel mõnesaja lennumasina ehitamise kokku leppimiseks. Diagramm: Lennufirmade aktsiate hinnad. Vt. samas: Lennukitööstuses õitsvad ajad

  5. "Wastne Testament" : das erste estnischsprachige Neue Testament / Peeter Roosimaa

    Index Scriptorium Estoniae

    Roosimaa, Peeter

    2003-01-01

    Ettekanne sümpoosionilt: Gemeinsames Symposium der Evangelisch-Theologischen Fakultät der Universität Tartu, der Estnischen Studiengesellschaft für Morgenlandkunde und der Deutschen Religionsgeschichtlichen Studiengesellschaft. Tartu, 2001

  6. Robert J. Aumann - matemaatikust Nobeli preemia laureaat / Peeter Puusemp

    Index Scriptorium Estoniae

    Puusemp, Peeter, 1947-

    2006-01-01

    2005. a. Nobeli preemia majanduse alal silmapaistva panuse eest mänguteooria ülesannete lahendamisse saanud Robert J. Aumannist ja D. Saari loetelu matemaatikutest - Nobeli preemia laureaatidest: John Nash'ist, Herbert Hauptman'ist, John Pople'ist, Bertrand Arthur William Russell'ist, Kenneth Joseph Arrow'ist, Gerard Debreu'ist, Leonid Vitaljevitš Kantorovitš'ist, Reinhard Selten'ist, Jan Tinbergen'ist

  7. Kuidas Peeter Esimene leppis Vladimir Leniniga / Jelena Skulskaja

    Index Scriptorium Estoniae

    Skulskaja, Jelena, 1950-

    2003-01-01

    Lev Tolstoi jutustuse "Saatan" ekraniseerimisest, Boriss Pasternaki romaan "Doktor Zhivago" itaalia režissööri Giacomo Campiotti ekraniseeringus ja Juri Ljubimovi Goethe "Fausti" muusikaliversioon Taganka teatris Moskvas

  8. Bunge sajand ja sajand Bungeta. II / Peeter Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    1998-01-01

    Tartu Ülikooli professorist, Balti eraõiguse uurimise alusepanijast ja baltisaksa professionaalse ajalooteaduse ühest rajajast Friedrich Georg von Bungest (1802-1897). Algus: Kleio : Ajaloo Ajakiri 1997, nr. 4, lk. 49-51

  9. Kui ei taha, ära õpi? / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2003-01-01

    Autor leiab, et viimase 10 aasta jooksul levinud arusaam - kui ei taha, ära õpi - on tegelikult väga negatiivsete tagajärgedega seisukoht. Haridus ei ole vaid individuaalne hüve ja selle puudumine individuaalne õnnetus, see on kogu ühiskonna probleem

  10. Kas Ene Ergmast saab president? / Ene Ergma ; interv. Peeter Ernits

    Index Scriptorium Estoniae

    Ergma, Ene, 1944-

    2006-01-01

    Riigikogu aseesimees räägib presidendivalimistel osalemisest, presidendile esitatavatest nõuetest, oma väidetavast kunagisest seotusest Nõukogude eriteenistusega, hariduse tähtsusest Eesti arengus ja Res Publica käekäigust

  11. [Tänapäeva heitlikus majandusmaailmas] / Peeter Koppel

    Index Scriptorium Estoniae

    Koppel, Peeter

    2010-01-01

    Majanduse seisust ja muinasjutust „Kolm põrsakest”, nii kiputakse nimetama Euroopa Liidu probleemseid riike lühendiga PIGS (Portugal, Italy, Greece, Spain). Need riigid on aastatega akumuleerinud endale tohutu võlakoormuse

  12. Kaplan võiks olla malevapealiku oluliseks toeks / Peeter Parts

    Index Scriptorium Estoniae

    Parts, Peeter

    2007-01-01

    Kokkuvõte Kaitseliidu Tallinna maleva Toompea malevkonna pealiku kapten Heiki Arikese peetud ettekandest Kaitseliidu maleva juhtide ootuste kohta kaplani suhtes. Kaplanite erialaoskusi peaks rakendama ka malevlaste psühholoogilisel nõustamisel ning sotsiaalse mälu meeldetuletamisel

  13. Uued juristide leksikonid Euroopas / Peeter Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    1994-01-01

    Arvustus: Deutsche Juristen aus fünf Jahrhundert. Heidelberg, 1989 ; Juristen in Österreich 1200-1980. Wien, 1987 ; Deutsche Juristen jüdischer Herkunft. München, 1933 ; Juristen an der Universität Frankfurt am Main. Baden-Baden, 1989 ; Rechtswissenschaft in der Bonner Republik. Frankfurt am Main, 1994

  14. Kahe venna suured ärid / Peeter Raidla, Hanno Tomberg

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    1997-01-01

    Ärimeestest vendade tegevus ja nende osalusega firmad: AS BKE, AS Eferelt, AS Standard, AS Kodax, Eesti Näituste AS, Expodi-Saini AS. Ilmunud ka: Molodjozh Estonii : Kupetsheskaja Gavan 11. apr. lk. 8

  15. Ahtme tehas teeb vaguneid vaid omanikule / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2004-01-01

    Ahtmes asuv AS UVZ & AVR koostetehas on siiani tootnud tsisternvaguneid vaid AS-ile AVR Transservice, vagunite suurimaks kasutajaks on tõusmas naftatransiidile spetsialiseeruv AS Onako Eesti Grupp. Vt. samas: Oma töölistele valmivad kortermajad; Keedetud vähid ja Anne Veski

  16. Kunst kui aheldatud kaup / Peeter Künstler

    Index Scriptorium Estoniae

    Künstler, Peeter, 1958-2009

    2000-01-01

    Välismaale näitusele saadetavate tööde tollis vormistamine on keeruline. Reti Saksa viie raamatuillustratsiooni, mida ta saatis raamatuillustratsiooninäitusi korraldavale Jaapani Hiroko Mori & Stasys Museum'i direktorile Nadayuki Hasegawale, tollis vormistamisest.

  17. Mõned mõtted "suvelugemisest" ja suvelugemisest / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2009-01-01

    Tutvustatakse ja soovitatakse raamatuid: Aleksejev, Tiit. Palveränd : lugu Esimesest ristisõjast. Tallinn : Varrak, 2008 ; Rebane, Kristi. Minu oma. Tallinn : Tänapäev, 2009 ; Kaints, Holger. Lennukivaatleja. Tallinn : Kultuurileht, 2009 ; Kehlmann, Daniel. Maailma mõõtmine. Tartu : Atlex, c2008 ; Zafón, Carlos Ruiz. Tuule vari. Tallinn : Varrak, 2008

  18. Kus me kange bestseller? / Peeter Künstler

    Index Scriptorium Estoniae

    Künstler, Peeter, 1958-2009

    2000-01-01

    Arvustus: Uustulnd, Lembit. Kiikhobune Antverpenist. Tallinn : Varrak, 1999 ; Tiidenberg, Ants. Vietnam-transiit Tallinn : SE & JS, 1999 ; Tamman, Tiina. Tihe udu Tallinnas. Tallinn : Perioodika, 2000

  19. Peeter I moorlasest vändatakse dokfilm / Tambet Kaugema

    Index Scriptorium Estoniae

    Kaugema, Tambet

    2001-01-01

    Eestis filmiti osa vene režissööri Konstantin Artjuhhovi sügisel valmivast dokumentaalfilmist "Minu Aafrika taeva all". Film jutustab Aleksandr Pushkini vaarisast Abram Hannibalist (1696-1781), kelle elust suur osa möödus Eestis

  20. Kaks head prantslast korraga / Peeter Künstler

    Index Scriptorium Estoniae

    Künstler, Peeter, 1958-2009

    1996-01-01

    Arvustus: Guibert, Hervé. Sõbrale, kes ei päästnud mu elu / Prantsuse k. tlk. T. Arot. Tln. : Kupar, 1996; Modiano, Patrick. Hämarate poodide tänav / Prantsuse k. tlk. Tatjana Hallap. Tln. : Kupar, 1996

  1. Angotti noolis raudtee siinsete prominentide toel / Peeter Ernits

    Index Scriptorium Estoniae

    Ernits, Peeter, 1953-

    2002-01-01

    Ilmunud ka: Molodjozh Estonii 12. oktoober lk. 14. Skandaalse raudtee-erastaja Antonio Angotti toimikusse köidetud kaitsepolitsei ülekuulamisprotokollist. Tabel: Eesti Raudtee erastamine. Vt. samas: Jaht 2,6 miljardile

  2. Afganistani kindral unistab õhuväest / Peeter Kuimet

    Index Scriptorium Estoniae

    Kuimet, Peeter

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 24. aug. lk. 10-11. Afganistani armee brigaadikindral Gul Aqa Nahibi räägib riigi probleemidest võitluses Talibani sissidega ja loodab, et liitlased ei jäta neid üksi. Lisa: Abi afgaanidele. Vt. samas: Lääne sõjaväelinnak paikneb otse Talibani sünnipaigas

  3. Book reviews / Carolina Pihelgas, Peeter Helme and Jan Kaus

    Index Scriptorium Estoniae

    Pihelgas, Carolina, 1986-

    2016-01-01

    Arvustus: Sommer, Lauri. Kunagi: 2008-2015. Räestu [Võrumaa] : Tiivaalune, 2015 ; Rooste, Jürge. Ideaalne abikaasa. Saarde ; Pärnu : [Jumalikud Ilmutused], 2015 ; Ruitlane, Olavi. Vee peal. Tallinn : ZA/UM, 2015 ; Riismaa, Kaur. Pühamägi. Tallinn : Verb, 2015 ; Riismaa, Kaur. Pimeda mehe aiad. Tallinn : Tänapäev, 2015 ; Raud, Rein. Täiusliku lause surm. Tallinn : Mustvalge Kirjastus, 2015 ; Matsin, Paavo. Gogoli disko. Viljandi : Lepp ja Nagel, 2015 ; Lennuk, Urmas. Ükskord Eestimaal. Viljandi : Ugala Teater, 2015

  4. Soome riigifirma kasutas Eestis kelmivõtteid / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 24. aug. lk. 3. Soome tee-ehitusfirma Tieliikelaitos soovis teha ülevõtupakkumise Eesti firmale Titania, kuid ei teinud pakkumist kõikidele aktsionäridele. Vt. samas: Tieliikelaitose tung Eesti turule. Lisad: Tüliõun Titania; Luhtunud ülevõtmiskatse

  5. Mulluseid sõnu ei korda / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2009-01-01

    Riigikogu liikme mõtisklusi Eesti arengutest vabariigi 91. sünnipäeva eel. Kõnet, mida president Toomas Hendrik Ilves pidas Eesti Vabariigi 90. juubelisünnipäeval, ei saa korrata 91. sünnipäeval. Autor kritiseerib Eesti majandusmudelit ja õhukest väärtussüsteemi

  6. Uskumatu, kuhu me oleme jõudnud - puhtast veest tehti Järsi külla teemapark / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2016-01-01

    Puhta vee teemapargist Tamsalu vallas Järsi külas, kus käisid õppekäigul Tallinna Ülikooli Rakvere kolledži 3. kursuse alushariduse tudengid, kellel õppekavas keskkonnapedagoogika. Teemapargi kohta jagab selgitusi loodusgiid Priit Adler

  7. Archaeological test excavations at the mesolithic and iron age settlement site Jägala-Joa IV / Aivar Kriiska, Kaarel Sikk

    Index Scriptorium Estoniae

    Kriiska, Aivar, 1965-

    2014-01-01

    Jägala jõe alamjooksul on mitmeid eriaegseid muinasjäänuseid. Vanim neist on Jägala-Joa IV asulakoht. Mesoliitiline asustuskoht annab tuge hüpoteesile, et Eesti rannikuala asustamise esimesel etapil ei asunud elupaigad vahetult mererannal, vaid veidi kaugemal jõgede kallastel ja tööriistu valmistati sellel ajal üldiselt tulekivist

  8. Night Song Festival "Time to Take Notice" or "The world had never seen such a birthday bash before" / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2008-01-01

    Laulvast revolutsioonist 1988. aastal. 19.-20. augustil 2008 Tallinna lauluväljakul toimunud öölaulupeost "Märkamisaeg". Vt. samas: Freedom is not self-evident. Väljavõte president Toomas Hendrik Ilvese kõnest

  9. Väär vastandus: vastus Seyla Benhabibile ja Judith Butlerile / Nancy Fraser ; tõlk. Merilin Sikk

    Index Scriptorium Estoniae

    Fraser, Nancy

    2006-01-01

    Benhabibi-Butleri mõttevahetus tekitab autori arvates väära vastanduse ning ebavajalikke polarisatsioone. Feministid ei pea valima kriitilise teooria ja poststrukturalismi vahel, selle asemel võiks rekonstrueerida kumbagi lähenemist viisil, et see teisega sobituks, leiab autor

  10. Suvitus-Meka Võsu võib jääda päästjateta / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2011-01-01

    Võsu päästekomando võimalikust likvideerimisest ja sellega kaasnevatest ohtudest. Päästeameti peadirektori asetäitja Alo Tammsalu sõnul analüüsitakse praegu 9-13 päästekomando likvideerimist

  11. Kriitilisi mõtisklusi antoloogiatest, läti luulest ja kirjandusest / Ivar Ivask ; tõlkinud Ita Saks

    Index Scriptorium Estoniae

    Ivask, Ivar, 1927-1992

    2010-01-01

    Neljast paguluses ilmunud läti luuleantoloogiast: Elav luule (Stockholm, 1955); Luule ja näod (New York, 1962); A century of Latvian poetry (tlk. William Kleesmann Matthews. London, 1957); Lettische Lyrik (tlk. E. Eckardt-Skalberg. Hannover-Döhren, 1960)

  12. Formation of Hydrochemical River Regime Under Extreme Contamination by Waste Water (the Sak-Elga River in the Chelyabinsk Region)

    Science.gov (United States)

    Denisov, S. E.; Ulrikh, D. V.; Zhbankov, G. O.

    2017-11-01

    Modern technologies designed to use natural resources in different ways are applied to restructure the environment. The use of technologies results in the deformation of environment, its local, regional and global changes occur. In the course of mining the spaces disturbed by the mine opening rock heaps and processing wastes are formed and rapidly appear. These spaces are dead surfaces the negative effect of which extends to the surrounding areas. Thus, the indirect impact on the lands connected with the change of the condition and regime of the surface and groundwater, settling of dust and chemical compounds from emissions to the atmosphere as well as the products of wind and water erosion lead to deterioration in the quality of the lands, surface and groundwater resources in the area affected by mining.

  13. Juriidilise isiku õigusvõime : [bakalaureusetöö] / Siret Saks ; Tartu Ülikool, õigusteaduskond ; juhendaja: Kadri Siibak

    Index Scriptorium Estoniae

    Saks, Siret

    2006-01-01

    Juriidilise isiku koht ja areng õigussüsteemis, õigusvõime subjektide liigituse alused ja muudatused, ultra vires doktriinist tänapäevase olukorrani, juriidilise isiku õigusvõime omastamine, õigusvõime lõpetamine

  14. Kognitiivsete ja metakognitiivsete õpistrateegiate toetamine tehnoloogiaga tõhustatud keeleõppes / Katrin Saks, Äli Leijen

    Index Scriptorium Estoniae

    Saks, Katrin, 1968-

    2015-01-01

    Tehnoloogiliste vahenditega tõhustatud võõrkeelekursuse raames välja töötatud sekkumisest, mis võimaldab õpetajal parimal moel toetada õppijate kognitiivseid ja metakognitiivseid keele- õppestrateegiaid

  15. Nurettin Topçu and Necip Fazıl Kısakürek: stories of 'conversion' and ...

    African Journals Online (AJOL)

    ... the Naqshbandi practices inspired in these two authors a new methodology to propagate religion within the strict limits of secular Turkey. On the other hand, the new 'modern' intellectual environment also forced Islamist intellectuals to change their way of advocating religiosity through academically accepted standards ...

  16. Kolonel Peeter Läns: tark personalipoliitika on kaitseväes ülemate võimalus / Peeter Läns ; intervjueerinud Ivar Jõesaar

    Index Scriptorium Estoniae

    Läns, Peeter

    2013-01-01

    Kaitseväe Peastaabi personaliosakonna ülem hindab kaitseväe personalipoliitikat lähtudes uuest kaitseväeteenistuse seadusest, avaliku teenistuse seadusest ja riigikaitse arengukavast aastateks 2013-2022

  17. Viru-Jaagupi soovib Läänemaa raamatukogust pastori pärandit tagasi / Rein Sikk, Aarne Mäe

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2004-01-01

    Viru-Jaagupiga seotud inimesed arutavad võimalust tuua Lääne Maakonna Keskraamatukogust tagasi osa pastor Madis Oviiri raamatukogust ja käsikirjadest, mis kingiti raamatukogule, sest Lääne-Virus ei suudetud unukaalse pärandi hoidmist tagada

  18. İslâm Öncesi Orta Asya Sikkelerinde Görülen Çin Sikke Darbı Etkileri

    OpenAIRE

    Babayar, Gaybullah

    2018-01-01

    Some part of the pre-Islamic coins of Central Asia, including those belonging to 7th-8th centuries, have some features, specific to Chinese monetary system. In fact, the evidence of Chinese influence displayed by the coins of Bukhara and Samarqand, a little bit later by those of Chach (Tashkent), Farghana, Northern To-kharistan (South Uzbekistan–South Tajikistan), Otrar and Taraz (South Kazakhstan), about ten out of small oasis kingdoms of South-Eastern Jetisu/Semirech’e (Kyrgyzstan), belongs...

  19. Kas 1933. aasta põhiseadus lubas autoritaarset valimist? / Peeter Kenkmann

    Index Scriptorium Estoniae

    Kenkmann, Peeter, 1977-

    2009-01-01

    Lühidalt 1933. aasta põhiseaduse muudatuste sisust. Autoritaarrežiimist praktikas. Kas 1934. aasta riigipööre sai võimalikuks 1933. aasta põhiseaduse muudatuste autoritaarsuse või demokraatiavastasuse tõttu?

  20. Elektromagnetiline ühildatavus - probleemide jada aastast 1930 : EMC = EMI + EMS / Peeter Lamster

    Index Scriptorium Estoniae

    Lamster, Peeter

    2007-01-01

    Elektrisüsteemist lähtuvast seadmete tööd häirivast elektromagnetilisest inferentsist (EMI), elektromagnetilise haavatavuse (EMS) vähendamisest ja elektromagnetilise ühildatavuse (EMC) tagamisest. Elektromagnetilise ühildatavuse tähtsusest sõjanduses

  1. Maa tõmbab, maa tõukab : Uusimaid raamatuid lugedes / Peeter Künstler

    Index Scriptorium Estoniae

    Künstler, Peeter, 1958-2009

    1995-01-01

    Arvustused: Vahing, Vaino. Kaunimad jutud. Tartu : Ilmamaa, 1995 ; Dovlatov, Sergei. Kompromiss. Tallinn : Kupar, 1995 ; Mukka, Timo K. Maa on patune laul. [Tartu] : Ilmamaa, 1995 ; Luiga, Juhan. Mäss ja meelehaigus. Tartu : Ilmamaa, 1995 ; Böll, Heinrich. Katharina Blumi kaotatud au. Tallinn : Perioodika, 1995 ; Nirk, Endel. Siin maa peal. 2. Tallinn : E. Nirk, 1995

  2. TiVo heitlus elu pärast / John Gartner ; tõlk. Peeter Peetersoo

    Index Scriptorium Estoniae

    Gartner, John

    2005-01-01

    Peale interaktiivse salvestusseadme TiVo turuletulekut 1997. aastal ei ole ettevõte vaatamate toote headusele suutnud saavutada ootuspäraseid müügitulemusi ega saada suurt kasumit. Artiklis tutvustatakse ettevõtte heitlusi partnerite otsinguil ja edu saavutamisel

  3. Tähelepanu, lätlased tulevad...! / Peeter Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    1991-01-01

    Arvustus: Tartu Ülikooli õigusteaduskonna lõpetanute ja õigusteadust õpetanute nimekiri 1919-1989. Tartu, 1989 ; Latvijas Universitātes Tiesību Zinātnu Nodalas absolventu saraksts 1920-1940. Hamburg, 1990. - Sisaldab andmeid ka prof. Dietrich André Loeberi kohta

  4. Männiku sotsiaalelamu = Social housing in Männiku / Peeter Pere

    Index Scriptorium Estoniae

    Pere, Peeter, 1957-

    2012-01-01

    2012. a. Tallinnas Männiku tee 92 valminud inva- ja peremajutamiseks mõeldud sotsiaalelamu, vana ühiselamu ümberprojekteerimine. Arhitektid: Siiri Vallner, Indrek Peil, Kaire Nõmm, kaasautorid: Ragnar Põllukivi, Andro Mänd, Kadri Klementi (Kavakava). Sisearhitekt Tarmo Piirmets (Pink). Projekt: 2010-2011

  5. Maahariduse peab päästma tugev põhikoolide võrk / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2007-01-01

    Ilmunud ka: Virumaa Teataja, 5. sept. 2007, lk. 15; Vali Uudised, 5. sept. 2007. lk. 2; Sõnumitooja, 5. sept. 2007, lk. 2; Põhjarannik, 5. sept. 2007, lk. 2; Meie Maa, 5. sept. 2007, lk. 2; Nädaline, 6. sept. 2007, lk. 4; Koit, 6. sept. 2007, lk. 5; Vooremaa, 6. sept. 2007, lk. 2; Võrumaa Teataja, 6. sept. 2007, lk. 2; Sakala, 7. sept. 2007, lk. 2; Nädalaleht, 7. sept. 2007, lk. 3; Järva Teataja, 11. sept. 2007, lk. 2; Pärnu Postimees, 18. sept. 2007, lk. 19. Parlamendiliikme arvates on Eesti hariduse olulisemad probleemid koolivõrk ja ja hariduse kättesaadavus. Kool on hariduse omandamise koht ning eelkõige tuleb panustada põhiharidusse, suuremate ja tugevamate põhikoolide tekkesse, gümnaasiumides peaks edaspidi jätkama pool põhikoolide lõpetajatest, ülejäänud siirduksid kutsekooli

  6. Esimest korda toetab riik lasteaiaõpetajate palgatõusu / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2007-01-01

    Ilmunud ka: Põhjarannik, 8. dets. 2007, lk. 2; Severnoje Poberezhje, 8. dets. 2007, lk. 2; Lääne Elu, 11. dets. 2007, lk. 2; Hiiu Leht, 11. dets. 2007, lk. 2; Sõnumitooja, 12. dets. 2007, lk. 2; Vali Uudised, 12. dets. 2007, lk. 2; Virumaa Teataja, 13. dets. 2007, lk. 11; Kuulutaja, 14. dets. 2007, lk. 4; Pärnu Postimees, 10. jaan. 2008, lk. 15; Oma Saar, 18. jaan. 2008, lk. 5. Lasteasutuste toetustest 2008. riigieelarves

  7. Punk film kodanikuühiskonnast / Artur Talvik, Peeter Vihma, Jaan Tootsen ; intervjueerinud Andrei Liimets

    Index Scriptorium Estoniae

    Talvik, Artur, 1964-

    2013-01-01

    Tallinna Uue Maailma kogukonnast rääkivast režissöör Jaan Tootseni ja produtsent Jaak Kilmi dokumentaalfilmist "Uus Maailm". Arutlus teemal, milline on kohaliku kogukonna ja milline riiklike ning kohalike institutsioonide roll paikkonna elu suunamisel ja koordineerimisel, nende omavaheline mõju

  8. Kaheksakümnendate eesti fotost = Estonian photography in the eighties / Peeter Laurits

    Index Scriptorium Estoniae

    Laurits, Peeter, 1962-

    2010-01-01

    Fotograafiast, fotoklubidest ja fotorühmitustest, fotograafidest ja nende vormiotsingutest, sotsiaalse ja nn. salongliku suuna esindajate vahelistest probleemidest ja diskussioonidest teemal "Kas fotokunst on kunst?" Neil aastail hakkas eesti fotokunst väljuma kultuurilisest isolatsioonist

  9. Vikergallup : eesti kirjandus 2014 / Vahur Afanasjev, Sirel Heinloo, Peeter Helme ... [jt.

    Index Scriptorium Estoniae

    2015-01-01

    Kriitikute arvamus 2014. aastal Eestis ilmunud nüüdiskirjandusest. Aasta parimaks uudisteoseks nimetati Hasso Krulli luuleraamat "Kui kivid olid veel pehmed", parimaks debüüdiks Kristjan Haljaku luulekogu "Palavik", parimate tõlkeraamatutena tõsteti esile Elena Ferrante romaan "Üksilduse päevad", Konstantinos Petrou Kavafise "Kogutud luuletusi" ja Ivan Turgenevi "Senilia"

  10. Merevägi soetab 800 miljoni eest uusi laevu / Peeter Kuimet

    Index Scriptorium Estoniae

    Kuimet, Peeter

    2005-01-01

    Kaitseministeerium ootab valitsuselt heakskiitu 800 miljoni krooni eraldamiseks Eesti mereväele kahe uue miinijahtija ostmiseks, mis vahetaksid välja ligi 40 aastat vanad miinitraalerid Vaindlo ja Olevi. Olenevalt hankeprotsessist ja meeskondade väljaõppest peaksid uued alused olema rivis umbes 2008. aastaks. Lisaks laevadele uuendab kaitsevägi lähiaastail ka maavägede relvastust. Lisa: Miiniotsijad

  11. Elmar Lepp ja Hans H. Luik lammutavad Pärnu veetorni / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2007-01-01

    Meediaärimees Hans H. Luik ja ettevõtja Elmar Lepp tahavad lammutada Pärnu veetorni ning ehitada selle asemele üheksakorruselise hoone, mis naaberkruntide omanike seas on tekitanud ägedat protesti. Vt. samas: Pärnu esimene kooperaator tahab varieteed. Kommenteerib Elmar Lepp

  12. Nähtamatu näitleja / Yoshi Oida, Lorna Marshall ; tõlk. Peeter Raudsepp

    Index Scriptorium Estoniae

    Oida, Yoshi

    2004-01-01

    Jaapani näitlejaYoshi Oida näitlemisest erinevates traditsioonilistes jaapani teatristiilides, aga ka lääne stiili näidendites. Katkendid tema raamatust "Nähtamatu näitleja", mille kaasautor on Lorna Marshall. "The Invisible Actor", Methuen, 1997). Järgneb

  13. Nähtamatu näitleja / Yoshi Oida, Lorna Marshall ; tõlk. Peeter Raudsepp

    Index Scriptorium Estoniae

    Oida, Yoshi

    2005-01-01

    Jaapani näitlejaYoshi Oida näitlemisest erinevates traditsioonilistes jaapani teatristiilides, aga ka lääne stiili näidendites. Katkendid tema raamatust "Nähtamatu näitleja", mille kaasautor on Lorna Marshall. "The Invisible Actor", Methuen, 1997). Algus: TMK 2004, nr.12. Järg nr. 2, lk. 27-32

  14. Johan Kõpp ja Jüri Uluots - õpetaja ja õpilane / Peeter Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    2009-01-01

    Kunagise Laiuse kirikuõpetaja, Tartu Ülikooli rektori ja Eesti Evangeelse Luterliku Kiriku peapiiskopi Johan Kõpu õpetajaametist Pärnu Poeglaste Gümnaasiumis ja selle mõjust õpilastele professor Jüri Uluotsa saatuse valgusel

  15. Mees, kes väärtustab tundeid / Christian Boltanski ; interv. Peeter Linnap

    Index Scriptorium Estoniae

    Boltanski, Christian, 1944-

    1998-01-01

    P. Linnap Christian Boltanski loomingust ja 5. oktoobrini Helsingi Taidehallis avatud näitusest "Augustiöö". Kureerinud Jan Kaila, Timo Valjakka. Christian Boltanski oma 1990ndate töödest, näitusest Soomes, miks ta nimetab end 20. sajandi lõpu maalikunstnikuks. Valik Christian Boltanski autobiograafilisest küsitlusest "Mida nad minust mäletavad?". Ilmunud ka kogumikus "Silmakirjad". Tartu, 2007, lk. 306-308 pealkirja all "Suremise viisid : intervjuu Christian Boltanskiga"

  16. Segadus pakendijäätmete kogumisega / Peeter Eek ; interv. Agnes Jürgens

    Index Scriptorium Estoniae

    Eek, Peeter, 1963-

    2008-01-01

    Jäätmeseaduse rakendamisest. Ilmunud ka Järva Teataja 31. jaan. 2008, lk. 2, pealkiri kujul: nõrgad kohad tulid ilmsiks ; Virumaa Teataja 31. jaan. 2008, lk. 2 ; Valgamaalane 31. jaan. 2008, lk. 2 ; Harju Ekspress 1. veeb. 2008, lk. 9 ; Oma Saar 1. veeb. 2008, lk. 4 ; Türi Rahvaleht 8. veeb. 2008, lk. 4, pealkiri kujul: pakendijäätmete kogumine tekitab endiselt segadust ; Meie Maa 13. veeb. 2008, lk. 6 ; Vali Uudised 15. veeb. 2008, lk. 2

  17. Riigikogulaste tegelik vara on endiselt varjus / Peeter Raidla, Harry Tuul, Gert D. Hankewitz

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2006-01-01

    Majanduslike huvide deklaratsioonid ei peegelda riigikogulaste ja riigiametnike tegelikku varanduslikku seisu. Vt. samas: Riigikogulaste jõukusega koos kasvab ka nende võlakoormus; Valitsusel vähe investeeringuid ja võlgu; Ametnike vara kontroll karmistub

  18. GM pakub tuhandetele liigsetele töötajatele suurt lahkumisraha / Peeter Teder

    Index Scriptorium Estoniae

    Teder, Peeter

    2006-01-01

    Raskustes olev maailma suurim autotootja General Motors pakub kulude kokkuhoiu eesmärgil eelpensioni võimalust ning kompensatsiooni 113 000 vabrikutöölisele. Diagramm: General Motorsi aktsia kaotanud aastaga viiendiku

  19. Klaaspärlimäng jätkub / Peeter Vähi

    Index Scriptorium Estoniae

    Vähi, Peeter, 1955-

    2005-01-01

    Marika Järvi ja Martin Kuuskmanni kontserdist 20. juulil (kaastegev Kanada pianist Matt Herskowitz) ja Euroopa Liidu Kammerorkesteri kontserdist 21. juulil Pärnu kontserdimajas muusikafestivali "Klaaspärlimäng" raames

  20. Critical levels of debt? / Jana Kask, Peeter Luikmel, Lenno Uusküla

    Index Scriptorium Estoniae

    Kask, Jana

    2005-01-01

    Ilmunud ka: Development and convergence of financial sector of new EU members : 16-20 November 2005 Tallinn, Estonia. - Tallinn, 2005, lk. 211-223. Võlaindikaatorite kui finantskriiside võimalike tegurite analüüs, kust selgub, et kõrge võlatase kriisi puhkemisel pikendab selle kestvust ja suurendab kulusid. Tabelid. Lisad lk. 68

  1. Alvar Aalto ja Eesti / Karin Hallas ; tõlk. Peeter Tammisto

    Index Scriptorium Estoniae

    Hallas, Karin, 1957-

    1998-01-01

    Arhitektuurimuuseumi ja Aalto Fondi korraldatud näitus 'Aalto: Kolm objekti Eestis' Rotermanni soolalaos 7.-29. III 1998. Koostas K. Hallas, kujundas P. Mauer. Aalto Pärnu supelasutuse eskiisidest, supelasutuse arhitektuurikonkurssidest, professor Tammekannu villa (Tartu, Kreutzwaldi 6) ehituslugu, Aalto Eesti Kunstimuuseumi konkursiprojektist, H. Kompuse arvamus sellest, lühidalt konkursist

  2. 'Vana' ja 'moodne' ehituskultuuris / Jaak Poom ; tõlk. Peeter Tammisto

    Index Scriptorium Estoniae

    Poom, Jaak

    1998-01-01

    Vanad majad põlu all I maailmasõja järel. Modernism arhitektuuris ja linnaehituses pärast II maailmasõda. Funktsionalismi tagaküljed. Jälle hinda tõusnud vanade hoonete säilitamise tehnilised ja majanduslikud aspektid. Arhitekt ja 'vana' säilitamine. Vana tähendus täna. Ill.: uus ärikvartal Kyrkolunden Sigtuna vanalinnas

  3. Otepää Gümnaasiumi juurdeehitus / tõlk. Peeter Tammisto

    Index Scriptorium Estoniae

    1998-01-01

    Otepää Gümnaasiumi juurdeehitus on õppehoone I-IV klasside õpilastele ning sellel on olemasoleva tüüpkoolimajaga iga korruse ulatuses hoonesisene ühendus. Projekt 1998. Arhitekt Toomas Rein. Vaated, lõige, I ja II korruse plaaanid

  4. Vikergallup : eesti kirjandus 2008 / Peeter Helme, Ott Kilusk, Igor Kotjuh... [jt.

    Index Scriptorium Estoniae

    2009-01-01

    21 arvustaja vastus küsimusele, milline oli 2008. aasta parim uudisteos ja debüüt. Ära nimetati fs-i luulekogu "Alasti ja elus", Andrei Hvostovi proosaraamatut "Võõrad lood", Maarja Kangro luulekogu "Heureka", Kalju Kruusa luulekogu "Pilvedgi mindgi liigutavadgi", Asko Künnapi luulekogu "Su ööd on loetud", Elo Viidingu proosaraamatut "Püha Maama", Mart Juure luulekogu "Pane Eesti peale tagasi", Jaan Kaplisnki luulekogu "Teiselpool järve", Mart Kivastiku proosaraamatut "Kurb raamat", Leo Kunnase romaani "Gort Ashryn I", Andres Langemetsa luulekogu "Vooder", Erkki Luugi "Valitud luuletusi", Rein Põdra romaani "Juba olnud", Rein Raua lühiromaani "Vend" ja Jaan Tangsoo romaani "Méduse'i parv". Parima debüüdina mainiti Andrus Kasemaa luulekogu "Poeedirahu", Barthol Lo Mejori proosaraamatut "Popdada" ja Chaneldiori proosaraamatut "Kontrolli alt väljas", Lauri Saatpalu laulutekstiraamatut "Nähtused ja tehtused", Tamur Kusnetsi romaani "Hundipäikese aeg" ja Jaanika Merilo luulekogu "Rütmist väljas"

  5. Hammasterannast Uusleitudmaani : killuke eestlaste maailma avastamise loost / Peeter Päll

    Index Scriptorium Estoniae

    Päll, Peeter, 1961-

    2009-01-01

    150 aastat tagasi ilmus esimene eestikeelne maailmaatlas: Maa kaardi-ramat kus sees 16 Maa Kaarti / [E. W. W. Schultz]. Pernos : R. Jakobi et Komp., 1859. Ülevaade kohanimede kujudest ja kirjutusviisist atlases

  6. Saksa Trakeeni Liidu külaskäik Peroni juurde / Maario Laas ; kommenteerinud Peeter Viiard

    Index Scriptorium Estoniae

    Laas, Maario

    2014-01-01

    14.-17. veebruarini külastasid Eestit Saksamaa Trakeeni Liidu turundus ja spordijuht Andre Hahn ning Andreas Loebnitz omanimelisest trakeenikasvandusest, eesmärgiga tutvuda Eestis kasvatatavate trakeenidega ja teha kaupa Trakehner Hengstmarketil ning Neumünsteri galashowl sakslastele silma jäänud Peroni asjus

  7. Avaliku õiguse ajaloo uurimisest Saksamaal 20. sajandi lõpul / Peeter Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    1999-01-01

    Ülevaade raamatutest: Willoweit, Dietmar. Deutsche Verfassungsgeschichte. Vom Frankenreich bis zur Wiedervereinigung Deutschlands. Ein Studienbuch. 3. Aufl. München, 1997 ; Stolleis, Michael. Geschichte des öffentlichen Rechts in Deutschland. München, 1999

  8. Eiki Nestor: Ma tunnen ennast dissidendina. See ei ole meeldiv / Eiki Nestor ; intervjueerinud Peeter Ernits

    Index Scriptorium Estoniae

    Nestor, Eiki, 1953-

    2009-01-01

    Intervjuu Riigikogu Sotsiaaldemokraatliku Erakonna fraktsiooni juhiga Eesti poliitikast ja erakonna valikutest. Eiki Nestor kommenteerib muuhulgas ka Keskerakonna esimehe Edgar Savisaare väidet, et proua Evelin Ilvesest võiks saada järgmine Eesti president

  9. Verine vihakolle Balkanil jahtus aastatega argiidülliks / Peeter Kuimet

    Index Scriptorium Estoniae

    Kuimet, Peeter

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 4. juuli lk. 4-5. Lõpeb Eesti kaitseväe pikim välismissioon Bosnia-Hertsegoviinas, mis kestis üksteist aastat. Vt. samas: Politseireform takistab Bosnia liikumist Euroopasse; Praeguseks lahenenud Bosnia konflikt sai alguse 1992. aastal ja põhines rahvustevahelisel vaenul

  10. Provokatsioon või käeviibe tundmatule mõttekaaslasele? / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2008-01-01

    Mihkel Muti novelli "Siseemigrant" (kirj. Fabian, 2007) võrdlus Martin Schwarzi manifestiga "Apoliteia kui mäss moodsa maailma vastu" (eesti k. kogumikus "Kriteerium", kirj. Eesti-Kambodzha MTÜ, 2007)

  11. Briti kindral peab Kaitseliidu tulevikuks missioone võõrsil / Gerald Grosvenor ; interv. Peeter Kuimet

    Index Scriptorium Estoniae

    Grosvenor, Gerald

    2006-01-01

    Briti kaitsejõudude ülema asetäitja reservide alal räägib Suurbritannia Territoriaalarmeest, Kaitseliidu-sarnaste vabatahtlike organisatsioonide kasutamisest välismissioonidel, ajateenistusest ja olukorrast Iraagis

  12. Vestlus Eve ja Peeter Linnapiga : ajanihe : Eesti fotograafia / intervjueerinud Michael Freitag

    Index Scriptorium Estoniae

    Linnap, Eve, 1960-

    2011-01-01

    Eesti fotograafid oma viimastest töödest ja näitusest "Piltide mälu" Berliinis ning kunsti mõistmise erinevustest lääne ja idabloki vahel, kuna nõukogude ajal on olnud teistsugune sotsiaalne kontekst - kunst tundus olevat mitmel viisil vaba, kuid tal ei olnud vabadust olla sotsiaalne

  13. Planeta Zemlja - matritsa ili nash metafizitsheski dom? / Peeter Liiv ; tõlk. Marina Tervonen

    Index Scriptorium Estoniae

    Liiv, Peeter, 1953-

    2005-01-01

    Metafüüsika nõrkusest Eesti kultuuris. Kannatuse ja rõõmu religioonidest, valgustumisest, "Brahma ööst" ja "Brahma päevast", miks ja kuidas on Jumal maailma loonud. Osho, Ken Wilberi, Maharishi Mahesh Yogi jt. mõtteid

  14. Kütiorust avaneb avaram vaade tulevikku kui Tallinna kunstikontori akendest / Peeter Laurits ; interv. Reet Varblane

    Index Scriptorium Estoniae

    Laurits, Peeter, 1962-

    2005-01-01

    2. VII lõpeb Kütioru maakunsti sümpoosion ja esitletakse maakunsti raja teist etappi. P. Laurits Kütiorust, maakunstist, sümpoosionil osalejatest (EKA maalikunsti eriala üliõpilased, Anke Mellin, Ko Seung-Hyun)

  15. Uus sünagoog pani juudid tantsima / Peeter Kuimet, Kaia Otti

    Index Scriptorium Estoniae

    Kuimet, Peeter

    2007-01-01

    Tallinnas Karu tänaval avati 16. mail 2007 uus juudi sünagoog, avamistseremoonial viibisid Iisraeli asepeaminister Shimon Peres, Eesti president Toomas Hendrik Ilves, peaminister Andrus Ansip, Venemaa pearabi Berl Lazar, Iisraeli pearabi Yona Metzger ja sünagoogi suurrahastaja Aleksander Bronshtein. President Toomas Hendrik Ilves viitas oma kõnes paralleelidele eestlaste ja juutide ajaloos. Vt. samas: Juutide usk, kombed ja toit; Sünagoogi avamist kommenteerivad meediaõppejõud Hagi Shein, dirigent Eri Klas. Vt. samas: Peres: elevantide keskel on väikestel raske magada. Ilmunud ka: Postimees : na russkom jazõke 17. mai 2007, lk. 2; Narvskaja Gazeta, 19. mai 2007, lk. 6 (autor Ksenia Repson)

  16. Saladusi mäletavad pildid : järelvaade Eric Soovere fotograafilisele dokumentalistikale / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2010-01-01

    Eric Sooverest ja tema fotoloomingust. Eric Soovere ja Johannes Pääsukese loomingu võrdlus. Katkendeid Eric Soovere raamatust "Käru ja kaameraga : pilte ja päevikulehti põgenemisteelt 1944-1949". Pikemalt emigreerumisest Ameerikasse

  17. Julge juht laseb töötajail otsustada / Peeter Klanberg

    Index Scriptorium Estoniae

    Klanberg, Peeter

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti : Karjera i obutshenije 9. aug. lk. 2. Firmad on hakanud juurutama koostööpõhist juhtimist ehk osalusjuhtimist, mis kaasab kõik töötajad ja suunab nende energia ühele, ettevõtte üldisele eesmärgile. Vt. samas: Arengurühmad aitavad ettevõtte eesmärgid lahti mõtestada; Arengurühmad lihvivad pidevalt ettevõtte strateegiat; Arengurühma päevakava

  18. Vikergallup : eesti kirjandus 2009 / Vahur Afanasjev, Ott Heinapuu, Peeter Helme... [jt.

    Index Scriptorium Estoniae

    2010-01-01

    24 arvustaja vastus küsimusele, milline oli 2009. aasta parim uudisteos ja debüüt. Parimaks debüüdina nimetati enim Mart Kanguri luulekogu "Kuldne põli" ja Triin Tasuja luulekogu "Provintsiluule", samuti märgiti mitme arvustaja poolt ära Jüri Kolgi luulekogu "Barbar Conan peeglitagusel maal" ning Birgit Renseri ja Terje Toomistu reisiromaan "Seitse maailma". Parima uudisteosena nimetati enim Jan Kausi romaani "Hetk" ning Hasso Krulli luulekogu "Neli korda neli"

  19. Ants Laaneots : palgaarmeele üleminek pole praegu aktuaalne / Ants Laaneots ; interv. Peeter Kuimet

    Index Scriptorium Estoniae

    Laaneots, Ants, 1948-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 6. dets. lk. 2. Kaitseväe uus juhataja kindralmajor Ants Laaneots vastab küsimustele kaitseväe ja ajateenistuse probleemide kohta. Lisa: Eesti kaitseväe juhatajad 1993-2006. Vt. samas: Laaneotsalt oodatakse sisetülide lahendamist

  20. Heiti Hääl vajab rahalaeva / Heiti Hääl ; interv. Peeter Raidla

    Index Scriptorium Estoniae

    Hääl, Heiti, 1963-

    2006-01-01

    Alexela Oili suuromanik Heiti Hääl Hydro Texaco tanklaketi ostmisest. Skeem: Heiti Hääl Alexela Oli suuromanik. Lisa: Alexela Oili rasked aastad. Vt. samas: Hydro Texaco on Eestisse matnud üle 110 mln krooni; Äripartnerid: Hääl - riskialdis ettevõtja

  1. Time Warner veab aktsionäriga vägikaigast / Peeter Teder

    Index Scriptorium Estoniae

    Teder, Peeter

    2005-01-01

    Meediafirma Time Warner juhid tõrjuvad aktsionär Carl Icahni süüdistusi firma juhtkonna tegevusetuses ja halvas majandamises. Diagramm: Time Warneri aktsia. Vt. samas: Kes on miljardär Carl Icahn

  2. Peek maksab endale 24 mln krooni dividende / Anne Oja, Peeter Raidla

    Index Scriptorium Estoniae

    Oja, Anne, 1970-

    2006-01-01

    OÜ Monteray Holdings maksab oma ainuomanikule ja juhatuse esimehele Toomas Peegile 2005. aasta kasumist dividende 24 miljonit krooni. Diagramm: Diagramm. Vt. samas: Peegil ja Paltsul kohtuotsus käes

  3. Riigivara õiguslikust režiimist. [1.-2. osa] / Peeter Kask

    Index Scriptorium Estoniae

    Kask, Peeter

    1996-01-01

    Riigivara õiguslik režiim 1990-1996. Riigivara baasil tegutsevate organisatsioonide jaotamine rühmadesse. Riigivaraseaduse üldmõistetest, riigivara kasutada andmisest, võõrandamisest, kõlbmatuks tunnistamisest, riigivara registrist ning eraõigusliku juriidilise isiku halduses olevast riigivarast. Õiend Juridica, 1997, Nr. 1, Lk. 40

  4. Sajanditagune Kuressaare = Kuressaare of a century ago / Olavi Pesti ; tõlk. Peeter Tammisto

    Index Scriptorium Estoniae

    Pesti, Olavi, 1950-

    2007-01-01

    Kuressaare ajaloost ja Kahni perekonnaloost. Leib ja Beila-Rebecka (Beila-Riva, neiuna Mendelowitsch) Schmuilowsky kolisid Riiast Kuressaarde 1900. a., nende esiklaps Itze-Leib (hiljem arhitekt Louis Kahn) sündis seal vkj 20. veebruaril 1901. a. 1904. a. asus Leib elama Philadelphiasse, tema abikaasa koos nende kolme lapsega järgnes talle USAsse 1906. a. L. Kahni emapoolne sugupuu

  5. Linn võiks Eesti koolivõrgu laastamise lõpetada / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2007-01-01

    Parlamendiliikme hinnangul on laste koolitusraha nõudmine teistelt omavalitsustelt väär. Autor kutsub Tallinna linnavalitsust mitte kasutama kahjuks veel kehtivat võimalust rahalisteks nõueteks teiste omavalitsuste vastu

  6. Uuring mõtestas usaldust poliitika vastu / Peeter Kreitzberg ; vahendas Argo Ideon

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Eesti elanike madal usaldus poliitika vastu ei käi mitte lihtsalt mõne isiku ja partei kohta, vaid hõlmab poliitikat kogu ulatuses, järeldasid sotsiaalteadlased septembris-oktoobris küsitletud tuhande inimese vastuseid analüüsides

  7. Me vajame häid, mitte odavaid õpetajaid / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2006-01-01

    Õpetajate madal palk tingib olukorra, kus äsja ülikooli lõpetanud pedagoogi ettevalmistusega noored ei asu kooli tööle, olukorda aitaks leevendada sotsiaaldemokraatide eelnõu, mille alusel kõrgharidusega õpetajate alampalk normkoormusel algaks Eesti keskmisest palgast

  8. Kuhu investeerida ettevõtte müügiga teenitud raha? / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2008-01-01

    Investor Rain Lõhmus ning ärimehed Elmut Paavel ja Raivo Hein räägivad oma põhimõtetest ja kogemustest ettevõtete müügist laekunud raha paigutamisel. Lisa: Valik viimaste aastate suurtehinguid. Vt. samas: Intervjuu Ambient Sound Investments tegevjuhi Tauno Tatsiga. Skype'i mehed jätkavad innovatiivselt

  9. Meenutusi tuntud kultuuritegelasest ja restauraatorist Friedrich Fred Raimond Allikust / Riho Illak, Peeter Tulviste, Indrek Martinson

    Index Scriptorium Estoniae

    Illak, Riho, 1955-

    2006-01-01

    Tartu Ülikooli auliikmest Friedrich Fred Raimond Allikust, kes annetas Tartu Ülikoolile oma kinnistud Tartus ja Elvas. Friedrich Fred Raimond Allik oli Rootsis tegev restauraatori, antikvaari ja eestlaste seltsielu edendajana

  10. Filosoofia silmitsi kriisiga / Klaus Heimes ; saksa keelest tõlkinud Peeter Helme

    Index Scriptorium Estoniae

    Heimes, Klaus

    2007-01-01

    Giorgio Agambeni teooriast riigi olemuse kohta tema teoste põhjal: "Homo Sacer" (1995), "Quel che resta di Auschwitz" ("See, mis jääb Auschwitzist", 1998), "Stato di eccezione" ("Eriolukord", 2003)

  11. Jutta Rabe : suurriigid kasutasid Eestit ära / Jutta Rabe ; interv. Peeter Ernits

    Index Scriptorium Estoniae

    Rabe, Jutta

    2003-01-01

    Saksa poliitiline põnevusfilm "Balti torm" ("Baltic Storm"), mis kujutab parvlaev "Estonia" hukku, esilinastus eile Eestis Coca-Cola Plazas. Saksa ajakirjanik, selle filmi stsenarist, produtsent ja peategelase prototüüp filmi kontseptsioonist

  12. Saladusi mäletavad pildid : järelvaade Eric Soovere fotograafilisele dokumentalistikale / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2009-01-01

    Ameerikas elanud eesti fotograafi Eric Soovere (sünd. Erich Soeson, 1916-2008) eluloolisi andmeid. Tema loomingust, mis jaguneb kolme perioodi: etnograafiline fotokooslus Lõuna-Eesti külaelanikest (1930ndate lõpp), Sooverede perekonna põgenemisteekond Eestist USA-sse (ca 1944-1949), perekonna elu Cincinnatis USA-s (1950ndad). Fotod eestlaste põgenemisteekonnast on avaldatud raamatus Eric Soovere. Käru ja kaameraga : pilte ja päevikulehti põgenemisteelt 1944-1949. Tallinn : Olion, 1999

  13. Salapäarane Toomas Tool pole enam suuraktsionär / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    1998-01-01

    Ühispanga Ja Tallinna Panga liitumisel tekkiva uue panga liitumisel tekkiva uue panga nõukogusse valitud Toomas Tool. Tabel: Toomas Tooliga seotud firmade Tallinna Panga aktsiad; skeem: Toomas Tooliga seotud firmade võrgustik

  14. Julgeolekuekspert : unustage jutud Eesti palgaarmeest / Edward N. Luttwak ; interv. Peeter Kuimet

    Index Scriptorium Estoniae

    Luttwak, Edward N.

    2006-01-01

    USA julgeolekuanalüütik soovitab Venemaa naabruses oleval Eestil oma riigikaitse üles ehitada Soome eeskujul, ajateenistus peab olema kohustuslik, et vajaduse korral end ise kaitsta, sest NATO abi ei saabu automaatselt. Lisa: Edward Nicolae Luttwak

  15. Hiina põlevkivikeemikud uurisid VKG tootmist / Peeter Lilleväli

    Index Scriptorium Estoniae

    Lilleväli, Peeter

    2004-01-01

    Ilmunud ka: Severnoje Poberezhje, 26. aug. 2004, lk. 1. Fushun Mining Group Co. Ltd juht Yin Liangi sõnul on nende firma tegelenud põlevkivist õli tootmisega üle 40 aasta, kuid kuna Eesti kogemus on sellel alal kaks korda pikem, huvituvad nad siin kasutatavast tehnoloogiast

  16. Book review: Peeters, H. 2007. Field guide to owls of California and the West

    Science.gov (United States)

    Eric D. Forsman

    2010-01-01

    Field Guide to Owls of California and the West. Written primarily for nonprofessionals,this little field guide is a treasure trove of published and unpublished information on the natural history and distribution of owls in the western United States. It covers just about everything you could want to know about owls, from why they take dust baths, to facultative...

  17. Vikergallup : eesti kirjandus 2013 / Vahur Afanasjev, Joanna Ellmann, Peeter Helme ... [jt.

    Index Scriptorium Estoniae

    2014-01-01

    Kriitikute arvamus 2013. aastal Eestis ilmunud nüüdiskirjandusest. Aasta parimaks uudisteoseks nimetati Valdur Mikita "Lingvistiline mets", parimaks debüüdiks Sveta Grigorjeva luulekogu "Kes kardab Sveta Grigorjevat?", parima tõlkeraamatuna tõsteti esile Michel Houellebeqi romaan "Kaart ja territoorium" ning Andrei Ivanovi romaan "Harbini ööliblikad"

  18. Augustis on üle Eesti kavas viis teabepäeva... / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2005-01-01

    Teabepäevadel (Tartus 12. VIII, Pärnus19. VIII, Narvas 17. VIII, Tallinnas 15. VIII kirjastajatele ja 16. VIII kultuurikorraldajatele) tutvustatakse Euroopa Liidu programmi "Kultuur 2000" ja teisi ELi võimalusi kultuuri rahastamiseks

  19. Noored alustasid jahti tasuta ülikoolikohtadele / Eva Kübar, Peeter Kuimet

    Index Scriptorium Estoniae

    Kübar, Eva

    2005-01-01

    Algas sisseastumisavalduste vastuvõtt Tallinna Ülikoolis, Eesti Kunstiakadeemias, Tartu Ülikoolis ja Eesti Muusikaakadeemias. Pärnu Postmees- pealk.: Ülikoolides algas pinev sisseastumisralli. Vt. ka Aesma, Madis. Netipõhine sisseastumine Tartus viibib : [ülikoolidevahelisest süsteemist SAIS], lk. 4

  20. Meelis Lao kuulutas eile sõja McDonald'sile / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2004-01-01

    Ärimees Meelis Lao lasi rendivaidlusele viidates sulgeda Viru tänava kiirtoitlustusasutuse McDonald's. Vt. samas: McDonald'si rendivaidlus küünib aastate taha; McDonald's andis asja politseisse; Meelis Lao kannab probleemide lahendaja tiitlit

  1. Liberalistlik sissejuhatus poliitilisse filosoofiasse / Tanel Vallimäe, Peeter Selg

    Index Scriptorium Estoniae

    Vallimäe, Tanel, 1975-

    2008-01-01

    Vastukaja arvustusele: Reiland, Indrek. Normatiivse poliitikafilosoofia peateemad (Rets. rmt.: Wolff, Jonathan. Sissejuhatus poliitikafilosoofiasse / tlk. Tiiu Hallap. Tartu, 2005). Akadeemia, 2008, nr. 4, lk. 880-883

  2. Antimodernistlik tegutseja modernismis : sissejuhatus Carl Schmitti riigifilosoofilisse õpetusse / Heimes. Claus ; tõlk. Peeter Helme

    Index Scriptorium Estoniae

    Heimes. Claus

    2004-01-01

    Saksa poliitilise teoreetiku, riigiõigusasjatundja ja kristliku filosoofi Carl Schmitti (1888-1985) seisukohtadest poliitilises teoloogias ja antropoloogias, uusajatõlgendusest ning positivistliku kaasaja kriitikast. Tõlke allikas: Antimoderner Akteur der Moderne : eine Einführung in die staatsphilosophische Lehre Carl Schmitts

  3. Severstaltrans muutub Eesti kütuse- ja transiidiäri valitsejaks / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2004-01-01

    Ilmunud ka: Delovõje Vedomosti 10. nov. lk. 6. Venemaa transiidihiid Severstaltrans omandas AS-i E.O.S. enamusosaluse. Diagramm: E.O.S.-i majandustulemused. Lisad: Vana E.O.S. muutus uueks E.O.S.-iks; Eelmine omanikuvahetus jättis E.O.S.-i omaniku samaks; Severstal on tõeline Venemaa tööstushiid

  4. Heteroloogiline "fotoversum" ja institutsionaalne ruum : noorest fotopõlvkonnast IV / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2002-01-01

    Ka Rael Arteli (23. 08. 2002) ja Eero Epneri (13. 09. 2002) käsitlustest. Horisontaalne vaade fotograafiale. Foto kunstiliste ja pragmaatiliste vormide suhetest. "Esteetilise" neoliberaalne reanimatsioon. Baudrillard, genius loci, Zeitgeist: kronoloogia ja topograafia komplitseerumine

  5. Mahepõllumajandus : [1999-2004, ka ökomärgist] / Peeter Prass

    Index Scriptorium Estoniae

    Prass, Peeter

    2005-01-01

    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk.43-45. Hinnanguliselt moodustas 2004. a. mahepõllundusega hõivatud maa üldisest põllumajandusmaast alla 5%. Piimalehmadest olid maheloomad veidi üle 2%. Diagrammid

  6. Doktoriväitekiri terminoloogia ja tõlkimise teemal / Peeter Päll

    Index Scriptorium Estoniae

    Päll, Peeter, 1961-

    2009-01-01

    Arvustus: Tavast, Arvi. The translator is human too: a case for instrumentalism in multilingual specialised communication. Tartu : Tartu University Press, c2008. (Dissertationes philologiae estonicae Universitatis Tartuensis ; 21)

  7. Igas riigis omad probleemid ja omad lahendused / Herb Brody ; tõlk. Peeter Peetersoo

    Index Scriptorium Estoniae

    Brody, Herb

    2005-01-01

    Brasiilia, Hiina, Tšiili, Saksamaa, Lõuna-Aafrika Vabariigi, Hollandi ja Ameerika Ühendriikide ajakirjanikud ning Technology Review toimetajad annavad ülevaate nimetatud riikides arendatavatest tehnoloogilistest projektidest, mis on kohalikele majandustele olulisimad. Lisatud statistilised lühiülevaaded tähtsamatest tehnoloogiasektoritest. Lisa: Ülemaailmne tehnoloogia arvudes

  8. Rikkus algab peast / Anne Veskimeister ; kommenteerinud Peeter Pärtel, Katriin Visamaa

    Index Scriptorium Estoniae

    Veskimeister, Anne, 1960-

    2010-01-01

    USA ettevõtjatest abielupaarist Robert ja Kim Kiyosakist, kes õpetavad oma raamatutes, seminaridel ja Cashflow-nimelise mängu kaudu inimesi mõtlema ning ajama rahaasju nii nagu seda teevad ning õpetavad oma lastele rikkad inimesed

  9. Von Krahl kutsub kinno, imet tabama / Peeter Jalakas ; interv. Tiit Tuumalu

    Index Scriptorium Estoniae

    Jalakas, Peeter, 1961-

    2006-01-01

    Pühapäeval esilinastub Von Krahli teatris E. Vilde ainetel mängufilm "Tabamata ime" : režissöörid Jaak Kilmi, Marianne Kõrver, Andres Maimik, Marko Raat, Rainer Sarnet ja Arbo Tammiksaar. Teatri juht filmi tegemise põhjustest. Režissöörid vastavad küsimusele : "Mis huvitas teid "Tabamata ime" juures?"

  10. Baltikumi õigussüsteemi uurimisest Saksamaal 1918-1960 / Peeter Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    1995-01-01

    Arvustus: Hasselblatt, Cornelius. Dissertationes Balticae : Verzeichnis der an der deutschen Hochschulen verteidigten Doktorarbeiten (1918-1960). Köln : Mare Balticum, 1993. 62 lk. Ülevaade 1918-1960. aastatel Saksamaal kaitstud Baltikumi teemalistest väitekirjadest, eraldi on esile toodud huvitavamate dissertatsioonide pealkirjad

  11. Aktsionäri laenuportfell suurem kui pangal endal / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2002-01-01

    Ilmunud ka: Delovõje Vedomosti 30. jaan. lk. 4. Tallinna Äripanga üks suuremaid aktsionäre, pangajuhtidega seotud Grand Marketing arendab laialdast laenutegevust. Küsimustele vastab Tallinna Äripanga juhatuse esimees Valeri Haritonov

  12. Signe Kivi arvates napib meil kultuurset mõtlemist / Signe Kivi ; interv. Peeter Kuimet

    Index Scriptorium Estoniae

    Kivi, Signe, 1957-

    2007-01-01

    Tekstiilikunstniku Signe Kivi eluloolisi andmeid, loomingust. Maile Grünbergi kujundatud näitustest "24" Eesti Kunstiakadeemia galeriis ja "24. veebruar" Disaini- ja Arhitektuurigaleriis. Sakala kultuurikeskuse lammutamisest. Kommentaarid Andres Talilt ja Mart Laarilt

  13. Diagnostikakeskuse suurosaluse omandas veeäris tegutsenud Janek Ottis / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2004-01-01

    Tallinna Diagnostikakeskuse aktsiate müügitehingust, keskuses suurosaluse omandanud OÜ Diagnostic Family omaniku Janek Ottise ja keskuse nõukogu liikme Theo Raudsepaga seotud äridest. Vt. samas: Ottis meditsiiniga seotud

  14. Otsalti süüasi rebis kaasa ka perekond Seli / Peeter Ernits

    Index Scriptorium Estoniae

    Ernits, Peeter, 1953-

    2009-01-01

    Tartu maakohus saatis politseiprefekt Aivar Otsalti kriminaalasja prokuratuuri tagasi, põhjendades seda lohaka uurimisega. Ärimees Neinar Selit kahlustab prokuratuur tulirelva padrunite andmises relvaloata isikule

  15. Kristen Michal : Anname Eestile eesmärgi / Kristen Michal ; interv. Ilmar Palli, Peeter Ernits

    Index Scriptorium Estoniae

    Michal, Kristen, 1975-

    2006-01-01

    Reformierakonna peasekretär vastab küsimustele, mis puudutavad läbiviidavaid reforme, võimukoalitsioonis olemist, erakonna ideoloogiat, rahvastikuprotsesse, vasakpoolseid parteisid, koostööd Keskerakonnaga, Reformierakonna eesmärki viia Eesti 15 aastaga Euroopa viie rikkama riigi hulka

  16. "Kui Teile minu kirjutis meeldis, siis levitage, kuidas heaks arvate..." / Peeter Kaasik

    Index Scriptorium Estoniae

    Kaasik, Peeter, 1951-

    2013-01-01

    Nõukogude perioodil ajalehetoimetustele saadetud kirjadest liigitus osa dissidentlikeks, kuid samas oli ka kirju, mis ei liigitunud dissidentlikeks, kuid oma olemuselt olid ikkagi "nõukogudevastased". Dokumenditekstidena avaldatakse 1983. aastal ajalehele "Edasi" saadetud värvikas stiilis saadetud kirjad.

  17. Kütuseärisse siseneb võimas finantsrusikas / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2004-01-01

    Ilmunud ka: Delovõje Vedomosti 19. mai lk. 6. OÜ Letofin Trading ärimeestest omanikering siseneb kütuseärisse. Lisa: Kütusefirmal viis omanikerühmitust; OÜ Letofin Trading kujunemine; Tsisternvagunite äri ja kütusefirma omanikud on tihedalt seotud; Jüri Mõisal on kontaktid ENSV KGB juhiga

  18. Amotz Zahavi - mees, kes leidis raiskamisele evolutsioonilise seletuse / Peeter Hõrak, Ivar Puuura

    Index Scriptorium Estoniae

    Hõrak, Peeter, 1963-

    2009-01-01

    Septembri alguses esineb Tartus loengutega Tel-Avivi ülikooli emeriitprofessor Amotz Zahavi. Ta on uurinud looduslikku valikut ning leidnud seal palju raiskamist ja pillamist, mis on omane inimühiskonnalegi

  19. Kapten haaras General Motorsis tüüri / Peeter Teder

    Index Scriptorium Estoniae

    Teder, Peeter

    2005-01-01

    General Motors'i tegevjuht Rick Wagoner võtab isiklikult vastutuse firma kahjumisse sattunud Põhja-Ameerika üksuses toimuva eest ning asub seda juhtima. Diagramm: GM-i aktsia. Lisa: GMi võlakirjad mõjutavad kogu finantsturgu

  20. Vaidlused või monoloogid? / Redi Koobak, Raili Põldsaar

    Index Scriptorium Estoniae

    Koobak, Redi

    2006-01-01

    Arvustus: Feministlikud vaidlused : filosoofiline mõttevahetus / [Seyla Benhabib, Judith Butler, Nancy Freiser, Drucilla Cornell] ; inglise keelest tõlkinud Merilin Sikk ; [koostaja Linda Nicholson]. Tallinn : Tallinna Ülikooli Kirjastus, 2006

  1. Helge Berntsen õpetab konkurendid omavahel koostööd tegema / Teeli Remmelg

    Index Scriptorium Estoniae

    Remmelg, Teeli

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti : Obutshenije i Upravlenije 9. märts lk. 5. Goodyear Dunlop Tires Balti juht Helge Berntsen paneb koolitustel konkurendid ühise laua taha kogemusi jagama. Kommenteerib Kristiina Sikk

  2. "Keisri hull" kui müstiline fantasy / Siimon Prii

    Index Scriptorium Estoniae

    Prii, Siimon

    2006-01-01

    30. sept. Ugalas esietendunud Jaan Krossi "Keisri hull" (autoridramatiseering), lavastajad Jaak Allik ja Peeter Tammearu. Kunstnik on Jaanus Laagriküll ja muusikaline kujundaja Peeter Konovalov. Peaosas Peeter Tammearu

  3. Hulluse hoomamatud piirid / Margot Visnap

    Index Scriptorium Estoniae

    Visnap, Margot, 1959-

    2006-01-01

    30. sept. Ugalas esietendunud Jaan Krossi "Keisri hull" (autoridramatiseering), lavastajad Jaak Allik ja Peeter Tammearu. Kunstnik on Jaanus Laagriküll ja muusikaline kujundaja Peeter Konovalov. Peaosas Peeter Tammearu

  4. Conjugation with Eight-Arm PEG Markedly Improves the In Vitro Activity and Prolongs the Blood Circulation of Staphylokinase.

    Science.gov (United States)

    Qi, Fangbing; Hu, Chunyang; Yu, Weili; Hu, Tao

    2018-01-24

    Staphylokinase (SAK) is a profibrinolytic protein and can be used for therapy of acute myocardial infarction and coronary thrombosis. However, SAK suffers from a short serum half-life time (∼6 min) that limits its clinical application. PEGylation prolongs the half-life time of SAK, whereas it significantly decreases the bioactivity of SAK for the steric shielding effect of PEG. To improve the bioactivity and prolong the half-life time of SAK, 8-arm PEG maleimide (8-arm PEG) was used for conjugation of multiple SAK molecules in one entity. C terminus of SAK was engineered with cysteine residue, followed by reaction with the maleimide moieties of 8-arm PEG to obtain the conjugate (SAKp-PEG). Conjugation with 8-arm PEG retained the secondary structure of SAK, slightly perturbed the tertiary structure of SAK, and essentially maintained its in vitro bioactivity by the multivalence of SAK. Conjugation with 8-arm PEG increased the hydrodynamic volume and thus significantly prolonged the half-life time of SAK. SAKp-PEG elicited a 1.4-fold increase in the SAK-specific IgG titers as compared with SAK, and rendered no apparent toxicity to the cardiac, liver and renal functions of mice. Thus, multiple conjugation of a protein with 8-arm PEG was an effective strategy to develop a long-acting protein drug with improved bioactivity and prolonged blood circulation.

  5. Dicty_cDB: VSF827 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hkllntqtsv*sklkvlshvkiqlfi*vkksv*sakfpn qpktqlvtkfhgvrfakptvvqvlsklvspetshqklwvpqselcythqtsk*ifktkkk --- ---...lahyikwkrftqkvsf*vtedhkllntqtsv*sklkvlshvkiqlfi*vkksv*sak fpnqpktqlvtkfhgvrfakptvvqvlsklvspetshqklwvpqselcyt

  6. Make believe ja skisofreenia : külaskäik Blairi nõia juurde / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2000-01-01

    Mängufilm "Blairi nõiafilm" ("The Blair Witch Project") : Stsenaristid ja režissöörid Eduardo Sanchez ja Daniel Myrick : Ameerika Ühendriigid 1999. Eesti dokumentalistika ja tegelikkuse kujutamise trendid eesti uuemas filmis

  7. Narva hävituspataljon ja töölispolk 1941. aasta sõjasuvel / Peeter Kaasik

    Index Scriptorium Estoniae

    Kaasik, Peeter

    2015-01-01

    Tagalakaitse korraldusest Eestis. Hävituspataljonida organiseerimisest Eestis. Narva hävituspataljoni formeerimisest ja struktuurist. Narva hävituspataljoni võitlusest metsavendade vastu. Narva töölipolgu formeerimisest, trsuktuurist ja isikkoosseisust. Kingissepa lahingust. Töölispolgu lagunemisest ja likvideerimisest

  8. Tarbimisühiskonna nõue on igale majapidamisele oma prügikonteiner / Peeter Eek

    Index Scriptorium Estoniae

    Eek, Peeter, 1963-

    2007-01-01

    Ilmunud ka: Vooremaa, 16. jaan. 2007, lk. 2; Lõunaleht, 18. jaan. 2007, lk. 2; Türi Rahvaleht, 19. jaan. 2007, lk. 2; Harju Ekspress, 19. jaan. 2007, lk. 5; Oma Saar, 19. jaan. 2007, lk. 4; Põhjarannik, 19. jaan. 2007, lk. 2; Severnoje Poberezhje, 19. jaan. 2007, lk. 2; Võrumaa Teataja, 20. jaan. 2007, lk. 2; Hiiu Leht, 23. jaan. 2007, lk. 5; Lääne Elu, 25. jaan. 2007, lk. 2; Järva Teataja, 30. jaan. 2007, lk. 5. Keskkonnaministeeriumi jäätmeosakonna juhataja korraldatud jäätmeveo vajalikkusest

  9. Vikergallup: eesti kirjandus 2003 : [vastused Vikerkaare küsimustele] / Vahur Afanasjev, Indrek Hargla, Peeter Helme ... [jt.

    Index Scriptorium Estoniae

    2004-01-01

    2003. a. parima uudisraamatu tiitli pälvis Kivisildniku "Päike, mida sa õhtul teed"; parima esikraamatu tiitlit jagasid Asko Künnapi "Ja sisalikud vastasid (kolmes kirjas)" ning Erkki Luugi "Ornitoloogi meelespea"

  10. Pihl : joobes autojuhtimised pole liikluses probleem number üks / Jüri Pihl ; interv. Peeter Kuimet

    Index Scriptorium Estoniae

    Pihl, Jüri, 1954-

    2007-01-01

    Siseminister Jüri Pihl vastab küsimustele liiklusõnnetuste ja -surmade põhjuste kohta, pidades suurimaks põhjuseks kiiruseületamist ja lahtisi turvavöid. Rikkujate karistamisest ja alkoholimüügi piirangutest. Lisa: Kurb statistika

  11. Mart Viljus : insener Garin ja moodne häkker = Engineer Garin and modern hacker / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2012-01-01

    Füüsik Mart Viljus on kunstnik, kes armastab allikmaterjalina kasutada olmes ringlevaid märke, valmisesemeid, mis on talle emblemaatilise tähendusega. Ta võtab need osadeks lahti ja paigutab seejärel nihestatult uuteks tervikuteks. Nõnda tekivad uued tähendused ja avaldub kunstniku isiklik suhtumine ühiskonda, mida vürtsitab paras annus huumorit, absurdi ja irooniat. Analüüsitakse põhiliselt 1990-ndate aastate loomingut

  12. Hiigelehitis täis kirge ja meelelisust / Märt Väljataga ; intervjueerinud Peeter Helme

    Index Scriptorium Estoniae

    Väljataga, Märt, 1965-

    2011-01-01

    Raamatust: Dante Alighieri. Jumalik komöödia. Põrgu / tõlkinud Harald Rajamets. Tallinn : Eesti Keele Sihtasutus, 2010 ; Dante Alighieri. Jumalik komöödia. Põrgu / tõlkinud Harald Rajamets. Tallinn : Tallinna Ülikooli Kirjastus, 2011. Intervjuu teose eestikeelse tõlke toimetaja Märt Väljatagaga

  13. Archaeological investigations in Tallinn at Viru street 8 site and in the area of bastions / Peeter Talvar

    Index Scriptorium Estoniae

    Talvar, Peeter

    2006-01-01

    Tehti kindlaks nelja puithoone jäänused, millest kolm olid rajatud 13. sajandi keskel ja üks 14. sajandi esimesel poolel. Lisaks puithoonetele leiti ka kaks paekivimüüri. Leiumaterjalist. Mitmekesine oli päevavalgele tulnud kangatükkide valik. Ühe hoone nahaleidude põhjal nähtub, et sellel kinnistul töötas kingsepp. Wismari raveliini ja Skåne bastioni müüristiku väljakaevamistest

  14. El otro lado del espejo : Arquitectura y cómic, la obra de Schuiten y Peeters.

    OpenAIRE

    Tuset Souto, Jorge

    2011-01-01

    . RESUMEN. La influencia de la Arquitectura en el Cómic es asunto probado. Críticos y estudiosos como Eco, Masotto, Montaner o Smolderen así lo atestiguan. La ciudad y su arquitectura son protagonistas en “The Yellow Kid” de Outcoult de 1896 y de las visiones perspectivas de metrópolis como New York en “Little Nemo” de Mc Cay de 1910. Los aportes más significativos a la visión de la arquitectura desde el cómic tal vez hayan sido los desarrollados por Hergé y sus ciudades de ficción c...

  15. The Baltic States 1918-2001 : thirty-two years of Baltic foreign policy-making / Peeter Vares, Marina Sergeyeva

    Index Scriptorium Estoniae

    Vares, Peeter

    2001-01-01

    Järgneb: nr. 7, lk. 134-144. Balti riikide välispoliitilisest koostööst maailmasõdade vahelisel ajal, nõukogude perioodil, taasiseseisvumisel ning tänapäeval, sõjalisest koostööst erinevate projektide BALTBAT, BALTRON, BALTNET ja BALTDEFCOL raames

  16. Nullindate nuhtlus: mõtteid möödunud kümnendi Eesti proosast / Peeter Helme

    Index Scriptorium Estoniae

    Helme, Peeter, 1978-

    2011-01-01

    Artikli autor leiab, et Eesti kirjandus on marginaalsemas seisus, kui ta oli seda sajandi eest. Uue aastatuhande Eesti proosa on olnud põnev ja mitmetahuline, kuid puudu on mahukas ja laiahaardeline romaan, mis kaardistaks kogu ühiskonda

  17. Kuidas EMTA osakonnad lähevad vastu kooli 100. tegevusaastale? / Ivari Ilja, Peeter Paemurru, Nadia Kurem...[jt.

    Index Scriptorium Estoniae

    2009-01-01

    Klaveriosakonna juhataja I. Ilja, keelpilliosak. juh. P. Paemurru, lauluosak. juh. N. Kurem, dirigeerimisosak. juh. T. Kapten, kammermuusikaosak. juh. H. Kapten, kompositsiooniosak. juh. T. Tulev, muusikateaduse osak. juh. U. Lippus, interpretatsioonipedagoogika instituudi juh. T. Reimann, koolimuusika inst. juh. K. Kiilu, jazzmuusika osak. juh. J. Sooäär, lavakunstikooli juh. I. Normet, kultuurikorralduse ja humanitaarainete osak. juh. G. Birnkraut, Tartu filiaali juh. K. Leivategija, pärimusmuusika eriala lektor ja koordinaator T. Bartosik oma osakondade tööst

  18. Jüri Pihl : Rahvale räägitakse valet, ilget valet / Jüri Pihl ; interv. Peeter Ernits

    Index Scriptorium Estoniae

    Pihl, Jüri, 1954-

    2005-01-01

    Justiitsministeeriumi kantsler Jüri Pihl kaitseb justiitsministeeriumi plaani korruptantide tabamiseks. Lisa: Justiitsminister Ken-Marti Vaheri nädal. Vt. ka: Kas justiitsminister Ken-Marti Vaheri korruptantide avastamise plaani varjutab stalinismi vari? Küsimusele vastavad Sotsiaaldemokraatliku erakonna esimees Ivari Padar, Keskerakonna liige Evelyn Sepp, Reformierakonna esimees Andrus Ansip, Rahvaliidu fraktsiooni esimees Jaanus Männik, sotsiaalliberaal Liina Tõnisson, Reformierakonna fraktsiooni esimees Peep Aru ja Isamaaliidu liige Mart Laar. Vastuseks vt. ka Ivar Tallo repliiki 7. apr. Maalehes

  19. Tallinnas Tõnismäel asuv punaarmeelaste ühishaud ja mälestusmärk / Peeter Kaasik

    Index Scriptorium Estoniae

    Kaasik, Peeter

    2006-01-01

    Eestis olevatel arhiiviallikatel, 1944.-1945. aasta ajakirjandusel ja muul informatsioonil tuginev analüüs Tallinnas Tõnismäel Kaarli pst 13 asuva ühishaua ning niinimetatud Vabastajate monumendi ajaloost. Tabel: Koondnimekiri võimalikest Tõnismäele maetud punaarmeelastest

  20. Kultuurrahvaks olemise kultuur Nava lava, Tuhalaane ja Sudiste külapäevade valguses / Peeter Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    2010-01-01

    Eestlaste kultuurrahvaks olemisest. Kultuuri edendamine Viljandimaal on heal järjel: Jaak Kõdari loodud mulgi kultuuri festivalist ja tema näitemängust "Rauksi talu lugu", Tuhalaane kultuuriloost, Sudiste külapäevadest

  1. Meelis Lao astub kohtu ette McDonald's Eesti ründamise eest / Martin Hanson, Peeter Raidla

    Index Scriptorium Estoniae

    Hanson, Martin, 1984-

    2005-01-01

    Prokuratuur süüdistab Meelis Laod McDonald'si omavolilises sulgemises rendivaidluse tõttu. Skeem: Meelis Laoga seotud firmad. Vt. samas: Omakohus kohut ei mõjutanud; Mõis: Lao tegutseb efektiivselt

  2. Lennart Meri armid ja sidemed : lähimineviku vähetuntud lehekülgi / Peeter Rahnel

    Index Scriptorium Estoniae

    Rahnel, Peeter, 1957-

    2002-01-01

    Järg 11.,18., 25. sept., 2. ,9.,16., 23., 30. okt., 6., 13. nov., lk. 9. Ilmunud ka: Hiiumaa 7., 12., 19., 26. sept. lk. 5, 6; 3., 10., 17., 24., 31. okt., 7., 14. november, lk. 6; Kesknädal, 4.,11., 18.,25 sept.;2., 9., 16. okt., lk. 9. Aruandest ENSV Riikliku Julgeoleku Komitee 2. vastuluure osakonna tööst ajavahemikul 1. aprill 1954 - 1. aprill 1955. Lennart Meri isast Georg Merist kui väidetavast NKVD agendist. Georg Meri Moskvas Butõrka vanglas. Eesti Vabariigi riigitegelastest, kelle NKVD Severurallagis surma mõistis. Perekond Meri käekäigust peale II maailmasõda. Lennart Meri õpingud Tartu Ülikoolis, tegevus VEKSA liinis. Lennart Meri väidetavad kahtlused Ülemnõukogu esimehe Arnold Rüütli suhtes 1990. a. Boriss Jeltsini visiit Eestisse 1990. a. Lennart Meri visiit Moskvasse 1994. a. Lepingule allakirjutamine

  3. Reet Aus, ausa moe nääpsuke saadik / Reet Aus ; intrvjueerinud Britt Rosen ; kommenteerinud Peeter Jalakas

    Index Scriptorium Estoniae

    Aus, Reet, 1974-

    2010-01-01

    Moekunstnik Reet Ausi eluloolisi andmeid, loomingust, karjäärist, edust välismaal. Keskkonnasäästlikust elustiilist ja moest, disainrõivaste tootmisest ja toote hinna kujunemisest. Loetletud teatri- ja filmitööd, võidetud auhinnad, valik näitusi

  4. Suur Peeter on Väikse Peetri toidukoti tühjaks söönud / Andrus Villem

    Index Scriptorium Estoniae

    Villem, Andrus

    2004-01-01

    Ilmunud ka: Meie Maa, 3. nov. 2004, lk. 2; Koit, 4. nov. 2004, lk. 6; Vooremaa, 4. nov. 2004, lk. 2; Harjumaa, 5. nov. 2004, lk. 2; Hiiu Leht, 5. nov. 2004, lk. 2; Elva Postipoiss, 6. nov. 2004, lk. 4; Lääne Elu, 9. nov. 2004, lk. 2; Kesknädal, 10. nov. 2004, lk. 1; Pärnu Postimees, 11. nov. 2004, lk. 11; Virumaa Teataja, 11. nov. 2004, lk. 7. Res Publica ja Reformierakonna liitumiskokkuleppest, selle tagamaadest ja tagajärgedest

  5. Cloning, high-level expression, purification and characterization of a ...

    African Journals Online (AJOL)

    The staphylokinase (Sak) is emerging as an important thrombolytic agent for the treatment of patients suffering from cardiovascular disease. Hence in this study, we reported the cloning, high-level expression, purification and characterization of the Sak variant SakøC from Staphylococcus aureus QT08 in Escherichia coli ...

  6. Kinetic and stoichiometric analysis of the modification process for N-terminal PEGylation of staphylokinase.

    Science.gov (United States)

    Wang, Jun; Hu, Tao; Liu, Yongdong; Zhang, Guifeng; Ma, Guanghui; Su, Zhiguo

    2011-05-01

    Staphylokinase (SAK) is a therapeutic protein with promise for thrombolytic therapy of acute myocardial infarction. In this study, polyethylene glycol (PEG) aldehyde was used for N-terminal PEGylation of SAK to improve the pharmacological profiles of SAK. Due to the presence of the competitive PEGylation between the N terminus and the Lys residues, kinetic and stoichiometric analysis was carried out to investigate the process for the N-terminal PEGylation of SAK. To achieve this objective, size exclusion chromatography and tryptic peptide mapping were used to measure the PEGylation extent of SAK molecule and its specific amino acid residues, respectively. Copyright © 2010 Elsevier Inc. All rights reserved.

  7. Mellem Sikkerhed og Faglighed

    DEFF Research Database (Denmark)

    Hansen, Agnete Meldgaard; Weber, Søren Salling; Nielsen, Klaus Tranetoft

    2017-01-01

    Artiklen belyser arbejdsmiljøarbejdet med vold på et døgn- og aflastningstilbud og to social-psykiatriske bosteder. På arbejdspladserne udbredes en ’sikkerhedsorienteret’ tilgang til volds-forebyggelse, med vægt på systematisering og beskyttelse af personalet mod potentielt farlige beboere. Sikke...

  8. Eestlased saadeti Marimaalt segaste põhjendustega välja / Jaak Prozes

    Index Scriptorium Estoniae

    Prozes, Jaak, 1965-

    2005-01-01

    Eesti Kunstiakadeemia poolt korraldatud 28. soome-ugri ekspeditsioon lõppes 17 Kunstiakadeemia tudengi väljasaatmisega Marimaalt kohalike võimude poolt. Lisa: Mõni marikeelne raamat aastas. Vt. samas: Rein Sikk. Suur mees, kes armastab väikseid

  9. Köök - meelte ateljee / Karen Jagodin

    Index Scriptorium Estoniae

    Jagodin, Karen, 1982-

    2008-01-01

    2008. a. valminud õppeköögist "Köök" Tallinnas Pikk t. 42. Sisekujundus: Indrek Kasela, Sikke Sumari (omanikud). Paekivi- ja punasetest tellistest seintega ruumi kaunistab moodne kunst. Skulpturaalse veini- ja raamaturiiuli on kavandanud Edith Karlson ja Flo Kasearu, lühtri autor on Anna Roomet

  10. Kuidas koostada meeskonda - Mount Everesti ainetel / Marii Karell

    Index Scriptorium Estoniae

    Karell, Marii, 1980-

    2003-01-01

    Eesti meeskonna Mount Everesti tippu juhtinud Tõivo Sarmet selgitab toimunud ekspeditsiooni näitel, miks tema peab meeskonna komplekteerimisel oluliseimaks inimeste iseloomuomadusi. Ekstreemoludes hakkama saamiseks tuleb meeles pidada, et eesmärk on ühine ja kellegi ego ei tohi seda nurjata, rõhutab Sarmet. Kommenteerib Alar Sikk

  11. Breakstructures

    DEFF Research Database (Denmark)

    Thrane, Torben

    2003-01-01

    is responsible for a principled distinction between structural (TopP) and rhetorical (CP) topicalization. Primary data are Det-clefts, Hv-clefts and so-called sikke-expressions in Danish. The latter are peripheral to the core of Danish grammar, but are nevertheless - or perhaps therefore - a mine of evidence...

  12. 24. IV avati Tartu Kunstimajas...

    Index Scriptorium Estoniae

    2003-01-01

    Vallo Kalamehe ja Peeter Linnapi kureeritud fotonäitus "XXL. Eesti fotoklassika". Osalevad Herkki-Erich Merila, Tarvo Hanno Varres, Peeter Laurits, Toomas Kalve, P. Linnap, V. Kalamees, Malev Toom, Madis Palm, Tõnu Tamm, Meelis Lokk

  13. Kino-Mati näitab Rakveres kino / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2001-01-01

    Rakveres tuli lavale Toomas Raudami ja Peeter Simmi näidend Lõuna-Eesti kinomehaaniku Mati Parkja elust "Kino-Mati. Tema elutee ja juhtumised, mis seal ette tulid". Lavastas Peeter Simm, nimiosas Erik Ruus

  14. Postimehe žürii hindab võistlusfilme

    Index Scriptorium Estoniae

    2007-01-01

    Toimetuse žürii koosseisus Peeter Simm, Karol Ansip, Sakarias Lepik, Jevgenia Tirdatova ja Kris Taska hindab PÖFFil näidatavaid filme. Seekord kommenteerivad oma hinnanguid Peeter Simm ja Jevgenia Tirdatova

  15. Aasta Puitehitis 2011 - väliköök Padise vallas / Karen Jagodin

    Index Scriptorium Estoniae

    Jagodin, Karen, 1982-

    2011-01-01

    Konkursi "Eesti parim puitehitis 2011" võitis Padise vallas asuv Peeter Loo ja Jan Skolimowski (KAMP Arhitektid) projekteeritud väliköök, mida tutvustab arhitekt Peeter Loo. Loetletud parimad tööd erinevates kategooriates

  16. Dokumentaalfilm Toomas Reinust

    Index Scriptorium Estoniae

    2011-01-01

    Kumu auditooriumis esilinastub 26. aprillil dokumentaalfilm "Ehituskunstnik Toomas Rein" (AD Oculos Film, 2010). Leonhard Lapini idee, Toivo Tammiku ja Peeter Brambati käsikiri, režissöör ja produtsent Peeter Brambat

  17. Kunst sai pronksist maski / Johannes Saar

    Index Scriptorium Estoniae

    Saar, Johannes, 1965-

    2005-01-01

    Dokumentaalfilm skulptuurinäitusest Kunstihoones "Pronksiaeg" : režissöör ja produtsent Peeter Brambat : stsenaristid Juta Kivimäe ja Peeter Brambat : operaator Peep Laansalu : AD Oculos Film 2002

  18. "Metsik roos" eesti ärinaisega / Jaan Ruus

    Index Scriptorium Estoniae

    Ruus, Jaan, 1938-2017

    2005-01-01

    Mängufilm "Stiilipidu" : režissöör Peeter Urbla : operaator Mait Mäekivi : kesksetes rollides Maarja Jakobson, Anne Reemann, Evelin Pang : EXITfilmi esilinastus 15. aprillil Coca-Cola Plazas. Lisaks "Valik Peeter Urbla filme"

  19. "Keset filmi" Kiasmas

    Index Scriptorium Estoniae

    2004-01-01

    Soome kunstniku Tellervo Kalleineni filmiprojektist "In the middle of a movie'". Eestist esinesid projektis Taavi Eelmaa, Tarrvi Laamann, Silva Lutz, Anders Melts, Anneli Remme, Siiri Salem, Martin Palm, Kaja Prikk, Peeter Ristsoo, filmisid Peeter Maimik ja Marianne Kõrver

  20. Kangelaste vanapaganastumisest Eestis. Toomas Reinu juhtum / Andri Ksenofontov

    Index Scriptorium Estoniae

    Ksenofontov, Andri, 1962-

    2010-01-01

    Dokumentaalfilmist "Ehituskunstnik Toomas Rein" (AD Oculos Film, 2010). Leonhard Lapini idee, Toivo Tammiku ja Peeter Brambati käsikiri, režissöör ja produtsent Peeter Brambat. Esilinastus 14. oktoobril kinos Sõprus

  1. Gut. Besser. Simmig? / Jaan J. Leppik

    Index Scriptorium Estoniae

    Leppik, Jaan J., 1969-

    2006-01-01

    Eesti-Saksa koostööfilm "Kõrini" : stsenaristid Hans-Werner Honert, Thomas Steinke, Peeter Simm, Valentin Kuik : režissöör Peeter Simm : operaator Rein Kotov : Ruut Pictures (Eesti) - Saxonia Film (Saksa) 2005

  2. "Dostali!"

    Index Scriptorium Estoniae

    2006-01-01

    Eesti-Saksa koostööfilm "Kõrini" : stsenaristid Valentin Kuik, Peeter Simm, Hans Werner Honert, Thomas Steinke : režissöör Peeter Simm : operaator Rein Kotov : Ruut Pictures (Eesti) - Saxonia Film (Saksa) 2005

  3. Kas eesti keelt kummitab sõnavaravaegus? / Virve Liivanõmm

    Index Scriptorium Estoniae

    Liivanõmm, Virve

    2009-01-01

    Terminoloogiakonverentsist "Eestikeelne ülikool" Tartus ning Eesti teaduskeele konverentsist Tallinna Ülikoolis. Konverentsidel võtsid sõna Peeter Päll, Mats Estonius, Peeter Saari, Igor Gräzin, Peep Nemvalts, Krista Kerge, Toomas Silk

  4. Kemplus pärast lahingut / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2005-01-01

    ETV 19. oktoobri saatest "Foorum", kus osalesid erakondade aseesimehed: Mailis Reps (Keskerakond), Meelis Atonen (Reformierakond), Katrin Saks (Sotsiaaldemokraatlik Erakond) ja Andres Herkel (Isamaaliit)

  5. Dicty_cDB: SSE420 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available f*vtedhkllntqtsv*sklkvlshvkiqlfi*vkksv*sakfpnqpkt qlvtkfhgvrfakptvvqvlsklvspetshq...rfarnlppkamgapvrvmlypsni*inl*ne--- ---ptrpikwkrftqkvlf*vtedhkllntqxsv*sklkvlxxvkiqlfi*vkkfv*sak fpnqpktqlvtkfhgvrfakptvvqvlskxvxpets

  6. Staphylokinase Control of Staphylococcus aureus Biofilm Formation and Detachment Through Host Plasminogen Activation.

    Science.gov (United States)

    Kwiecinski, Jakub; Peetermans, Marijke; Liesenborghs, Laurens; Na, Manli; Björnsdottir, Halla; Zhu, Xuefeng; Jacobsson, Gunnar; Johansson, Bengt R; Geoghegan, Joan A; Foster, Timothy J; Josefsson, Elisabet; Bylund, Johan; Verhamme, Peter; Jin, Tao

    2016-01-01

    Staphylococcus aureus biofilms, a leading cause of persistent infections, are highly resistant to immune defenses and antimicrobial therapies. In the present study, we investigated the contribution of fibrin and staphylokinase (Sak) to biofilm formation. In both clinical S. aureus isolates and laboratory strains, high Sak-producing strains formed less biofilm than strains that lacked Sak, suggesting that Sak prevents biofilm formation. In addition, Sak induced detachment of mature biofilms. This effect depended on plasminogen activation by Sak. Host-derived fibrin, the main substrate cleaved by Sak-activated plasminogen, was a major component of biofilm matrix, and dissolution of this fibrin scaffold greatly increased susceptibility of biofilms to antibiotics and neutrophil phagocytosis. Sak also attenuated biofilm-associated catheter infections in mouse models. In conclusion, our results reveal a novel role for Sak-induced plasminogen activation that prevents S. aureus biofilm formation and induces detachment of existing biofilms through proteolytic cleavage of biofilm matrix components. © The Author 2015. Published by Oxford University Press for the Infectious Diseases Society of America. All rights reserved. For permissions, e-mail journals.permissions@oup.com.

  7. Pronkssõduri teisaldamise ainsaks eelduseks on referendum / Kalev Rebane, Roman Zharov, Aleksandr Korobov...[jt.] ; interv. Peeter Ernits, Jüri Aarma, Annika Poldre

    Index Scriptorium Estoniae

    2006-01-01

    Oma seisukohtadest Tallinnas Tõnismäel asuva Teise maailmasõja mälestusmärgi suhtes räägivad isamaaliitlane Kalev Rebane ja vene noorteühenduse Notshnoi Dozor juhid Roman Zharov, Aleksandr Korobov, Oleg Filippov ja Igor Rogo

  8. Uudised : Õhtusöök ̉ la J.S. Bach. Peeter Lilje mälestusfondist. Nana Mouskouri Tallinnas / Kerle Arula

    Index Scriptorium Estoniae

    Arula, Kerle

    2000-01-01

    19. nov. restoranis Balthasar toimuvast õhtusöögist koos Bachi muusikaga. P. Lilje nimelisest fondist interpretatsioonikunsti jäädvustamiseks. 22. nov. annab Kaarli kirikus heategevuskontserdi N. Mouskouri

  9. Eesti Vabariigi 1929. a. kriminaalseadustiku väljatöötamine : [bakalaureusetöö] / Dea Hannust ; Tartu Ülikool, õigusteaduskond ; juhendaja: Peeter Järvelaid

    Index Scriptorium Estoniae

    Hannust, Dea

    1995-01-01

    Üldine situatsioon, 1918-1920 ettevalmistused Vene 1903. a. kriminaalseaduse kehtestamiseks Eesti Vabariigis, selle ümbertöötamine kriminaalseadustiku eelnõuks, seadustiku läbivaatamine Riigikogu erikomisjonides 1925-1928, kriminaalseadustiku arutelu ja vastuvõtmine Riigikogus

  10. Kohtuvõidu saanud soovivad riigilt õiglast hüvitist. 20 aastat raha ootel / Väinu Rozental ; kommenteerinud Peeter Jalakas

    Index Scriptorium Estoniae

    Rozental, Väinu, 1957-

    2011-01-01

    Ringkonnakohtu otsusest, mille kohaselt peab riik lahendama Nõukogude Liidu Välismajanduspanga (VEB) Fondi sertifikaatide hüvitamise äriühingutele AS Saare Kalur, AS Pärnu Kalur Holding, AS Akke, AS A.O.Imbi ja AS Tartu Lihakombinaat

  11. Commensuration and policy comparison: How the use of standardized indicators affects the rankings of pension system / Hans Peeters, Gert Verschraegen, Annelies Debels

    Index Scriptorium Estoniae

    Peeters, Hans

    2014-01-01

    Artikkel käsitleb standardiseertud indikaatorite konstrueerimist ja kasutamist pensionipoliitikas, mis aitavad võrrelda ja hinnata eri OECD liikmesriikide pensionisüsteemide sotsiaalset tulemuslikkust, nt vaesusriski vähendamine või elustandardi säilitamine vanas eas. Teiste seas on vaatluse all ka Eesti. Joonised

  12. Esmase ja teisese menetluse seosed piiriületavas pankrotimenetluses : [magistritöö] / Peeter Viirsalu ; Tartu Ülikool, õigusteaduskond ; juhendaja: Paul Varul

    Index Scriptorium Estoniae

    Viirsalu, Peeter

    2007-01-01

    Piireületav pankrotimenetlus ja selle peamised printsiibid, esmase ja teisese menetluse olemus, algatamine, lõpetamine, likvideerijad, nõuded ning otsuste tunnustamine esmases ja teiseses menetluses

  13. Elva, Viljandi,Tallinna ja Kuremäe võistlused / Karin Bachmann, Peeter Pere, Endrik Mänd, Veljo Kaasik

    Index Scriptorium Estoniae

    2016-01-01

    Eesti Vabariik 100 võistlussarja raames korraldatud arhitektuurivõistlustest Elvas, Viljandis, Tallinnas ja Kuremäel. Elva linn valis võistlusobjektiks kaubanduskeskuse ja parkla laienduse. Esimese preemia sai võistlustöö "Sõstrapõõsaste vahel" (autorid: Ülle Maiste, Diana Taalfeld, Anne Saarniit, Roomet Helbre ja Taavi Kuningas). Viljandi linna võistluse eesmärk oli leida terviklik ruumiline lahendus Vabaduse platsi ja selle lähialade ning Tallinna, Vaksali ja Vana-Vaksali tänava arenduseks. Esimese preemia sai võistlustöö "Tasa sõuab" (autorid: Ülle Maiste, Diana Taalfeld, Anne Saarniit, Roomet Helbre, Taavi Kuningas ja Mihkel Urmet). Tallinna linn valis võistlusobjektiks peatänava. Esimese preemia sai võistlustöö "Kevad linnas" (autorid: Toomas Paaver, Indrek Kustavus, Indrek Peil, Siiri Vallner, Kristel Niisuke, Valdis Linde ja Riin-Kärt Ranne). Kuremäe küla valis võistlusobjektiks küla keskuse kujundamise koos uute funktsioonide lisamisega. Esimese preemia sai võistlustöö "Rännak" (autorid: Helen Rebane, Kaie Kuldkepp ja Pelle-Sten Viiburg)

  14. Ita Sermani intervjuu Peeter Linnapiga : kõik, millest olen unistanud, on täide läinud / intervjueerinud Ita Serman

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2011-01-01

    Fotograaf ja kuraator oma nägemusest Baltimaade fotograafiast, kunsti ja fotograafia vahelisest vastasseisust Eestis, oma näitustest erinevates maades ja fotonäitusest "Le Top 50" Ajaloo Instituudi galeriis

  15. Taasvabanenud Eesti põhiseaduse eellugu / Eesti Akadeemiline Õigusteaduse Selts ; toim. Heinrich Schneider ; toimetuskolleegium: Rait Maruste, Heinrich Schneider, Tõnu Anton, Peeter Järvelaid

    Index Scriptorium Estoniae

    1997-01-01

    Eelpõhiseaduslike aktide loetelu lk. 299-302 ; Eelpõhiseaduslikud aktid (täistekstid) lk. 45-187 ; I. Gräzini Eesti Demokraatliku Sotsialistliku Vabariigi põhiseaduse töömakett lk. 190-210 ; E. Talviku ja J. Kaljuvee Eesti Vabariigi põhiseaduse eelnõu lk. 212-225 ; J. Raidla töögrupi Eesti Vabariigi põhiseaduse eelnõu lk. 226-247 ; A. Lepsi Eesti Vabariigi põhiseaduse eelnõu lk. 248-264 ; J. Adamsi töögrupi Eesti vabariigi põhiseaduse eelnõu lk. 266-284 ; K. Kulboki Eesti Vabariigi põhiseaduse eelnõu lk. 286-297

  16. Uudised : Noored vaskpillimängijad Võrus. Koorilaulude konkursi tulemused. Tartu muusikakoolil uus direktor. TÜ Kammerkoor otsib dirigenti. Loodi Kõpu Majaka Fond / Peeter Perens

    Index Scriptorium Estoniae

    Perens, Peeter

    1999-01-01

    10. augustil avatakse Võru vaskpillipäevad ja IV suvekool. 31. juulil toimus Puurmanis Eesti segakoorilauljate suvelaagris uute segakoorilaulude konkursi lõppkontsert. Heino Elleri nimelise Tartu Muusikakooli uueks direktoriks kinnitati M. Jaanson. TÜ Kammerkoor kuulutab välja konkursi dirigendi kohale. 24. juulil asutati E. Klasi eestvõtmisel Kõpu Majaka Fond, mille eesmärgiks on edendada Hiiumaa kultuurielu

  17. How the Estonian communists lost their war against the Finnish television : the documents of the Estonian State Archive reveal the historical truth / Olga Zhurjari, Peeter Vares

    Index Scriptorium Estoniae

    Zhurjari, Olga

    2000-01-01

    EKP võitlusest soome televisiooniga, mis jõudis haripunkti 1980-ndate alguses, kui keelati avalikes kohtades soome televisiooni vaatamine, üritati kontrollida soome telekanalite vaatamist kodudes jne

  18. Erikontingendi filtreerimine ja töölerakendamine Eesti NSV-s kontroll-filterlaager nr. 0316 näitel / Peeter Kaasik

    Index Scriptorium Estoniae

    Kaasik, Peeter, 1974-

    2010-01-01

    1945. aasta alguses paigutati Paldiski lähedale Põllkülasse NKVD erilaager. Laager allus NSV Liidu NKVD kontroll-filterlaagrite osakonnale. Erikontingendi mõistest. Kontroll-filterlaagri nr. 0316 rajamisest ja struktuurist. Laagri Smerši osakonna tegevusest. Kontroll-laager nr. 0316 oli mõneti erandlik, sealt ei saadetud isikuid üldjuhul Eestist välja. Balti riikide kodanikest erikontingendi küsimus jäi täpselt määratlemata, NSV Liidu kui oma kodumaa reeturiteks ei saanud neid nimetada

  19. Eesti mõjukad : Jüri Käo, Toomas Sildmäe, Neinar Seli / Ralf-Martin Soe, Peeter Raidla

    Index Scriptorium Estoniae

    Soe, Ralf-Martin

    2007-01-01

    Äripäev uuris, kes on Eesti kõige mõjukam äritegelane, võttes aluseks sidemete hulga ja kvaliteedi. Vt. samas: Kuidas sündis Eesti Mõjukate TOP; Tabel: TOP; Sotsioloog Andrus Saar: äritegemiseks on suhete võrgustik ülioluline; Mõjukad poliitikud Villu Reiljan ja Juhan Parts; Mõjukus tuleb Suurettevõtjate Assotsiatsiooni astumisega; Topeltmõjukas Jüri Käo; Toomas Sildmäe - Hansa asutaja ja hotelliärimees; Neinar Seli - südamesõber Ansipiga

  20. Kadrioru skandaali võtmetegelane: Ma olen ühiskonnast välja heidetud, aga mitte väljaheide / Peeter Ernits

    Index Scriptorium Estoniae

    Ernits, Peeter

    2006-01-01

    Noortepeod Kadrioru presidendilossis. Eesti presidendi residentsis toimunud noortepidude tagamaadest ja meediskandaalist. Skandaali võtmetegelane oli Marek Paulson, kes tõi noortepeod avalikkuse ette ETV saates "Pealtnägija". Ilmunud ka intervjuud uurimist juhtinud ülemkomissari Margus Kotter'iga: Ülemkomissar Kotter: Paulson valetas avalikkusele. Ilmunud ka Vaba Eesti Sõna = Free Estonian Word, 2006/May/4, lk. 2,9,11

  1. Kadrioru skandaali võtmetegelane: Ma olen ühiskonnast välja heidetud, aga mitte väljaheide / Peeter Ernits

    Index Scriptorium Estoniae

    Ernits, Peeter, 1953-

    2006-01-01

    Eesti presidendi residentsis toimunud noortepidude tagamaadest ja meediaskandaalist. Vt. ka intervjuud uurimist juhtinud ülemkomissari Margus Kotteriga: Ülemkomissar Kotter: Paulson valetas avalikkusele

  2. Joh. Aaviku keeleuuendus ja "purukodanlik kirjanik Koidula" sõjariistana eesti kommunistide sisekähmlustes 1930. aastatel. Vaade Fontankalt / Peeter Väljas

    Index Scriptorium Estoniae

    Väljas, Peeter, 1963-

    2014-01-01

    Nn "fontannikud" (Keskbüroo asus Petrogradis Fontanka kanali äärsel tänaval) eesotsas J. Palvadrega keeldusid tunnistamast EKP Eesti-suunalise tegevuse monopoli. 1930. aastate algul tõsteti ÜK(b)P ja selle sõltlasparteides päevakorda võitlus "rahvusdemokratismiga". Lisatud väljavõtteid fontannikute kirjandusteemalistest tekstidest

  3. Innovaatiliste tehnoloogiate rakendamine sugupulli sügavkülmutatud/sulatatud sperma kvaliteedi tõstmiseks / Peeter Padrik, Triin Hallap, Tanel Bulitko, Ülle Jaakma

    Index Scriptorium Estoniae

    Padrik, Peeter, 1961-

    2012-01-01

    Uuendatud tehnoloogia seisnes pullide optimeeritud kasutamises, sperma lahjendamise diferentseerimises, spermide arvu optimeerimises seemendusdoosis ning uue automaatse programmeeritava külmutusseadme Turbo Freezer rakendamises

  4. Töölepingu ülesütlemine majanduslikel põhjustel : töötaja tagatised / Vahur-Peeter Liin

    Index Scriptorium Estoniae

    Liin, Vahur-Peeter, 1983-

    2009-01-01

    Töötajate valiku kriteeriumitest, töölepingu ülesütlemise piirangutest ja teise töö pakkumise kohustusest enne töölepingu ülesütlemist. Etteteatamistähtajast ja rahalisest hüvitisest töölepingu ülesütlemisel

  5. MRP, Generalplan Ost ning baltisakslaste Eestist ja Lätist väljarändamine (Poola arhiivide valguses) / Peeter Järvelaid

    Index Scriptorium Estoniae

    Järvelaid, Peeter, 1957-

    2009-01-01

    Üürnike Liit korraldas 22. sept. 2009 Rahvusraamatukogus omandireformialase konverentsi. Õigusajaloolase ettekanne varade tagastamisest, kahjude kompenseerimisest, baltisakslaste väljarändamisest, II maailmasõjast

  6. Õigus Vanas Testamendis : [bakalaureusetöö] / Haide Rimmel ; Tartu Ülikool, õigusteaduskond ; juhendaja: Peeter Järvelaid

    Index Scriptorium Estoniae

    Rimmel, Haide

    1996-01-01

    Vana Testamendi õiguse üldiseloomustus (kasuistlikud normid, apodiktilised normid), Vana Testamendi õiguse allikad (lepinguraamat, deuteronoomium, Pühadusseadus ja Preestrikoodeks, muud allikad), Vana Testamendi õiguse subjektid (täieõiguslikud kodanikud, võõramaalased, orjad), Vana Testamendi õigusharud (kriminaalõigus, perekonnaõigus, pärimisõigus, võlaõigus, asjaõigus), õigusemõistmine Vanas Testamendis

  7. Kõlvatu konkurents: mõned teoreetilised ja õiguslikud alused : [bakalaureusetöö] / Peeter Kutman ; Tartu Ülikool, õigusteaduskond ; juhendaja: Heiki Pisuke

    Index Scriptorium Estoniae

    Kutman, Peeter

    1995-01-01

    Konkurentsi üldmõisted, kõlvatu konkurentsi ja selle vastase seadusandluse üldiseloomustus, kõlvatu konkurentsi üksikud liigid, konkurentsi riiklik järelevalve ja kaitse kõlvatu konkurentsi vastu

  8. Jääkild südamesse / Rainer Sarnet

    Index Scriptorium Estoniae

    Sarnet, Rainer, 1969-

    2001-01-01

    Eesti-Läti mängufilm "Head käed" : stsenaristid Toomas Raudam ja Peeter Simm : režissöör Peeter Simm : Allfilm (Eesti) - Stuudio F.O.R.M.A. (Läti) 2001. Lisa : Sulev Teinemaa koostatud Peeter Simmi filmograafia

  9. Isehakanud klassikute näitus / Margus Kiis

    Index Scriptorium Estoniae

    Kiis, Margus

    2003-01-01

    Fotonäitusest XXL, mis hõlmab peamiselt 1990-2000 a. fotosid, Tartu Kunstnike Majas. Näituse koostajad Peeter Linnap ja Vello Kalamets. Kirjeldatud DeStudio, Peeter Lauritsa, Toomas Kalve, Tarvo Hanno Varrese, Peeter Linnapi, Meelis Lukki, Ain Protsini, Tõnu Tamme, Malev Toomi, Vello Kalametsa ja Madis Palmi töid

  10. Gedandedi sa Geviya/ Dictionnaire Geviya–Français | Mavoungou ...

    African Journals Online (AJOL)

    No AbstractL.J. van der Veen et S. Bodinga-bwa-Bodinga. Gedandedi sa Geviya/ Dictionnaire Geviya–Français. 2002, 569 pp. ISBN 90-429-1105-0 (Peeters Louvain)/ISBN 2-87723-621-8 (Peeters France). Louvain/Paris/Sterling, Virginia: Peeters. Price: €60.

  11. "Andku jumal kõikidele isadele pojaarmastust! Teada, et kusagil kasvab su poeg...See oli mu raskeim aeg." / Kirsti Vainküla

    Index Scriptorium Estoniae

    Vainküla, Kirsti, 1972-

    2006-01-01

    President Arnold Rüütel lükkab väited oma Venemaal elavast vallaspojast kindlalt ümber. Eesti tuntud inimeste Peeter Sauli, Igor Gräzini, Eino Baskini ja Mark Soosaare eraelust. Dirigent Peeter Sauli pojast Peeter Loorentsist. Vt. samas: Rüütel: süüdistused ei vasta tõele; Poliitikute sohilapseskandaale

  12. The Problem of Untested Sexual Assault Kits: Why Are Some Kits Never Submitted to a Crime Laboratory?

    Science.gov (United States)

    Patterson, Debra; Campbell, Rebecca

    2012-01-01

    Victims of sexual assault are often advised to seek postassault medical care to have a forensic exam, which includes evidence collection (termed a "sexual assault kit" [SAK]). After the exam, law enforcement personnel are supposed to submit the SAK to a crime laboratory for analysis. However, recent media reports suggest that in many communities…

  13. Et spørgsmål om kompetence: Artikel 267 TEUF præjudiciel forelæggelse af FUSP-karakter

    DEFF Research Database (Denmark)

    Butler, Graham

    2017-01-01

    Kan Den Europæiske Unions Domstol (’Domstolen’) udøve kompetence og pålægge den nationale ret en fortolkning af EU retten i en sag, der henvises til Domstolen fra en national domstol i henhold til artikel 267 TEUF ang. præjudiciel forelæggelse, når emnet drejer sig om den fælles udenrigs- og sikk...

  14. F-hoone julge kombinatsioon / Liivi Tamm

    Index Scriptorium Estoniae

    Tamm, Liivi, 1978-

    2011-01-01

    F-hoone kohvik Tallinnas Telliskivi Loomelinnakus. Idee autoriteks, sisearhitektideks ja koha omanikeks on Jaagup Jalakas, Peeter Jalakas, Ville Jehe, Priit Juurmann, Steve Heinlo, Indrek Unt, Yoko Alender

  15. Suursaadikud Keskerakonna peakorteris

    Index Scriptorium Estoniae

    2001-01-01

    Ameerika Ühendriikide suursaadik Melissa Wells kohtus Edgar Savisaare, Peeter Kreitzbergi ja Sven Mikseriga. Kommentaarid suursaadik Melissa Wells'ilt. Suurbritannia suursaadik Sarah Squire Keskerakonna peakorteris

  16. "Fidelio" suurlavastuses astub lavale Ludwig van Beethoven ise / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2007-01-01

    26. augustil Viinistus esietenduvast Nargen Opera egiidi all valmivast ooperist "Fidelio", lavastaja Liis Kolle. Ooperi autorit kehastavad Peeter Oja, Tarmo Leinatamm, Hannes Võrno. Muusikaline juht Tõnu Kaljuste

  17. Universal Music Finlandi kontoriruumid = Offices of Universal Music Finland / Jan Skolimowski ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    Skolimowski, Jan, 1977-

    2011-01-01

    Helsingis Merimiehenkatu 36D asuvate kontoriruumide sisekujundusest. Sisearhitekt Jan Skolimowski, kaasautor Peeter Loo (KAMP Arhitektid OÜ). Graafilise disaini autor Martin Eelma (Tuumik Stuudio OÜ)

  18. Bluusivennad asuvad tiirutama mööda Eestimaad / Ülle Hallik

    Index Scriptorium Estoniae

    Hallik, Ülle, 1963-

    2006-01-01

    Peeter Volkonski lavastatud muusikalist "Bluusivennad" 11. juunil Pärnu Kontserdimajas, 12.-13. juunil Tartu kontserdimajas, 17. juunil Jõhvi kontserdimajas ja 28. juunil Tallinnas Vene Kultuurikeskuses

  19. A peer-led senior health education programme : an effect and process evaluation

    NARCIS (Netherlands)

    P. Kocken; A.J.J. Voorham

    2010-01-01

    In: J. Bouwer (ed.) Successful ageing, spirituality and meaning. Multidisciplinary perspectives. - Leuven, Peeters, 2010. - Titus Brandsma Institute, Studies in Spirituality, Supplement 20. pp121-136.

  20. Teod / Mihhail Gerts ; interv. Heili Vaus-Tamm

    Index Scriptorium Estoniae

    Gerts, Mihhail, 1984-

    2008-01-01

    Tallinna Filharmoonia egiidi all toimunud eesti ooperitrupi esinemisest Moskvas ja Peterburis, kus esitati Mihhail Gertsi juhatusel Piazolla tango-ooperit "Maria de Buenos Aires", lavastaja Peeter Volkonski

  1. Mikko Fritze : kultuuripealinna ei tehta vaid turistide ja ametnike lõbustamiseks / Mikko Fritze ; interv. Liina Ristoja

    Index Scriptorium Estoniae

    Fritze, Mikko, 1963-

    2008-01-01

    Sihtasutuse Tallinn Euroopa Kultuuripealinnaks 2011 juht Mikko Fritze vastab küsimustele, mis puudutavad kultuuripealinna tiitli mõjusid Tallinna linnale ning Eesti kultuurielule. Kommenteerib Peeter Jalakas

  2. A peer-led senior health education programme

    NARCIS (Netherlands)

    P. Kocken; A.J.J. Voorham

    2010-01-01

    In: J. Bouwer (ed.) Successful ageing, spirituality and meaning. Multidisciplinary perspectives. - Leuven, Peeters, 2010. - Titus Brandsma Institute, Studies in Spirituality, Supplement 20. pp121-136.

  3. Vanad majad nõuavad pieteeti / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    1999-01-01

    Kadriorus J. Poska tn. 21 kortermaja renoveerimine ja juurdeehitus (arhitekt Merle Kinks), pealeehitus E. Habermanni funktsionalistlikule hoonele A. Weizenbergi tn. 25 (arhitekt Peeter Pere). Arvamus A. Ksenofontovilt.

  4. Meder juures Till'iga / Toomas Velmet

    Index Scriptorium Estoniae

    Velmet, Toomas, 1942-

    2010-01-01

    20. veebruaril Mederi saalis toimunud kontserdist "Till Eulenspiegel", kus esinesid Katrin Matveus (viiul), Madis Kari (klarnet), Peeter Sarapuu (fagott), Rait Erikson (metsasarv) ja Mati Lukk (kontrabass)

  5. Noore kunstniku kaitseks / Kalev Rattus

    Index Scriptorium Estoniae

    Rattus, Kalev

    1998-01-01

    Fotograafide Peeter Lauritsa ja Herkki-Erich Merila poolt oma fotodel tekstiilikunstnik Jana Einardi kavandatud rõivaste kasutamisest selleks tekstiilikunstnikult luba omamata. Moekunstiteose autori õigustest.

  6. Gennadi Meleshko predstavil film "Poljot nad vremenjem"

    Index Scriptorium Estoniae

    2007-01-01

    Teleajakirjanike Gennadi ja Jelena Meleshko dokumentaalfilmi "Lend aja kohal" ("Poljot nad vremenem") esitleti 21. novembril Eesti Rahvusraamatukogus. Tervitusega esines ka riigikogu liigr Peeter Tulviste

  7. Ugala meenutab Alo Mattiisenit Viljandis naeruoratooriumiga / Riina Oruaas

    Index Scriptorium Estoniae

    Oruaas, Riina

    2001-01-01

    16. aug. Viljanis esietenduvast kontsertetendusest "Roheline muna". Teatraliseeritud kontsertlavastus põhineb Alo Mattiiseni ja Peeter Volkonski samanimelisel risotooriumil, lavastaja Andres Lepik, kunstnik Jaak Vaus

  8. On Zweier Sequence Spaces and de la Vall\\'{e}e-Poussin mean of order $\\alpha$

    Directory of Open Access Journals (Sweden)

    Bipan Hazarika

    2016-07-01

    Full Text Available The main purpose of this paper is to study some geometrical properties such as order continuous, the Fatou property and the Banach-Saks property of the new space $[\\mathcal{Z}_{\\lambda}^{\\alpha}]_{\\infty}(p.$

  9. Mõte matemaatikast tekitas mõtteid / Aavo Lind

    Index Scriptorium Estoniae

    Lind, Aavo, 1933-

    2009-01-01

    Kriitilisest suhtumisest koolimatemaatikasse, selle lihtsustamise ohtlikkusest tehnilisele haridusele ja murest õpilaste kahanevatest teadmistest matemaatikas. Vastukaja artiklile: Saks, Malle. [Keerukad matemaatikatekstid] : mõte. Õpetajate Leht (2009) 30. jaan., lk. 4

  10. Eesti graafikute edu Hispaanias

    Index Scriptorium Estoniae

    1999-01-01

    Hispaanias Orenses toimunud V rahvusvahelisel graafikabiennaalil (dets. 1998/jaan. 1999) pälvisid kiituse koos rahalise preemiaga Reti Saks, Vive Tolli, Benjamin Vasserman. Julio Prieto Naspereira auhinna žüriilt I preemia Tamoya Uchidale Jaapanist

  11. Graafika Filharmoonias : Harry Liivrand soovitab / Harry Liivrand

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    2004-01-01

    Alustatakse regulaarse kunstinäituse programmiga Estonia Kontserdisaalis. Avatakse graafikanäitus "Lähenemised" (koostaja Vappu Vabar). Osalevad Marje Üksine, Reti Saks, Maria-Kristiina Ulas, Kelli Kagovere, Naima Neidre jt

  12. 27 CFR 25.53 - Submissions of samples of fermented products.

    Science.gov (United States)

    2010-04-01

    ... TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Miscellaneous Provisions Samples § 25.53...) Materials used in the production of cereal beverage, saké, or any fermented product; and (c) Cereal beverage...

  13. International conference "Cultural Plurality in Estonia : Policies and Solutions"

    Index Scriptorium Estoniae

    2000-01-01

    Ettekandjad: Katrin Saks, Mall Hellam, Mati Luik, Kirsti Häkkinen, Vello Pettai, Ivi Proos, Katri Raik, NiinaOrhimenko, Ib Ostergaard Rasmussen, Urve Läänemets, Jüri Valge, Aleksander Dusman, Raivo Juurak, Rein Ruutsoo

  14. Kolm kiitust eesti graafikale / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    1999-01-01

    Graafik Benjamin Vassermanni loomingust, näitustest ja saadud auhindadest. Rahvusvahelisel Orense graafikabiennaalil 1998. a. said kolm eesti graafikut (B. Vassermann, V. Tolli, R. Saks) kiituse osaliseks. B. Vassermannilt oli töö 'Kaalutlus'

  15. Sexuality: A Neglected Component of Child Sexual Abuse Education and Training.

    Science.gov (United States)

    Gillman, Ruth; Whitlock, Katherine

    1989-01-01

    A rationale, specific content, and teaching methodologies are suggested for the integration of sexuality content in the preparation of child welfare workers concerned with the prevention, intervention, and treatment of child sexual abuse. (SAK)

  16. Eduard Odinets : "Olen eestlane, kelle emakeel on vene keel" / Eduard Odinets ; interv. Erik Kalda

    Index Scriptorium Estoniae

    Odinets, Eduard, 1976-

    2006-01-01

    Ilmunud ka: Severnoje Poberezhje Ilmunud ka: Severnoje Poberezhje : Subbota 3. juuni lk. 3. Riigikogu sotsiaaldemokraatide fraktsiooni nõunik oma poliitikukarjäärist. Arvamust avaldab Katrin Saks ja Meelis Goldberg (Severnoje Pob.)

  17. Füüsilisest isikust ettevõtja kui ettevõtlusvorm, rõhuasetusega varalise vastutuse problemaatikal : [bakalaureusetöö] / Katri Tomson ; Tartu Ülikool, õigusteaduskond ; juhendaja: Peeter Jerofejev

    Index Scriptorium Estoniae

    Tomson, Katri, 1981-

    2003-01-01

    FIE kui ettevõtlusvorm - lihtne, aga vastutusrikas, varalise vastutuse problemaatika (vastutusele allutatud vara, abielulised suhted FIE varalist vastutust mõjutava asjaoluna, vara, millele ei või pöörata sissenõuet)

  18. Eraomandi puutumatuse õigus sõja ajal : loomuõiguslik aspekt ja Friedrich von Martensi käsitlused : [magistritöö] / Indrek Olmaru ; Akadeemia Nord, õigusteaduskond ; juhendaja: Peeter Järvelaid

    Index Scriptorium Estoniae

    Olmaru, Indrek

    2004-01-01

    Filosoofia järgi joonduva rahvusvahelise õiguse areng, F. von Martens tsiviliseeritud rahvaste vahelisest õigusest, Martensi klausli ratsionaalne järelkonstruktsioon, sõjaõiguse areng, eraomand vaenlase territooriumil sõja ajal ja vaenlase käest võidetud territooriumil

  19. Muusika : Brahmsi reekviem Tõnu Kaljustega. Rahvusooperi nõukogus. Võimalus veeta õhtu La Scalas. Rene Eespere uus CD. Jukka Savijoki käis Eestis. Võistlesid pianistid. Jõulukontserdid / Peeter Olesk

    Index Scriptorium Estoniae

    Olesk, Peeter, 1953-

    2001-01-01

    Tõnu Kaljuste juhatab Ljubljana Gallus Hallis Johannes Brahmsi "Saksa reekviemi". EMA kuratooriumi ja rahvusooperi Estonia nõukogu arutasid ühisistungil Eesti ooperikunsti, muusikateatri ja kõrgema muusikalise hariduse probleeme. 7. XII kell 19.00 saab "Klassikaraadiost" kuulata Milano La Scala hooaja avaetenduse otseülekannet. Antese väljaandel ilmus CD Rene Eespere kammerteostega. 29.XI ئ 2.XII viibis Eestis Sibeliuse akadeemia klassikalise kitarri õppejõud Jukka Savijoki. 23. ja 24. XI toimus Tartus kolme keskastme muusikakooli noorte pianistide konkurss. 8.XII toimub EMA kammersaalis suur jõulukontsert, kus esinevad parimad EMA üliõpilased. Kontserdiagentuuri Concerto Grosso sari "Advendiaeg poistekooridega" viib kontserte Eestimaa erinevatesse linnadesse. Plaadi "Kahest üks" esitluskontserdiga, kus tuleb esiettekandele Urmas Sisaski kantaat "Armastusesle", tähistab TTÜ Akadeemiline Naiskoor oma 50. aastapäeva . Eesti Naistelaulu Seltsi korraldusel toimus 2. XII Balti Misjonikeskuses Tallinna naiskooride advendikontsert. 28. XI toimus Estonia talveaias Tarmo Lepiku 55. sünniaastapäevale pühendatud mälestuskontsert. 17.XI toimus Põlva kultuuri ja huvikeskuses VII Lõuna-Eesti meestelaulu päev

  20. Esikromaan tõi filoloogitudengile võidu : Aarne Rubeni võiduromaanist ""Volta" annab kaeblikku vilet" huvitus esimesena kirjastus Tänapäev / Neeme Korv, Peeter Selg

    Index Scriptorium Estoniae

    Korv, Neeme, 1974-

    2001-01-01

    I koht (Aarne Ruben ""Volta" annab kaeblikku vilet"); II koht (Leo Kunnas "Sõdurjumala teener"); III koht (Maimu Veske "Continental" ja Lehte Hainsalu "Kellakuuljad"); Ulmekirjanduse eripreemia Varrakult (Indrek Hargla "Baiita needus")

  1. Riigi suveräänsuse mõiste määratlusest 20. sajandi lõpu Eestis : [bakalaureusetöö] / Siiri Malmberg ; Akadeemia Nord, õigusteaduskond ; juhendaja: Peeter Järvelaid

    Index Scriptorium Estoniae

    Malmberg, Siiri

    2004-01-01

    Suveräänsuse mõiste määratlemisest 19. ja 20. sajandi õigusteoorias, Ida-Euroopa õigusteaduses ja riigiõiguslikus praktikas 20. sajandil, diskussioon Eesti suveräänsusest 20. sajandi lõpus ja 21. sajandi algul

  2. [Effect of long-term shallow tillage and straw returning on soil potassium content and stratification ratio in winter wheat/summer maize rotation system in Guanzhong Plain, Northwest China].

    Science.gov (United States)

    Shi, Jiang-lan; Li, Xiu-shuang; Wang, Shu-juan; Li, Shuo; Li, You-bing; Tian, Xiao-hong

    2015-11-01

    Soil stratified sampling method and potassium chemical fractionation analysis were used to investigate effects of long-term shallow tillage and straw returning on soil K contents and stratification ratios in winter wheat/summer maize rotation system in Guanzhong Plain of Northwest China. The results showed that after 13-year continuous shallow tillage and straw returning, surface accumulation and stratification effect obviously occurred for soil available K (SAK) and non-exchangeable K (NEK), which was particularly remarkable for SAK and its fractions. Serious depletion of SAK occurred in 15-30 cm soil layer, and the SAK value was lower than the critical value of soil potassium deficiency. Meanwhile, significant differences were found between SR1 and SR2 values of SAK and its fractions, SR was obtained by values of topsoil layer (0-5 cm) divided by corresponding values of lower soil layers (5-15 cm layer, SR1, or 15-30 cm layer, SR2). However, no significant difference was observed between SR values of NEK and mineral K. In conclusion, returning of all straw over 10 years in the winter wheat/summer maize rotation system contributed greatly to maintaining soil K pool balance, while special attention should be paid to the negative effects of surface accumulation and stratification of SAK on soil K fertility.

  3. Sea Anemone Toxins Affecting Potassium Channels

    Science.gov (United States)

    Diochot, Sylvie; Lazdunski, Michel

    The great diversity of K+ channels and their wide distribution in many tissues are associated with important functions in cardiac and neuronal excitability that are now better understood thanks to the discovery of animal toxins. During the past few decades, sea anemones have provided a variety of toxins acting on voltage-sensitive sodium and, more recently, potassium channels. Currently there are three major structural groups of sea anemone K+ channel (SAK) toxins that have been characterized. Radioligand binding and electrophysiological experiments revealed that each group contains peptides displaying selective activities for different subfamilies of K+ channels. Short (35-37 amino acids) peptides in the group I display pore blocking effects on Kv1 channels. Molecular interactions of SAK-I toxins, important for activity and binding on Kv1 channels, implicate a spot of three conserved amino acid residues (Ser, Lys, Tyr) surrounded by other less conserved residues. Long (58-59 amino acids) SAK-II peptides display both enzymatic and K+ channel inhibitory activities. Medium size (42-43 amino acid) SAK-III peptides are gating modifiers which interact either with cardiac HERG or Kv3 channels by altering their voltage-dependent properties. SAK-III toxins bind to the S3C region in the outer vestibule of Kv channels. Sea anemones have proven to be a rich source of pharmacological tools, and some of the SAK toxins are now useful drugs for the diagnosis and treatment of autoimmune diseases.

  4. Exome sequencing identifies a TCF4 mutation in a Chinese pedigree with symmetrical acral keratoderma.

    Science.gov (United States)

    Chen, P; Sun, S; Zeng, K; Li, C; Wen, J; Liang, J; Tian, X; Jiang, Y; Zhang, J; Zhang, S; Han, K; Han, C; Zhang, X

    2017-09-18

    Symmetrical acral keratoderma (SAK) is a rare skin disorder and its pathogenesis and inheritability are unknown. To investigate the inheritance and pathogenesis of SAK. Four SAK cases occurred in a four-generation Chinese family. Exome sequencing identified SNPs with potential SAK-related mutations, and a potentially responsible gene transcription factor 4 (TCF4) was identified. TCF4 was then sequenced in all 11 family members, and pedigree analysis was performed. Histopathology and immunohistochemistry evaluated TCF4 expression in skin lesions. The gene mutation was investigated in human keratinocytes for keratin-related protein expression. A novel heterozygous missense mutation, c.85C>A (p.Pro29Thr) was found in TCF4. The mutation showed autosomal dominant inheritance and perfectly cosegregated with the SAK phenotype in all family members. In skin lesions, TCF4 was present in the cytoplasm and membranes of the basal layer, the stratum spinosum and the stratum granulosum of the epidermis. The mutant TCF4 induced overexpression of differentiation markers including KRT1, KRT14, loricrin and involucrin. A SAK-related gene mutation in TCF4 may function through transcriptional regulation of keratin. © 2017 European Academy of Dermatology and Venereology.

  5. Use of Structural Assessment of Knowledge for Outcomes Assessment in the Neuroscience Classroom.

    Science.gov (United States)

    Stevenson, Jennifer L; Shah, Samir; Bish, Joel P

    2016-01-01

    Outcomes assessment of undergraduate neuroscience curricula should assess the ability to think integratively about basic neuroscience concepts based on two of the core competencies established by the Faculty for Undergraduate Neuroscience. The current study investigated whether the structural assessment of knowledge (SAK) approach, which evaluates the organization of an individual's knowledge structures, is effective for demonstrating learning of basic neuroscience concepts. Students in an introductory psychology course (n = 29), an introductory neuroscience course (n = 19), or an advanced behavioral neuroscience course (n = 15) completed SAK before and after learning gross brain anatomy and neuronal physiology. All students showed improvements in their SAK after short-term dissemination for gross brain anatomy, but not for neuronal physiology, concepts. Therefore, research is needed to determine whether the effectiveness of SAK in outcomes assessment depends on the content or teaching style. Additional research using SAK should also explore effectiveness for learning over longer time frames and correlations with student performance in the course. However, the results suggest SAK is a promising technique for outcomes assessment of undergraduate neuroscience curricula.

  6. Pääsküla raamatukogu : Pärnu mnt. 480A, Tallinn = Pääsküla Library : Pärnu mnt. 480A, Tallinn / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2005-01-01

    Kahekorruselise lehisega vooderdatud raamatukoguhoone üks külg on klaasist. Projekteerija: Arhitektid Muru & Pere. Autorid: Urmas Muru, Peeter Pere. Konstruktor Ago-Allan Kuddu. Sisekujundus: Katrin Kaevats, Urmas Muru, Peeter Pere. Projekt: 2002-2003, valmis: 2005. Ill.:4 värv. välis ja 2 sisevaadet, I ja II korruse plaan

  7. Universaal Universum - kasumlik eksootika / Tiina Kolk

    Index Scriptorium Estoniae

    Kolk, Tiina

    2005-01-01

    Margus Kalam ja Peeter Salmela toovad India ja Indoneesia reisidelt kaasa maske, muusikariistu, mööblit ja muid eksootilisi kaupu, mida müüvad oma äris Universaal Universum. Kommenteerivad Peeter Vähi ja Sirje Kadalipp

  8. Kummaline maag / Roger Pierre Turine

    Index Scriptorium Estoniae

    Turine, Roger Pierre

    1998-01-01

    Peeter Mudistist ja tema loomingust 1990. a. kunstniku ja tema loominguga esmakohtumise ja nüüd Tallinna Kunstihoones avatud Peeter Mudisti näituse 'Valguses on kood' põhjal. Näitusele kaasatud : Jaan Koorti 'Abikaasa portree' (1916), Raul Meel, kes koos Ly Lestbergi ja Jaan Toomikuga esitab video ja fotoseeria. Kunstniku arkaadiaotsinguist

  9. Arco Vara insaider ostis aktsiaid keeluajal / Annika Matson

    Index Scriptorium Estoniae

    Matson, Annika, 1976-

    2008-01-01

    Kinnisvaraettevõtte Arco Vara ühe asutaja ja omaniku Hillar-Peeter Luitsalu abikaasa Maie Luitsalu ostis ettevõtte aktsiaid keeluajal, oma ettevõtte aktsiaid on ostnud juurde ka AS-i Baltika juhatuse liikmed ja Tallinki suuromanik Enn Pant. Vt. samas: Hillar-Peeter Luitsalu; Taust

  10. Jaan Poska 150. sünniaastapäevaks valmib temast kõnelev film / Riina Mägi

    Index Scriptorium Estoniae

    Mägi, Riina, 1957-

    2015-01-01

    Juristi ja poliitiku Jaan Poska elust ja tema pärandist valmiva filmi produtsent ja režissöör on Toomas Lepp, üks stsenariste Peeter Järvelaid. Filmi kohta jagab selgitusi Tallinna Ülikooli õigusajaloo ja võrdleva õiguse professor ning sihtasutuse Jaan Poska Mälestusfond nõukogu esimees Peeter Järvelaid

  11. Rainer Sarnet alustab homme uue mängufilmi võtteid / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2006-01-01

    Režissöör Rainer Sarnet alustab noortefilmi "Kuhu põgenevad hinged?" võtteid, milleks raha eraldasid Eesti Filmi Sihtasutus, Kultuurkapital ja Euroopa Liidu Media+ programm. Loo aluseks on Aidi Valliku romaanid Annist, kaasstsenarist on Peeter Sauter. Filmi tootjaks on Exitfilm, kaastootjaks Austria Synchro Film. Lisatud lühiintervjuu Peeter Sauteriga

  12. Areeni aastapreemia nominendid on selgunud

    Index Scriptorium Estoniae

    2004-01-01

    Areeni aastapreemia nominentide seas ka Aivar Tõnso (elektroonilise muusika välja andmine ja sündmuste korraldamine), ansambel Toe Tag (album "Legendaarne"), Rein Fuks (ansambli Pia Fraus EP "Mooie Island"), samuti Peeter Laurits, Ain Mäeots, Peeter Mudist, Jaan Manitski, Mark Soosaar, Arne Maasik, Tiit Lepp, Ivar Kaasik jt

  13. Millist presidenti siis vajab Eesti vabariik? / Ando Leps

    Index Scriptorium Estoniae

    Leps, Ando, 1935-

    2001-01-01

    Järg Kesknädal Jul/24, Aug/1;8;15;22 lk. 7. Ilmunud ka Virumaa Teataja Jul/31 lk. 7; Aug/7;15;23 lk. 7. Autor analüüsib viit presidendikandidaati: Peeter Kreitzbergi, Arnold Rüütlit, Toomas Savi, Andres Tarandit ja Peeter Tulvistet. President Lennart Meri kriitika

  14. Pojehali, hüüab "Jääaeg 2" / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2006-01-01

    Täispikk animafilm "Jääaeg 2 : Suur sula" ("Ice Age 2 : The Meltdown") : režissöör Carlos Sandanha : eestikeelse dublaazhi režissöör Peeter Simm : Ameerika Ühendriigid 2006. Peeter Simm dublaazhi tegemisest

  15. "Musta Peetri" stuudio Nafta näitab uusi lühifilme / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2010-01-01

    Filmistuudio Nafta lühifilmide kava 1. oktoobrist 2010 Tallinna kinos Artis. Kavasse kuuluvad uued linateosed Heleri Saariku "Näkilugu" ja Margus Paju "Blackout" ning Priit Pääsukese "Must Peeter" (2008), Peeter Sauteri novelli "Must notsu" ekraniseering

  16. Küülikud jooksus ja jumal surnud : eesti lasteproosa tipud on "kuldaja" autoritega võrdväärsed / Jürgen Rooste

    Index Scriptorium Estoniae

    Rooste, Jürgen, 1979-

    2005-01-01

    Arvustus: Raud, Piret. Ernesto küülikud. Tallinn : Tänapäev, 2004 ; Soans, Kerttu. Kruubi-Ruudi ja tema inimesed. Puhja : Väike Vanker, 2004 ; Kivirähk, Andrus. Limpa ja mereröövlid. Tallinn : Varrak, 2004 ; Sauter, Peeter. Laste raamat / Rull ja Ekke ja Pipa ja Peeter Sauter. Tallinn : Huma, 2004

  17. Kaameraga veere pääl / Arp Müller

    Index Scriptorium Estoniae

    Müller, Arp

    2005-01-01

    Dokumentaalfilm "Vahtsõ ilma veere pääl" : idee Vahur Laiapea : autorid Silvia Karro, Peeter Brambat : režissöör Peeter Brambat : operaator Arvo Vilu : muusika Ardo R. Varres, Tõnu Kõrvits : produtsent Vahur Laiapea : Ikoon, AD Oculos Film 2004

  18. "Keisri hull" on viimast korda laval

    Index Scriptorium Estoniae

    2010-01-01

    Neli hooaega Ugala repertuaaris olnud Jaan Krossi romaani põhjal lavastatud draama "Keisri hull" etendub viimast korda 10. veebruaril. Viimane etendus on pühendatud Jaan Krossi 90. sünniaastapäevale, mis on 19. veebruaril. Lavastajad Peeter Tammearu ja Jaak Allik. Peaosas Peeter Tammearu

  19. Tung Kadriorgu: ülevaade 2001. aasta presidendikampaaniatest / Erik Moora

    Index Scriptorium Estoniae

    Moora, Erik

    2002-01-01

    Ülevaade 2001. aasta presidendivalimiste kampaaniatest, tagasivaade varasematele kampaaniatele, kampaaniameeskondade strateegiliste valikute kirjeldus. Tabelid: Arnold Rüütli toetus avaliku arvamuse küsitlusel (%); Toomas Savi toetus avaliku arvamuse küsitlusel (%); Peeter Tulviste toetus avaliku arvamuse küsitlusel (%); Peeter Kreitzbergi toetus avaliku arvamuse küsitlusel (%)

  20. Eesti mees nõustab Absoluti viinatootjat / Raigo Neudorf

    Index Scriptorium Estoniae

    Neudorf, Raigo

    2005-01-01

    Rootsis eestlastest vanemate pojana sündinud ning Põhjamaade suurima ning maailma kuuenda alkoholitootja Vin & Sprit Groupi nõunikuna töötav Peeter Luksep nendib, et alkoholimüügi maht maailmas stagneerub. Vt. samas: Peeter Luksep oli Eesti eksiilvalitsuse finantsminister; Töö rahvusvahelise haardega kontsernis tähendab pidevat reisimist