Snowmelt runoff: a new focus of urban nonpoint source pollution.

Science.gov (United States)

Zhu, Hui; Xu, Yingying; Yan, Baixing; Guan, Jiunian

2012-11-30

Irregular precipitation associated with global climate change had been causing various problems in urban regions. Besides the runoff due to rainfall in summer, the snowmelt runoff in early spring could also play an important role in deteriorating the water quality of the receiving waters. Due to global climate change, the snowfall has increased gradually in individual regions, and snowstorms occur more frequently, which leads to an enhancement of snowmelt runoff flow during the melting seasons. What is more, rivers just awaking from freezing constitute a frail ecosystem, with poor self-purification capacity, however, the urban snowmelt runoff could carry diverse pollutants accumulated during the winter, such as coal and/or gas combustion products, snowmelting agents, automotive exhaust and so on, which seriously threaten the receiving water quality. Nevertheless, most of the research focused on the rainfall runoff in rainy seasons, and the study on snowmelt runoff is still a neglected field in many countries and regions. In conclusion, due to the considerable water quantity and the worrisome water quality, snowmelt runoff in urban regions with large impervious surface areas should be listed among the important targets in urban nonpoint source pollution management and control.

The development of an ecological approach to manage the pollution risk from highway runoff.

Science.gov (United States)

Crabtree, B; Dempsey, P; Johnson, I; Whitehead, M

2009-01-01

In the UK, the Highways Agency is responsible for operating, maintaining and improving the strategic road network in England. One focus of the Highways Agency's ongoing research into the nature and impact of highway runoff is aimed at ensuring that the Highways Agency will meet the requirements of the EU Water Framework Directive. A research programme, undertaken in partnership with the Environment Agency, is in progress to develop a better understanding of pollutants in highway runoff and their ecological impact. The paper presents the outcome of a study to: (1) monitor pollutants in highway runoff under different climate and traffic conditions; (2) develop standards to assess potential ecological risks from soluble pollutants in highway runoff; and (3) develop a model to predict pollutant concentrations in highway runoff. The model has been embedded in a design tool incorporating risk assessment procedures and receiving water standards for soluble and insoluble pollutants--the latter has been developed elsewhere in another project within the research programme. The design tool will be used to support improved guidance on where, and to what level, treatment of runoff is required for highway designers to manage the risk of ecological impact from highway runoff.

Runoff of pyrethroid insecticides from concrete surfaces following simulated and natural rainfalls.

Science.gov (United States)

Jiang, Weiying; Haver, Darren; Rust, Michael; Gan, Jay

2012-03-01

Intensive residential use of insecticides has resulted in their ubiquitous presence as contaminants in urban surface streams. For pest eradication, urban hard surfaces such as concrete are often directly treated with pesticides, and wind/water can also carry pesticides onto hard surfaces from surrounding areas. This study expanded on previous bench-scale studies by considering pesticide runoff caused by irrigation under dry weather conditions and rain during the wet season, and evaluated the effects of pesticide residence time on concrete, single versus recurring precipitations, precipitation intensity, and concrete surface conditions, on pesticide transferability to runoff water. Runoff from concrete 1 d after pesticide treatment contained high levels of bifenthrin (82 μg/L) and permethrin (5143 μg/L for cis and 5518 μg/L for trans), indicating the importance of preventing water contact on concrete after pesticide treatments. Although the runoff transferability quickly decreased as the pesticide residence time on concrete increased, detectable residues were still found in runoff water after 3 months (89 d) exposure to hot and dry summer conditions. ANOVA analysis showed that precipitation intensities and concrete surface conditions (i.e., acid wash, silicone seal, stamping, and addition of microsilica) did not significantly affect the pesticide transferability to runoff. For concrete slabs subjected to natural rainfalls during the winter wet season, pesticide levels in the runoff decreased as the time interval between pesticide application and the rain event increased. However, bifenthrin and permethrin were still detected at 0.15-0.17 and 0.75-1.15 μg/L in the rain runoff after 7 months (221 d) from the initial treatment. In addition, pesticide concentrations showed no decrease between the two rainfall events, suggesting that concrete surfaces contaminated by pesticides may act as a reservoir for pesticide residues, leading to sustained urban runoff

First flush of storm runoff pollution from an urban catchment in China.

Science.gov (United States)

Li, Li-Qing; Yin, Cheng-Qing; He, Qing-Ci; Kong, Ling-Li

2007-01-01

Storm runoff pollution process was investigated in an urban catchment with an area of 1.3 km2 in Wuhan City of China. The results indicate that the pollutant concentration peaks preceded the flow peaks in all of 8 monitored storm events. The intervals between pollution peak and flow peak were shorter in the rain events with higher intensity in the initial period than those with lower intensity. The fractions of pollution load transported by the first 30% of runoff volume (FF30) were 52.2%-72.1% for total suspended solids (TSS), 53.0%-65.3% for chemical oxygen demand (COD), 40.4%-50.6% for total nitrogen (TN), and 45.8%-63.2% for total phosphorus (TP), respectively. Runoff pollution was positively related to non-raining days before the rainfall. Intercepting the first 30% of runoff volume can remove 62.4% of TSS load, 59.4% of COD load, 46.8% of TN load, and 54.1% of TP load, respectively, according to all the storm events. It is suggested that controlling the first flush is a critical measure in reduction of urban stormwater pollution.

[Effect of antecedent dry period on water quality of urban storm runoff pollution].

Science.gov (United States)

Bian, Bo

2009-12-01

Identified the main factor influencing urban rainfall-runoff pollution provides a scientific basis for urban rainfall-runoff pollution control and management. Therefore, starting in May 2006, a study was conducted to characterize water quality from representative land uses types in Zhenjiang to analyse the effect of antecedent dry period on stormwater runoff quality. The results show that the beginning of rainfall, with the increase of antecedent dry periods, the percentages of less than 40 microm is increased, the correlation of the water quality parameters (TN, TP, Zn, Pb, Cu, TSS and COD) and antecedent dry period shows a significant positive correlation, dissolved pollutants in the initial period surface runoff is increased. These findings show that facilitating the recognition of antecedent dry periods is the main factor influencing the change in concentration and partitioning of pollutants to provide the scientific basis for non-point source pollution control and management.

Modeling global distribution of agricultural insecticides in surface waters.

Science.gov (United States)

Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J; Schäfer, Ralf B; Fornaroli, Riccardo; Liess, Matthias

2015-03-01

Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. Copyright © 2014 Elsevier Ltd. All rights reserved.

Assessment of pollution in road runoff using a Bufo viridis biological assay.

Science.gov (United States)

Dorchin, A; Shanas, U

2010-12-01

Road runoff is a major source of environmental pollution, significantly threatening nearby aquatic habitats. Chemical analyses indicate high pollutant concentrations in the road's "first flush", but bioassays are more advantageous for addressing the cumulative effects of the numerous pollutants within the runoff. We used Bufo viridis embryos and larvae to assess the toxicity of road runoff from two major highways in Israel. We show, for the first time, that exposure to midseason runoff not only has an adverse effect on growth and development rates of B. viridis larvae but can also lead to increased rates of morphological deformations. Seasonal first flushes, despite having higher metal concentrations, did not adversely affect the toad larvae, apparently due to a counter effect of organic matter that potentially served as a supplementary energy resource. Road runoff can be a major cause for a qualitative decrease in the quality of aquatic habitats threatening amphibians in Israel. Copyright © 2010 Elsevier Ltd. All rights reserved.

[Runoff Pollution Experiments of Paddy Fields Under Different Irrigation Patterns].

Science.gov (United States)

Zhou, Jing-wen; Su, Bao-lin; Huang, Ning-bo; Guan, Yu-tang; Zhao, Kun

2016-03-15

To study runoff and non-point source pollution of paddy fields and to provide a scientific basis for agricultural water management of paddy fields, paddy plots in the Jintan City and the Liyang City were chosen for experiments on non-point source pollution, and flood irrigation and intermittent irrigation patterns were adopted in this research. The surface water level and rainfall were observed during the growing season of paddies, and the runoff amount from paddy plots and loads of total nitrogen (TN) and total phosphorus (TP) were calculated by different methods. The results showed that only five rain events of totally 27 rainfalls and one artificially drainage formed non-point source pollution from flood irrigated paddy plot, which resulted in a TN export coefficient of 49.4 kg · hm⁻² and a TP export coefficient of 1.0 kg · hm⁻². No any runoff event occurred from the paddy plot with intermittent irrigation even in the case of maximum rainfall of 95.1 mm. Runoff from paddy fields was affected by water demands of paddies and irrigation or drainage management, which was directly correlated to surface water level, rainfall amount and the lowest ridge height of outlets. Compared with the flood irrigation, intermittent irrigation could significantly reduce non-point source pollution caused by rainfall or artificial drainage.

[Pollution Characteristics of Surface Runoff of Typical Town in Chongqing City].

Science.gov (United States)

Wang, Long-tao; Duan, Bing-zheng; Zhao, Jian-wei; Hua, Yu-mei; Zhu, Duan-wei

2015-08-01

Six kinds of impermeable underlying surface, cement tile roof, asbestos roof, cement flat roof, residential concrete pavement, asphalt pavement of restaurants, asphalt pavement of oil depot, and a combined sewer overflow canal in the Jiansheng town of Dadukou district in Chongqing city were chosen as sample plots to study the characteristics of nutritional pollutants and heavy metals in town runoff. The research showed that the average mass concentrations of TSS, COD, TN, TP in road runoff were (1681.2 +/- 677.2), (1154.7 +/- 415.5), (12.07 +/- 2.72), (3.32 +/- 1.15) mgL(-1), respectively. These pollutants were higher than those in roof runoff which were (13.3 +/- 6.5), (100.4 +/- 24.8), (3.58 +/- 0.70), (0.10 +/- 0.02) mg x L(-1), respectively. TDN accounted for 62.60% +/- 34.38% of TN, and TDP accounted for 42.22% +/- 33.94% of TP in the runoff of impermeable underlying surface. Compared with the central urban runoff, town runoff in our study had higher mass concentrations of these pollutants. The mass concentrations of TSS, COD, TDN, TN, TDP and TP in the combined sewer overflow were (281.57 +/- 308.38), (231.21 +/- 42.95), (8.16 +/- 2.78), (10.60 +/- 3.94), (0.38 +/- 0.23) and (1.51 +/- 0.75) mg x L(-1), respectively. The average levels of heavy metals in this kind of runoff did not exceed the class VI level of the surface water environmental quality standard. Most pollutants in the combined sewer overflow had first flush. However, this phenomenon was very rare for TSS. There was a significant positive correlation between TSS and COD, TP in the combined sewer overflow. And this correlation was significant between NH4+ -N and TP, TDP, TN, TDP. However, a negative correlation existed between NO3- -N and all other indicators.

[Off-line control of runoff pollution by filtering ditch-pond system in urban tourist areas].

Science.gov (United States)

Chen, Qing-Feng; Shan, Bao-Qing; Yin, Cheng-Qing; Hu, Cheng-Xiao

2007-10-01

An off-line filtering ditch-pond system for controlling storm runoff pollution in urban tourist areas was developed, which could retain the first flush effectively, resulting in the decrease of pollutant concentration and suspended solid average grain size, and the improvement of pollutant retention in runoff. This system could be an effective treatment system for storm runoff pollution, particularly for the scarcity of available land use in urban areas. In 2005, the yearly retention rates of TSS, COD, TN and TP were 86.4%, 85.5%, 83.9% and 82.9%, and during a storm event on June 26, the retention rates of runoff volume, TSS, COD, TN and TP were 67.9%, 97.0%, 89.2%, 94.9% and 96.2%, respectively. This system could also retain most of the suspended solids in runoff.

Pollution Of Insecticide Residues In PPTN Pasar Jumat Area

International Nuclear Information System (INIS)

Syahrir, Ulfa T.; Chairul, Sofnie M.

2000-01-01

Measurement of insecticide residue pollution from some organochlorin and organo-phosphat in soil and water samples were carried out 1999-2000 periode. The aim of the measurement was to get information about impact of laboratorium activity on insecticide contents in PPTN PASAR JUMAT. Gas chromatograph with electron capture and flame ionization detector were used to measure the pesticide content. Result of the measurement in PPTN area showed that organo-chlorin were alpha BHC, endosulfan band DDT and organo-phosphat were klorphyriphos and malation and were lower than tolerance level

Interpolating precipitation and its relation to runoff and non-point source pollution.

Science.gov (United States)

Chang, Chia-Ling; Lo, Shang-Lien; Yu, Shaw-L

2005-01-01

When rainfall spatially varies, complete rainfall data for each region with different rainfall characteristics are very important. Numerous interpolation methods have been developed for estimating unknown spatial characteristics. However, no interpolation method is suitable for all circumstances. In this study, several methods, including the arithmetic average method, the Thiessen Polygons method, the traditional inverse distance method, and the modified inverse distance method, were used to interpolate precipitation. The modified inverse distance method considers not only horizontal distances but also differences between the elevations of the region with no rainfall records and of its surrounding rainfall stations. The results show that when the spatial variation of rainfall is strong, choosing a suitable interpolation method is very important. If the rainfall is uniform, the precipitation estimated using any interpolation method would be quite close to the actual precipitation. When rainfall is heavy in locations with high elevation, the rainfall changes with the elevation. In this situation, the modified inverse distance method is much more effective than any other method discussed herein for estimating the rainfall input for WinVAST to estimate runoff and non-point source pollution (NPSP). When the spatial variation of rainfall is random, regardless of the interpolation method used to yield rainfall input, the estimation errors of runoff and NPSP are large. Moreover, the relationship between the relative error of the predicted runoff and predicted pollutant loading of SS is high. However, the pollutant concentration is affected by both runoff and pollutant export, so the relationship between the relative error of the predicted runoff and the predicted pollutant concentration of SS may be unstable.

The sources, impact and management of car park runoff pollution: a review.

Science.gov (United States)

Revitt, D Michael; Lundy, Lian; Coulon, Frédéric; Fairley, Martin

2014-12-15

Traffic emissions contribute significantly to the build-up of diffuse pollution loads on urban surfaces with their subsequent mobilisation and direct discharge posing problems for receiving water quality. This review focuses on the impact and mitigation of solids, metals, nutrients and organic pollutants in the runoff deriving from car parks. Variabilities in the discharged pollutant levels and in the potentials for pollutant mitigation complicate an impact assessment of car park runoff. The different available stormwater best management practices and proprietary devices are reported to be capable of reductions of between 20% and almost 100% for both suspended solids and a range of metals. This review contributes to prioritising the treatment options which can achieve the appropriate pollutant reductions whilst conforming to the site requirements of a typical car park. By applying different treatment scenarios to the runoff from a hypothetical car park, it is shown that optimal performance, in terms of ecological benefits for the receiving water, can be achieved using a treatment train incorporating permeable paving and bioretention systems. The review identifies existing research gaps and emphasises the pertinent management practices as well as design issues which are relevant to the mitigation of car park pollution. Copyright © 2014 Elsevier Ltd. All rights reserved.

Urban nonpoint source pollution buildup and washoff models for simulating storm runoff quality in the Los Angeles County

International Nuclear Information System (INIS)

Wang Long; Wei Jiahua; Huang Yuefei; Wang Guangqian; Maqsood, Imran

2011-01-01

Many urban nonpoint source pollution models utilize pollutant buildup and washoff functions to simulate storm runoff quality of urban catchments. In this paper, two urban pollutant washoff load models are derived using pollutant buildup and washoff functions. The first model assumes that there is no residual pollutant after a storm event while the second one assumes that there is always residual pollutant after each storm event. The developed models are calibrated and verified with observed data from an urban catchment in the Los Angeles County. The application results show that the developed model with consideration of residual pollutant is more capable of simulating nonpoint source pollution from urban storm runoff than that without consideration of residual pollutant. For the study area, residual pollutant should be considered in pollutant buildup and washoff functions for simulating urban nonpoint source pollution when the total runoff volume is less than 30 mm. - Highlights: → An improved urban NPS model was developed. → It performs well in areas where storm events have great temporal variation. → Threshold of total runoff volume for ignoring residual pollutant was determined. - An improved urban NPS model was developed. Threshold of total runoff volume for ignoring residual pollutant was determined.

[Pollution load and the first flush effect of BOD5 and COD in urban runoff of Wenzhou City].

Science.gov (United States)

Wang, Jun; Bi, Chun-juan; Chen, Zhen-lou; Zhou, Dong

2013-05-01

Four typical rainfalls were monitored in two different research areas of Wenzhou Municipality. Concentrations of BOD5 and COD in six different urban runoffs were measured. In addition the event mean concentration (EMC), M (V) curve and BOD5/COD of pollutant were calculated. The results showed that concentrations of BOD5 and COD in different urban runoffs of Wenzhou ranged from ND to 69.21 mg x L(-1) and ND to 636 mg x L(-1). Concentrations of BOD5 and COD in different urban runoffs were decreasing over time, so it is greatly significant to manage the initial runoff for reducing organic pollution. Judged by EMC of BOD5 and COD in these five rainfalls, concentrations of pollutant in some urban runoffs were out of the integrated wastewater discharge standard. If these runoffs flowed into river, it would cause environmental pressure to the next level receiving water bodies. According to the M (V) curve, the first flush effect of COD in most urban runoffs was common; while the first flush effect of BOD5 was same as that of COD. The result also showed that organic pollution was serious at the beginning of runoff. The underlying surface type could affect the concentration of BOD5 and COD in urban runoff. While the results of BOD5/COD also suggested that biodegradation was considered as one of the effective ways to decrease the pollution load of organics in urban runoff, and the best management plans (BMPs) should be selected for various urban runoff types for the treatment of organic pollution.

Pollutant concentrations and pollution loads in stormwater runoff from different land uses in Chongqing.

Science.gov (United States)

Wang, Shumin; He, Qiang; Ai, Hainan; Wang, Zhentao; Zhang, Qianqian

2013-03-01

To investigate the distribution of pollutant concentrations and pollution loads in stormwater runoff in Chongqing, six typical land use types were selected and studied from August 2009 to September 2011. Statistical analysis on the distribution of pollutant concentrations in all water samples shows that pollutant concentrations fluctuate greatly in rainfall-runoff, and the concentrations of the same pollutant also vary greatly in different rainfall events. In addition, it indicates that the event mean concentrations (EMCs) of total suspended solids (TSS) and chemical oxygen demand (COD) from urban traffic roads (UTR) are significantly higher than those from residential roads (RR), commercial areas (CA), concrete roofs (CR), tile roofs (TRoof), and campus catchment areas (CCA); and the EMCs of total phosphorus (TP) and NH3-N from UTR and CA are 2.35-5 and 3 times of the class-II standard values specified in the Environmental Quality Standards for Surface Water (GB 3838-2002). The EMCs of Fe, Pb and Cd are also much higher than the class-III standard values. The analysis of pollution load producing coefficients (PLPC) reveals that the main pollution source of TSS, COD and TP is UTR. The analysis of correlations between rainfall factors and EMCs/PLPC indicates that rainfall duration is correlated with EMCs/PLPC of TSS for TRoof and TP for UTR, while rainfall intensity is correlated with EMCs/PLPC of TP for both CR and CCA. The results of this study provide a reference for better management of non-point source pollution in urban regions.

Rainfall-induced runoff from exposed streambed sediments: an important source of water pollution.

Science.gov (United States)

Frey, S K; Gottschall, N; Wilkes, G; Grégoire, D S; Topp, E; Pintar, K D M; Sunohara, M; Marti, R; Lapen, D R

2015-01-01

When surface water levels decline, exposed streambed sediments can be mobilized and washed into the water course when subjected to erosive rainfall. In this study, rainfall simulations were conducted over exposed sediments along stream banks at four distinct locations in an agriculturally dominated river basin with the objective of quantifying the potential for contaminant loading from these often overlooked runoff source areas. At each location, simulations were performed at three different sites. Nitrogen, phosphorus, sediment, fecal indicator bacteria, pathogenic bacteria, and microbial source tracking (MST) markers were examined in both prerainfall sediments and rainfall-induced runoff water. Runoff generation and sediment mobilization occurred quickly (10-150 s) after rainfall initiation. Temporal trends in runoff concentrations were highly variable within and between locations. Total runoff event loads were considered large for many pollutants considered. For instance, the maximum observed total phosphorus runoff load was on the order of 1.5 kg ha. Results also demonstrate that runoff from exposed sediments can be a source of pathogenic bacteria. spp. and spp. were present in runoff from one and three locations, respectively. Ruminant MST markers were also present in runoff from two locations, one of which hosted pasturing cattle with stream access. Overall, this study demonstrated that rainfall-induced runoff from exposed streambed sediments can be an important source of surface water pollution. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

Investigation on the pollution of road rainwater runoff in Shijiazhuang City

Directory of Open Access Journals (Sweden)

Tongjun GUAN

2017-12-01

Full Text Available To protect groundwater and urban ecological environment, much more sponge cities have been built in China. The sponge road is an important part of a sponge city. In recent years, Shijiazhuang Municipal Design Institute proposes a new sponge road structure, namely planting soil and crushed stone green belt, and it has been extensively used in Shijiazhuang City. In the design of the road structure, it is a key issue whether the infiltration rainwater quality pollutes the groundwater. Therefore, it is necessary to investigate the pollution of road rainwater runoff in Shijiazhuang City for the design of sponge road and the construction of sponge city. To obtain the characteristics of rainwater runoff pollution in Shijiazhuang City, four investigation points are chosen at the intersection of the Nanerhuan Road and Yuxiang Street, the east gate of Hebei University of Science and Technology, the site under the Xierhuan Road and Zhongshan Road overpass, and the catch-basin along the roadside in Shijiazhuang City. The investigating points are located in the main road of Shijiazhuang urban area, which covers Shijiazhuang City, and can represent the pollution characteristics of road runoff in Shijiazhuang City. Six rainfalls are collected from March to June in 2017. The rainfall on 3, May is viewed as typical middle and light one which is studied in this paper. The concentration of COD, TP, TN, NH3-N and SS in road runoff is tested by potassium dichromate method, ammonium molybdate spectrophotometry, potassium persulfate digestion-UV spectrophotometry and Nessler’s reagent spectrophotometry and filter paper filtration, respectively. The concentrations of Zn ions and Pb ions are tested by inductively coupled plasma method. According to the test results, the concentration evolutions of COD, TP, TN, NH3-N, SS, Zn and Pb ion in runoff during rainfall are studied. The results show that the contaminant concentration approximately decreases during the rainfall

Urban nonpoint source pollution buildup and washoff models for simulating storm runoff quality in the Los Angeles County.

Science.gov (United States)

Wang, Long; Wei, Jiahua; Huang, Yuefei; Wang, Guangqian; Maqsood, Imran

2011-07-01

Many urban nonpoint source pollution models utilize pollutant buildup and washoff functions to simulate storm runoff quality of urban catchments. In this paper, two urban pollutant washoff load models are derived using pollutant buildup and washoff functions. The first model assumes that there is no residual pollutant after a storm event while the second one assumes that there is always residual pollutant after each storm event. The developed models are calibrated and verified with observed data from an urban catchment in the Los Angeles County. The application results show that the developed model with consideration of residual pollutant is more capable of simulating nonpoint source pollution from urban storm runoff than that without consideration of residual pollutant. For the study area, residual pollutant should be considered in pollutant buildup and washoff functions for simulating urban nonpoint source pollution when the total runoff volume is less than 30 mm. Copyright © 2011 Elsevier Ltd. All rights reserved.

Stormwater Runoff Pollutant Loading Distributions and Their Correlation with Rainfall and Catchment Characteristics in a Rapidly Industrialized City

Science.gov (United States)

Li, Dongya; Wan, Jinquan; Ma, Yongwen; Wang, Yan; Huang, Mingzhi; Chen, Yangmei

2015-01-01

Fast urbanization and industrialization in developing countries result in significant stormwater runoff pollution, due to drastic changes in land-use, from rural to urban. A three-year study on the stormwater runoff pollutant loading distributions of industrial, parking lot and mixed commercial and residential catchments was conducted in the Tongsha reservoir watershed of Dongguan city, a typical, rapidly industrialized urban area in China. This study presents the changes in concentration during rainfall events, event mean concentrations (EMCs) and event pollution loads per unit area (EPLs). The first flush criterion, namely the mass first flush ratio (MFFn), was used to identify the first flush effects. The impacts of rainfall and catchment characterization on EMCs and pollutant loads percentage transported by the first 40% of runoff volume (FF40) were evaluated. The results indicated that the pollutant wash-off process of runoff during the rainfall events has significant temporal and spatial variations. The mean rainfall intensity (I), the impervious rate (IMR) and max 5-min intensity (Imax5) are the critical parameters of EMCs, while Imax5, antecedent dry days (ADD) and rainfall depth (RD) are the critical parameters of FF40. Intercepting the first 40% of runoff volume can remove 55% of TSS load, 53% of COD load, 58% of TN load, and 61% of TP load, respectively, according to all the storm events. These results may be helpful in mitigating stormwater runoff pollution for many other urban areas in developing countries. PMID:25774922

Stormwater runoff pollutant loading distributions and their correlation with rainfall and catchment characteristics in a rapidly industrialized city.

Science.gov (United States)

Li, Dongya; Wan, Jinquan; Ma, Yongwen; Wang, Yan; Huang, Mingzhi; Chen, Yangmei

2015-01-01

Fast urbanization and industrialization in developing countries result in significant stormwater runoff pollution, due to drastic changes in land-use, from rural to urban. A three-year study on the stormwater runoff pollutant loading distributions of industrial, parking lot and mixed commercial and residential catchments was conducted in the Tongsha reservoir watershed of Dongguan city, a typical, rapidly industrialized urban area in China. This study presents the changes in concentration during rainfall events, event mean concentrations (EMCs) and event pollution loads per unit area (EPLs). The first flush criterion, namely the mass first flush ratio (MFFn), was used to identify the first flush effects. The impacts of rainfall and catchment characterization on EMCs and pollutant loads percentage transported by the first 40% of runoff volume (FF40) were evaluated. The results indicated that the pollutant wash-off process of runoff during the rainfall events has significant temporal and spatial variations. The mean rainfall intensity (I), the impervious rate (IMR) and max 5-min intensity (Imax5) are the critical parameters of EMCs, while Imax5, antecedent dry days (ADD) and rainfall depth (RD) are the critical parameters of FF40. Intercepting the first 40% of runoff volume can remove 55% of TSS load, 53% of COD load, 58% of TN load, and 61% of TP load, respectively, according to all the storm events. These results may be helpful in mitigating stormwater runoff pollution for many other urban areas in developing countries.

Sustainability assessment of stormwater management systems and the importance of pollutants in runoff

DEFF Research Database (Denmark)

Brudler, Sarah; Arnbjerg-Nielsen, Karsten; Ammitsøe, Christian

substance groups present in runoff, metals cause the highest impacts. To integrate this method into holistic sustainability assessment, we assess the complete life cycle of a complex stormwater management. We show that runoff discharges have a high relative importance: The impacts exceed the combined......We develop a method to systematically include impacts caused by runoff discharge into the sustainability assessment of stormwater management systems. By defining priority pollutants and calculating mean concentrations, an average ecotoxicity impact per litre of runoff is calculated. Of all assessed...... impacts of implementation, maintenance and decommissioning of the stormwater management system....

Assessing metal pollution in ponds constructed for controlling runoff from reclaimed coal mines.

Science.gov (United States)

Miguel-Chinchilla, Leticia; González, Eduardo; Comín, Francisco A

2014-08-01

Constructing ponds to protect downstream ecosystems is a common practice in opencast coal mine reclamation. As these ponds remain integrated in the landscape, it is important to evaluate the extent of the effect of mine pollution on these ecosystems. However, this point has not been sufficiently addressed in the literature. The main objective of this work was to explore the metal pollution in man-made ponds constructed for runoff control in reclaimed opencast coal mines over time. To do so, we evaluated the concentration of ten heavy metals in the water, sediment, and Typha sp. in 16 runoff ponds ranging from 1 to 19 years old that were constructed in reclaimed opencast coal mines of northeastern Spain. To evaluate degree of mining pollution, we compared these data to those from a pit lake created in a local unreclaimed mine and to local streams as an unpolluted reference, as well as comparing toxicity levels in aquatic organisms. The runoff ponds showed toxic concentrations of Al, Cu, and Ni in the water and As and Ni in the sediment, which were maintained over time. Metal concentrations in runoff ponds were higher than in local streams, and macrophytes showed high metal concentrations. Nevertheless, metal concentrations in water and sediment in runoff ponds were lower than those in the pit lake. This study highlights the importance of mining reclamation to preserve the health of aquatic ecosystems and suggests the existence of chronic metal toxicity in the ponds, potentially jeopardizing pond ecological functions and services.

[Transport and sources of runoff pollution from urban area with combined sewer system].

Science.gov (United States)

Li, Li-Qing; Yin, Cheng-Qing

2009-02-15

Sampling and monitoring of runoff and sewage water in Wuhan urban area with combined sewer system were carried out during the period from 2003 to 2006, to study the transport and sources of runoff pollution at the catchment scale coupled with environmental geochemistry method. The results showed a change in quality between the runoff entering the sewer network and the combined storm water flow at the sewer's outlet. A significant increase was observed in the concentrations of total suspended solids (TSS), volatile suspended solids (VSS), COD, TN, and TP, and in the proportion of COD linked to particles. During the runoff production and transport, the concentrations of TSS and COD increased from 18.7 mg/L and 37.0 mg/L in roof runoff, to 225.3 mg/L and 176.5 mg/L in street runoff, and to 449.7 mg/L and 359.9 mg/L in combined storm water flow, respectively. The proportion of COD linked to particles was increased by 18%. In addition, the total phosphorus (P) and iron (Fe) contents in urban ground dust, storm drain sediment, sewage sewer sediment and combined sewer sediment were measured to identify the potential sources of suspended solids in the combined flow. The urban ground dust andstorm drain sediment wererich in Fe, whereas the sewage sewer sediment was rich in P. The P/Fe ratios in these groups were significantly distinct and able to differentiate them. A calculation of the two storm events based on the P/Fe rations showed that 56% +/- 26% of suspended solids in combined flow came from urban ground and storm drain. The rest wer e originated from the sewage sewer sediments which deposited in combined sewer on the dry weather days and were eroded on the wet weather days. The combined sewer network not only acts as a transport system, but also constitutes a physicochemical reactor that degrades the quality of urban water. Reducing the in-sewer pollution stocks would effectively control urban runoff pollution.

Effects of cattle manure on erosion rates and runoff water pollution by faecal coliforms.

Science.gov (United States)

Ramos, M C; Quinton, J N; Tyrrel, S F

2006-01-01

The large quantities of slurry and manure that are produced annually in many areas in which cattle are raised could be an important source of organic matter and nutrients for agriculture. However, the benefits of waste recycling may be partially offset by the risk of water pollution associated with runoff from the fields to which slurry or manure has been applied. In this paper, the effects of cattle manure application on soil erosion rates and runoff and on surface water pollution by faecal coliforms are analysed. Rainfall simulations at a rate of 70 mm h(-1) were conducted in a sandy loam soil packed into soil flumes (2.5m long x 1m wide) at a bulk density of 1400 kg m(-3), with and without cattle slurry manure applied on the surface. For each simulation, sediment and runoff rates were analysed and in those simulations with applied slurry, presumptive faecal coliform (PFC) concentrations in the runoff were evaluated. The application of slurry on the soil surface appeared to have a protective effect on the soils, reducing soil detachment by up to 70% but increasing runoff volume by up to 30%. This practice implies an important source of pollution for surface waters especially if rainfall takes place within a short period after application. The concentrations of micro-organisms (presumptive faecal coliforms (PFCs)) found in water runoff ranged from 1.9 x 10(4) to 1.1 x 10(6) PFC 100mL(-1), depending on the initial concentration in the slurry, and they were particularly high during the first phases of the rainfall event. The result indicates a strong relationship between the faecal coliforms transported by runoff and the organic matter in the sediment.

Spatial variations of storm runoff pollution and their correlation with land-use in a rapidly urbanizing catchment in China.

Science.gov (United States)

Qin, Hua-Peng; Khu, Soon-Thiam; Yu, Xiang-Ying

2010-09-15

The composition of land use for a rapidly urbanizing catchment is usually heterogeneous, and this may result in significant spatial variations of storm runoff pollution and increase the difficulties of water quality management. The Shiyan Reservoir catchment, a typical rapidly urbanizing area in China, is chosen as a study area, and temporary monitoring sites were set at the downstream of its 6 sub-catchments to synchronously measure rainfall, runoff and water quality during 4 storm events in 2007 and 2009. Due to relatively low frequency monitoring, the IHACRES and exponential pollutant wash-off simulation models are used to interpolate the measured data to compensate for data insufficiency. Three indicators, event pollutant loads per unit area (EPL), event mean concentration (EMC) and pollutant loads transported by the first 50% of runoff volume (FF50), were used to describe the runoff pollution for different pollutants in each sub-catchment during the storm events, and the correlations between runoff pollution spatial variations and land-use patterns were tested by Spearman's rank correlation analysis. The results indicated that similar spatial variation trends were found for different pollutants (EPL or EMC) in light storm events, which strongly correlate with the proportion of residential land use; however, they have different trends in heavy storm events, which correlate with not only the residential land use, but also agricultural and bare land use. And some pairs of pollutants (such as COD/BOD, NH(3)-N/TN) might have the similar source because they have strong or moderate positive spatial correlation. Moreover, the first flush intensity (FF50) varies with impervious land areas and different interception ratio of initial storm runoff volume should be adopted in different sub-catchments. Copyright 2010 Elsevier B.V. All rights reserved.

Pollution characteristics of surface runoff under different restoration types in manganese tailing wasteland.

Science.gov (United States)

Wang, Jun; Cheng, Qingyu; Xue, Shengguo; Rajendran, Manikandan; Wu, Chuan; Liao, Jiaxin

2018-04-01

A great deal of manganese and associated heavy metals (such as Ni, Cu, Zn, Cd, Pb, etc.) was produced in manganese mining, smelting, and other processes and weathering and leaching of waste slag, which entered rainwater runoff by different means under the action of rainfall runoff. It caused heavy metal pollution in water environment to surrounding areas, and then environmental and human health risks were becoming increasingly serious. In the Xiangtan manganese mine, we studied the characteristics of nutritional pollutants and heavy metals by using the method of bounded runoff plots on the manganese tailing wasteland after carrying out some site treatments using three different approaches, such as (1) exposed tailings, the control treatment (ET), (2) external-soil amelioration and colonization of Cynodon dactylon (Linn.) Pers. turf (EC), and (3) external-soil amelioration and seedling seeding propagation of Cynodon dactylon (Linn.) Pers. (ES). The research showed that the maximum runoff occurred in 20,140,712 rainfall events, and the basic law of runoff was EC area > ET area > ES area in the same rainfall event. The concentration of total suspended solids (TSS) and chemical oxygen demand (COD) of three ecological restoration areas adopted the following rule: ET area > EC area > ES area. Nitrogen (N) existed mainly in the form of water soluble while phosphorus (P) was particulate. The highest concentrations of total nitrogen (TN) and total phosphorus (TP) were 11.57 ± 2.99 mg/L in the EC area and 1.42 ± 0.56 mg/L in the ET area, respectively. Cr, Ni, Pb, Zn, Mn, and Cu in surface runoff from three restoration types all exceeded the class V level of the environmental quality standard for surface water except Cu in EC and ES areas. Pollution levels of heavy metals in surface runoff from three restoration areas are shown as follows: ET area > EC area > ES area. There was a significant positive correlation between TSS and runoff, COD, and TP. And this

Characterization and source identification of pollutants in runoff from a mixed land use watershed using ordination analyses.

Science.gov (United States)

Lee, Dong Hoon; Kim, Jin Hwi; Mendoza, Joseph A; Lee, Chang Hee; Kang, Joo-Hyon

2016-05-01

While identification of critical pollutant sources is the key initial step for cost-effective runoff management, it is challenging due to the highly uncertain nature of runoff pollution, especially during a storm event. To identify critical sources and their quantitative contributions to runoff pollution (especially focusing on phosphorous), two ordination methods were used in this study: principal component analysis (PCA) and positive matrix factorization (PMF). For the ordination analyses, we used runoff quality data for 14 storm events, including data for phosphorus, 11 heavy metal species, and eight ionic species measured at the outlets of subcatchments with different land use compositions in a mixed land use watershed. Five factors as sources of runoff pollutants were identified by PCA: agrochemicals, groundwater, native soils, domestic sewage, and urban sources (building materials and automotive activities). PMF identified similar factors to those identified by PCA, with more detailed source mechanisms for groundwater (i.e., nitrate leaching and cation exchange) and urban sources (vehicle components/motor oils/building materials and vehicle exhausts), confirming the sources identified by PCA. PMF was further used to quantify contributions of the identified sources to the water quality. Based on the results, agrochemicals and automotive activities were the two dominant and ubiquitous phosphorus sources (39-61 and 16-47 %, respectively) in the study area, regardless of land use types.

[Pollution load and the first flush effect of phosphorus in urban runoff of Wenzhou City].

Science.gov (United States)

Zhou, Dong; Chen, Zhen-lou; Bi, Chun-juan

2012-08-01

Five typical rainfalls were monitored in two different research areas of Wenzhou municipality. The pH and concentrations of total phosphorus (TP), dissolved phosphorus (DP), particulate phosphorus (PP), total inorganic carbon (TIC), total organic carbon (TOC), total suspended substances (TSS), BOD5 and COD in six different kinds of urban runoff were measured. The results showed that, the concentrations of TP, DP and PP in different kinds of urban runoff of Wenzhou ranged from 0.01 to 4.32 mg x L(-1), ND to 0.88 mg x L(-1) and ND to 4.31 mg x L(-1), respectively. In the early stages of runoff process PP was dominated, while in the later, the proportion of DP in most of the runoff samples would show a rising trend, especially in roof and outlet runoff. Judged by the event mean concentration (EMC) of TP and DP in these five rainfalls, some kinds of urban runoff could cause environmental pressure to the next level receiving water bodies. Meanwhile, the differences among the TP and DP content (maximum, minimum and mean content) in various urban runoffs were significant, and so were the differences among various rainfall events. According to the M (V) curve, the first flush effect of TP in most kinds of urban runoff was common; while the first flush effect of DP was more difficult to occur comparing with TP. Not only the underlying surface types but also many physico-chemical properties of runoff could affect the concentration of TP in urban runoff. All the results also suggested that different best management plans (BMPs) should be selected for various urban runoff types for the treatment of phosphorus pollution, and reducing the concentration of TSS is considered as one of the effective ways to decrease the pollution load of phosphorus in urban runoff.

Assessing the polycyclic aromatic hydrocarbon (PAH) pollution of urban stormwater runoff: a dynamic modeling approach.

Science.gov (United States)

Zheng, Yi; Lin, Zhongrong; Li, Hao; Ge, Yan; Zhang, Wei; Ye, Youbin; Wang, Xuejun

2014-05-15

Urban stormwater runoff delivers a significant amount of polycyclic aromatic hydrocarbons (PAHs), mostly of atmospheric origin, to receiving water bodies. The PAH pollution of urban stormwater runoff poses serious risk to aquatic life and human health, but has been overlooked by environmental modeling and management. This study proposed a dynamic modeling approach for assessing the PAH pollution and its associated environmental risk. A variable time-step model was developed to simulate the continuous cycles of pollutant buildup and washoff. To reflect the complex interaction among different environmental media (i.e. atmosphere, dust and stormwater), the dependence of the pollution level on antecedent weather conditions was investigated and embodied in the model. Long-term simulations of the model can be efficiently performed, and probabilistic features of the pollution level and its risk can be easily determined. The applicability of this approach and its value to environmental management was demonstrated by a case study in Beijing, China. The results showed that Beijing's PAH pollution of road runoff is relatively severe, and its associated risk exhibits notable seasonal variation. The current sweeping practice is effective in mitigating the pollution, but the effectiveness is both weather-dependent and compound-dependent. The proposed modeling approach can help identify critical timing and major pollutants for monitoring, assessing and controlling efforts to be focused on. The approach is extendable to other urban areas, as well as to other contaminants with similar fate and transport as PAHs. Copyright © 2014 Elsevier B.V. All rights reserved.

The measurement of dry deposition and surface runoff to quantify urban road pollution in Taipei, Taiwan.

Science.gov (United States)

Wang, Yunn-Jinn; Chen, Chi-Feng; Lin, Jen-Yang

2013-10-16

Pollutants deposited on road surfaces and distributed in the environment are a source of nonpoint pollution. Field data are traditionally hard to collect from roads because of constant traffic. In this study, in cooperation with the traffic administration, the dry deposition on and road runoff from urban roads was measured in Taipei City and New Taipei City, Taiwan. The results showed that the dry deposition is 2.01-5.14 g/m(2) · day and 78-87% of these solids are in the 75-300 µm size range. The heavy metals in the dry deposited particles are mainly Fe, Zn, and Na, with average concentrations of 34,978, 1,519 and 1,502 ppm, respectively. Elevated express roads show the highest heavy metal concentrations. Not only the number of vehicles, but also the speed of the traffic should be considered as factors that influence road pollution, as high speeds may accelerate vehicle wear and deposit more heavy metals on road surfaces. In addition to dry deposition, the runoff and water quality was analyzed every five minutes during the first two hours of storm events to capture the properties of the first flush road runoff. The sample mean concentration (SMC) from three roads demonstrated that the first flush runoff had a high pollution content, notably for suspended solid (SS), chemical oxygen demand (COD), oil and grease, Pb, and Zn. Regular sweeping and onsite water treatment facilities are suggested to minimize the pollution from urban roads.

Design procedure for pollutant loadings and impacts for highway stormwater runoff (Macintosh version) (for microcomputers). Software

International Nuclear Information System (INIS)

1990-01-01

The interactive computer program was developed to make a user friendly procedure for the personal computer for calculations and guidance to make estimations of pollutant loadings and impacts from highway stormwater runoff which are presented in the Publication FHWA-RD-88-006, Pollutant Loadings and Impacts from Highway Stormwater Runoff, Volume I: Design Procedure. The computer program is for the evaluation of the water quality impact from highway stormwater runoff to a lake or a stream from a specific highway site considering the necessary rainfall data and geographic site situation. The evaluation considers whether or not the resulting water quality conditions can cause a problem as indicated by the violations of water quality criteria or objectives

Design procedure for pollutant loadings and impacts for highway stormwater runoff (IBM version) (for microcomputers). Software

International Nuclear Information System (INIS)

1990-01-01

The interactive computer program was developed to make a user friendly procedure for the personal computer for calculations and guidance to make estimations of pollutant loadings and impacts from highway stormwater runoff which are presented in the Publication FHWA-RD-88-006, Pollutant Loadings and Impacts from Highway Stormwater Runoff, Volume I: Design Procedure. The computer program is for the evaluation of the water quality impact from highway stormwater runoff to a lake or a stream from a specific highway site considering the necessary rainfall data and geographic site situation. The evaluation considers whether or not the resulting water quality conditions can cause a problem as indicated by the violations of water quality criteria or objectives

The effect of metal pollution on the life history and insecticide resistance phenotype of the major malaria vector Anopheles arabiensis (Diptera: Culicidae.

Directory of Open Access Journals (Sweden)

Shüné V Oliver

Full Text Available Metal exposure is one of the commonest anthropogenic pollutants mosquito larvae are exposed to, both in agricultural and urban settings. As members of the Anopheles gambiae complex, which contains several major malaria vector species including An. arabiensis, are increasingly adapting to polluted environments, this study examined the effects of larval metal exposure on various life history traits of epidemiological importance. Two laboratory strains of An. arabiensis, SENN (insecticide susceptible and SENN DDT (insecticide resistant, were reared in maximum acceptable toxicity concentrations, (MATC-the highest legally accepted concentration of cadmium chloride, lead nitrate and copper nitrate. Following these exposures, time to pupation, adult size and longevity were determined. Larvae reared in double the MATC were assessed for changes in malathion and deltamethrin tolerance, measured by lethal time bottle bioassay, as well as changes in detoxification enzyme activity. As defence against oxidative stress has previously been demonstrated to affect the expression of insecticide resistance, catalase, glutathione peroxidase and superoxide dismutase activity was assessed. The relative metal toxicity to metal naïve larvae was also assessed. SENN DDT larvae were more tolerant of metal pollution than SENN larvae. Pupation in SENN larvae was significantly reduced by metal exposure, while adult longevity was not affected. SENN DDT showed decreased adult size after larval metal exposure. Adult insecticide tolerance was increased after larval metal exposure, and this effect appeared to be mediated by increased β-esterase, cytochrome P450 and superoxide dismutase activity. These data suggest an enzyme-mediated positive link between tolerance to metal pollutants and insecticide resistance in adult mosquitoes. Furthermore, exposure of larvae to metal pollutants may have operational consequences under an insecticide-based vector control scenario by increasing

Calculation of intercepted runoff depth based on stormwater quality and environmental capacity of receiving waters for initial stormwater pollution management.

Science.gov (United States)

Peng, Hai-Qin; Liu, Yan; Gao, Xue-Long; Wang, Hong-Wu; Chen, Yi; Cai, Hui-Yi

2017-11-01

While point source pollutions have gradually been controlled in recent years, the non-point source pollution problem has become increasingly prominent. The receiving waters are frequently polluted by the initial stormwater from the separate stormwater system and the wastewater from sewage pipes through stormwater pipes. Consequently, calculating the intercepted runoff depth has become a problem that must be resolved immediately for initial stormwater pollution management. The accurate calculation of intercepted runoff depth provides a solid foundation for selecting the appropriate size of intercepting facilities in drainage and interception projects. This study establishes a separate stormwater system for the Yishan Building watershed of Fuzhou City using the InfoWorks Integrated Catchment Management (InfoWorks ICM), which can predict the stormwater flow velocity and the flow of discharge outlet after each rainfall. The intercepted runoff depth is calculated from the stormwater quality and environmental capacity of the receiving waters. The average intercepted runoff depth from six rainfall events is calculated as 4.1 mm based on stormwater quality. The average intercepted runoff depth from six rainfall events is calculated as 4.4 mm based on the environmental capacity of the receiving waters. The intercepted runoff depth differs when calculated from various aspects. The selection of the intercepted runoff depth depends on the goal of water quality control, the self-purification capacity of the water bodies, and other factors of the region.

Polluted rainwater runoff from waste recovery and recycling companies: Determination of emission levels associated with the best available techniques.

Science.gov (United States)

Huybrechts, D; Verachtert, E; Vander Aa, S; Polders, C; Van den Abeele, L

2016-08-01

Rainwater falling on outdoor storage areas of waste recovery and recycling companies becomes polluted via contact with the stored materials. It contains various pollutants, including heavy metals, polycyclic aromatic hydrocarbons and polychlorinated biphenyls, and is characterized by a highly fluctuating composition and flow rate. This polluted rainwater runoff is legally considered as industrial wastewater, and the polluting substances contained in the rainwater runoff at the point of discharge, are considered as emissions into water. The permitting authorities can set emission limit values (discharge limits) at the point of discharge. Best available techniques are an important reference point for setting emission limit values. In this paper, the emission levels associated with the best available techniques for dealing with polluted rainwater runoff from waste recovery and recycling companies were determined. The determination is based on an analysis of emission data measured at different companies in Flanders. The data show that a significant fraction of the pollution in rainwater runoff is associated with particles. A comparison with literature data provides strong indications that not only leaching, but also atmospheric deposition play an important role in the contamination of rainwater at waste recovery and recycling companies. The prevention of pollution and removal of suspended solids from rainwater runoff to levels below 60mg/l are considered as best available techniques. The associated emission levels were determined by considering only emission data from plants applying wastewater treatment, and excluding all samples with suspended solid levels >60mg/l. The resulting BAT-AEL can be used as a reference point for setting emission limit values for polluted rainwater runoff from waste recovery and recycling companies. Since the BAT-AEL (e.g. 150μg/l for Cu) are significantly lower than current emission levels (e.g. 300μg/l as the 90% percentile and 4910�

The Measurement of Dry Deposition and Surface Runoff to Quantify Urban Road Pollution in Taipei, Taiwan

Science.gov (United States)

Wang, Yunn-Jinn; Chen, Chi-Feng; Lin, Jen-Yang

2013-01-01

Pollutants deposited on road surfaces and distributed in the environment are a source of nonpoint pollution. Field data are traditionally hard to collect from roads because of constant traffic. In this study, in cooperation with the traffic administration, the dry deposition on and road runoff from urban roads was measured in Taipei City and New Taipei City, Taiwan. The results showed that the dry deposition is 2.01–5.14 g/m2·day and 78–87% of these solids are in the 75–300 µm size range. The heavy metals in the dry deposited particles are mainly Fe, Zn, and Na, with average concentrations of 34,978, 1,519 and 1,502 ppm, respectively. Elevated express roads show the highest heavy metal concentrations. Not only the number of vehicles, but also the speed of the traffic should be considered as factors that influence road pollution, as high speeds may accelerate vehicle wear and deposit more heavy metals on road surfaces. In addition to dry deposition, the runoff and water quality was analyzed every five minutes during the first two hours of storm events to capture the properties of the first flush road runoff. The sample mean concentration (SMC) from three roads demonstrated that the first flush runoff had a high pollution content, notably for suspended solid (SS), chemical oxygen demand (COD), oil and grease, Pb, and Zn. Regular sweeping and onsite water treatment facilities are suggested to minimize the pollution from urban roads. PMID:24135820

[Performance of Grass Swales for Controlling Pollution of Roadway Runoff in Field Experiments].

Science.gov (United States)

Huang, Jun-jie; Shen, Qing-ran; Li, Tian

2015-06-01

Two different styles of grass swales were built in new Binhu region of Hefei city to monitor the flux and quality of the influent and effluent water under actual precipitation conditions, in order to evaluate the performance of water quality purification and pollution load control for roadway runoff. The results showed that both of the grass swales could effectively remove the pollutants such as TSS, COD, Pb, Cu, Cd, Zn in roadway runoff; the median EMC removal efficiencies of TSS and COD were 67.1%, 46.7% respectively,for facility I, and the median EMC removal efficiencies of TSS and COD were 78.6%, 58.6% respectively, for facility II; the concentrations of Pb, Cu, Zn in the effluent of facility II could meet the requirements of the surface water quality class V; release of nitrogen and phosphorus occurred in both facilities I and I[ in several rainfall events, mainly in heavy storms; the removal efficiencies of TP in the two grass swales were improved with the increase of influent concentration; the mean removal efficiencies of TP in facilities I and II were 14.7% and 45.4%, respectively; the load control performance of facility II for pollutants such as TSS, COD, TP, TN, NH4+ -N and NO3- -N was better than that of facility I; in the district with poor soil permeability and low ground slope, application of dry swale could achieve better performance in water quality control and pollution load reduction of roadway runoff.

[Research of the Stormwater Runoff and Pollution Characteristics in Rural Area of Yuhang District, Hangzhou].

Science.gov (United States)

Duan, Sheng-hui; Zhao, Yu; Shan, Bao-qing; Tang, Wen-zhong; Zhang, Wen-qiang; Zhang, Shu-zhen; Lang, Chao

2015-10-01

In order to investigate the pollution characteristics of stormwater runoff in the southern developed rural region, the runoff samples were collected from four different underlying surfaces during three storm events in Caoqiao and Pujia Tou, which are two typical villages and are located in Yuhang District of Hangzhou. The content of nutrition (nitrogen and phosphorus) and heavy metals (Mn, Cu, Zn, Ni, Cr, Cd, As, Pb) in the simples were analyzed, and the difference of EMC ( event mean concentration) and pollution load of the contaminants in the runoff on different underlying surfaces were compared. The results showed that the EMC of TSS, COD, NH4(+)-N, TP and TN were 16.19, 21.01, 0.74, 1.39 and 2.39 mg x L(-1) in the Caoqiao, respectively; as to Pujia Tou, they were 3.10, 15.69, 0.90, 0.78 and 3.58 mg x L(-1), respectively. The content of heavy metals was all lower than the national surface water quality of two type water in the runoff. Compared with the quality standards for surface water, the EMC of TP was 9 times and 3. 5 times higher and TN was 1. 8 times and 1. 2 times higher in two areas. Besides, the pollution loads of TSS and COD were the highest in farmland.

Best management practices to reduce and prevent water pollution with herbicides from run-off and erosion

Directory of Open Access Journals (Sweden)

Gehring, Klaus

2014-02-01

Full Text Available The natural phenomenon of run-off and erosion lead to unpreventable pesticide water pollution in case of extreme weather conditions. In this relationship the use of herbicides involves a higher risk than other pesticides because of the specific terms of application. Directive 2009/128/EC for the sustainable use of pesticides aspires to enhanced water protection. German national action plan contains quantitative objectives which require strong reduction of water pollution by run-off and erosion of pesticides and accordingly herbicides. The European TOPPS prowadis project developed a consolidated and basic diagnosis concept for the first time to determine the field specific run-off risk. Compatible mitigation measures were linked to specific risk scenarios. Risk diagnosis and suitable mitigation measures determine best management practices for the prevention of run-off and erosion. Different new diagnosis methods and the implementation are presented. Further documents and information are available on the web [http://www.topps-life.org/].

The use of simulated rainfall to study the discharge process and the influence factors of urban surface runoff pollution loads.

Science.gov (United States)

Qinqin, Li; Qiao, Chen; Jiancai, Deng; Weiping, Hu

2015-01-01

An understanding of the characteristics of pollutants on impervious surfaces is essential to estimate pollution loads and to design methods to minimize the impacts of pollutants on the environment. In this study, simulated rainfall equipment was constructed to investigate the pollutant discharge process and the influence factors of urban surface runoff (USR). The results indicated that concentrations of total suspended solids (TSS), total nitrogen (TN), total phosphorus (TP) and chemical oxygen demand (COD) appeared to be higher in the early period and then decreased gradually with rainfall duration until finally stabilized. The capacity and particle size of surface dust, rainfall intensity and urban surface slopes affected runoff pollution loads to a variable extent. The loads of TP, TN and COD showed a positive relationship with the surface dust capacity, whereas the maximum TSS load appeared when the surface dust was 0.0317 g·cm⁻². Smaller particle sizes (pollution carrying capacity of runoff, leading to higher pollution loads. Knowledge of the influence factors could assist in the management of USR pollution loads.

Development and evaluation of best management practices (BMPS) for highway runoff pollution control.

Science.gov (United States)

2013-12-01

Polluted storm water runoff is commonly transported through Municipal Separate Storm Sewer Systems (MS4s). Currently, : sufficient information is not available on development and evaluation of Best Management Practices (BMPs) within an MS4 : boundary...

Runoff characteristics and non-point source pollution analysis in the Taihu Lake Basin: a case study of the town of Xueyan, China.

Science.gov (United States)

Zhu, Q D; Sun, J H; Hua, G F; Wang, J H; Wang, H

2015-10-01

Non-point source pollution is a significant environmental issue in small watersheds in China. To study the effects of rainfall on pollutants transported by runoff, rainfall was monitored in Xueyan town in the Taihu Lake Basin (TLB) for over 12 consecutive months. The concentrations of different forms of nitrogen (N) and phosphorus (P), and chemical oxygen demand, were monitored in runoff and river water across different land use types. The results indicated that pollutant loads were highly variable. Most N losses due to runoff were found around industrial areas (printing factories), while residential areas exhibited the lowest nitrogen losses through runoff. Nitrate nitrogen (NO3-N) and ammonia nitrogen (NH4-N) were the dominant forms of soluble N around printing factories and hotels, respectively. The levels of N in river water were stable prior to the generation of runoff from a rainfall event, after which they were positively correlated to rainfall intensity. In addition, three sites with different areas were selected for a case study to analyze trends in pollutant levels during two rainfall events, using the AnnAGNPS model. The modeled results generally agreed with the observed data, which suggests that AnnAGNPS can be used successfully for modeling runoff nutrient loading in this region. The conclusions of this study provide important information on controlling non-point source pollution in TLB.

Characterization of road runoff with regard to seasonal variations, particle size distribution and the correlation of fine particles and pollutants.

Science.gov (United States)

Hilliges, R; Endres, M; Tiffert, A; Brenner, E; Marks, T

2017-03-01

Urban runoff is known to transport a significant pollutant load consisting of e.g. heavy metals, salts and hydrocarbons. Interactions between solid and dissolved compounds, proper understanding of particle size distribution, dissolved pollutant fractions and seasonal variations is crucial for the selection and development of appropriate road runoff treatment devices. Road runoff at an arterial road in Augsburg, Germany, has been studied for 3.5 years. A strong seasonal variation was observed, with increased heavy metal concentrations with doubled and tripled median concentrations for heavy metals during the cold season. Correlation analysis showed that de-icing salt is not the only factor responsible for increased pollutant concentrations in winter. During the cold period, the fraction of dissolved metals was lower compared to the warm season. In road dust, the highest metal concentrations were measured for fine particles. Metals in road runoff were found to show a significant correlation to fine particles SS63 (removal rates.

Grain size distribution of road-deposited sediment and its contribution to heavy metal pollution in urban runoff in Beijing, China.

Science.gov (United States)

Zhao, Hongtao; Li, Xuyong; Wang, Xiaomei; Tian, Di

2010-11-15

Pollutant washoff from road-deposited sediment (RDS) is an increasing problem associated with the rapid urbanization of China that results in urban non-point source pollution. Here, we analyzed the RDS grain size distribution and its potential impact on heavy metal pollution in urban runoff from impervious surfaces of urban villages, colleges and residences, and main traffic roads in the Haidian District, Beijing, China. RDS with smaller grain size had a higher metal concentration. Specifically, particles with the smallest grain size (runoff water accounted for greater than 70% of the metal mass in the total suspended solids (TSS). The heavy metal content in the TSS was 2.21-6.52% of that in the RDS. These findings will facilitate our understanding of the importance of RDS grain size distribution in heavy metal pollution caused by urban storm runoff. Copyright © 2010 Elsevier B.V. All rights reserved.

Runoff of particle bound pollutants from urban impervious surfaces studied by analysis of sediments from stormwater traps

International Nuclear Information System (INIS)

Jartun, Morten; Ottesen, Rolf Tore; Steinnes, Eiliv; Volden, Tore

2008-01-01

Runoff sediments from 68 small stormwater traps around the harbor of urban Bergen, Norway, were sampled and the concentrations of polychlorinated biphenyls (PCBs), polycyclic aromatic hydrocarbons (PAHs), heavy metals, and total organic carbon (TOC) were determined in addition to grain size. Our study provides empirical data from a large area in the interface between the urban and marine environment, studying the active transport of pollutants from land-based sources. The results of the analyses clearly demonstrate the importance of the urban environment representing a variety of contamination sources, and that stormwater runoff is an important dispersion mechanism of toxic pollutants. The concentrations of different pollutants in urban runoff sediments show that there are several active pollution sources supplying the sewage systems with PCBs, PAHs and heavy metals such as lead (Pb), zinc (Zn) and cadmium (Cd). The concentration of PCB 7 in the urban runoff sediments ranged between 16 , the concentration range was < 0.2-80 mg/kg, whereas the concentration ranges of Pb, Zn and Cd were 9-675, 51.3-4670 and 0.02-11.1 mg/kg respectively. Grain size distribution in 21 selected samples varied from a median particle diameter of 13 to 646 μm. However, several samples had very fine-grained particles even up to the 90 percentile of the samples, making them available for stormwater dispersion in suspended form. The sampling approach proposed in this paper will provide environmental authorities with a useful tool to examine ongoing urban contamination of harbors and similar recipients

Multiple evaluations of the removal of pollutants in road runoff by soil infiltration.

Science.gov (United States)

Murakami, Michio; Sato, Nobuyuki; Anegawa, Aya; Nakada, Norihide; Harada, Arata; Komatsu, Toshiya; Takada, Hideshige; Tanaka, Hiroaki; Ono, Yoshiro; Furumai, Hiroaki

2008-05-01

Groundwater replenishment by infiltration of road runoff is expected to be a promising option for ensuring a sustainable urban water cycle. In this study, we performed a soil infiltration column test using artificial road runoff equivalent to approximately 11-12 years of rainfall to evaluate the removal of pollutants by using various chemical analyses and bioassay tests. These results indicated that soil infiltration treatment works effectively to remove most of the pollutants such as organic matter (chemical oxygen demand (CODMn) and dissolved organic carbon (DOC)), P species, polycyclic aromatic hydrocarbons (PAHs), numerous heavy metals and oestrogenic activities. Bioassay tests, including algal growth inhibition test, Microtox and mutagen formation potential (MFP) test, also revealed effective removal of toxicities by the soils. However, limited amounts of NO3, Mn, Ni, alkaline earth metals, perfluorooctane sulphonate (PFOS) and perfluorooctane sulphonamide (FOSA) were removed by the soils and they possibly reach the groundwater and cause contamination.

Heavy metal contents of road-deposited sediment along the urban-rural gradient around Beijing and its potential contribution to runoff pollution.

Science.gov (United States)

Zhao, Hongtao; Li, Xuyong; Wang, Xiaomei

2011-09-01

Understanding the contribution of road-deposited sediment (RDS) and its washoff process is essential for controlling urban runoff pollution. Ninety-seven RDS samples were collected along the urban-suburban-rural gradient from areas of five administrative units in the Beijing metropolitan region, including central urban (UCA), urban village (UVA), central suburban county (CSA), rural town (RTA), and rural village (RVA) areas. RDS washoff was evaluated with different particle sizes using a rainfall simulator. Heavy metal elements (i.e., Cr, Cu, Ni, Pb, and Zn) were estimated in both RDS and runoff samples. The RDS mass per unit area increased in the order UCA (21 ± 24 g/m(2)) ≈ CSA (20 ± 16 g/m(2)) runoff pollution contributions per unit area. Our findings imply that controlling the first flush in the UCA and CSA, and improving existing street cleaning methods and road surface conditions in the TRA, UVA, and RVA will be appropriate strategies for controlling runoff pollution from RDS.

Development of a Web-Based L-THIA 2012 Direct Runoff and Pollutant Auto-Calibration Module Using a Genetic Algorithm

Directory of Open Access Journals (Sweden)

Chunhwa Jang

2013-11-01

Full Text Available The Long-Term Hydrology Impact Assessment (L-THIA model has been used as a screening evaluation tool in assessing not only urbanization, but also land-use changes on hydrology in many countries. However, L-THIA has limitations due to the number of available land-use data that can represent a watershed and the land surface complexity causing uncertainties in manually calibrating various input parameters of L-THIA. Thus, we modified the L-THIA model so that could use various (twenty three land-use categories by considering various hydrologic responses and nonpoint source (NPS pollutant loads. Then, we developed a web-based auto-calibration module by integrating a Genetic-Algorithm (GA into the L-THIA 2012 that can automatically calibrate Curve Numbers (CNs for direct runoff estimations. Based on the optimized CNs and Even Mean Concentrations (EMCs, our approach calibrated surface runoff and nonpoint source (NPS pollution loads by minimizing the differences between the observed and simulated data. Here, we used default EMCs of biochemical oxygen demand (BOD, total nitrogen (TN, and total phosphorus-TP (as the default values to L-THIA collected at various local regions in South Korea corresponding to the classifications of different rainfall intensities and land use for improving predicted NPS pollutions. For assessing the model performance, the Yeoju-Gun and Icheon-Si sites in South Korea were selected. The calibrated runoff and NPS (BOD, TN, and TP pollutions matched the observations with the correlation (R2: 0.908 for runoff and R2: 0.882–0.981 for NPS and Nash-Sutcliffe Efficiency (NSE: 0.794 for runoff and NSE: 0.882–0.981 for NPS for the sites. We also compared the NPS pollution differences between the calibrated and averaged (default EMCs. The calibrated TN and TP (only for Yeoju-Gun EMCs-based pollution loads identified well with the measured data at the study sites, but the BOD loads with the averaged EMCs were slightly better than

Agricultural runoff pollution control by a grassed swales coupled with wetland detention ponds system: a case study in Taihu Basin, China.

Science.gov (United States)

Zhao, Jinhui; Zhao, Yaqian; Zhao, Xiaoli; Jiang, Cheng

2016-05-01

The performance of a field grassed swales (GSs) coupled with wetland detention ponds (WDPs) system was monitored under four typical rainfall events to assess its effectiveness on agricultural runoff pollution control in Taihu Basin, China. The results indicated that suspended solids (SS) derived from the flush process has significant influence on pollution loads in agricultural runoff. Determination of first flush effect (FFE) indicated that total suspended solids (TSS) and total phosphorus (TP) exhibited moderate FFE, while chemical oxygen demand (COD) and total nitrogen (TN) showed weak FFE. Average removal efficiencies of 83.5 ± 4.5, 65.3 ± 6.8, 91.6 ± 3.8, and 81.3 ± 5.8 % for TSS, COD, TN, and TP were achieved, respectively. The GSs played an important role in removing TSS and TP and acted as a pre-treatment process to prevent clogging of the subsequent WDPs. Particle size distributions (PSDs) analysis indicated that coarse particles larger than 75 μm accounted for 80 % by weight of the total particles in the runoff. GSs can effectively reduce coarse particles (≥75 μm) in runoff, while its removal efficiency for fine particles (runoff pollution control.

Anopheles gambiae distribution and insecticide resistance in the cities of Douala and Yaoundé (Cameroon): influence of urban agriculture and pollution.

Science.gov (United States)

Antonio-Nkondjio, Christophe; Fossog, Billy Tene; Ndo, Cyrille; Djantio, Benjamin Menze; Togouet, Serge Zebaze; Awono-Ambene, Parfait; Costantini, Carlo; Wondji, Charles S; Ranson, Hilary

2011-06-08

Urban malaria is becoming a major health priority across Africa. A study was undertaken to assess the importance of urban pollution and agriculture practice on the distribution and susceptibility to insecticide of malaria vectors in the two main cities in Cameroon. Anopheline larval breeding sites were surveyed and water samples analysed monthly from October 2009 to December 2010. Parameters analysed included turbidity, pH, temperature, conductivity, sulfates, phosphates, nitrates, nitrites, ammonia, aluminium, alkalinity, iron, potassium, manganese, magnesium, magnesium hardness and total hardness. Characteristics of water bodies in urban areas were compared to rural areas and between urban sites. The level of susceptibility of Anopheles gambiae to 4% DDT, 0.75% permethrin, 0.05% deltamethrin, 0.1% bendiocarb and 5% malathion were compared between mosquitoes collected from polluted, non polluted and cultivated areas. A total of 1,546 breeding sites, 690 in Yaoundé and 856 in Douala, were sampled in the course of the study. Almost all measured parameters had a concentration of 2- to 100-fold higher in urban compare to rural breeding sites. No resistance to malathion was detected, but bendiocarb resistance was present in Yaounde. Very low mortality rates were observed following DDT or permethrin exposure, associated with high kdr frequencies. Mosquitoes collected in cultivated areas, exhibited the highest resistant levels. There was little difference in insecticide resistance or kdr allele frequency in mosquitoes collected from polluted versus non-polluted sites. The data confirm high selection pressure on mosquitoes originating from urban areas and suggest urban agriculture rather than pollution as the major factor driving resistance to insecticide.

Modeling the impacts of wildfire on runoff and pollutant transport from coastal watersheds to the nearshore environment.

Science.gov (United States)

Morrison, Katherine D; Kolden, Crystal A

2015-03-15

Wildfire is a common disturbance that can significantly alter vegetation in watersheds and affect the rate of sediment and nutrient transport to adjacent nearshore oceanic environments. Changes in runoff resulting from heterogeneous wildfire effects are not well-understood due to both limitations in the field measurement of runoff and temporally-limited spatial data available to parameterize runoff models. We apply replicable, scalable methods for modeling wildfire impacts on sediment and nonpoint source pollutant export into the nearshore environment, and assess relationships between wildfire severity and runoff. Nonpoint source pollutants were modeled using a GIS-based empirical deterministic model parameterized with multi-year land cover data to quantify fire-induced increases in transport to the nearshore environment. Results indicate post-fire concentration increases in phosphorus by 161 percent, sediments by 350 percent and total suspended solids (TSS) by 53 percent above pre-fire years. Higher wildfire severity was associated with the greater increase in exports of pollutants and sediment to the nearshore environment, primarily resulting from the conversion of forest and shrubland to grassland. This suggests that increasing wildfire severity with climate change will increase potential negative impacts to adjacent marine ecosystems. The approach used is replicable and can be utilized to assess the effects of other types of land cover change at landscape scales. It also provides a planning and prioritization framework for management activities associated with wildfire, including suppression, thinning, and post-fire rehabilitation, allowing for quantification of potential negative impacts to the nearshore environment in coastal basins. Copyright © 2014 Elsevier Ltd. All rights reserved.

A framework for managing runoff and pollution in the rural landscape using a Catchment Systems Engineering approach.

Science.gov (United States)

Wilkinson, M E; Quinn, P F; Barber, N J; Jonczyk, J

2014-01-15

Intense farming plays a key role in increasing local scale runoff and erosion rates, resulting in water quality issues and flooding problems. There is potential for agricultural management to become a major part of improved strategies for controlling runoff. Here, a Catchment Systems Engineering (CSE) approach has been explored to solve the above problem. CSE is an interventionist approach to altering the catchment scale runoff regime through the manipulation of hydrological flow pathways throughout the catchment. By targeting hydrological flow pathways at source, such as overland flow, field drain and ditch function, a significant component of the runoff generation can be managed in turn reducing soil nutrient losses. The Belford catchment (5.7 km(2)) is a catchment scale study for which a CSE approach has been used to tackle a number of environmental issues. A variety of Runoff Attenuation Features (RAFs) have been implemented throughout the catchment to address diffuse pollution and flooding issues. The RAFs include bunds disconnecting flow pathways, diversion structures in ditches to spill and store high flows, large wood debris structure within the channel, and riparian zone management. Here a framework for applying a CSE approach to the catchment is shown in a step by step guide to implementing mitigation measures in the Belford Burn catchment. The framework is based around engagement with catchment stakeholders and uses evidence arising from field science. Using the framework, the flooding issue has been addressed at the catchment scale by altering the runoff regime. Initial findings suggest that RAFs have functioned as designed to reduce/attenuate runoff locally. However, evidence suggested that some RAFs needed modification and new RAFs be created to address diffuse pollution issues during storm events. Initial findings from these modified RAFs are showing improvements in sediment trapping capacities and reductions in phosphorus, nitrate and suspended

A systematic assessment of watershed-scale nonpoint source pollution during rainfall-runoff events in the Miyun Reservoir watershed.

Science.gov (United States)

Qiu, Jiali; Shen, Zhenyao; Wei, Guoyuan; Wang, Guobo; Xie, Hui; Lv, Guanping

2018-03-01

The assessment of peak flow rate, total runoff volume, and pollutant loads during rainfall process are very important for the watershed management and the ecological restoration of aquatic environment. Real-time measurements of rainfall-runoff and pollutant loads are always the most reliable approach but are difficult to carry out at all desired location in the watersheds considering the large consumption of material and financial resources. An integrated environmental modeling approach for the estimation of flash streamflow that combines the various hydrological and quality processes during rainstorms within the agricultural watersheds is essential to develop targeted management strategies for the endangered drinking water. This study applied the Hydrological Simulation Program-Fortran (HSPF) to simulate the spatial and temporal variation in hydrological processes and pollutant transport processes during rainstorm events in the Miyun Reservoir watershed, a drinking water resource area in Beijing. The model performance indicators ensured the acceptable applicability of the HSPF model to simulate flow and pollutant loads in the studied watershed and to establish a relationship between land use and the parameter values. The proportion of soil and land use was then identified as the influencing factors of the pollution intensities. The results indicated that the flush concentrations were much higher than those observed during normal flow periods and considerably exceeded the limits of Class III Environmental Quality Standards for Surface Water (GB3838-2002) for the secondary protection zones of the drinking water resource in China. Agricultural land and leached cinnamon soils were identified as the key sources of sediment, nutrients, and fecal coliforms. Precipitation volume was identified as a driving factor that determined the amount of runoff and pollutant loads during rainfall processes. These results are useful to improve the streamflow predictions, provide

Evaluation of statistical distributions to analyze the pollution of Cd and Pb in urban runoff.

Science.gov (United States)

Toranjian, Amin; Marofi, Safar

2017-05-01

Heavy metal pollution in urban runoff causes severe environmental damage. Identification of these pollutants and their statistical analysis is necessary to provide management guidelines. In this study, 45 continuous probability distribution functions were selected to fit the Cd and Pb data in the runoff events of an urban area during October 2014-May 2015. The sampling was conducted from the outlet of the city basin during seven precipitation events. For evaluation and ranking of the functions, we used the goodness of fit Kolmogorov-Smirnov and Anderson-Darling tests. The results of Cd analysis showed that Hyperbolic Secant, Wakeby and Log-Pearson 3 are suitable for frequency analysis of the event mean concentration (EMC), the instantaneous concentration series (ICS) and instantaneous concentration of each event (ICEE), respectively. In addition, the LP3, Wakeby and Generalized Extreme Value functions were chosen for the EMC, ICS and ICEE related to Pb contamination.

Comparison of heavy metal loads in stormwater runoff from major and minor urban roads using pollutant yield rating curves

International Nuclear Information System (INIS)

Davis, Brett; Birch, Gavin

2010-01-01

Trace metal export by stormwater runoff from a major road and local street in urban Sydney, Australia, is compared using pollutant yield rating curves derived from intensive sampling data. The event loads of copper, lead and zinc are well approximated by logarithmic relationships with respect to total event discharge owing to the reliable appearance of a first flush in pollutant mass loading from urban roads. Comparisons of the yield rating curves for these three metals show that copper and zinc export rates from the local street are comparable with that of the major road, while lead export from the local street is much higher, despite a 45-fold difference in traffic volume. The yield rating curve approach allows problematic environmental data to be presented in a simple yet meaningful manner with less information loss. - A simple method for representing data onroad runoff pollution allows comparisons among dissimilar sites and could form the basis for a pollution database.

Mitigation of two pyrethroid insecticides in a Mississippi Delta constructed wetland

Energy Technology Data Exchange (ETDEWEB)

Moore, M.T. [USDA Agricultural Research Service National Sedimentation Laboratory, Water Quality and Ecology Research Unit, PO Box 1157, 598 McElroy Drive, Oxford, MS 38655 (United States)], E-mail: matt.moore@ars.usda.gov; Cooper, C.M.; Smith, S.; Cullum, R.F.; Knight, S.S.; Locke, M.A.; Bennett, E.R. [USDA Agricultural Research Service National Sedimentation Laboratory, Water Quality and Ecology Research Unit, PO Box 1157, 598 McElroy Drive, Oxford, MS 38655 (United States)

2009-01-15

Constructed wetlands are a suggested best management practice to help mitigate agricultural runoff before entering receiving aquatic ecosystems. A constructed wetland system (180 m x 30 m), comprising a sediment retention basin and two treatment cells, was used to determine the fate and transport of simulated runoff containing the pyrethroid insecticides lambda-cyhalothrin and cyfluthrin, as well as suspended sediment. Wetland water, sediment, and plant samples were collected spatially and temporally over 55 d. Results showed 49 and 76% of the study's measured lambda-cyhalothrin and cyfluthrin masses were associated with vegetation, respectively. Based on conservative effects concentrations for invertebrates and regression analyses of maximum observed wetland aqueous concentrations, a wetland length of 215 m x 30 m width would be required to adequately mitigate 1% pesticide runoff from a 14 ha contributing area. Results of this experiment can be used to model future design specifications for constructed wetland mitigation of pyrethroid insecticides. - A wetland length of 215 m x 30 m mitigated pyrethroid runoff from a 14 ha field.

Mitigation of two pyrethroid insecticides in a Mississippi Delta constructed wetland

International Nuclear Information System (INIS)

Moore, M.T.; Cooper, C.M.; Smith, S.; Cullum, R.F.; Knight, S.S.; Locke, M.A.; Bennett, E.R.

2009-01-01

Constructed wetlands are a suggested best management practice to help mitigate agricultural runoff before entering receiving aquatic ecosystems. A constructed wetland system (180 m x 30 m), comprising a sediment retention basin and two treatment cells, was used to determine the fate and transport of simulated runoff containing the pyrethroid insecticides lambda-cyhalothrin and cyfluthrin, as well as suspended sediment. Wetland water, sediment, and plant samples were collected spatially and temporally over 55 d. Results showed 49 and 76% of the study's measured lambda-cyhalothrin and cyfluthrin masses were associated with vegetation, respectively. Based on conservative effects concentrations for invertebrates and regression analyses of maximum observed wetland aqueous concentrations, a wetland length of 215 m x 30 m width would be required to adequately mitigate 1% pesticide runoff from a 14 ha contributing area. Results of this experiment can be used to model future design specifications for constructed wetland mitigation of pyrethroid insecticides. - A wetland length of 215 m x 30 m mitigated pyrethroid runoff from a 14 ha field

[Research on evaluation of water quality of Beijing urban stormwater runoff].

Science.gov (United States)

Hou, Pei-Qiang; Ren, Yu-Fen; Wang, Xiao-Ke; Ouyang, Zhi-Yun; Zhou, Xiao-Ping

2012-01-01

The natural rainwater and stormwater runoff samples from three underlying surfaces (rooftop, campus road and ring road) were sampled and analyzed from July to October, 2010 in Beijing. Eight rainfall events were collected totally and thirteen water quality parameters were measured in each event. Grey relationship analysis and principal component analysis were applied to assess composite water quality and identify the main pollution sources of stormwater runoff. The results show that the composite water quality of ring road runoff is mostly polluted, and then is rooftop runoff, campus road runoff and rainwater, respectively. The composite water quality of ring road runoff is inferior to V class of surface water, while rooftop runoff, campus road runoff and rainwater are in II class of surface water. The mean concentration of TN and NH4(+)-N in rainwater and runoff is 5.49-11.75 mg x L(-1) and 2.90-5.67 mg x L(-1), respectively, indicating that rainwater and runoff are polluted by nitrogen (N). Two potential pollution sources are identified in ring road runoff: (1) P, SS and organic pollutant are possibly related to debris which is from vehicle tyre and material of ring road; (2) N and dissolved metal have relations with automobile exhaust emissions and bulk deposition.

Polluted Runoff: Nonpoint Source Pollution

Science.gov (United States)

Nonpoint Source (NPS) pollution is caused by rainfall or snowmelt moving over and through the ground, it picks up and carries natural and human-made pollutants, depositing them into lakes, rivers, wetlands, coastal waters and ground waters.

[Analysis of first flush effect of typical underlying surface runoff in Beijing urban city].

Science.gov (United States)

Ren, Yu-Fen; Wang, Xiao-Ke; Ouyang, Zhi-Yun; Hou, Pei-Qiang

2013-01-01

Rapid increase of the urban impervious underlying surfaces causes a great increase of urban runoff and the accumulation of pollutants on the roof and road surfaces brings many pollutants into the drainage system with the runoff, and it thus becomes a great threat to the urban water environment. To know the runoff pollution process and to build scientific basis for pollutant control, runoff processes from the roof and road surfaces were monitored and analyzed from 2004 to 2006, and the runoff EMC (Event Mean Concentration) was calculated. It was found that two types of runoff were seriously polluted by COD and TN. The COD and TN of roof runoff exceeded the fifth level of the surface water environmental quality standard (GB 3838-2002) by 3.64 and 4.80 times, respectively, and the COD and TN of road runoff exceeded by 3.73 and 1.07 times, respectively. M (V) curve was used to determine the relation between runoff volume and runoff pollution load. Various degrees of the first flush phenomenon were found for TSS, COD, TN and TP in roof runoff. But this phenomenon occurred only for TSS and TP of the road runoff, and on the whole it was not obvious. Properties of the underlying surfaces, rainfall intensity, and pollutant accumulation are all important factors affecting the roof and road runoff pollutant emission characteristics.

Satellite Remote Sensing Detection of Coastal Pollution in Southern California: Stormwater Runoff and Wastewater Plumes

Science.gov (United States)

Trinh, R. C.; Holt, B.; Gierach, M.

2016-02-01

Coastal pollution poses a major health and environmental hazard, not only for beach goers and coastal communities but for marine organisms as well. Stormwater runoff is the largest source of environmental pollution in coastal waters of the Southern California Bight (SCB) and is of great concern in increasingly urbanized areas. Buoyant wastewater plumes also pose a marine environmental risk. In this study we provide a comprehensive overview of satellite remote sensing capabilities in detecting buoyant coastal pollutants in the form of stormwater runoff and wastewater effluent. The SCB is the final destination of four major urban rivers that act as channels for runoff and pollution during and after rainstorms. We analyzed and compared sea surface roughness data from various Synthetic Aperture Radar (SAR) instruments to ocean color data from the Moderate Imaging System (MODIS) sensor on board the Aqua satellite and correlated the results with existing environmental data in order to create a climatology of naturally occurring stormwater plumes in coastal waters after rain events, from 1992 to 2014 from four major rivers in the area. Heat maps of the primary extent of stormwater plumes were constructed to specify areas that may be subject to the greatest risk of coastal contamination. In conjunction with our efforts to monitor coastal pollution and validate the abilities of satellite remote sensing, a recent Fall 2015 wastewater diversion from the City of Los Angeles Hyperion Treatment Plant (HTP) provided the opportunity to apply these remote sensing methodologies of plume detection to wastewater. During maintenance of their 5-mile long outfall pipe, wastewater is diverted to a shorter outfall pipe that terminates 1-mile offshore and in shallower waters. Sea surface temperature (SST), chlorophyll-a (chl-a) fluorescence, remote sensing reflectance and particulate backscatter signatures were analyzed from MODIS. Terra-ASTER and Landsat-8 thermal infrared data were also

Nonpoint source pollution of urban stormwater runoff: a methodology for source analysis.

Science.gov (United States)

Petrucci, Guido; Gromaire, Marie-Christine; Shorshani, Masoud Fallah; Chebbo, Ghassan

2014-09-01

The characterization and control of runoff pollution from nonpoint sources in urban areas are a major issue for the protection of aquatic environments. We propose a methodology to quantify the sources of pollutants in an urban catchment and to analyze the associated uncertainties. After describing the methodology, we illustrate it through an application to the sources of Cu, Pb, Zn, and polycyclic aromatic hydrocarbons (PAH) from a residential catchment (228 ha) in the Paris region. In this application, we suggest several procedures that can be applied for the analysis of other pollutants in different catchments, including an estimation of the total extent of roof accessories (gutters and downspouts, watertight joints and valleys) in a catchment. These accessories result as the major source of Pb and as an important source of Zn in the example catchment, while activity-related sources (traffic, heating) are dominant for Cu (brake pad wear) and PAH (tire wear, atmospheric deposition).

Run-off from roofs

International Nuclear Information System (INIS)

Roed, J.

1985-01-01

In order to find the run-off from roof material a roof has been constructed with two different slopes (30 deg C and 45 deg C). Beryllium-7 and caesium-137 has been used as tracers. Considering new roof material the pollution removed by runoff processes has been shown to be very different for various roof materials. The pollution is much more easily removed from silicon-treated material than from porous red-tile roof material. Caesium is removed more easily than beryllium. The content of caesium in old roof materials is greater in red-tile than in other less-porous materials. However, the measured removal from new material does not correspond to the amount accumulated in the old. This could be explained by weathering and by saturation effects. This last effect is probably the more important. The measurements on old material indicates a removal of 44-86% of the caesium pollution by run-off, whereas the measurement on new showed a removal of only 31-50%. It has been demonstrated that the pollution concentration in the run-off water could be very different from that in rainwater. The work was part of the EEC Radiation Protection Programme and done under a subcontract with Association Euratom-C.E.A. No. SC-014-BIO-F-423-DK(SD) under contract No. BIO-F-423-81-F. (author)

Urban Runoff: Getting to the Nonpoint

OpenAIRE

Pendall, Rolf

1994-01-01

Mandates for water-quality improvement have forced regulators and planners to confront the problem of urban runoff, still an important source of water pollution. This ar­ticle discusses those mandates and how to meet them, and provides examples of ongoing nonpoint water pollution control programs in the San Francisco Bay Area. These examples suggest that cleanup of urban runoff may require more comprehensive regional planning to encourage a de­velopment pattern conducive to pollution control.

Mitigation of two pyrethroid insecticides in a Mississippi Delta constructed wetland.

Science.gov (United States)

Moore, M T; Cooper, C M; Smith, S; Cullum, R F; Knight, S S; Locke, M A; Bennett, E R

2009-01-01

Constructed wetlands are a suggested best management practice to help mitigate agricultural runoff before entering receiving aquatic ecosystems. A constructed wetland system (180 m x 30 m), comprising a sediment retention basin and two treatment cells, was used to determine the fate and transport of simulated runoff containing the pyrethroid insecticides lambda-cyhalothrin and cyfluthrin, as well as suspended sediment. Wetland water, sediment, and plant samples were collected spatially and temporally over 55 d. Results showed 49 and 76% of the study's measured lambda-cyhalothrin and cyfluthrin masses were associated with vegetation, respectively. Based on conservative effects concentrations for invertebrates and regression analyses of maximum observed wetland aqueous concentrations, a wetland length of 215 m x 30 m width would be required to adequately mitigate 1% pesticide runoff from a 14 ha contributing area. Results of this experiment can be used to model future design specifications for constructed wetland mitigation of pyrethroid insecticides.

Response of soil microbial activity and biodiversity in soils polluted with different concentrations of cypermethrin insecticide.

Science.gov (United States)

Tejada, Manuel; García, Carlos; Hernández, Teresa; Gómez, Isidoro

2015-07-01

We performed a laboratory study into the effect of cypermethrin insecticide applied to different concentrations on biological properties in two soils [Typic Xerofluvent (soil A) and Xerollic Calciorthid (soil B)]. Two kg of each soil were polluted with cypermethrin at a rate of 60, 300, 600, and 1,200 g ha(-1) (C1, C2, C3, and C4 treatments). A nonpolluted soil was used as a control (C0 treatment). For all treatments and each experimental soil, soil dehydrogenase, urease, β-glucosidase, phosphatase, and arylsulphatase activities and soil microbial community were analysed by phospholipid fatty acids, which were measured at six incubation times (3, 7, 15, 30, 60, and 90 days). The behavior of the enzymatic activities and microbial population were dependent on the dose of insecticide applied to the soil. Compared with the C0 treatment, in soil A, the maximum inhibition of the enzymatic activities was at 15, 30, 45, and 90 days for the C1, C2, C3, and C4 treatments, respectively. However, in soil B, the maximum inhibition occurred at 7, 15, 30, and 45 days for the C1, C2, C3, and C4 treatments, respectively. These results suggest that the cypermethrin insecticide caused a negative effect on soil enzymatic activities and microbial diversity. This negative impact was greater when a greater dose of insecticide was used; this impact was also greater in soil with lower organic matter content. For both soils, and from these respective days onward, the enzymatic activities and microbial populations progressively increased by the end of the experimental period. This is possibly due to the fact that the insecticide or its breakdown products and killed microbial cells, subsequently killed by the insecticide, are being used as a source of energy or as a carbon source for the surviving microorganisms for cell proliferation.

[Output characteristics of rainfall runoff phosphorus pollution from a typical small watershed in Yimeng mountainous area].

Science.gov (United States)

Yu, Xing-xiu; Li, Zhen-wei; Liu, Qian-jin; Jing, Guang-hua

2012-08-01

Relationships between phosphorus pollutant concentrations and precipitation-runoff were analyzed by monitoring pollutant losses at outlets of the Menglianggu watershed in 2010. A typical small watershed was selected to examine the runoff and quality parameters such as total phosphorus (TP), particle phosphorus (PP), dissolve phosphorus (DP) and dissolve inorganic phosphorus (DIP) in rainfall-runoff of 10 rainfall events. Precipitation was above 2 mm for all the 10 rainfall events. The results showed that the peak of phosphorus concentrations occurred before the peak of water flows, whereas change processes of the phosphorus fluxes were consistent with that of the water flows and the phosphorus flux also have a strong linear relationship with the water flows. The minimums of the phosphorus concentrations in every 10 natural rainfall events have small differences with each other, but the maximum and EMCs of the phosphorus concentrations have significant differences with each rainfall event. This was mainly influenced by the precipitation, maximum rainfall intensity and mean rainfall intensity (EMCs) and was less influenced by rainfall duration. DP and TP were mainly composed of DIP and PP, respectively. There were no significant correlations between DIP/DP dynamic changes and rainfall characteristics, whereas significant correlations between PP/TP dynamic changes and maximum rainfall intensity were detected. The production of DIP, DP, AND TP were mainly influenced by the direct runoff (DR) and base flow (BF). The EMCs of DIP, DP, TP and the variations of DIP/DP were all found to have significant polynomial relationships with DR/TR., but the dynamic changes of PP/ TP and the EMCS of PP were less influenced by the DR/TR.

Characterizations of the first flush in storm water runoff from an urban roadway.

Science.gov (United States)

Lee, B C; Matsui, S; Shimizu, Y; Matsuda, T

2005-07-01

Storm water runoff from urban roadways contains anthropogenic pollutants, which are mainly generated from traffic-related activities. The purpose of this study was to evaluate the characteristics of pollutants from the roadway runoff as well as first flush effects. Storm water runoff was sampled during five storm events from the experimental site in Otsu, Shiga, Japan. From the hydrographs and pollutographs for the roadway runoff, the concentration of pollutants increased with increasing runoff flow in the low flow rate event, but did not significantly increase in the high flow rate event. Moreover, according to the analysis of cumulative pollutant mass versus runoff volume curves from five storm events, the first 50% of the runoff volume transported 62% of TOC and Mo, 60% of SS, 59% of Fe, Mn and Cu, 58% of Ni, 57% of Cd and Pb, 56% of Al, 55% of Zn, and 54% of Cr, as the mean values. The first 30% and 80% of the runoff volume also transported 34-43% mass of the pollutants and 82-88% mass of the pollutants, respectively. This study for storm water runoff may also provide useful information to correctly design treatment facilities, such as detention tanks and ponds, filtration and adsorption systems.

Evaluation of secondary environmental impacts of urban runoff pollution control

International Nuclear Information System (INIS)

Huibregtse, K.R.; Geinopolos, A.

1982-03-01

A generalized evaluation of the impacts associated with different urban stormwater runoff (UR) treatment techniques is presented. It addresses the definition of the problem, estimates the volume and characteristics of the UR and the sludges expected, evaluates six methods of UR sludge treatment, and examines alternatives and impacts for UR treatment sludge handling such as bleed/pump back to the dry weather plant, and land disposal. Regarding bleed/pump back of UR sludges, solids deposition in sewers and overload to the dry weather facilities are anticipated to cause problems. The most cost effective sludge treatment alternative appeared to be lime stabilization followed by thickening, pressure filter dewatering, and landfill disposal. Secondary impacts included costs, water quality, noise, energy consumption, air pollution, and land area requirements

Nano- and microparticles and associated pollutants in stormwater runoff: effects of disc filtration with and without flocculant addition

DEFF Research Database (Denmark)

Nielsen, Katrine; Mørch-Madsen, Andreas; Mikkelsen, Peter Steen

2014-01-01

Danish municipalities work towards separating stormwater and sewage. But stormwater runoff may be heavily polluted and therefore it is needed to find Best Available Technologies (BAT) to source separate and treat stormwater before discharge into surface waters. The aim here was to determine...... for treating stormwater runoff. The micro-sized particles were found to be mainly 2.1-19 μm in diameter and nano-sized particles were also observed (86-228 nm). Although the flocculant increased the observed volume of the micro-sized particles by 46%, the majority of the particles where still

Run-off from roofing materials

International Nuclear Information System (INIS)

Roed, J.

1985-01-01

In order to find the runn-off from roof material, a roof has been constructed with two different slopes (30 deg. and 45 deg.). 7 Be and 137 Cs have been used as tracers. Considering new roof material, the pollution removed by run-off processes has been shown to be very different for various roof materials. The pollution is much more easily removed from silicon-treated material than from porous red-tile roof material. Cesium is removed more easily than beryllium. The content of cesium in old roof materials is greater in red-tile than in other less porous roof materials. However, the measured removal from new material does not correspond to the amount accumulated in the old. This could be explained by weathering and by saturation effects. The last effect is probably the more important. The measurements on old material indicate a removal of 44-86% of cesium pollution by run-off, whereas the measurement on new material showed a removal of only 31-50%. It has been demonstrated that the pollution concentration in run-off water could be very different from that in rainwater

[Heavy metals pollution and analysis of seasonal variation runoff in Xi'an].

Science.gov (United States)

Yuan, Hong-Lin; Li, Xing-Yu; Wang, Xiao-Chang

2014-11-01

In order to explore heavy metals pollution situation,changes in characteristics, the correlation between each heavy mental and pollution source analysis of Xi'an various regions in different season in one year. This study collected several samples of Xi'an rainfall typical urban trunk roads throughout the year in 2013 and used inductively coupled plasma mass spectrometry (ICP-MS) to determine the level of Fe, Mn, Pb, Zn, Al, Cd of the samples, then, analyzed the seasonal change of heavy mental. Studies have shown that: the heavy metal of Xi'an road runoff pollutes seriously, the concentration of Fe over three times of the national standard and maintain the higher levels throughout the year, meanwhile the concentration with the intensity of human activities increases. The concentration of Mn and Zn in one year show a trends: winter > autumn > summer> spring. Pb concentration increases with the increase in traffic volume, while showing: winter > spring > summer > autumn. Factor analysis shows: Fe and Al was affected by the same sources-natural sources; Zn, Cd affected by anthropogenic sources of large; Mn, Pb affected by the larger traffic sources.

The effect of metal pollution on the life history and insecticide resistance phenotype of the major malaria vector Anopheles arabiensis (Diptera: Culicidae)

OpenAIRE

Oliver, Shüné V.; Brooke, Basil D.

2018-01-01

Metal exposure is one of the commonest anthropogenic pollutants mosquito larvae are exposed to, both in agricultural and urban settings. As members of the Anopheles gambiae complex, which contains several major malaria vector species including An. arabiensis, are increasingly adapting to polluted environments, this study examined the effects of larval metal exposure on various life history traits of epidemiological importance. Two laboratory strains of An. arabiensis, SENN (insecticide suscep...

[Research on stormwater runoff quality of mountain city by source area monitoring].

Science.gov (United States)

Li, Li-Qing; Shan, Bao-Qing; Zhao, Jian-Wei; Guo, Shu-Gang; Gao, Yong

2012-10-01

Stormwater runoff samples were collected from 10 source areas in Mountain City, Chongqing, during five rain events in an attempt to investigate the characteristics of runoff quality and influencing factors. The outcomes are expected to offer practical guidance of sources control of urban runoff pollution. The results indicated that the stormwater runoff of Mountain City presented a strong first flush for almost all events and constituents. The runoff quality indices were also influenced by the rainfall intensity. The concentration of TSS, COD, TN and TP decreased as the rainfall intensity increased. The concentrations of COD and TP in stormwater runoff were highly correlated with TSS concentrations. Suspended solid matter were not only the main pollutant of stormwater runoff but also served as the vehicle for transport of organic matter and phosphorus. Organic matter and phosphorus in stormwatrer runoff were mainly bound to particles, whereas nitrogen was predominantly dissolved, with ammonia and nitrate. A significant difference of stormwater runoff quality was observed among the ten monitored source areas. The highest magnitude of urban stormwater runoff pollution was expected in the commercial area and the first trunk road, followed by the minor road, residential area, parking lot and roof. Urban surface function, traffic volume, population density, and street sweeping practice are the main factors determining spatial differentiation of urban surface runoff quality. Commercial area, the first trunk road and residential area with high population density are the critical sources areas of urban stormwater runoff pollution.

[A review of green roof performance towards management of roof runoff].

Science.gov (United States)

Chen, Xiao-ping; Huang, Pei; Zhou, Zhi-xiang; Gao, Chi

2015-08-01

Green roof has a significant influence on reducing runoff volume, delaying runoff-yielding time, reducing the peak flow and improving runoff quality. This paper addressed the related research around the world and concluded from several aspects, i.e., the definition of green roof of different types, the mechanism how green roof manages runoff quantity and quality, the ability how green roof controls roof runoff, and the influence factors of green roof toward runoff quantity and quality. Afterwards, there was a need for more future work on research of green roof toward roof runoff, i.e., vegetation selection of green roof, efficient construction model selection of green roof, the regulating characteristics of green roof on roof runoff, the value assessment of green roof on roof runoff, analysis of source-sink function of green roof on the water pollutants of roof runoff and the research on the mitigation measures of roof runoff pollution. This paper provided a guideline to develop green roofs aiming to regulating roof runoff.

The Other Water Pollution

Science.gov (United States)

Barton, Kathy

1978-01-01

Nonpoint source pollution, water pollution not released at one specific identifiable point, now accounts for 50 percent of the nation's water pollution problem. Runoff is the primary culprit and includes the following sources: agriculture, mining, hydrologic modifications, and urban runoff. Economics, legislation, practices, and management of this…

Contaminants in urban runoff to Norwegian fjords

Energy Technology Data Exchange (ETDEWEB)

Jartun, Morten [Geological Survey of Norway, Trondheim (Norway); Pettersen, Arne [Norwegian Geotechnical Inst., Oslo (Norway)

2010-03-15

Introduction: Sediments from urban stormwater runoff have been collected and analyzed for the content of various contaminants in harbor areas of Harstad, Trondheim, Bergen, and Drammen, Norway. Materials and methods: The concentrations of polychlorinated biphenyls (PCBs), polycyclic aromatic hydrocarbons (PAHs), tributyltin, heavy metals, and total organic carbon were determined in most samples. This study provides substantial empirical data on the active, ongoing dispersion of pollutants from land-based sources in an urban area toward the marine environments in Norway. Results and discussion: The results of the analyses clearly demonstrate the importance of the urban environment representing a variety of contamination sources, and that stormwater runoff is an important dispersion mechanism of toxic pollutants. Conclusion: The concentrations of different contaminants in the urban runoff sediments show that there are several active pollution sources supplying the runoff systems with PCBs, PAHs (including benzo(a)pyrene, B(a)p), and heavy metals such as lead, mercury, zinc, and cadmium. This study describe the usefulness of the methods on how to examine ongoing urban contamination of harbors and similar recipients before any remediation plan for improving the environmental condition of marine sediments is effectuated. (orig.)

Critical review of heavy metal pollution of traffic area runoff: Occurrence, influencing factors, and partitioning

International Nuclear Information System (INIS)

Huber, Maximilian; Welker, Antje; Helmreich, Brigitte

2016-01-01

A dataset of 294 monitored sites from six continents (Africa, Asia, Australia, Europe, North and South America) was compiled and evaluated to characterize the occurrence and fate of heavy metals in eight traffic area categories (parking lots, bridges, and three types each of both roads and highways). In addition, site-specific (fixed and climatic) and method-specific (related to sample collection, preparation, and analysis) factors that influence the results of the studies are summarized. These factors should be considered in site descriptions, conducting monitoring programs, and implementing a database for further research. Historical trends for Pb show a sharp decrease during recent decades, and the median total Pb concentrations of the 21st century for North America and Europe are approximately 15 μg/L. No historical trend is detected for Zn. Zn concentrations are very variable in traffic area runoff compared with other heavy metals because of its presence in galvanized structures and crumbs of car tire rubber. Heavy metal runoff concentrations of parking lots differ widely according to their use (e.g., employee, supermarket, rest areas for trucks). Bridge deck runoff can contain high Zn concentrations from safety fences and galvanizing elements. Roads with more than 5000 vehicles per day are often more polluted than highways because of other site-specific factors such as traffic signals. Four relevant heavy metals (Zn, Cu, Ni, and Cd) can occur in the dissolved phase. Knowledge of metal partitioning is important to optimize stormwater treatment strategies and prevent toxic effects to organisms in receiving waters. - Highlights: • Heavy metal runoff concentrations in parking lots, bridges, and roads • Large dataset of dissolved and total metal concentrations in traffic area runoff • Description of site-specific and monitoring method-specific factors • Summary of traffic-related and anthropogenic heavy metals in road runoff • Reduction in Pb

Critical review of heavy metal pollution of traffic area runoff: Occurrence, influencing factors, and partitioning

Energy Technology Data Exchange (ETDEWEB)

Huber, Maximilian [Chair of Urban Water Systems Engineering, Technical University of Munich, Am Coulombwall 8, 85748 Garching (Germany); Welker, Antje [Fachgebiet Siedlungswasserwirtschaft und Hydromechanik, Frankfurt University of Applied Sciences, Nibelungenplatz 1, 60318 Frankfurt am Main (Germany); Helmreich, Brigitte, E-mail: b.helmreich@tum.de [Chair of Urban Water Systems Engineering, Technical University of Munich, Am Coulombwall 8, 85748 Garching (Germany)

2016-01-15

A dataset of 294 monitored sites from six continents (Africa, Asia, Australia, Europe, North and South America) was compiled and evaluated to characterize the occurrence and fate of heavy metals in eight traffic area categories (parking lots, bridges, and three types each of both roads and highways). In addition, site-specific (fixed and climatic) and method-specific (related to sample collection, preparation, and analysis) factors that influence the results of the studies are summarized. These factors should be considered in site descriptions, conducting monitoring programs, and implementing a database for further research. Historical trends for Pb show a sharp decrease during recent decades, and the median total Pb concentrations of the 21st century for North America and Europe are approximately 15 μg/L. No historical trend is detected for Zn. Zn concentrations are very variable in traffic area runoff compared with other heavy metals because of its presence in galvanized structures and crumbs of car tire rubber. Heavy metal runoff concentrations of parking lots differ widely according to their use (e.g., employee, supermarket, rest areas for trucks). Bridge deck runoff can contain high Zn concentrations from safety fences and galvanizing elements. Roads with more than 5000 vehicles per day are often more polluted than highways because of other site-specific factors such as traffic signals. Four relevant heavy metals (Zn, Cu, Ni, and Cd) can occur in the dissolved phase. Knowledge of metal partitioning is important to optimize stormwater treatment strategies and prevent toxic effects to organisms in receiving waters. - Highlights: • Heavy metal runoff concentrations in parking lots, bridges, and roads • Large dataset of dissolved and total metal concentrations in traffic area runoff • Description of site-specific and monitoring method-specific factors • Summary of traffic-related and anthropogenic heavy metals in road runoff • Reduction in Pb

Runoff quality and pollution loadings from a tropical urban catchment.

Science.gov (United States)

Yusop, Z; Tan, L W; Ujang, Z; Mohamed, M; Nasir, K A

2005-01-01

Runoff quality draining from 17.14 km2 urban catchment in Johor Bahru, Malaysia, was analysed. The land-use consists of residential (30.3%), agricultural (27.3%), open space (27.9%), industrial (8.1%) and commercial (6.4%) areas. Three storm events were sampled in detail. These storms produced stormflow between 0.84 mm and 27.82 mm, and peakflow from 2.19 m3/s to 42.36 m3/s. Water quality showed marked variation during storms especially for TSS, BOD and COD with maximum concentrations of 778 mg/l, 135 mg/l and 358 mg/l, respectively. Concentrations of TOC, DOC, NH3-N, Fe and level of colour were also high. In general, the river quality is badly polluted and falls in Class V based on the Malaysian Interim National Water Quality Standards. Event Mean Concentrations (EMC) for various parameters varied considerably between storms. The largest storm produced higher EMC for TSS, NO3-N and SS whereas the smaller storms tend to register higher EMC for BOD, COD, NH3-N, TOC, Ca, K, Mg, Fe and Zn. Such variations could be explained in terms of pollutant availability and the effects of flushing and dilution. Based on a three-month average recurrence interval (ARI) of rainfall, the estimated event loadings (ton/ha) of TSS, BOD, COD, TOC, NH3-N and NO3-N were 0.055, 0.016, 0.012, 0.039, 0.010, 0.0007 and 0.0002, respectively. Heavy metals present in trace quantities. Storms with 3 months ARI could capture about 70% of the total annual loads of major pollutants.

Pesticide runoff from energy crops: A threat to aquatic invertebrates?

Science.gov (United States)

Bunzel, Katja; Schäfer, Ralf B; Thrän, Daniela; Kattwinkel, Mira

2015-12-15

The European Union aims to reach a 10% share of biofuels in the transport sector by 2020. The major burden is most likely to fall on already established annual energy crops such as rapeseed and cereals for the production of biodiesel and bioethanol, respectively. Annual energy crops are typically cultivated in intensive agricultural production systems, which require the application of pesticides. Agricultural pesticides can have adverse effects on aquatic invertebrates in adjacent streams. We assessed the relative ecological risk to aquatic invertebrates associated with the chemical pest management from six energy crops (maize, potato, sugar beet, winter barley, winter rapeseed, and winter wheat) as well as from mixed cultivation scenarios. The pesticide exposure related to energy crops and cultivation scenarios was estimated as surface runoff for 253 small stream sites in Central Germany using a GIS-based runoff potential model. The ecological risk for aquatic invertebrates, an important organism group for the functioning of stream ecosystems, was assessed using acute toxicity data (48-h LC50 values) of the crustacean Daphnia magna. We calculated the Ecological Risk from potential Pesticide Runoff (ERPR) for all three main groups of pesticides (herbicides, fungicides, and insecticides). Our findings suggest that the crops potato, sugar beet, and rapeseed pose a higher ecological risk to aquatic invertebrates than maize, barley, and wheat. As maize had by far the lowest ERPR values, from the perspective of pesticide pollution, its cultivation as substrate for the production of the gaseous biofuel biomethane may be preferable compared to the production of, for example, biodiesel from rapeseed. Copyright © 2015 Elsevier B.V. All rights reserved.

Impact of Roadway Stormwater Runoff on Microbial Contamination in the Receiving Stream.

Science.gov (United States)

Wyckoff, Kristen N; Chen, Si; Steinman, Andrew J; He, Qiang

2017-09-01

Stormwater runoff from roadways has increasingly become a regulatory concern for water pollution control. Recent work has suggested roadway stormwater runoff as a potential source of microbial pollutants. The objective of this study was to determine the impact of roadway runoff on the microbiological quality of receiving streams. Microbiological quality of roadway stormwater runoff and the receiving stream was monitored during storm events with both cultivation-dependent fecal bacteria enumeration and cultivation-independent high-throughput sequencing techniques. Enumeration of total coliforms as a measure of fecal microbial pollution found consistently lower total coliform counts in roadway runoff than those in the stream water, suggesting that roadway runoff was not a major contributor of microbial pollutants to the receiving stream. Further characterization of the microbial community in the stormwater samples by 16S ribosomal RNA gene-based high-throughput amplicon sequencing revealed significant differences in the microbial composition of stormwater runoff from the roadways and the receiving stream. The differences in microbial composition between the roadway runoff and stream water demonstrate that roadway runoff did not appear to have a major influence on the stream in terms of microbiological quality. Thus, results from both fecal bacteria enumeration and high-throughput amplicon sequencing techniques were consistent that roadway stormwater runoff was not the primary contributor of microbial loading to the stream. Further studies of additional watersheds with distinct characteristics are needed to validate these findings. Understanding gained in this study could support the development of more effective strategies for stormwater management in sensitive watersheds. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

Residential runoff as a source of pyrethroid pesticides to urban creeks

Energy Technology Data Exchange (ETDEWEB)

Weston, D.P. [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Building, Berkeley, CA 94720-3140 (United States)], E-mail: dweston@berkeley.edu; Holmes, R.W. [Water Branch, California Department of Fish and Game, 830 S Street, Sacramento, CA 95811 (United States)], E-mail: rholmes@dfg.ca.gov; Lydy, M.J. [Fisheries and Illinois Aquaculture Center, Department of Zoology, Southern Illinois University, 171 Life Sciences II, Carbondale, IL 62901 (United States)], E-mail: mlydy@siu.edu

2009-01-15

Pyrethroid pesticides occur in urban creek sediments at concentrations acutely toxic to sensitive aquatic life. To better understand the source of these residues, runoff from residential neighborhoods around Sacramento, California was monitored over the course of a year. Pyrethroids were present in every sample. Bifenthrin, found at up to 73 ng/L in the water and 1211 ng/g on suspended sediment, was the pyrethroid of greatest toxicological concern, with cypermethrin and cyfluthrin of secondary concern. The bifenthrin could have originated either from use by consumers or professional pest controllers, though the seasonal pattern of discharge from the drain was more consistent with professional use as the dominant source. Stormwater runoff was more important than dry season irrigation runoff in transporting pyrethroids to urban creeks. A single intense storm was capable of discharging as much bifenthrin to an urban creek in 3 h as that discharged over 6 months of irrigation runoff. - Pyrethroid insecticides regularly detected in residential runoff at toxicologically significant concentrations.

Residential runoff as a source of pyrethroid pesticides to urban creeks

International Nuclear Information System (INIS)

Weston, D.P.; Holmes, R.W.; Lydy, M.J.

2009-01-01

Pyrethroid pesticides occur in urban creek sediments at concentrations acutely toxic to sensitive aquatic life. To better understand the source of these residues, runoff from residential neighborhoods around Sacramento, California was monitored over the course of a year. Pyrethroids were present in every sample. Bifenthrin, found at up to 73 ng/L in the water and 1211 ng/g on suspended sediment, was the pyrethroid of greatest toxicological concern, with cypermethrin and cyfluthrin of secondary concern. The bifenthrin could have originated either from use by consumers or professional pest controllers, though the seasonal pattern of discharge from the drain was more consistent with professional use as the dominant source. Stormwater runoff was more important than dry season irrigation runoff in transporting pyrethroids to urban creeks. A single intense storm was capable of discharging as much bifenthrin to an urban creek in 3 h as that discharged over 6 months of irrigation runoff. - Pyrethroid insecticides regularly detected in residential runoff at toxicologically significant concentrations

Ground water pollution by roof runoff infiltration evidenced with multi-tracer experiments.

Science.gov (United States)

Ammann, Adrian A; Hoehn, Eduard; Koch, Sabine

2003-03-01

The infiltration of urban roof runoff into well permeable subsurface material may have adverse effects on the ground water quality and endanger drinking water resources. Precipitation water from three different roofs of an industrial complex was channelled to a pit and infiltrated into a perialpine glaciofluvial gravel-and-sand aquifer. A shaft was constructed at the bottom of the pit and equipped with an array of TDR probes, lysimeters and suction cups that allowed measuring and sampling soil water at different depths. A fast infiltration flow was observed during natural rainfall events and during artificial infiltration experiments. For a better understanding of the behaviour of contaminants, experiments were conducted with cocktails of compounds of different reactivity (ammonium, strontium, atratone) and of non-reactive tracers (uranine, bromide, naphthionate), which represent different classes of pollutants. The experiment identified cation exchange reactions influencing the composition of the infiltrating water. These processes occurred under preferential flow conditions in macropores of the material. Measuring concentration changes under the controlled inflow of tracer experiments, the pollution potential was found to be high. Non-reactive tracers exhibited fast breakthrough and little sorption.

[Research on spatial differentiation of urban stormwater runoff quality by source area monitoring].

Science.gov (United States)

Li, Li-Qing; Zhu, Ren-Xiao; Guo, Shu-Gang; Yin, Cheng-Qing

2010-12-01

Runoff samples were collected from 14 source areas in Hanyang district during four rain events in an attempt to investigate the spatial differentiation and influencing factors of urban stormwater runoff quality. The outcomes are expected to offer practical guidance in sources control of urban runoff pollution. The results revealed that particle-bound proportion of chemical oxygen demand (COD), total nitrogen (TN), and total phosphorus (TP) in stormwater runoff were 58% +/- 17%, 65% +/- 13% and 92% +/- 6%, respectively. The fractions of ammonia, nitrate and dissolved organic nitrogen were homogeneous in dissolved nitrogen composition. Urban surface function, traffic volume, land use, population density, and street sweeping practice are the main factors determining spatial differentiation of urban surface runoff quality. The highest magnitude of urban stormwater runoff pollution was expected in the old urban residential area, followed by general residential with restaurants, commercial and transport area, new developments and green land. In addition, the magnitude of road stormwater runoff pollution is positively correlated to traffic volume, in the following order: the first trunk road > the second trunk road > minor road. Street sweeping and critical source areas controls should be implemented to mitigate the adverse effects of urban stormwater runoff on receive waters.

TREATMENT OF HEAVY METALS IN STORMWATER RUNOFF USING WET POND AND WETLAND MESOCOSMS

Science.gov (United States)

Urban stormwater runoff is being recognized as a major source of pollutants to receiving waters and a number of recent investigations have evaluated stormwater runoff quality and best management practices to minimize pollutant input to receiving waters. Particle-bound contaminant...

Snowmelt Runoff: A New Focus of Urban Nonpoint Source Pollution

OpenAIRE

Jiunian Guan; Baixing Yan; Hui Zhu; Yingying Xu

2012-01-01

Irregular precipitation associated with global climate change had been causing various problems in urban regions. Besides the runoff due to rainfall in summer, the snowmelt runoff in early spring could also play an important role in deteriorating the water quality of the receiving waters. Due to global climate change, the snowfall has increased gradually in individual regions, and snowstorms occur more frequently, which leads to an enhancement of snowmelt runoff flow during the melting season...

Efficiency of source control systems for reducing runoff pollutant loads: feedback on experimental catchments within Paris conurbation.

Science.gov (United States)

Bressy, Adèle; Gromaire, Marie-Christine; Lorgeoux, Catherine; Saad, Mohamed; Leroy, Florent; Chebbo, Ghassan

2014-06-15

Three catchments, equipped with sustainable urban drainage systems (SUDS: vegetated roof, underground pipeline or tank, swale, grassed detention pond) for peak flow mitigation, have been compared to a reference catchment drained by a conventional separate sewer system in terms of hydraulic behaviour and discharged contaminant fluxes (organic matter, organic micropollutants, metals). A runoff and contaminant emission model has been developed in order to overcome land use differences. It has been demonstrated that the presence of peak flow control systems induces flow attenuation even for frequent rain events and reduces water discharges at a rate of about 50% depending on the site characteristics. This research has also demonstrated that this type of SUDS contributes to a significant reduction of runoff pollutant discharges, by 20%-80%. This level of reduction varies depending on the considered contaminant and on the design of the drainage system but is mostly correlated with the decrease in runoff volume. It could be improved if the design of these SUDS focused not only on the control of exceptional events but also targeted more explicitly the interception of frequent rain events. Copyright © 2014 Elsevier Ltd. All rights reserved.

Pollution from Urban Runoff

DEFF Research Database (Denmark)

Hvitved-Jacobsen, Thorkild; Schaarup-Jensen, Kjeld

1992-01-01

The main idea of this paper is to establish the following facts: Biodegradable organic matter discharged from combined sewer overflows (CSO) gives rise to an acute effect on the dissolved oxygen (DO) concentration of a river. This acute effect consist of two subeffects: an immediate oxygen deplet...... depletion which takes place in the polluted water volume passing down the river, and a delayed oxygen depletion which is associated with degradation of the organic matter accumulated at the river bottom during the passage of the polluted water volume....

Modeling urban storm rainfall runoff from diverse underlying surfaces and application for control design in Beijing.

Science.gov (United States)

Ouyang, Wei; Guo, Bobo; Hao, Fanghua; Huang, Haobo; Li, Junqi; Gong, Yongwei

2012-12-30

Managing storm rainfall runoff is paramount in semi-arid regions with urban development. In Beijing, pollution prevention in urban storm runoff and storm water utilization has been identified as the primary strategy for urban water management. In this paper, we sampled runoff during storm rainfall events and analyzed the concentration of chemical oxygen demand (COD), total suspended solids (TSS) and total phosphorus (TP) in the runoff. Furthermore, the first flush effect of storm rainfall from diverse underlying surfaces was also analyzed. With the Storm Water Management Model (SWMM), the different impervious rates of underlying surfaces during the storm runoff process were expressed. The removal rates of three typical pollutants and their interactions with precipitation and underlying surfaces were identified. From these rates, the scenarios regarding the urban storm runoff pollution loading from different designs of underlying previous rates were assessed with the SWMM. First flush effect analysis showed that the first 20% of the storm runoff should be discarded, which can help in utilizing the storm water resource. The results of this study suggest that the SWMM can express in detail the storm water pollution patterns from diverse underlying surfaces in Beijing, which significantly affected water quality. The scenario analysis demonstrated that impervious rate adjustment has the potential to reduce runoff peak and decrease pollution loading. Copyright © 2012 Elsevier Ltd. All rights reserved.

Integrated solutions for urban runoff pollution control in Brazilian metropolitan regions.

Science.gov (United States)

Morihama, A C D; Amaro, C; Tominaga, E N S; Yazaki, L F O L; Pereira, M C S; Porto, M F A; Mukai, P; Lucci, R M

2012-01-01

One of the most important causes for poor water quality in urban rivers in Brazil is the low collection efficiency of the sewer system due to unforeseen interconnections with the stormwater drainage system. Since the beginning of the 20th century, Brazilian cities have adopted separate systems for sanitary sewers and stormwater runoff. Gradually these two systems became interconnected. A major challenge faced today by water managers in Brazil is to find efficient and low cost solutions to deal with this mixed system. The current situation poses an important threat to the improvement of the water quality in urban rivers and lakes. This article presents an evaluation of the water quality parameters and the diffuse pollution loads during rain events in the Pinheiros River, a tributary of the Tietê River in São Paulo. It also presents different types of integrated solutions for reducing the pollution impact of combined systems, based on the European experience in urban water management. An evaluation of their performance and a comparison with the separate system used in most Brazilian cities is also presented. The study is based on an extensive water quality monitoring program that was developed for a special investigation in the Pinheiros River and lasted 2.5 years. Samples were collected on a daily basis and water quality variables were analyzed on a daily, weekly or monthly basis. Two hundred water quality variables were monitored at 53 sampling points. During rain events, additional monitoring was carried out using an automated sampler. Pinheiros River is one of the most important rivers in the São Paulo Metropolitan Region and it is also a heavily polluted one.

The combined use of MODFLOW and precipitation-runoff modeling to simulate groundwater flow in a diffuse-pollution prone watershed.

Science.gov (United States)

Elçi, A; Karadaş, D; Fistikoğlu, O

2010-01-01

A numerical modeling case study of groundwater flow in a diffuse pollution prone area is presented. The study area is located within the metropolitan borders of the city of Izmir, Turkey. This groundwater flow model was unconventional in the application since the groundwater recharge parameter in the model was estimated using a lumped, transient water-budget based precipitation-runoff model that was executed independent of the groundwater flow model. The recharge rate obtained from the calibrated precipitation-runoff model was used as input to the groundwater flow model, which was eventually calibrated to measured water table elevations. Overall, the flow model results were consistent with field observations and model statistics were satisfactory. Water budget results of the model revealed that groundwater recharge comprised about 20% of the total water input for the entire study area. Recharge was the second largest component in the budget after leakage from streams into the subsurface. It was concluded that the modeling results can be further used as input for contaminant transport modeling studies in order to evaluate the vulnerability of water resources of the study area to diffuse pollution.

Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth.

Science.gov (United States)

David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

2013-02-19

The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments.

Urban Runoff: National Management Measures

Science.gov (United States)

This helps citizens and municipalities in urban areas protect bodies of water from polluted runoff . These scientifically sound techniques are the best practices known today. The guidance helps states to implement their nonpoint source control program.

Storm water runoff concentration matrix for urban areas

Science.gov (United States)

Göbel, P.; Dierkes, C.; Coldewey, W. G.

2007-04-01

The infrastructure (roads, sidewalk, commercial and residential structures) added during the land development and urbanisation process is designed to collect precipitation and convey it out of the watershed, typically in existing surface water channels, such as streams and rivers. The quality of surface water, seepage water and ground water is influenced by pollutants that collect on impervious surfaces and that are carried by urban storm water runoff. Heavy metals, e.g. lead (Pb), zinc (Zn), copper (Cu), cadmium (Cd), polycyclic aromatic hydrocarbons (PAH), mineral oil hydrocarbons (MOH) and readily soluble salts in runoff, contribute to the degradation of water. An intensive literature search on the distribution and concentration of the surface-dependent runoff water has been compiled. Concentration variations of several pollutants derived from different surfaces have been averaged. More than 300 references providing about 1300 data for different pollutants culminate in a representative concentration matrix consisting of medians and extreme values. This matrix can be applied to long-term valuations and numerical modelling of storm water treatment facilities.

Predicting nonpoint stormwater runoff quality from land use

Science.gov (United States)

2018-01-01

Evaluating the impact of urban development on natural ecosystem processes has become an increasingly complex task for planners, environmental scientists, and engineers. As the built environment continues to grow, unregulated nonpoint pollutants from increased human activity and large-scale development severely stress urban streams and lakes resulting in their currently impaired or degraded state. In response, integrated water quality management programs have been adopted to address these unregulated nonpoint pollutants by utilizing best management practices (BMPs) that treat runoff as close to the source as possible. Knowing where to install effective BMPs is no trivial task, considering budget constraints and the spatially extensive nature of nonpoint stormwater runoff. Accordingly, this paper presents an initial, straightforward and cost-effective methodology to identify critical nonpoint pollutant source watersheds through correlation of water quality with land use. Through an illustrative application to metropolitan Denver, Colorado, it is shown how this method can be used to aid stormwater professionals to evaluate and specify retrofit locations in need of water quality treatment features reduce, capture and treat stormwater runoff prior to entering receiving waters. PMID:29742172

A field study to evaluate the impact of different factors on the nutrient pollutant concentrations in green roof runoff.

Science.gov (United States)

Wang, Xiaochen; Zhao, Xinhua; Peng, Chenrui; Zhang, Xinbo; Wang, Jianghai

2013-01-01

The objectives of this study are to investigate the impact of different factors on the nutrient pollutant concentrations in green roof runoff and to provide reference data for the engineering design of dual substrate layer green roofs. The data were collected from eight different trays under three kinds of artificial rains. The results showed that except for total phosphorus, dual substrate layer green roofs behaved as a sink for most of the nutrient pollutants (significant at p green roof and the depth of the adsorption substrates. Compared with the influence of the substrates, the influence of the plant density and drainage systems was small.

Optimal pollution trading without pollution reductions

Science.gov (United States)

Many kinds of water pollution occur in pulses, e.g., agricultural and urban runoff. Ecosystems, such as wetlands, can serve to regulate these pulses and smooth pollution distributions over time. This smoothing reduces total environmental damages when “instantaneous” damages are m...

The quality and quantity of runoff and groundwater in two overburden dumps undergoing pyritic oxidation

International Nuclear Information System (INIS)

Daniel, J.A.; Harries, J.R.; Ritchie, A.I.M.

1983-01-01

The quality and quantity of runoff and seepage water from two waste rock dumps at the abandoned uranium mine at Rum Jungle, N.T., have been monitored over various time intervals since 1975. Both dumps contain pyrite which is oxidising and solubilising trace metals within the dumps. Results are presented for the quality and quantity of runoff from both dumps measured in the 1980-81 wet season. The rainfall/runoff characteristics of the two dumps measured during this wet season are similar and in good agreement with measurements made in previous wet seasons. Pollution loads in runoff were only a few per cent of pollution loads in water percolating through to the base of the dumps. The rainfall/runoff characteristics and the dominance of pollution loads in water percolating through the dumps are likely to apply to other similar waste rock dumps

Contributions of wastewater, runoff and sewer deposit erosion to wet weather pollutant loads in combined sewer systems.

Science.gov (United States)

Gasperi, J; Gromaire, M C; Kafi, M; Moilleron, R; Chebbo, G

2010-12-01

An observatory of urban pollutants was created in Paris for the purpose of assessing the dynamics of wastewater and wet weather flow (WW and WWF) pollutant loads within combined sewers. This observatory is composed of six urban catchments, covering land areas ranging in size from 42 ha to 2581 ha. For a wide array of parameters including total suspended solids (TSS), chemical and biochemical oxygen demand (COD and BOD(5)), total organic carbon (TOC), total Kjeldahl nitrogen (TKN), heavy metals (Cu and Zn) and polycyclic aromatic hydrocarbons (PAHs), this article is intended to evaluate the contributions of wastewater, runoff and in-sewer processes to WWF pollutant loads through the use of an entry-exit mass balance approach. To achieve this objective, a total of 16 rain events were sampled on these sites between May 2003 and February 2006. This study has confirmed that at the considered catchment scale (i.e. from 42 ha to 2581 ha) the production and transfer processes associated with WWF pollutant loads do not vary with basin scale. Entry-exit chemical mass balances over all catchments and for a large number of rain events indicate that wastewater constitutes the main source of organic and nitrogenous pollution, while runoff is the predominant source of Zn. For Cu, PAHs and TSS, the calculation underscores the major role played by in-sewer processes, specifically by sediment erosion, as a source of WWF pollution. A significant loss of dissolved metals was also observed during their transfer within the sewer network, likely as a consequence of the adsorption of dissolved metals on TSS and/or on sewer deposits. Moreover, the nature of eroded particles was examined and compared to the various sewer deposits. This comparison has highlighted that such particles exhibit similar organic and PAH contents to those measured in the organic layer, thus suggesting that the deposit eroded during a wet weather period is organic and of a nature comparable to the organic layer

Specifics of surface runoff contents and treatment in large cities

OpenAIRE

V.N. Chechevichkin; N.I. Vatin

2014-01-01

The degree of surface runoff pollution in large cities has been assessed in modern conditions in the case study of production sites of St. Petersburg. Increased content of petroleum derivatives and heavy metal ions both in rainwater runoff and especially in snowmelt runoff has been revealed. It has been established that the composition of infiltration runoff from the newly built-up sites within the city limits commonly depends on their background, especially in the places of former unaut...

Critical review of heavy metal pollution of traffic area runoff: Occurrence, influencing factors, and partitioning.

Science.gov (United States)

Huber, Maximilian; Welker, Antje; Helmreich, Brigitte

2016-01-15

A dataset of 294 monitored sites from six continents (Africa, Asia, Australia, Europe, North and South America) was compiled and evaluated to characterize the occurrence and fate of heavy metals in eight traffic area categories (parking lots, bridges, and three types each of both roads and highways). In addition, site-specific (fixed and climatic) and method-specific (related to sample collection, preparation, and analysis) factors that influence the results of the studies are summarized. These factors should be considered in site descriptions, conducting monitoring programs, and implementing a database for further research. Historical trends for Pb show a sharp decrease during recent decades, and the median total Pb concentrations of the 21st century for North America and Europe are approximately 15 μg/L. No historical trend is detected for Zn. Zn concentrations are very variable in traffic area runoff compared with other heavy metals because of its presence in galvanized structures and crumbs of car tire rubber. Heavy metal runoff concentrations of parking lots differ widely according to their use (e.g., employee, supermarket, rest areas for trucks). Bridge deck runoff can contain high Zn concentrations from safety fences and galvanizing elements. Roads with more than 5000 vehicles per day are often more polluted than highways because of other site-specific factors such as traffic signals. Four relevant heavy metals (Zn, Cu, Ni, and Cd) can occur in the dissolved phase. Knowledge of metal partitioning is important to optimize stormwater treatment strategies and prevent toxic effects to organisms in receiving waters. Copyright © 2015 Elsevier B.V. All rights reserved.

Characteristics of the event mean concentration (EMC) from rainfall runoff on an urban highway

International Nuclear Information System (INIS)

Lee, Ju Young; Kim, Hyoungjun; Kim, Youngjin; Han, Moo Young

2011-01-01

The purpose of this study was to investigate the characterization of the event mean concentration (EMC) of runoff during heavy precipitation events on highways. Highway runoff quality data were collected from the 7th highway, in South Korea during 2007-2009. The samples were analyzed for runoff quantity and quality parameters such as COD cr , TSS, TPHs, TKN, NO 3 , TP, PO 4 and six heavy metals, e.g., As, Cu, Cd, Ni, Pb and Zn. Analysis of resulting hydrographs and pollutant graphs indicates that the peak of the pollutant concentrations in runoff occurs 20 min after the first rainfall runoff occurrence. The first flush effect depends on the preceding dry period and the rainfall intensity. The results of this study can be used as a reference for water quality management of urban highways. - Research highlights: → Field test on urban highway were performed to 50 of 100 storm events for 3 years. → The peak pollutant concentrations occurs 20 min after the first runoff. → The first flush effect depends on the preceding dry period and rainfall intensity. → Relationship between runoff and event mean concentration for SS and COD. → A crest of the EMC by 70-80 m 3 /event and decreasing EMC after 70-80 m 3 /event. - This study investigate the characterization of the EMC of runoff during rainfall event on highway.

Treatment conditions for the removal of contaminants from road runoff

OpenAIRE

Hallberg, Magnus

2007-01-01

The pollutant load in road runoff is related to traffic densities and road maintenance activities. Inurbanised areas treatment of road runoff is common and often considered necessary. The pollutantsare partitioned between the particulate and dissolved matter. However, the contaminantstend to have an affinity to the particulate material. Sedimentation, the predominant treatmentmethod for road runoff uses various types of ponds. Design tools used for stormwater treatmentsystems are based on ext...

Urban Stormwater Runoff. Instructor Guide. Working for Clean Water: An Information Program for Advisory Groups.

Science.gov (United States)

Simko, Robert A.

Urban stormwater runoff collects pollutants from many parts of a city and is an important consideration in water quality planning. Presented is an instructor's guide for a learning session covering various aspects of urban runoff including pollutant sources, management practices, and regulatory programs. Intended for citizen advisory groups, this…

Heavy metal contamination in surface runoff sediments of the urban area of Vilnius, Lithuania

Directory of Open Access Journals (Sweden)

Gytautas Ignatavičius

2017-02-01

Full Text Available Surface runoff from urbanized territories carries a wide range of pollutants. Sediments in untreated runoff from direct discharge stormwater systems significantly contribute to urban waterway pollution. In this study, heavy metal (Pb, Zn, Cu, Cr, Ba, As and Fe contamination in surface runoff sediments of the urban area of the city of Vilnius was investigated. The surface runoff sediment samples were collected from seven dischargers with the highest volume rate of water flow and concentrations of suspended solids. The geospatial analysis of the distribution of heavy metals shows that there are several active pollution sources supplying the dischargers with contaminated sediments. Most of these areas are located in the central part of the city and in old town with intense traffic. Principal components analysis and t-test results clearly depicted the significantly different chemical compositions of winter and autumn surface sediment samples. The sampling approach and assessment of results provide a useful tool to examine the contamination that is generated in urban areas, distinguish pollution sources and give a better understanding of the importance of permeable surfaces and green areas.

Optimal Pollution Trading without Pollution Reductions : A Note

Science.gov (United States)

Many kinds of water pollution occur in pulses, e.g., agricultural and urban runoff. Ecosystems, such as wetlands, can serve to regulate these pulses and smooth pollution distributions over time. This smoothing reduces total environmental damages when “instantaneous” damages are m...

Distribution and toxicity of current-use insecticides in sediment of a lake receiving waters from areas in transition to urbanization

International Nuclear Information System (INIS)

Wang Jizhong; Li Huizhen; You Jing

2012-01-01

Current-use insecticides including organophosphate (OPs) and synthetic pyrethroid (SPs) insecticides were analyzed in 35 sediment samples collected from Chaohu Lake in China, where a transition from a traditional agricultural to a modern urbanized society is ongoing. Total concentrations of five OPs and eight SPs ranged from 0.029 to 0.681 ng/g dry weight and 0.016–301 ng/g dry weight, respectively. Toxic unit analysis showed that 13% of the sediment samples likely produced over 50% of the mortality for benthic invertebrates. Analysis also showed that cypermethrin was the principal contributor to the toxicity. Spatial distribution evaluation implied that OPs were mainly from non-point sources associated with agricultural activities. Conversely, SPs may have been derived from runoff of inflowing rivers through urban regions, as their concentrations were well-correlated with concentrations of other urban-oriented contaminants. - Highlights: ► Though lower than urban sites, pyrethroid insecticides in Chaohu Lake, China may cause toxicity to benthic invertebrates. ► Concentrations of pyrethroids were well correlated with those of other urban-oriented contaminants, e.g. PAHs and LABs. ► Spatial distribution showed urban runoff was the major source of pyrethroids deposited in the lake sediment. ► Conversely, organophosphate insecticides were mainly associated with agricultural non-point sources. - Evaluation of the distribution, potential toxicity, and input sources of organophosphate and pyrethroid insecticides in sediment from Chaohu Lake, China.

Frequency analysis of urban runoff quality in an urbanizing catchment of Shenzhen, China

Science.gov (United States)

Qin, Huapeng; Tan, Xiaolong; Fu, Guangtao; Zhang, Yingying; Huang, Yuefei

2013-07-01

This paper investigates the frequency distribution of urban runoff quality indicators using a long-term continuous simulation approach and evaluates the impacts of proposed runoff control schemes on runoff quality in an urbanizing catchment in Shenzhen, China. Four different indicators are considered to provide a comprehensive assessment of the potential impacts: total runoff depth, event pollutant load, Event Mean Concentration, and peak concentration during a rainfall event. The results obtained indicate that urban runoff quantity and quality in the catchment have significant variations in rainfall events and a very high rate of non-compliance with surface water quality regulations. Three runoff control schemes with the capacity to intercept an initial runoff depth of 5 mm, 10 mm, and 15 mm are evaluated, respectively, and diminishing marginal benefits are found with increasing interception levels in terms of water quality improvement. The effects of seasonal variation in rainfall events are investigated to provide a better understanding of the performance of the runoff control schemes. The pre-flood season has higher risk of poor water quality than other seasons after runoff control. This study demonstrates that frequency analysis of urban runoff quantity and quality provides a probabilistic evaluation of pollution control measures, and thus helps frame a risk-based decision making for urban runoff quality management in an urbanizing catchment.

Stormwater infiltration and surface runoff pollution reduction performance of permeable pavement layers.

Science.gov (United States)

Niu, Zhi-Guang; Lv, Zhi-Wei; Zhang, Ying; Cui, Zhen-Zhen

2016-02-01

In this paper, the laboratory-scale permeable pavement layers, including a surface permeable brick layer, coarse sand bedding layers (thicknesses = 2, 3.5, and 5 cm), and single-graded gravel sub-base layers (thicknesses = 15, 20, 25, and 30 cm), were built to evaluate stormwater infiltration and surface runoff pollution reduction performance. And, the infiltration rate (I) and concentrations of suspended solids (SS), total phosphorus (TP), chemical oxygen demand (COD), ammonia nitrogen, and total nitrogen (TN) were measured under the simulated rainfall intensity of 72.4 mm/h over duration of 60 min. The results indicate that the thickness factor primarily influences the infiltration rate and pollutant removal rate. The highest steady infiltration rate was for surface brick layer 51.0 mm/h, for 5-cm sand bedding layer 32.3 mm/h, and for 30-cm gravel sub-base layer 42.3 mm/h, respectively. The SS average removal rate was relative higher (79.8 ∼ 98.6 %) for all layers due to the interception and filtration. The average removal rates of TP and COD were for surface layer 71.2 and 24.1 %, for 5-cm bedding layer 54.8 and 9.0 %, and for 20-cm sub-base layer 72.2 and 26.1 %. Ammonia nitrogen and TN cannot steadily be removed by layers according to the experiment results. The optimal thickness of bedding sands was 5 cm, and that of sub-base gravels was 20 ∼ 30 cm.

Climate change, agricultural insecticide exposure, and risk for freshwater communities.

Science.gov (United States)

Kattwinkel, Mira; Kühne, Jan-Valentin; Foit, Kaarina; Liess, Matthias

2011-09-01

Climate change exerts direct effects on ecosystems but has additional indirect effects due to changes in agricultural practice. These include the increased use of pesticides, changes in the areas that are cultivated, and changes in the crops cultivated. It is well known that pesticides, and in particular insecticides, affect aquatic ecosystems adversely. To implement effective mitigation measures it is necessary to identify areas that are affected currently and those that will be affected in the future. As a consequence, we predicted potential exposure to insecticide (insecticide runoff potential, RP) under current conditions (1990) and under a model scenario of future climate and land use (2090) using a spatially explicit model on a continental scale, with a focus on Europe. Space-for-time substitution was used to predict future levels of insecticide application, intensity of agricultural land use, and cultivated crops. To assess the indirect effects of climate change, evaluation of the risk of insecticide exposure was based on a trait-based, climate-insensitive indicator system (SPEAR, SPEcies At Risk). To this end, RP and landscape characteristics that are relevant for the recovery of affected populations were combined to estimate the ecological risk (ER) of insecticides for freshwater communities. We predicted a strong increase in the application of, and aquatic exposure to, insecticides under the future scenario, especially in central and northern Europe. This, in turn, will result in a severe increase in ER in these regions. Hence, the proportion of stream sites adjacent to arable land that do not meet the requirements for good ecological status as defined by the EU Water Framework Directive will increase (from 33% to 39% for the EU-25 countries), in particular in the Scandinavian and Baltic countries (from 6% to 19%). Such spatially explicit mapping of risk enables the planning of adaptation and mitigation strategies including vegetated buffer strips and

Nitrogen and phosphorus associating with different size suspended solids in roof and road runoff in Beijing, China.

Science.gov (United States)

Wu, Junliang; Ren, Yufen; Wang, Xuemei; Wang, Xiaoke; Chen, Liding; Liu, Gangcai

2015-10-01

Roofs and roads, accounting for a large portion of the urban impervious land surface, have contributed significantly to urban nonpoint pollution. In this study, in Beijing, China, roof and road runoff are sampled to measure the suspended solids (SS), nitrogen (N), and phosphorus (P) contained in particles with different sizes. The SS content in the road runoff (151.59 mg/L) was sevenfold that in the roof runoff (21.13 mg/L, p runoff than in road runoff. The small particulates in the range of 0.45-50 μm consisted of 59 % SS in the roof runoff and 94 % SS in the road runoff. P was mainly attached to particle sizes of 10-50 μm in the roof (73 %) and road (48 %) runoffs, while N was mainly in a dissolved phase state in both runoffs. So, the different associations of N and P raise a challenge in preventing stormwater pollution in urban environments.

[Monitoring and analysis on evolution process of rainfall runoff water quality in urban area].

Science.gov (United States)

Dong, Wen; Li, Huai-En; Li, Jia-Ke

2013-02-01

In order to find the water quality evolution law and pollution characteristics of the rainfall runoff from undisturbed to the neighborhood exit, 6 times evolution process of rainfall runoff water quality were monitored and analyzed from July to October in 2011, and contrasted the clarification efficiency of the grassland to the roof runoff rudimentarily at the same time. The research showed: 1. the results of the comparison from "undisturbed, rainfall-roof, rainfall runoff-road, rainfall-runoff the neighborhood exit runoff " showed that the water quality of the undisturbed rain was better than that from the roof and the neighborhood exist, but the road rainfall runoff water quality was the worst; 2. the average concentrations of the parameters such as COD, ammonia nitrogen and total nitrogen all exceeded the Fifth Class of the Surface Water Quality Standard except for the soluble total phosphorus from undisturbed rainfall to the neighborhood exit; 3. the runoff water quality of the short early fine days was better than that of long early fine days, and the last runoff water quality was better than that of the initial runoff in the same rainfall process; 4. the concentration reduction of the grassland was notable, and the reduction rate of the grassland which is 1.0 meter wide of the roof runoff pollutants such as COD and nitrogen reached 30%.

Modeling Ballasted Tracks for Pollutants

Science.gov (United States)

2012-08-01

In this study, the Regional Transportation Districts (RTDs) light rail operations were examined for pollutant production and runoff. To : accomplish this, a laboratory study utilizing a rainfall-runoff facility was conducted. Input to this labo...

Environmental insecticide residues from tsetse fly control measures in Uganda

International Nuclear Information System (INIS)

Sserunjoji-Sebalija, J.

1976-01-01

Up to June 1974 areas in Uganda totalling 8600km 2 have been successfully reclaimed from tsetse fly infestation by ground spray of 3% dieldrin water emulsions. A search for equally effective but less persistent and toxic compounds against tsetse flies has been unsuccessful. Fourteen insecticide formulations have been tested for their persistence on tree bark surfaces and, therefore, their availability and toxicity to the target tsetse flies. Only those compounds with a high immediate insecticidal activity (some higher than dieldrin) like endosulfan, Chlorfenvinphos and propoxur could merit further consideration in tsetse control. While some were toxic to tsetse as fresh deposits, they lacked sufficient persistence. A study of the environmental implication from the continued use of the highly persistent and toxic dieldrin has provided useful data on residues likely to be found both in terrestrial and aquatic fauna and flora. These are generally low. Moreover, there is evidence of degradation in some fish species (Protopterus aethiopicus and Clarias). Also, dilution factors and adsorption involving the muddy nature of water run-off, etc., and controlled burning of grasses after tsetse eradication would tend to inactivate the residual insecticide and protect aquatic systems. The general findings have indicated less risk than anticipated of the environmental contamination from tsetse control by application of persistent and toxic insecticides. (author)

Experimental study on soluble chemical transfer to surface runoff from soil.

Science.gov (United States)

Tong, Juxiu; Yang, Jinzhong; Hu, Bill X; Sun, Huaiwei

2016-10-01

Prevention of chemical transfer from soil to surface runoff, under condition of irrigation and subsurface drainage, would improve surface water quality. In this paper, a series of laboratory experiments were conducted to assess the effects of various soil and hydraulic factors on chemical transfer from soil to surface runoff. The factors include maximum depth of ponding water on soil surface, initial volumetric water content of soil, depth of soil with low porosity, type or texture of soil and condition of drainage. In the experiments, two soils, sand and loam, mixed with different quantities of soluble KCl were filled in the sandboxes and prepared under different initial saturated conditions. Simulated rainfall induced surface runoff are operated in the soils, and various ponding water depths on soil surface are simulated. Flow rates and KCl concentration of surface runoff are measured during the experiments. The following conclusions are made from the study results: (1) KCl concentration in surface runoff water would decrease with the increase of the maximum depth of ponding water on soil surface; (2) KCl concentration in surface runoff water would increase with the increase of initial volumetric water content in the soil; (3) smaller depth of soil with less porosity or deeper depth of soil with larger porosity leads to less KCl transfer to surface runoff; (4) the soil with finer texture, such as loam, could keep more fertilizer in soil, which will result in more KCl concentration in surface runoff; and (5) good subsurface drainage condition will increase the infiltration and drainage rates during rainfall event and will decrease KCl concentration in surface runoff. Therefore, it is necessary to reuse drained fertile water effectively during rainfall, without polluting groundwater. These study results should be considered in agriculture management to reduce soluble chemical transfer from soil to surface runoff for reducing non-point sources pollution.

The effect of different surface materials on runoff quality in permeable pavement systems.

Science.gov (United States)

Li, Haiyan; Li, Zhifei; Zhang, Xiaoran; Li, Zhuorong; Liu, Dongqing; Li, Tanghu; Zhang, Ziyang

2017-09-01

To investigate the effect of different permeable pavement surface materials on the removal of pollutants from urban storm-runoff, six commonly surface materials (porous asphalt, porous concrete, cement brick, ceramic brick, sand base brick, and shale brick) were selected in this study and the research was carried out by column experiments. Except the concentrations of total suspended solids (TSS), chemical oxygen demand (COD), ammonia nitrogen (NH 4 -N), nitrate nitrogen (NO 3 -N), total nitrogen (TN), and total phosphorus (TP) in the influent and effluent that were measured, the removal mechanism of pollutants was discussed further. The results indicate that the surface materials influence the removal efficiency of pollutants greatly and have different effects on certain pollutant. Furthermore, the physical interception and adsorption would be the main mechanism for the removal of pollutants from runoff. For example, for all surface materials, the average removal efficiency of TSS is nearly about 90.0% because of physical interception. Due to the amount of iron oxide, the removal efficiency of COD, NO 3 -N, and TN of shale brick was 88.2, 35.1, and 17.5%, respectively. NH 4 -N and TN can be easily removed by porous asphalt due to the high content of organic matter. By lacking of useful adsorption sites, all the surface materials had little effect on the removal of TP from runoff. This research could offer useful guidelines for the better design of permeable pavement system and promote the insight into the removal mechanism of pollutants in permeable pavement system. Graphical abstract Different types of materials for the different types of pollutants in the runoff purification capacity were significantly different, overall, shale brick and porous asphalt Shale bricks and porous asphalt have a better purification effect according to the six kinds of materials.

Enrichment behavior and transport mechanism of soil-bound PAHs during rainfall-runoff events

International Nuclear Information System (INIS)

Zheng Yi; Luo Xiaolin; Zhang Wei; Wu Bin; Han Feng; Lin Zhongrong; Wang Xuejun

2012-01-01

Polycyclic Aromatic Hydrocarbons (PAHs) transported by surface runoff result in nonpoint source pollution and jeopardize aquatic ecosystems. The transport mechanism of PAHs during rainfall-runoff events has been rarely studied regarding pervious areas. An experimental system was setup to simulate the runoff pollution process on PAHs-contaminated soil. The enrichment behavior of soil-bound PAHs was investigated. The results show that soil organic matters (SOM), rather than clay particles, seem to be the main carrier of PAHs. The enrichment is highly conditioned on runoff and erosion processes, and its magnitude varies among PAH compounds. It is not feasible to build a simple and universal relationship between enrichment ratio and sediment discharge following the traditional enrichment theory. To estimate the flux of PAHs from pervious areas, soil erosion process has to be clearly understood, and both organic carbon content and composition of SOM should be factored into the calculation. - Highlights: ► Significant enrichment of particle-bound PAHs during rainfall-runoff events. ► Organic matters as the direct carrier of PAHs in runoff from contaminated soil. ► The traditional enrichment theory is not fully valid for PAHs. - The traditional enrichment theory is not fully valid for PAHs, and soil organic matters have a significant impact on the transport of PAHs during rainfall-runoff events.

Depuration of highway runoff water into grass-covered embankments.

Science.gov (United States)

Boivin, P; Saadé, M; Pfeiffer, H R; Hammecker, C; Degoumois, Y

2008-06-01

The management of polluted road runoff water is an important issue in environmental protection. A strategy could be to perform local depuration by infiltration into the soils of the embankment, but knowledge for designing such systems is lacking. This study aims at discussing the relevant soil properties, by estimating the long-term depuration of road runoff water infiltrating into the sandy soil embankment of the A9 highway in Wallis, Switzerland. This was done by estimating the heavy metals (HM) mass balance of two sites 23 and 12 years old, respectively. The accumulated HM were estimated by soil and GB analyses. The HM input was estimated by average water quality and traffic. The results were discussed using two-dimensional simulation of infiltration and a 14 months in situ monitoring of the runoff from the pavement to the embankment and at the bottom of the embankment. The soil properties were appropriate for both small particle adsorption and filtration. A good match between input and stored pollutant charges was found, and the HM profiles accorded well with infiltration simulation and monitoring results, which showed that 80-100% of the runoff water infiltrated into the embankment. Replacement of the cracked concrete gutters by an infiltration channel made of similar soil is recommended. These results oppose the Swiss guidelines for road-polluted water infiltration, as much more clayey soils are recommended. These later soils are difficult to find in Switzerland, and may allow for preferential flow through macro pores, in contrast to the studied site.

Mineral Adsorbents for Removal of Metals in Urban Runoff

Science.gov (United States)

Bjorklund, Karin; Li, Loretta

2014-05-01

The aim of this research was to determine the capacity of four different soil minerals to adsorb metals frequently detected in urban runoff. These are low-cost, natural and commercially available soil minerals. Contaminated surface runoff from urban areas is a major cause of concern for water quality and aquatic ecosystems worldwide. Pollution in urban areas is generated by a wide array of non-point sources, including vehicular transportation and building materials. Some of the most frequently detected pollutants in urban runoff are metals. Exhaust gases, tire wear and brake linings are major sources of such metals as Pb, Zn and Cu, while impregnated wood, plastics and galvanized surfaces may release As, Cd, Cr and Zn. Many metals have toxic effects on aquatic plants and animals, depending on metal speciation and bioavailability. The removal efficiency of pollutants in stormwater depends on treatment practices and on the properties the pollutant. The distribution of metals in urban runoff has shown, for example, that Pb is predominantly particle-associated, whereas Zn and Cd are present mainly in dissolved form. Many metals are also attached to colloids, which may act as carriers for contaminants, thereby facilitating their transport through conventional water treatment processes. Filtration of stormwater is one of the most promising techniques for removal of particulates, colloidal and truly dissolved pollutants, provided that effective filtration and adsorption media are used. Filtration and infiltration are used in a wide array of stormwater treatment methods e.g. porous paving, infiltration drains and rain gardens. Several soil minerals were investigated for their potential as stormwater filter materials. Laboratory batch tests were conducted to determine the adsorption capacity of these minerals. A synthetic stormwater was tested, with spiked concentrations corresponding to levels reported in urban runoff, ranging from 50-1,500 µg/L for Zn; 5-250 µg/L for Cu

Ecosystem Effects from Nutrient and Pesticide Pollutants: Catchment Care as a Solution

Directory of Open Access Journals (Sweden)

Kathleen H Bowmer

2013-09-01

Full Text Available Agricultural chemicals include fertilisers (nitrogen and phosphorus and biocides (herbicides, fungicides and insecticides. Environmental impacts in surface waters include algal blooms and disruption to ecological function. Strategies for protection of rivers from eutrophication include improved agricultural land management, conservation farming methods, recycling or retention of drainage and runoff water, and use of buffer strips and riparian vegetation for filtration. Reduction in pesticide use has been achieved by improved application technologies, precision farming, adoption of organic farming, and use of biological control methods. Australian river health audits show widespread deterioration, and protection using the “Polluter Pays Principle” is attractive. However, who should pay for environmental assessment, for adoption of new technologies or change in land use, and how will this be determined? Unfortunately, as demonstrated in two case studies on algal blooms and cotton pesticides, the links between pollutant source and environmental impact remain poorly understood, and the complexity of assessing environmental benefit of agricultural changes makes sheeting home the costs of pollution sources difficult. Alternatives to imposition of penalties include catchment-based targets and guidelines, benchmarking, and adoption of best management practice with an emphasis on incentives and encouragement. Many strategies for risk reduction in agricultural cropping systems are available for inclusion in a “Catchment Care” approach.

Untreated runoff quality from roof and road surfaces in a low intensity rainfall climate.

Science.gov (United States)

Charters, Frances J; Cochrane, Thomas A; O'Sullivan, Aisling D

2016-04-15

Sediment and heavy metals in stormwater runoff are key pollutants of urban waterways, and their presence in stormwater is driven by climatic factors such as rainfall intensity. This study describes the total suspended solids (TSS) and heavy metal concentrations found in runoff from four different urban surfaces within a residential/institutional catchment, in a climate where rainfall is typically of low intensity (runoff quality from a compilation of international studies. The road runoff had the highest TSS concentrations, while copper and galvanized roof runoff had the highest copper and zinc concentrations, respectively. Pollutant concentrations were found to be significantly different between surfaces; quantification and prediction of pollutant contributions from urban surfaces should thus take account of the different surface materials, instead of being aggregated into more generalized categories such as land use. The TSS and heavy metal concentrations were found to be at the low to medium end of ranges observed internationally, except for total copper and zinc concentrations generated by dissolution of copper and galvanized roofing material respectively; these concentrations were at least as high as those reported internationally. TSS wash-off from the roofs was seen to be a source-limited process, where all available TSS is washed off during the rain event despite the low intensity rainfall, whereas both road TSS and heavy metals wash-off from roof and road surfaces appeared to all be transport-limited and therefore some carryover of pollutants occurs between rain events. A first flush effect was seen from most surfaces for TSS, but not for heavy metals. This study demonstrates that in low intensity rainfall climates, quantification of untreated runoff quality from key individual surface types in a catchment are needed to enable development of targeted and appropriately sized stormwater treatment systems. Copyright © 2016 Elsevier B.V. All rights reserved.

Pyrethroid insecticides in urban salmon streams of the Pacific Northwest

Energy Technology Data Exchange (ETDEWEB)

Weston, D.P., E-mail: dweston@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Asbell, A.M., E-mail: aasbell@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Hecht, S.A., E-mail: scott.hecht@noaa.gov [NOAA Fisheries, Office of Protected Resources, 510 Desmond Drive S.E., Lacey, WA 98503 (United States); Scholz, N.L., E-mail: nathaniel.scholz@noaa.gov [NOAA Fisheries, Northwest Fisheries Science Center, 2725 Montlake Blvd. E., Seattle, WA 98112 (United States); Lydy, M.J., E-mail: mlydy@siu.edu [Fisheries and Illinois Aquaculture Center and Department of Zoology, Southern Illinois University, 171 Life Sciences II, Carbondale, IL 62901 (United States)

2011-10-15

Urban streams of the Pacific Northwest provide spawning and rearing habitat for a variety of salmon species, and food availability for developing salmon could be adversely affected by pesticide residues in these waterbodies. Sediments from Oregon and Washington streams were sampled to determine if current-use pyrethroid insecticides from residential neighborhoods were reaching aquatic habitats, and if they were at concentrations acutely toxic to sensitive invertebrates. Approximately one-third of the 35 sediment samples contained measurable pyrethroids. Bifenthrin was the pyrethroid of greatest concern with regards to aquatic life toxicity, consistent with prior studies elsewhere. Toxicity to Hyalella azteca and/or Chironomus dilutus was found in two sediment samples at standard testing temperature (23 deg. C), and in one additional sample at a more environmentally realistic temperature (13 deg. C). Given the temperature dependency of pyrethroid toxicity, low temperatures typical of northwest streams can increase the potential for toxicity above that indicated by standard testing protocols. - Highlights: > Salmon-bearing creeks can be adversely impacted by insecticides from urban runoff. > Pyrethroid insecticides were found in one-third of the creeks in Washington and Oregon. > Two creeks contained concentrations acutely lethal to sensitive invertebrates. > Bifenthrin was of greatest concern, though less than in prior studies. > Standard toxicity testing underestimates the ecological risk of pyrethroids. - Pyrethroid insecticides are present in sediments of urban creeks of Oregon and Washington, though less commonly than in studies elsewhere in the U.S.

Pyrethroid insecticides in urban salmon streams of the Pacific Northwest

International Nuclear Information System (INIS)

Weston, D.P.; Asbell, A.M.; Hecht, S.A.; Scholz, N.L.; Lydy, M.J.

2011-01-01

Urban streams of the Pacific Northwest provide spawning and rearing habitat for a variety of salmon species, and food availability for developing salmon could be adversely affected by pesticide residues in these waterbodies. Sediments from Oregon and Washington streams were sampled to determine if current-use pyrethroid insecticides from residential neighborhoods were reaching aquatic habitats, and if they were at concentrations acutely toxic to sensitive invertebrates. Approximately one-third of the 35 sediment samples contained measurable pyrethroids. Bifenthrin was the pyrethroid of greatest concern with regards to aquatic life toxicity, consistent with prior studies elsewhere. Toxicity to Hyalella azteca and/or Chironomus dilutus was found in two sediment samples at standard testing temperature (23 deg. C), and in one additional sample at a more environmentally realistic temperature (13 deg. C). Given the temperature dependency of pyrethroid toxicity, low temperatures typical of northwest streams can increase the potential for toxicity above that indicated by standard testing protocols. - Highlights: → Salmon-bearing creeks can be adversely impacted by insecticides from urban runoff. → Pyrethroid insecticides were found in one-third of the creeks in Washington and Oregon. → Two creeks contained concentrations acutely lethal to sensitive invertebrates. → Bifenthrin was of greatest concern, though less than in prior studies. → Standard toxicity testing underestimates the ecological risk of pyrethroids. - Pyrethroid insecticides are present in sediments of urban creeks of Oregon and Washington, though less commonly than in studies elsewhere in the U.S.

Stormwater Management: Calculation of Traffic Area Runoff Loads and Traffic Related Emissions

Directory of Open Access Journals (Sweden)

Maximilian Huber

2016-07-01

Full Text Available Metals such as antimony, cadmium, chromium, copper, lead, nickel, and zinc can be highly relevant pollutants in stormwater runoff from traffic areas because of their occurrence, toxicity, and non-degradability. Long-term measurements of their concentrations, the corresponding water volumes, the catchment areas, and the traffic volumes can be used to calculate specific emission loads and annual runoff loads that are necessary for mass balances. In the literature, the annual runoff loads are often specified by a distinct catchment area (e.g., g/ha. These loads were summarized and discussed in this paper for all seven metals and three types of traffic areas (highways, parking lots, and roads; 45 sites. For example, the calculated median annual runoff loads of all sites are 355 g/ha for copper, 110 g/ha for lead (only data of the 21st century, and 1960 g/ha for zinc. In addition, historical trends, annual variations, and site-specific factors were evaluated for the runoff loads. For Germany, mass balances of traffic related emissions and annual heavy metal runoff loads from highways and total traffic areas were calculated. The influences on the mass fluxes of the heavy metal emissions and the runoff pollution were discussed. However, a statistical analysis of the annual traffic related metal fluxes, in particular for different traffic area categories and land uses, is currently not possible because of a lack of monitoring data.

Enrichment behavior and transport mechanism of soil-bound PAHs during rainfall-runoff events.

Science.gov (United States)

Zheng, Yi; Luo, Xiaolin; Zhang, Wei; Wu, Bin; Han, Feng; Lin, Zhongrong; Wang, Xuejun

2012-12-01

Polycyclic Aromatic Hydrocarbons (PAHs) transported by surface runoff result in nonpoint source pollution and jeopardize aquatic ecosystems. The transport mechanism of PAHs during rainfall-runoff events has been rarely studied regarding pervious areas. An experimental system was setup to simulate the runoff pollution process on PAHs-contaminated soil. The enrichment behavior of soil-bound PAHs was investigated. The results show that soil organic matters (SOM), rather than clay particles, seem to be the main carrier of PAHs. The enrichment is highly conditioned on runoff and erosion processes, and its magnitude varies among PAH compounds. It is not feasible to build a simple and universal relationship between enrichment ratio and sediment discharge following the traditional enrichment theory. To estimate the flux of PAHs from pervious areas, soil erosion process has to be clearly understood, and both organic carbon content and composition of SOM should be factored into the calculation. Copyright © 2012 Elsevier Ltd. All rights reserved.

UV light and urban pollution: bad cocktail for mosquitoes?

Science.gov (United States)

Tetreau, Guillaume; Chandor-Proust, Alexia; Faucon, Frédéric; Stalinski, Renaud; Akhouayri, Idir; Prud'homme, Sophie M; Régent-Kloeckner, Myriam; Raveton, Muriel; Reynaud, Stéphane

2014-01-01

Mosquito breeding sites consist of water pools, which can either be large open areas or highly covered ponds with vegetation, thus with different light exposures combined with the presence in water of xenobiotics including polycyclic aromatic hydrocarbons (PAHs) generated by urban pollution. UV light and PAHs are abiotic factors known to both affect the mosquito insecticide resistance status. Nonetheless, their potential combined effects on the mosquito physiology have never been investigated. The present article aims at describing the effects of UV exposure alongside water contamination with two major PAH pollutants (fluoranthene and benzo[a]pyrene) on a laboratory population of the yellow fever mosquito Aedes aegypti. To evaluate the effects of PAH exposure and low energetic UV (UV-A) irradiation on mosquitoes, different parameters were measured including: (1) The PAH localization and its impact on cell mortality by fluorescent microscopy; (2) The detoxification capacities (cytochrome P450, glutathione-S-transferase, esterase); (3) The responses to oxidative stress (Reactive Oxygen Species-ROS) and (4) The tolerance of mosquito larvae to a bioinsecticide (Bacillus thuringiensis subsp. israelensis-Bti) and to five chemical insecticides (DDT, imidacloprid, permethrin, propoxur and temephos). Contrasting effects regarding mosquito cell mortality, detoxification and oxidative stress were observed as being dependent on the pollutant considered, despite the fact that the two PAHs belong to the same family. Moreover, UV is able to modify pollutant effects on mosquitoes, including tolerance to three insecticides (imidacloprid, propoxur and temephos), cell damage and response to oxidative stress. Taken together, our results suggest that UV and pollution, individually or in combination, are abiotic parameters that can affect the physiology and insecticide tolerance of mosquitoes; but the complexity of their direct effect and of their interaction will require further

Runoff and degradation of aerially applied dinotefuran in paddy fields and river.

Science.gov (United States)

Yokoyama, Sayako; Ito, Masataka; Nagasawa, Shunsuke; Morohashi, Masayuki; Ohno, Masaki; Todate, Yukitaka; Kose, Tomohiro; Kawata, Kuniaki

2015-06-01

Variation, run-off and degradation characteristics of the insecticide dinotefuran, (EZ)-(RS)-1-methyl-2-nitro-3-(tetrahydro-3-furyl-methyl)guanidine, in water and soil from two paddy fields after aerial application was investigated as well as in river water. Maximum concentrations of dinotefuran were 290 and 720 µg/L in the two paddy waters, 25 and 28 µg/kg dry in the two paddy soils, and 10 µg/L in the river water. Runoff ratios of dinotefuran from the paddy fields were calculated as 14%-41%. Mean half-lives of dinotefuran were 5.4 days in the paddy water and 12 days in the paddy soil. Results obtained in this study are important for the evaluation of the actual behavior of dinotefuran in paddy fields and rivers.

Development of urban runoff model FFC-QUAL for first-flush water-quality analysis in urban drainage basins.

Science.gov (United States)

Hur, Sungchul; Nam, Kisung; Kim, Jungsoo; Kwak, Changjae

2018-01-01

An urban runoff model that is able to compute the runoff, the pollutant loadings, and the concentrations of water-quality constituents in urban drainages during the first flush was developed. This model, which is referred to as FFC-QUAL, was modified from the existing ILLUDAS model and added for use during the water-quality analysis process for dry and rainy periods. For the dry period, the specifications of the coefficients for the discharge and water quality were used. During rainfall, we used the Clark and time-area methods for the runoff analyses of pervious and impervious areas to consider the effects of the subbasin shape; moreover, four pollutant accumulation methods and the washoff equation for computing the water quality each time were used. According to the verification results, FFC-QUAL provides generally similar output as the measured data for the peak flow, total runoff volume, total loadings, peak concentration, and time of peak concentration for three rainfall events in the Gunja subbasin. In comparison with the ILLUDAS, SWMM, and MOUSE models, there is little difference between these models and the model developed in this study. The proposed model should be useful in urban watersheds because of its simplicity and its capacity to model common pollutants (e.g., biological oxygen demand, chemical oxygen demand, Escherichia coli, suspended solids, and total nitrogen and phosphorous) in runoff. The proposed model can also be used in design studies to determine how changes in infrastructure will affect the runoff and pollution loads. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

Development of Environment-Friendly Insecticides Based on Enantioselectivity: Bifenthrin as a Case.

Science.gov (United States)

Qian, Yi; Zhou, Peixue; Zhang, Quan

2017-01-01

Chiral insecticides significantly contribute to the environmental pollutions recently. As the development of industry and agriculture, increasing number of chiral insecticides are to be introduced into the market. However, their enantioselective toxicology to ecosystem still remains uncertain. In this review, we embarked on a structured search of bibliographic databases for peer-reviewed articles regarding the enantioselective effects of bifenthrin, a typical chiral insecticide, on both target and non-target species. With this enantioselective property of chiral insecticides, they often exhibit adverse effects on non-target species enantioselectively. Specifically, the enantioselective effects of bifenthrin on target and non-target organisms were discussed. In target species, R-bifenthrin exerts more significant activities in deinsectization, compared with S-bifenthrin. On the other hand, Sbifenthrin is more toxic to non-target species than R-bifenthrin, which suggests that the application of sole enantiomer is more efficient and environment-friendly than that of racemate. This review confirms the choice of environment-friendly insecticides from the perspective of the enantioselectivity of chiral insecticides. To make insecticides more efficient to target species and less toxic to non-target species, further research should be done to investigated the potential effects of targetactive enantiomers on non-target organisms as well as the enantioselective fate of enantiomers in multiple environmental matrix.

Inorganic constituents in surface runoff from urbanised areas in winter: the case study of the city of Brest, Belarus

Directory of Open Access Journals (Sweden)

Ina Bulskaya

2014-03-01

Full Text Available The aim of this paper was to study the inorganic constituents of snow and snowmelt surface runoff in a case study of the city of Brest and to indicate components that could pose a threat to the environment. Samples of snow and snowmelt runoff were analysed for the following parameters: total suspended solids, pH, the contents of nitrate, phosphate and ammonium ions, and of heavy metals. The concentrations of most of these pollutants were higher in the snowmelt runoff than in snow. The concentrations of pollutants in the snowmelt surface runoff exceeded the levels established by national regulations (maximum permissible concentrations.

Assessment of suspended solids concentration in highway runoff and its treatment implication.

Science.gov (United States)

Hallberg, M; Renman, G

2006-09-01

It is understood that the major pollution from storm water is related to the content of particulate matter. One treatment practice is based on the first flush, i.e. detention of the initial part of the runoff that is considered to contain the highest concentrations of pollutants. This study has evaluated the concentration of total suspended solids in 30 consecutive runoff events during the winter season for an area of 6.7 hectares. A six-lane highway (E4) that has an annual average daily traffic load of 120,000 dominates the area and road de-icing salt (NaCl) and studded tires were in regular use during the studied period. The effluent standard for wastewater of 60 mg TSS per litre applied in EU was used to assess the treatment requirement of storm water. In only two of the events the event mean concentration was below 60 mg 1(-1). In four runoff events a partial event mean concentration below 60 mg 1(-1) was found, in 26 %, 12 %, 11 %, and 2 % respectively of the runoff volume. This would suggest that a capture of the initial part of the runoff for subsequent treatment is less applicable in this type of urban watershed.

Infiltration of runoff rainwater and transfer of the associated pollutants in the urban ground - towards a global and multi-disciplinary approach; Infiltration des eaux de ruissellement pluvial et transfert de polluants associes dans le sol urbain - vers une approche globale et pluridisciplinaire

Energy Technology Data Exchange (ETDEWEB)

Martinelli, I.

1999-12-01

Storm water run-off infiltration now appears as a supplementary or alternative strategy to gravitational drainage systems. The present study sought to draw up a framework to represent pollutant transfer in such infiltration, this phenomenon being governed by various physical, chemical and biological processes. Study of the literature was able on the one hand to specify urban storm water run-off pollution, and, on the other, to identify the various possible processes undergone or induced during infiltration in the soil. It was noted that experimentation in this area requires certain extra input, whether, at laboratory level, for studying interactions effects between several pollutants and several processes, or, in the field, for a better account of soil heterogeneity and of integration of various elementary phenomena. Nevertheless, the state of knowledge regarding these levels and various scientific areas made it possible to identify the main parameters seeming to govern pollutant transfer. A representation was drawn up of the soil underlying a storm water run-off infiltration system, and a experimental framework proposed both to validate and to enhance the present model. (author)

[The Influence of Runoff Pollution to DOM Features in an Urban Wastewater Treatment Plant].

Science.gov (United States)

He, Li; Ji, Fang-ying; Lai, Ming-sheng; Xu, Xuan; Zhou, Wei-wei; Mao, Bo-lin; Yang, Ming-jia

2015-03-01

Combined with wastewater treatment process, the sewage in sunny and rainy day was collected from a wastewater treatment plant in Chongqing. Three-dimensional fluorescence spectra was used to investigate the characteristic fluorescence of dissolved organic matter (DOM). DOM dissolved organic carbon (DOC), chemical oxygen demand (COD), fluorescence index (ƒ450/500) and fluorescence intensity ratio γ (A, C) of fulvic acid in ultraviolet and visible region were used to analyze the impact of rain runoff pollution on sewage DOM. According to the experimental data, the DOM fluorescence fingerprints of this wastewater treatment plant were quite different from typical municipal sewage, and the main component was tryptophan with low excitation wavelength (Peak S), then the tryptophan with long wavelength excitation (Peak T) followed. A2/O process had an approximative degradation of the protein-like both in sunny day and rainy day, but had a better degradation of fulvic-like, DOC and COD in rainy day than that in sunny day. Morever, the fluorescence peaks got red-shifted after the biological treatment. The differences of DOM fluorescence fingerprint between sunny and rainy day were significant, the fluorescence center of UV fulvic (Peak A) in rainy day getting blue-shifted obviously, shifting from 240 - 248/390 - 440 to 240 - 250/370 - 400 nm. Although the DOM types in sunny and rainy day were the same, the source of fulvic got more complex by runoff and the component ratio of DOM also changed. Compared with the sunny day, the proportion of Peak S in DOM dereased by 10%, and the proportion of Peak A increased by 7% in rainy day.

Stormwater runoff plumes in the Southern California Bight: A comparison study with SAR and MODIS imagery.

Science.gov (United States)

Holt, Benjamin; Trinh, Rebecca; Gierach, Michelle M

2017-05-15

Stormwater runoff is the largest source of pollution in the Southern California Bight (SCB), resulting from untreated runoff and pollutants from urban watersheds entering the coastal waters after rainstorms. We make use of both satellite SAR and MODIS-Aqua ocean color imagery to examine two different components of runoff plumes, the surface slick and the sediment discharge. We expand on earlier satellite SAR studies by examining an extensive collection of multi-platform SAR imagery, spanning from 1992 to 2014, that provides a more comprehensive view of the plume surface slick characteristics, illustrated with distribution maps of the extent and flow direction of the plumes. The SAR-detected surface plumes are compared with coincident rain and runoff measurements, and with available measured shoreline fecal bacteria loads. We illustrate differences in the detection of SAR surface plumes with the sediment-related discharge plumes derived from MODIS imagery. A conceptual satellite stormwater runoff monitoring approach is presented. Copyright © 2017 Elsevier Ltd. All rights reserved.

Probabilistic risk assessment of insecticide concentrations in agricultural surface waters: a critical appraisal.

Science.gov (United States)

Stehle, Sebastian; Knäbel, Anja; Schulz, Ralf

2013-08-01

Due to the specific modes of action and application patterns of agricultural insecticides, the insecticide exposure of agricultural surface waters is characterized by infrequent and short-term insecticide concentration peaks of high ecotoxicological relevance with implications for both monitoring and risk assessment. Here, we apply several fixed-interval strategies and an event-based sampling strategy to two generalized and two realistic insecticide exposure patterns for typical agricultural streams derived from FOCUS exposure modeling using Monte Carlo simulations. Sampling based on regular intervals was found to be inadequate for the detection of transient insecticide concentrations, whereas event-triggered sampling successfully detected all exposure incidences at substantially lower analytical costs. Our study proves that probabilistic risk assessment (PRA) concepts in their present forms are not appropriate for a thorough evaluation of insecticide exposure. Despite claims that the PRA approach uses all available data to assess exposure and enhances risk assessment realism, we demonstrate that this concept is severely biased by the amount of insecticide concentrations below detection limits and therefore by the sampling designs. Moreover, actual insecticide exposure is of almost no relevance for PRA threshold level exceedance frequencies and consequential risk assessment outcomes. Therefore, we propose a concept that features a field-relevant ecological risk analysis of agricultural insecticide surface water exposure. Our study quantifies for the first time the environmental and economic consequences of inappropriate monitoring and risk assessment concepts used for the evaluation of short-term peak surface water pollutants such as insecticides.

Simulating runoff from small grazed pasture watersheds located at North Appalachian Experimental Watershed in Ohio

Science.gov (United States)

Runoff from grazing pasture lands can impact water quality in receiving streams if not well managed. Management consists of conservation practices to reduce runoff and pollutants transport. Simulation models have been effectively used to design and implement these conservation practices. The Agricul...

Insecticide toxicity to Hyalella curvispina in runoff and stream water within a soybean farm (Buenos Aires, Argentina).

Science.gov (United States)

Mugni, H; Ronco, A; Bonetto, C

2011-03-01

Toxicity to the locally dominant amphipod Hyalella curvispina was assessed in a first-order stream running through a cultivated farm. Cypermethrin, chlorpyrifos, endosulfan and glyphosate were sprayed throughout the studied period. Toxicity was assayed under controlled laboratory conditions with runoff and stream water samples taken from the field under steady state and flood conditions. Ephemeral toxicity pulses were observed as a consequence of farm pesticide applications. After pesticide application, runoff water showed 100% mortality to H. curvispina for 1 month, but no mortality thereafter. Toxicity persistence was shortest in stream water, intermediate in stream sediments and longest in soil samples. Runoff had a more important toxicity effect than the exposure to direct aerial fumigation. The regional environmental features determining fast toxicity dissipation are discussed. Copyright © 2010. Published by Elsevier Inc.

Fate and transport of furrow-applied granular tefluthrin and seed-coated clothianidin insecticides: Comparison of field-scale observations and model estimates.

Science.gov (United States)

Huff Hartz, Kara E; Edwards, Tracye M; Lydy, Michael J

2017-09-01

The transport of agricultural insecticides to water bodies may create risk of exposure to non-target organisms. Similarly, widespread use of furrow-applied and seed-coated insecticides may increase risk of exposure, yet accessible exposure models are not easily adapted for furrow application, and only a few examples of model validation of furrow-applied insecticides exist using actual field data. The goal of the current project was to apply an exposure model, the Pesticide in Water Calculator (PWC), to estimate the concentrations of two in-furrow insecticides applied to maize: the granular pyrethroid, tefluthrin, and the seed-coated neonicotinoid, clothianidin. The concentrations of tefluthrin and clothianidin in surface runoff water, sampled from a field in central Illinois (USA), were compared to the PWC modeled pesticide concentrations in surface runoff. The tefluthrin concentrations were used to optimize the application method in the PWC, and the addition of particulate matter and guttation droplets improved the models prediction of clothianidin concentrations. Next, the tefluthrin and clothianidin concentrations were calculated for a standard farm pond using both the optimized application method and the application methods provided in PWC. Estimated concentrations in a standard farm pond varied by a factor of 100 for tefluthrin and 50 for clothianidin depending on the application method used. The addition of guttation droplets and particulate matter to the model increased the annual clothianidin concentration in a standard farm pond by a factor of 1.5, which suggested that these transport routes should also be considered when assessing neonicotinoid exposure.

Build-up and wash-off dynamics of atmospherically derived Cu, Pb, Zn and TSS in stormwater runoff as a function of meteorological characteristics.

Science.gov (United States)

Murphy, Louise U; Cochrane, Thomas A; O'Sullivan, Aisling

2015-03-01

Atmospheric pollutants deposited on impermeable surfaces can be an important source of pollutants to stormwater runoff; however, modelling atmospheric pollutant loads in runoff has rarely been done, because of the challenges and uncertainties in monitoring their contribution. To overcome this, impermeable concrete boards (≈ 1m(2)) were deployed for 11 months in different locations within an urban area (industrial, residential and airside) throughout Christchurch, New Zealand, to capture spatially distributed atmospheric deposition loads in runoff over varying meteorological conditions. Runoff was analysed for total and dissolved Cu, Zn, Pb, and total suspended solids (TSS). Mixed-effect regression models were developed to simulate atmospheric pollutant loads in stormwater runoff. In addition, the models were used to explain the influence of different meteorological characteristics (e.g. antecedent dry days and rain depth) on pollutant build-up and wash-off dynamics. The models predicted approximately 53% to 69% of the variation in pollutant loads and were successful in predicting pollutant-load trends over time which can be useful for general stormwater planning processes. Results from the models illustrated the importance of antecedent dry days on pollutant build-up. Furthermore, results indicated that peak rainfall intensity and rain duration had a significant relationship with TSS and total Pb, whereas, rain depth had a significant relationship with total Cu and total Zn. This suggested that the pollutant speciation phase plays an important role in surface wash-off. Rain intensity and duration had a greater influence when the pollutants were predominantly in their particulate phase. Conversely, rain depth exerted a greater influence when a high fraction of the pollutants were predominantly in their dissolved phase. For all pollutants, the models were represented by a log-arctan relationship for pollutant build-up and a log-log relationship for pollutant wash

Insecticide solvents: interference with insecticidal action.

Science.gov (United States)

Brattsten, L B; Wilkinson, C F

1977-06-10

Several commercial solvent mixtures commonly used as insecticide carriers in spray formulations increase by more than threefold the microsomal N-demethylation of p-chloro N-methylaniline in midgut preparations of southern army-worm (Spodoptera eridania) larvae exposed orally to the test solvents. Under laboratory conditions, the same solvent mixtures exhibit a protective action against the in vivo toxicity of the insecticide carbaryl to the larvae. The data are discussed with respect to possible solvent-insecticide interactions occurring under field conditions and, more broadly, to potential toxicological hazards of these solvents to humans.

Leaching of additives from construction materials to urban storm water runoff.

Science.gov (United States)

Burkhardt, M; Zuleeg, S; Vonbank, R; Schmid, P; Hean, S; Lamani, X; Bester, K; Boller, M

2011-01-01

Urban water management requires further clarification about pollutants in storm water. Little is known about the release of organic additives used in construction materials and the impact of these compounds to storm water runoff. We investigated sources and pathways of additives used in construction materials, i.e., biocides in facades' render as well as root protection products in bitumen membranes for rooftops. Under wet-weather conditions, the concentrations of diuron, terbutryn, carbendazim, irgarol 1051 (all from facades) and mecoprop in storm water and receiving water exceeded the predicted no-effect concentrations values and the Swiss water quality standard of 0.1 microg/L. Under laboratory conditions maximum concentrations of additives were in the range of a few milligrams and a few hundred micrograms per litre in runoff of facades and bitumen membranes. Runoff from aged materials shows approximately one to two orders of magnitude lower concentrations. Concentrations decreased also during individual runoff events. In storm water and receiving water the occurrence of additives did not follow the typical first flush model. This can be explained by the release lasting over the time of rainfall and the complexity of the drainage network. Beside the amounts used, the impact of construction materials containing hazardous additives on water quality is related clearly to the age of the buildings and the separated sewer network. The development of improved products regarding release of hazardous additives is the most efficient way of reducing the pollutant load from construction materials in storm water runoff.

Effect of climate change on stormwater runoff characteristics and treatment efficiencies of stormwater retention ponds; a case study from Denmark using TSS and Cu as indicator pollutants. SpringerPlus, 5:1984, 1-12

DEFF Research Database (Denmark)

Sharma, Anitha Kumari; Vezzaro, Luca; Birch, Heidi

2016-01-01

This study investigated the potential effect of climate changes on stormwater pollution runoff characteristics and the treatment efficiency of a stormwater retention pond in a 95 ha catchment in Denmark. An integrated dynamic stormwater runoff quality and treatment model was used to simulate two...... scenarios: one representing the current climate and another representing a future climate scenario with increased intensity of extreme rainfall events and longer dry weather periods. 100-year long high-resolution rainfall time series downscaled from regional climate model projections were used as input...... concentrations. Similar results are expected for other particle bound pollutants including metals and slowly biodegradable organic substances such as PAH. Acute toxicity impacts to downstream surface waters seem to be only slightly affected. A minor increase in yearly loads of sediments and particle...

Surface runoff from urban areas. New aspects; Neue Aspekte in der Behandlung von Siedlungsabfluessen

Energy Technology Data Exchange (ETDEWEB)

Fuchs, Stephan [Karlsruher Institut fuer Technologie (KIT), Karlsruhe (Germany). Bereich Siedlungswasserwirtschaft und Wasserguetewirtschaft; Lambert, Benedikt [Bioplan Landeskulturgesellschaft, Sinsheim (Germany); Grotehusmann, Dieter [Ingenieurgesellschaft fuer Stadthydrologie, Hannover (Germany)

2010-12-15

The surface runoff from urban areas is one of the most important sources of pollutants emitted into surface waters. Suspended solids which act as a transport vehicle for many anthropogenic pollutants (e. g. heavy metals, PAH) are a key factor in this regard. The development of efficient measures of storm water runoff treatment thus requires a further differentiation of suspended solids in a fine (clay and silt) and coarse (sand and gravel) fraction. Both fractions show distinctly different characteristics in pollutant loading, transport and retention on urban surfaces and sewer systems. The primary aim of storm water runoff treatment is the reduction of the fine particles which are always highly loaded with anthropogenic pollutants. In contrast the coarse particles are almost unpolluted especially if they have a low organic share. The widespread sedimentation tanks with surface loadings between 10 and 2 m/h are very inefficient. A significant, save and lasting reduction of the emitted load of fine particles requires a considerable reduction of the surface loads. That can be achieved with the installation of lamellar settler or the utilization of the very large volumes of flood management tanks frequently present in urban areas. Filtration plants are highly efficient but there application in urban areas is limited due to their high space demands. (orig.)

Studies and Analysis of the Effectiveness of Stormwater Runoff Purification Equipment in Vilnius

Directory of Open Access Journals (Sweden)

Egidija Jaruševičiūtė

2011-02-01

Full Text Available In order to protect the natural environment from pollution, pollutant reduction in the stormwater runoff of urban areas is a particularly relevant factor. Uneven surface water flow and changes in pollutant concentration complicate conventional matching techniques and processes as well as prolong the duration of time which requires a comprehensive study in this area. Therefore, experiments on inflow stormwater turbidity and impurity with suspended solids and petroleum products were carried out according to the prepared sample collecting methodology. The study evaluated the effectiveness of cleaning a stormwater treatment plant along the settlement chamber in the chosen points. The settling time of impurities found in stormwater was analyzed under the presence of ideal conditions in the laboratory. The conducted experiments established dependence between suspended solids and turbidity. Stormwater pollution by SS was reduced only to 21–35% after heavy rain or a snow melting period in treatment plants. Keywords: storm water runoff, cleaning stormwater treatment plant, pollutants, turbidity, suspended solids, petrol products.DOI: 10.3846/mla.2010.087

How uncertain is model-based prediction of copper loads in stormwater runoff?

DEFF Research Database (Denmark)

Lindblom, Erik Ulfson; Ahlman, S.; Mikkelsen, Peter Steen

2007-01-01

(runoff volumes and pollutant masses). We use the generalized likelihood uncertainty estimation (GLUE) methodology and generate posterior parameter distributions that result in model outputs encompassing a significant number of the highly variable measurements. Given the applied pollution accumulation......In this paper, we conduct a systematic analysis of the uncertainty related with estimating the total load of pollution (copper) from a separate stormwater drainage system, conditioned on a specific combination of input data, a dynamic conceptual pollutant accumulation-washout model and measurements...

Small drains, big problems: the impact of dry weather runoff on shoreline water quality at enclosed beaches.

Science.gov (United States)

Rippy, Megan A; Stein, Robert; Sanders, Brett F; Davis, Kristen; McLaughlin, Karen; Skinner, John F; Kappeler, John; Grant, Stanley B

2014-12-16

Enclosed beaches along urban coastlines are frequent hot spots of fecal indicator bacteria (FIB) pollution. In this paper we present field measurements and modeling studies aimed at evaluating the impact of small storm drains on FIB pollution at enclosed beaches in Newport Bay, the second largest tidal embayment in Southern California. Our results suggest that small drains have a disproportionate impact on enclosed beach water quality for five reasons: (1) dry weather surface flows (primarily from overirrigation of lawns and ornamental plants) harbor FIB at concentrations exceeding recreational water quality criteria; (2) small drains can trap dry weather runoff during high tide, and then release it in a bolus during the falling tide when drainpipe outlets are exposed; (3) nearshore turbulence is low (turbulent diffusivities approximately 10(-3) m(2) s(-1)), limiting dilution of FIB and other runoff-associated pollutants once they enter the bay; (4) once in the bay, runoff can form buoyant plumes that further limit vertical mixing and dilution; and (5) local winds can force buoyant runoff plumes back against the shoreline, where water depth is minimal and human contact likely. Outdoor water conservation and urban retrofits that minimize the volume of dry and wet weather runoff entering the local storm drain system may be the best option for improving beach water quality in Newport Bay and other urban-impacted enclosed beaches.

Runoff erosion

OpenAIRE

Evelpidou, Niki (Ed.); Cordier, Stephane (Ed.); Merino, Agustin (Ed.); Figueiredo, Tomás de (Ed.); Centeri, Csaba (Ed.)

2013-01-01

Table of Contents PART I – THEORY OF RUNOFF EROSION CHAPTER 1 - RUNOFF EROSION – THE MECHANISMS CHAPTER 2 - LARGE SCALE APPROACHES OF RUNOFF EROSION CHAPTER 3 - MEASURING PRESENT RUNOFF EROSION CHAPTER 4 - MODELLING RUNOFF EROSION CHAPTER 5 - RUNOFF EROSION AND HUMAN SOCIETIES: THE INFLUENCE OF LAND USE AND MANAGEMENT PRACTICES ON SOIL EROSION PART II - CASE STUDIES CASE STUDIES – INTRODUCTION: RUNOFF EROSION IN MEDITERRANEAN AREA CASE STUDY 1: Soil Erosion Risk...

Diffuse emission and control of copper in urban surface runoff.

Science.gov (United States)

Boller, M A; Steiner, M

2002-01-01

Copper washed off from roofs and roads is considered to be a major contribution to diffuse copper pollution of urban environments. In order to guarantee sustainable protection of soils and water, the long-term strategy is to avoid or replace copper containing materials on roofs and fagades. Until achievement of this goal, a special adsorber system is suggested to control the diffuse copper fluxes by retention of copper by a mixture of granulated iron-hydroxide (GEH) and calcium carbonate. Since future stormwater runoff concepts are based on decentralised runoff infiltration into the underground, solutions are proposed which provide for copper retention in infiltration sites using GEH adsorption layers. The example of a large copper façade of which the runoff is treated in an adsorption trench reveals the first full-scale data on façade runoff and adsorber performance. During the first year of investigation average façade runoff concentrations in the range of 1-10 mg Cu/l are reduced by 96-99% in the adsorption ditch.

The ecological value of constructed wetlands for treating urban runoff.

Science.gov (United States)

Pankratz, S; Young, T; Cuevas-Arellano-, H; Kumar, R; Ambrose, R F; Suffet, I H

2007-01-01

The Sweetwater Authority's urban runoff diversion system (URDS) comprises constructed wetlands on a hillside between the town of Spring Valley and the Sweetwater Reservoir, California, USA. The URDS were designed to divert dry-weather and first-flush urban runoff flows from the Sweetwater reservoir. However, these constructed wetlands have developed into ecologically valuable habitat. This paper evaluates the following ecological questions related to the URDS: (1) the natural development of the species present and their growth pattern; (2) the biodiversity and pollutant stress on the plants and invertebrates; and (3) the question of habitat provided for endangered species. The URDS wetlands are comprised primarily of rush (Scirpus spp.) and cattails (Typha spp.). This vegetative cover ranged from 39-78% of the area of the individual wetland ponds. Current analyses of plant tissues and wetland sediment indicates the importance of sediment sorption for metals and plant uptake of nutrients. Analyses of URDS water following runoff events show the URDS wetlands do reduce the amount of nutrients and metals in the water column. Invertebrate surveys of the wetland ponds revealed lower habitat quality and environmental stress compared to unpolluted natural habitat. The value of the wetlands as wildlife habitat is constrained by low plant biodiversity and pollution stress from the runoff. Since the primary Sweetwater Authority goal is to maintain good water quality for drinking, any secondary utilization of URDS habitat by species (endangered or otherwise) is deemed an added benefit.

Assessment on urban soil pollution by biocides from building materials

DEFF Research Database (Denmark)

Bollmann, Ulla E.; Vollertsen, Jes; Bester, Kai

2015-01-01

. Based on a monitoring study of stormwater runoff from a residential catchment as well as direct façade runoff analysis, the present study was assessing the pollution of urban soil to biocides from building material. The stormwater runoff of a residential catchment in Silkeborg (Denmark) was monitored...... from a freshly painted or rendered house, it is obvious that a huge part is actually draining directly to the soil and not to the sewer system. Consequently, the soil in urban areas is exposed to stormwater highly polluted by biocides which might affect the microbial community there....

Mathematical modeling of rainwater runoff over catchment surface ...

African Journals Online (AJOL)

The subject of an article is the mathematical modeling of the rainwater runoff along the surface catchment taking account the transport of pollution which permeates into the water flow from a porous media of soil at the certain areas of this surface. The developed mathematical model consists of two types of equations: the ...

Treatment of suspended solids and heavy metals from urban stormwater runoff by a tree box filter.

Science.gov (United States)

Geronimo, F K F; Maniquiz-Redillas, M C; Tobio, J A S; Kim, L H

2014-01-01

Particulates, inorganic and toxic constituents are the most common pollutants associated with urban stormwater runoff. Heavy metals such as chromium, nickel, copper, zinc, cadmium and lead are found to be in high concentration on paved roads or parking lots due to vehicle emissions. In order to control the rapid increase of pollutant loads in stormwater runoff, the Korean Ministry of Environment proposed the utilization of low impact developments. One of these was the application of tree box filters that act as a bioretention treatment system which executes filtration and sorption processes. In this study, a tree box filter located adjacent to an impervious parking lot was developed to treat suspended solids and heavy metal concentrations from urban stormwater runoff. In total, 11 storm events were monitored from July 2010 to August 2012. The results showed that the tree box filter was highly effective in removing particulates (up to 95%) and heavy metals (at least 70%) from the urban stormwater runoff. Furthermore, the tree box filter was capable of reducing the volume runoff by 40% at a hydraulic loading rate of 1 m/day and below.

Study on road surface source pollution controlled by permeable pavement

Science.gov (United States)

Zheng, Chaocheng

2018-06-01

The increase of impermeable pavement in urban construction not only increases the runoff of the pavement, but also produces a large number of Non-Point Source Pollution. In the process of controlling road surface runoff by permeable pavement, a large number of particulate matter will be withheld when rainwater is being infiltrated, so as to control the source pollution at the source. In this experiment, we determined the effect of permeable road surface to remove heavy pollutants in the laboratory and discussed the related factors that affect the non-point pollution of permeable pavement, so as to provide a theoretical basis for the application of permeable pavement.

Hydrologic conditions and quality of rainfall and storm runoff for two agricultural areas of the Oso Creek Watershed, Nueces County, Texas, 2005-07

Science.gov (United States)

Ockerman, Darwin J.

2008-01-01

per acre per year from the West Oso Creek subwatershed and 0.966 pound per acre per year from the Oso Creek tributary subwatershed. Total phosphorus yields from the West Oso Creek and the Oso Creek tributary subwatersheds for the 2-year period were 0.776 and 0.498 pound per acre per year. Runoff yields of nitrogen and phosphorus were relatively small compared to inputs of nitrogen in fertilizer and rainfall deposition. Average annual runoff yield of total nitrogen (subwatersheds combined) represents about 2.4 percent of nitrogen applied as fertilizer and nitrogen entering the subwatersheds through rainfall deposition. Average annual runoff yield of total phosphorus (subwatersheds combined) represents about 4.4 percent of the phosphorus in applied fertilizer and rainfall deposition. Suspended-sediment yields from the West Oso Creek subwatershed were more than twice those from the Oso Creek tributary subwatershed. The average suspended-sediment yield from the West Oso Creek subwatershed was 582 pounds per acre per year. The average suspended-sediment yield from the Oso Creek tributary subwatershed was 257 pounds per acre per year. Twenty-two herbicides and eight insecticides were detected in runoff samples collected from the two subwatershed outlet sites. At the West Oso Creek site, 18 herbicides and four insecticides were detected, and at the Oso Creek tributary site, 17 herbicides and six insecticides. Seventeen pesticides were detected in only one sample at low concentrations (near the laboratory reporting level). Atrazine, atrazine degradation byproducts 2-chloro-4-isopropylamino-6-amino-s-triazine (CIAT) and 2-hydroxy-4-isopropylamino-6-ethylamino-s-triazine (OIET), glyphosate, and glyphosate byproduct aminomethylphosphonic acid (AMPA) were detected in all samples. Of all pesticides detected in runoff, the highest runoff yields were for glyphosate, 0.013 pound per acre per year for the West Oso Creek subwatershed and 0.001 pound per acre per year for the Oso Creek

Sources of pollution

Indian Academy of Sciences (India)

First page Back Continue Last page Overview Graphics. Sources of pollution. Domestic wastewater (Sewage). Organic matter; Nitrogen & phosphorus; Pathogens, viruses, …. Agricultural runoff. Nitrogen & phosphorus; Pesticides; Industrial effluents; Organics (oil &grease, pigments, phenols, organic matter ….) Heavy ...

UV light and urban pollution: Bad cocktail for mosquitoes?

International Nuclear Information System (INIS)

Tetreau, Guillaume; Chandor-Proust, Alexia; Faucon, Frédéric; Stalinski, Renaud; Akhouayri, Idir; Prud’homme, Sophie M.; Régent-Kloeckner, Myriam; Raveton, Muriel; Reynaud, Stéphane

2014-01-01

Highlights: •Mosquito tolerance to temephos is induced by PAHs and UV exposure. •Toxicity of fluoranthene for mosquito Malpighian tubules cells is induced by UV. •Fluoranthene crystallizes in mosquito Malpighian tubules upon UV exposure. •Mixture of two PAHs is less toxic for mosquitoes than each PAHs separately. •Combination of abiotic parameters (PAHs and UV) affect mosquito physiology. -- Abstract: Mosquito breeding sites consist of water pools, which can either be large open areas or highly covered ponds with vegetation, thus with different light exposures combined with the presence in water of xenobiotics including polycyclic aromatic hydrocarbons (PAHs) generated by urban pollution. UV light and PAHs are abiotic factors known to both affect the mosquito insecticide resistance status. Nonetheless, their potential combined effects on the mosquito physiology have never been investigated. The present article aims at describing the effects of UV exposure alongside water contamination with two major PAH pollutants (fluoranthene and benzo[a]pyrene) on a laboratory population of the yellow fever mosquito Aedes aegypti. To evaluate the effects of PAH exposure and low energetic UV (UV-A) irradiation on mosquitoes, different parameters were measured including: (1) The PAH localization and its impact on cell mortality by fluorescent microscopy; (2) The detoxification capacities (cytochrome P450, glutathione-S-transferase, esterase); (3) The responses to oxidative stress (Reactive Oxygen Species–ROS) and (4) The tolerance of mosquito larvae to a bioinsecticide (Bacillus thuringiensis subsp. israelensis–Bti) and to five chemical insecticides (DDT, imidacloprid, permethrin, propoxur and temephos). Contrasting effects regarding mosquito cell mortality, detoxification and oxidative stress were observed as being dependent on the pollutant considered, despite the fact that the two PAHs belong to the same family. Moreover, UV is able to modify pollutant effects on

UV light and urban pollution: Bad cocktail for mosquitoes?

Energy Technology Data Exchange (ETDEWEB)

Tetreau, Guillaume, E-mail: guillaume.tetreau@gmail.com [Laboratoire d’Ecologie Alpine, LECA-UMR 5553, Université de Grenoble 1, BP 53, 38041 Grenoble cedex 09 (France); Department of Entomology, Cornell University, New York State Agricultural Experiment Station, Geneva, NY 14456 (United States); Chandor-Proust, Alexia; Faucon, Frédéric; Stalinski, Renaud; Akhouayri, Idir; Prud’homme, Sophie M.; Régent-Kloeckner, Myriam; Raveton, Muriel; Reynaud, Stéphane [Laboratoire d’Ecologie Alpine, LECA-UMR 5553, Université de Grenoble 1, BP 53, 38041 Grenoble cedex 09 (France)

2014-01-15

Highlights: •Mosquito tolerance to temephos is induced by PAHs and UV exposure. •Toxicity of fluoranthene for mosquito Malpighian tubules cells is induced by UV. •Fluoranthene crystallizes in mosquito Malpighian tubules upon UV exposure. •Mixture of two PAHs is less toxic for mosquitoes than each PAHs separately. •Combination of abiotic parameters (PAHs and UV) affect mosquito physiology. -- Abstract: Mosquito breeding sites consist of water pools, which can either be large open areas or highly covered ponds with vegetation, thus with different light exposures combined with the presence in water of xenobiotics including polycyclic aromatic hydrocarbons (PAHs) generated by urban pollution. UV light and PAHs are abiotic factors known to both affect the mosquito insecticide resistance status. Nonetheless, their potential combined effects on the mosquito physiology have never been investigated. The present article aims at describing the effects of UV exposure alongside water contamination with two major PAH pollutants (fluoranthene and benzo[a]pyrene) on a laboratory population of the yellow fever mosquito Aedes aegypti. To evaluate the effects of PAH exposure and low energetic UV (UV-A) irradiation on mosquitoes, different parameters were measured including: (1) The PAH localization and its impact on cell mortality by fluorescent microscopy; (2) The detoxification capacities (cytochrome P450, glutathione-S-transferase, esterase); (3) The responses to oxidative stress (Reactive Oxygen Species–ROS) and (4) The tolerance of mosquito larvae to a bioinsecticide (Bacillus thuringiensis subsp. israelensis–Bti) and to five chemical insecticides (DDT, imidacloprid, permethrin, propoxur and temephos). Contrasting effects regarding mosquito cell mortality, detoxification and oxidative stress were observed as being dependent on the pollutant considered, despite the fact that the two PAHs belong to the same family. Moreover, UV is able to modify pollutant effects on

Anthropogenic impacts on global organic river pollution

NARCIS (Netherlands)

Wen, Y.

2017-01-01

Organic pollution of rivers by wastewater discharge from human activities negatively impacts people and ecosystems. Without treatment, pollution control relies on a combination of natural degradation and dilution by natural runoff to reduce downstream effects. To implement integrated water

EPA RESEARCH IN URBAN STORMWATER POLLUTION CONTROL

Science.gov (United States)

This state-of-the-art on the Environmental Protection Agency' s research in urban stormwater and combined sewer overflow pollution control describes the major elements of the Urban Runoff Pollution Control Program. roblem definition, users assistance tools, management alternative...

Adhesion of and to soil in runoff as influenced by polyacrylamide.

Science.gov (United States)

Bech, Tina B; Sbodio, Adrian; Jacobsen, Carsten S; Suslow, Trevor

2014-11-01

Polyacrylamide (PAM) is used in agriculture to reduce soil erosion and has been reported to reduce turbidity, nutrients, and pollutants in surface runoff water. The objective of this work was to determine the effect of PAM on the concentration of enteric bacteria in surface runoff by comparing four enteric bacteria representing phenotypically different motility and hydrophobicity from three soils. Results demonstrated that bacterial surface runoff was differentially influenced by the PAM treatment. Polyacrylamide treatment increased surface runoff for adhered and planktonic cells from a clay soil; significantly decreased surface runoff of adhered bacteria, while no difference was observed for planktonic bacteria from the sandy loam; and significantly decreased the surface runoff of planktonic cells, while no difference was observed for adhered bacteria from the clay loam. Comparing strains from a final water sample collected after 48 h showed a greater loss of while serovar Poona was almost not detected. Thus, (i) the PAM efficiency in reducing the concentration of enteric bacteria in surface runoff was influenced by soil type and (ii) variation in the loss of enteric bacteria highlights the importance of strain-specific properties that may not be captured with general fecal indicator bacteria. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

Green roofs as a means of pollution abatement

International Nuclear Information System (INIS)

Rowe, D. Bradley

2011-01-01

Green roofs involve growing vegetation on rooftops and are one tool that can help mitigate the negative effects of pollution. This review encompasses published research to date on how green roofs can help mitigate pollution, how green roof materials influence the magnitude of these benefits, and suggests future research directions. The discussion concentrates on how green roofs influence air pollution, carbon dioxide emissions, carbon sequestration, longevity of roofing membranes that result in fewer roofing materials in landfills, water quality of stormwater runoff, and noise pollution. Suggestions for future directions for research include plant selection, development of improved growing substrates, urban rooftop agriculture, water quality of runoff, supplemental irrigation, the use of grey water, air pollution, carbon sequestration, effects on human health, combining green roofs with complementary related technologies, and economics and policy issues. - Green roofs can help mitigate air pollution, carbon dioxide emissions, sequester carbon, conserve energy, reduce the urban heat island, and improve water quality.

Performance of Two Bioswales on Urban Runoff Management

Directory of Open Access Journals (Sweden)

Qingfu Xiao

2017-09-01

Full Text Available This study evaluated the effectiveness of two bioswales eight years after construction in Davis, California. The treatment bioswale measured 9 m × 1 m × 1 m (L × W × D. Engineered soil mix (75% native lava rock and 25% loam soil replaced the native loam soil. Four Red Tip Photinia (Photinia × fraseri Dress trees and two Blueberry Muffin Hawthorn (Rhaphiolepis umbellata (Thunb. Makino shrubs were planted in the bioswale. Runoff flowed into the bioswale from an adjacent 171 m2 panel of turf grass. An identically sized control bioswale consisting of non-disturbed native soil was located adjacent to the treatment bioswale. Surface runoff quantity and quality were measured during three experiments with different pollutant loads. When compared to the control, the treatment bioswale reduced surface runoff by 99.4%, and reduced nitrogen, phosphate, and total organic carbon loading by 99.1%, 99.5%, and 99.4%, respectively. After eight years, tree growth characteristics were similar across both sites.

Insecticide control of vector-borne diseases: when is insecticide resistance a problem?

Directory of Open Access Journals (Sweden)

Ana Rivero

Full Text Available Many of the most dangerous human diseases are transmitted by insect vectors. After decades of repeated insecticide use, all of these vector species have demonstrated the capacity to evolve resistance to insecticides. Insecticide resistance is generally considered to undermine control of vector-transmitted diseases because it increases the number of vectors that survive the insecticide treatment. Disease control failure, however, need not follow from vector control failure. Here, we review evidence that insecticide resistance may have an impact on the quality of vectors and, specifically, on three key determinants of parasite transmission: vector longevity, competence, and behaviour. We argue that, in some instances, insecticide resistance is likely to result in a decrease in vector longevity, a decrease in infectiousness, or in a change in behaviour, all of which will reduce the vectorial capacity of the insect. If this effect is sufficiently large, the impact of insecticide resistance on disease management may not be as detrimental as previously thought. In other instances, however, insecticide resistance may have the opposite effect, increasing the insect's vectorial capacity, which may lead to a dramatic increase in the transmission of the disease and even to a higher prevalence than in the absence of insecticides. Either way-and there may be no simple generality-the consequence of the evolution of insecticide resistance for disease ecology deserves additional attention.

Hydrologic conditions and water quality of rainfall and storm runoff for two agricultural areas of the Oso Creek watershed, Nueces County, Texas, 2005-08

Science.gov (United States)

Ockerman, Darwin J.; Fernandez, Carlos J.

2010-01-01

-year study period averaged 2.62 pounds per acre per year from the West Oso Creek subwatershed and 0.839 pound per acre per year from the Oso Creek tributary subwatershed. Total phosphorus yields from the West Oso Creek and Oso Creek tributary subwatersheds for the 3-year period were 0.644 and 0.419 pound per acre per year, respectively. Runoff yields of nitrogen and phosphorus were relatively small compared to inputs of nitrogen in fertilizer and rainfall deposition. Average annual runoff yield of total nitrogen (subwatersheds combined) represents about 2.5 percent of nitrogen applied as fertilizer to cropland in the watershed and nitrogen entering the subwatersheds through rainfall deposition. Average annual runoff yield of total phosphorus (subwatersheds combined) represents about 4.0 percent of the phosphorus in applied fertilizer and rainfall deposition. Suspended-sediment yields from the West Oso Creek subwatershed were more than twice those from the Oso Creek tributary subwatershed. The average suspended-sediment yield from the West Oso Creek subwatershed was 522 pounds per acre per year and from the Oso Creek tributary subwatershed was 139 pounds per acre per year. Twenty-four herbicides and eight insecticides were detected in runoff samples collected at the two subwatershed outlets. At the West Oso Creek site, 19 herbicides and 4 insecticides were detected; at the Oso Creek tributary site, 18 herbicides and 6 insecticides were detected. Fourteen pesticides were detected in only one sample at low concentrations (near the laboratory reporting level). Atrazine and atrazine degradation byproduct 2-chloro-4-isopropylamino-6-amino-s-triazine (CIAT) were detected in all samples. Glyphosate and glyphosate byproduct aminomethylphosphonic acid (AMPA) were detected in all samples collected and analyzed during water years 2006-07 but were not included in analysis for samples collected in water year 2008. Of all pesticides detected in runoff, the highest runoff yields w

Leaching of additives from construction materials to urban storm water runoff

DEFF Research Database (Denmark)

Burkhardt, Mike; Zuleeg, S.; Boller, M.

2011-01-01

Urban water management requires further clarification about pollutants in storm water. Little is known about the release of organic additives used in construction materials and the impact of these compounds to storm water runoff. We investigated sources and pathways of additives used...... shows approximately one to two orders of magnitude lower concentrations. Concentrations decreased also during individual runoff events. In storm water and receiving water the occurrence of additives did not follow the typical first flush model. This can be explained by the release lasting over the time...

Highway runoff quality models for the protection of environmentally sensitive areas

Science.gov (United States)

Trenouth, William R.; Gharabaghi, Bahram

2016-11-01

This paper presents novel highway runoff quality models using artificial neural networks (ANN) which take into account site-specific highway traffic and seasonal storm event meteorological factors to predict the event mean concentration (EMC) statistics and mean daily unit area load (MDUAL) statistics of common highway pollutants for the design of roadside ditch treatment systems (RDTS) to protect sensitive receiving environs. A dataset of 940 monitored highway runoff events from fourteen sites located in five countries (Canada, USA, Australia, New Zealand, and China) was compiled and used to develop ANN models for the prediction of highway runoff suspended solids (TSS) seasonal EMC statistical distribution parameters, as well as the MDUAL statistics for four different heavy metal species (Cu, Zn, Cr and Pb). TSS EMCs are needed to estimate the minimum required removal efficiency of the RDTS needed in order to improve highway runoff quality to meet applicable standards and MDUALs are needed to calculate the minimum required capacity of the RDTS to ensure performance longevity.

[Hydrology and water quality of rainfall-runoff in combined sewerage system along Suzhou Creek in central Shanghai].

Science.gov (United States)

Cheng, Jiang; Yang, Kai; Huang, Xiao-Fang; Lü, Yong-Peng

2009-07-15

In order to obtain the processes of hydrology and water quality of urban combined sewerage system (CSS) in highly urbanized region, the precipitation, discharge and pollutant concentration of four different intensity rainfall (light rain, moderate rain, heavy rain and storm) were measured from Jul. to Sep. 2007 in the Chendulu CSS along Suzhou Creek in Shanghai. The results show that the shapes of runoff graph are similar to rainfall graph, with a weaker fluctuation range and a 15-25 min delay between rainfall and runoff graph. Runoff coefficients of the four different rainfall are 0.33, 0.62, 0.67 and 0.73, respectively. The 30/30 first flush phenomenon is found in Chendulu CSS. The peak of pollutant concentration graph lags rainfall peak about 30-40 min. The pH and event mean concentration (EMC) of Cu, Zn, Cr, Cd, Pb and Ni totally measure up to environmental quality standards V for surface water of China besides COD, BOD5, NH4(+) -N and TP, and the EMC of COD, BOD5, NH4(+) -N and TP are 225.0-544.1, 31.5-98.9, 8.9-44.2 and 1.98-3.52 mg x L(-1), respectively. The rainfall-runoff pollutant concentration in Chendulu CSS is close to those of other foreign cites. At the confidence level of p < 0.01, good relationships exist between SS and COD, BOD5, NH4(+) -N and TP, respectively, and the average proportion of particulate organic pollutant and nutrient is 70.21%.

The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors

OpenAIRE

Reid, Molly C.; McKenzie, F. Ellis

2016-01-01

The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malari...

Discussion on runoff purification technology of highway bridge deck based on water quality safety

Science.gov (United States)

Tan, Sheng-guang; Liu, Xue-xin; Zou, Guo-ping; Xiong, Xin-zhu; Tao, Shuang-cheng

2018-06-01

Aiming at the actual problems existing, including a poor purification effect of highway bridge runoff collection and treatment system across sensitive water and necessary manual emergency operation, three kinds of technology, three pools system of bridge runoff purification, the integral pool of bridge runoff purification and ecological planting tank, are put forward by optimizing the structure of purification unit and system setting. At the same time, we come up with an emergency strategy for hazardous material leakage basing on automatic identification and remote control of traffic accidents. On the basis of combining these with the optimized pool structure, sensitive water safety can be guaranteed and water pollution, from directly discharging of bridge runoff, can be decreased. For making up for the shortages of green highway construction technology, the technique has important reference value.

The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors.

Science.gov (United States)

Reid, Molly C; McKenzie, F Ellis

2016-02-19

The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malaria vectors were identified. In 23 of the 25 relevant recent publications from across Africa, higher resistance in mosquito populations was associated with agricultural insecticide use. This association appears to be affected by crop type, farm pest management strategy and urban development.

Characteristics of Phosphorus Runoff Losses from Typical Paddy Fields in Guangdong Province, China

Directory of Open Access Journals (Sweden)

NING Jian-feng

2018-03-01

Full Text Available Three experimental paddy fields located in the city of Zengcheng, Qingyuan and Gaozhou in Guangdong Province were selected to monitor the runoff losses of phosphorus from the year of 2008 to 2012. The results showed that runoff event in paddy field occurred mainly in the early rice season. The runoff concentration of total phosphorus(TP under conventional fertilization treatment was in the range of 0.02~1.56 mg·L-1. It was recorded that TP concentration in 11%~18% of the total runoff samples exceeded the grade Ⅴ of the national surface water environmental quality(0.4 mg·L-1. Peak concentration of different phosphorus forms[TP, dissolved total P(DTP and particulate P(PP] were observed within 14 days after fertilization, which indicated the high environmental pollution risk of phosphorus during this period. Application of phosphorus fertilizer increased runoff load of DTP in paddy field and showed no effect on that of PP and TP. The annual runoff loads of 0.63~4.05, 0.33~2.91 kg·hm-2 and 1.10~6.68 kg·hm-2 for DTP, PP and TP, respectively, were recorded under conventional fertilizer model. Runoff load of phosphorus exhibited wide spatial and temporal variation during experimental period. Runoff coefficient of 0.06%~6.81% of phosphorus was recorded. It was observed that DTP dominated the phosphorus runoff load. Phosphorus runoff losses from paddy field was affected by a variety of natural and human factors, and fertilization, precipitation and runoff volume were identified as the main factors.

Modeling of runoff pollution load in a data scarce situation using ...

African Journals Online (AJOL)

This study used Soil Water Assessment Tool (SWAT) to simulate temporal-spatial distribution of surface water runoff (river flow), sediment and nutrient generation in Sondu watershed, and to identify soil erosion and nutrient source hot spots. Annual sediment generation to the lake is 80,000 t/yr composed of mainly silt while ...

Impact of agriculture on the selection of insecticide resistance in the malaria vector Anopheles gambiae: a multigenerational study in controlled conditions.

Science.gov (United States)

Nkya, Theresia Estomih; Poupardin, Rodolphe; Laporte, Frederic; Akhouayri, Idir; Mosha, Franklin; Magesa, Stephen; Kisinza, William; David, Jean-Philippe

2014-10-16

Resistance of mosquitoes to insecticides is mainly attributed to their adaptation to vector control interventions. Although pesticides used in agriculture have been frequently mentioned as an additional force driving the selection of resistance, only a few studies were dedicated to validate this hypothesis and characterise the underlying mechanisms. While insecticide resistance is rising dramatically in Africa, deciphering how agriculture affects resistance is crucial for improving resistance management strategies. In this context, the multigenerational effect of agricultural pollutants on the selection of insecticide resistance was examined in Anopheles gambiae. An urban Tanzanian An. gambiae population displaying a low resistance level was used as a parental strain for a selection experiment across 20 generations. At each generation larvae were selected with a mixture containing pesticides and herbicides classically used in agriculture in Africa. The resistance levels of adults to deltamethrin, DDT and bendiocarb were compared between the selected and non-selected strains across the selection process together with the frequency of kdr mutations. A microarray approach was used for pinpointing transcription level variations selected by the agricultural pesticide mixture at the adult stage. A gradual increase of adult resistance to all insecticides was observed across the selection process. The frequency of the L1014S kdr mutation rose from 1.6% to 12.5% after 20 generations of selection. Microarray analysis identified 90 transcripts over-transcribed in the selected strain as compared to the parental and the non-selected strains. Genes encoding cuticle proteins, detoxification enzymes, proteins linked to neurotransmitter activity and transcription regulators were mainly affected. RT-qPCR transcription profiling of candidate genes across multiple generations supported their link with insecticide resistance. This study confirms the potency of agriculture in selecting

A short history of insecticides

Directory of Open Access Journals (Sweden)

Oberemok Volodymyr Volodymyrovych

2015-07-01

Full Text Available This review contains a brief history of the use of insecticides. The peculiarities, main advantages, and disadvantages of some modern insecticides are described. The names of the discoverers of some of the most popular insecticide preparations on the world market, are listed. The tendencies to find new insecticides to control the quantity of phytophagous insects are discussed. Special attention is paid to the perspective of creating preparations based on nucleic acids, in particular DNA insecticides. The use of insect-specific, short single-stranded DNA fragments as DNA insecticides, is paving the way in the field of “intellectual” insecticides that “think” before they act. It is worth noting, though, that in the near future, the quantity of produced insecticides will increase due to the challenges associated with food production for a rapidly growing population. It is concluded, that an agreeable interaction of scientists and manufacturers of insecticides should lead to the selection of the most optimal solutions for insect pest control, which would be safe, affordable, and effective at the same time.

GIS Based Distributed Runoff Predictions in Variable Source Area Watersheds Employing the SCS-Curve Number

Science.gov (United States)

Steenhuis, T. S.; Mendoza, G.; Lyon, S. W.; Gerard Marchant, P.; Walter, M. T.; Schneiderman, E.

2003-04-01

Because the traditional Soil Conservation Service Curve Number (SCS-CN) approach continues to be ubiquitously used in GIS-BASED water quality models, new application methods are needed that are consistent with variable source area (VSA) hydrological processes in the landscape. We developed within an integrated GIS modeling environment a distributed approach for applying the traditional SCS-CN equation to watersheds where VSA hydrology is a dominant process. Spatial representation of hydrologic processes is important for watershed planning because restricting potentially polluting activities from runoff source areas is fundamental to controlling non-point source pollution. The methodology presented here uses the traditional SCS-CN method to predict runoff volume and spatial extent of saturated areas and uses a topographic index to distribute runoff source areas through watersheds. The resulting distributed CN-VSA method was incorporated in an existing GWLF water quality model and applied to sub-watersheds of the Delaware basin in the Catskill Mountains region of New York State. We found that the distributed CN-VSA approach provided a physically-based method that gives realistic results for watersheds with VSA hydrology.

A BMP selection process based on the granulometry of runoff solids ...

African Journals Online (AJOL)

This article presents the methodology and results of the field survey carried out to characterise the pollution associated with the stormwater runoff from an urban catchment in Galicia (Spain). Various instruments were installed in the control section of this catchment measuring some 55 ha and located in the separate sewer ...

Decrease of insecticide resistance over generations without exposure to insecticides in Nilaparvata lugens (Hemipteran: Delphacidae).

Science.gov (United States)

Yang, Yajun; Dong, Biqin; Xu, Hongxing; Zheng, Xusong; Tian, Junce; Heong, Kongleun; Lu, Zhongxian

2014-08-01

The brown planthopper, Nilaparvata lugens (Stål), is one of the most important insect pests on paddy rice in tropical and temperate Asia. Overuse and misuse of insecticides have resulted in the development of high resistance to many different insecticides in this pest. Studies were conducted to evaluate the change of resistance level to four insecticides over 15 generations without any exposure to insecticides in brown planthopper. After 15 generations' rearing without exposure to insecticide, brown planthopper could reverse the resistance to imidacloprid, chlorpyrifos, fipronil, and fenobucarb. The range and style of resistance reversal of brown planthopper differed when treated with four different insecticides. To monitor potential changes in insect physiological responses, we measured the activity of each of the three selected enzymes, including acetylcholinesterases (AChE), general esterases (EST), and glutathione S-transferases. After multiple generations' rearing without exposure to insecticide, AChE and EST activities of brown planthopper declined with the increased generations, suggesting that the brown planthopper population adjusted activities of EST and AChE to adapt to the non-insecticide environment. These findings suggest that the reducing, temporary stop, or rotation of insecticide application could be incorporated into the brown planthopper management.

Critical review: Copper runoff from outdoor copper surfaces at atmospheric conditions.

Science.gov (United States)

Hedberg, Yolanda S; Hedberg, Jonas F; Herting, Gunilla; Goidanich, Sara; Odnevall Wallinder, Inger

2014-01-01

This review on copper runoff dispersed from unsheltered naturally patinated copper used for roofing and facades summarizes and discusses influencing factors, available literature, and predictive models, and the importance of fate and speciation for environmental risk assessment. Copper runoff from outdoor surfaces is predominantly governed by electrochemical and chemical reactions and is highly dependent on given exposure conditions (size, inclination, geometry, degree of sheltering, and orientation), surface parameters (age, patina composition, and thickness), and site-specific environmental conditions (gaseous pollutants, chlorides, rainfall characteristics (amount, intensity, pH), wind direction, temperature, time of wetness, season). The corrosion rate cannot be used to assess the runoff rate. The extent of released copper varies largely between different rain events and is related to dry and wet periods, dry deposition prior to the rain event and prevailing rain and patina characteristics. Interpretation and use of copper runoff data for environmental risk assessment and management need therefore to consider site-specific factors and focus on average data of long-term studies (several years). Risk assessments require furthermore that changes in copper speciation, bioavailability aspects, and potential irreversible retention on solid surfaces are considered, factors that determine the environmental fate of copper runoff from outdoor surfaces.

WET-WEATHER POLLUTION PREVENTION THROUGH MATERIALS SUBSTITUTION AS PART OF INDUSTRIAL CONSTRUCTION

Science.gov (United States)

A literature review of urban stormwater runoff and building/construction materials has shown that many materials such as galvanized metal, concrete, asphalt, and wood products, have the potential to release pollutants into urban stormwater runoff and snowmelt. However, much of th...

LARGE-SCALE INDICATIVE MAPPING OF SOIL RUNOFF

Directory of Open Access Journals (Sweden)

E. Panidi

2017-11-01

Full Text Available In our study we estimate relationships between quantitative parameters of relief, soil runoff regime, and spatial distribution of radioactive pollutants in the soil. The study is conducted on the test arable area located in basin of the upper Oka River (Orel region, Russia. Previously we collected rich amount of soil samples, which make it possible to investigate redistribution of the Chernobyl-origin cesium-137 in soil material and as a consequence the soil runoff magnitude at sampling points. Currently we are describing and discussing the technique applied to large-scale mapping of the soil runoff. The technique is based upon the cesium-137 radioactivity measurement in the different relief structures. Key stages are the allocation of the places for soil sampling points (we used very high resolution space imagery as a supporting data; soil samples collection and analysis; calibration of the mathematical model (using the estimated background value of the cesium-137 radioactivity; and automated compilation of the map (predictive map of the studied territory (digital elevation model is used for this purpose, and cesium-137 radioactivity can be predicted using quantitative parameters of the relief. The maps can be used as a support data for precision agriculture and for recultivation or melioration purposes.

Surface runoff and subsurface tile drain losses of neonicotinoids and companion herbicides at edge-of-field.

Science.gov (United States)

Chrétien, François; Giroux, Isabelle; Thériault, Georges; Gagnon, Patrick; Corriveau, Julie

2017-05-01

With their application as seed coatings, the use of neonicotinoid insecticides increased dramatically during the last decade. They are now frequently detected in aquatic ecosystems at concentrations susceptible to harm aquatic invertebrates at individual and population levels. This study intent was to document surface runoff and subsurface tile drain losses of two common neonicotinoids (thiamethoxam and clothianidin) compared to those of companion herbicides (atrazine, glyphosate, S-metolachlor and mesotrione) at the edge of a 22.5-ha field under a corn-soybean rotation. A total of 14 surface runoff and tile drain discharge events were sampled over two years. Events and annual unit mass losses were computed using flow-weighted concentrations and total surface runoff and tile drain flow volumes. Detection frequencies close to 100% in edge-of-field surface runoff and tile drain water samples were observed for thiamethoxam and clothianidin even though only thiamethoxam had been applied in the first year. In 2014, thiamethoxam median concentrations in surface runoff and tile drain samples were respectively 0.46 and 0.16 μg/L, while respective maximum concentrations of 2.20 and 0.44 μg/L were measured in surface runoff and tile drain samples during the first post-seeding storm event. For clothianidin, median concentrations in surface runoff and tile drain samples were 0.02 and 0.01, μg/L, and respective maximum concentrations were 0.07 μg/L and 0.05 μg/L. Surface runoff and tile drain discharge were key transport mechanisms with similar contributions of 53 and 47% of measured mass losses, respectively. Even if thiamethoxam was applied at a relatively low rate and had a low mass exportation value (0.3%), the relative toxicity was one to two orders of magnitude higher than those of the other chemicals applied in 2014 and 2015. Companion herbicides, except glyphosate in tile drains, exceeded their water quality guideline during one sampling campaign after

Development of an indicator for characterizing particle size distribution and quality of stormwater runoff.

Science.gov (United States)

Wang, Qian; Zhang, Qionghua; Dzakpasu, Mawuli; Lian, Bin; Wu, Yaketon; Wang, Xiaochang C

2018-03-01

Stormwater particles washed from road-deposited sediments (RDS) are traditionally characterized as either turbidity or total suspended solids (TSS). Although these parameters are influenced by particle sizes, neither of them characterizes the particle size distribution (PSD), which is of great importance in pollutant entrainment and treatment performance. Therefore, the ratio of turbidity to TSS (Tur/TSS) is proposed and validated as a potential surrogate for the bulk PSD and quality of stormwater runoff. The results show an increasing trend of Tur/TSS with finer sizes of both RDS and stormwater runoff. Taking heavy metals (HMs, including Cu, Pb, Zn, Cr, and Ni) as typical pollutants in stormwater runoff, the concentrations (mg/kg) were found to vary significantly during rainfall events and tended to increase significantly with Tur/TSS. Therefore, Tur/TSS is a valid parameter to characterize the PSD and quality of stormwater. The high negative correlations between Tur/TSS and rainfall intensity demonstrate that stormwater with higher Tur/TSS generates under low intensity and, thus, characterizes small volume, finer sizes, weak settleability, greater mobility, and bioavailability. Conversely, stormwater with lower Tur/TSS generates under high intensity and, thus, characterizes large volume, coarser sizes, good settleability, low mobility, and bioavailability. These results highlight the need to control stormwater with high Tur/TSS. Moreover, Tur/TSS can aid the selection of stormwater control measures with appropriate detention storage, pollution loading, and removal effectiveness of particles.

Reducing nitrogen runoff from paddy fields with arbuscular mycorrhizal fungi under different fertilizer regimes.

Science.gov (United States)

Zhang, Shujuan; Wang, Li; Ma, Fang; Zhang, Xue; Fu, Dafang

2016-08-01

Nitrogen (N) runoff from paddy fields serves as one of the main sources of water pollution. Our aim was to reduce N runoff from paddy fields by fertilizer management and inoculation with arbuscular mycorrhizal fungi (AMF). In northeast China, Shuangcheng city in Heilongjiang province, a field experiment was conducted, using rice provided with 0%, 20%, 40%, 60%, 80%, and 100% of the local norm of fertilization (including N, phosphorus and potassium), with or without inoculation with Glomus mosseae. The volume, concentrations of total N (TN), dissolved N (DN) and particulate N (PN) of runoff water were measured. We found that the local norm of fertilization led to 18.9kg/ha of N runoff during rice growing season, with DN accounting for 60%-70%. We also found that reduction in fertilization by 20% cut down TN runoff by 8.2% while AMF inoculation decreased N runoff at each fertilizer level and this effect was inhibited by high fertilization. The combination of inoculation with AMF and 80% of the local norm of fertilization was observed to reduce N runoff by 27.2%. Conclusively, we suggested that the contribution of AMF inoculation combined with decreasing fertilization should get more attention to slow down water eutrophication by reducing N runoff from paddy fields. Copyright © 2016. Published by Elsevier B.V.

Agroforestry practices, runoff, and nutrient loss: a paired watershed comparison.

Science.gov (United States)

Udawatta, Ranjith P; Krstansky, J John; Henderson, Gray S; Garrett, Harold E

2002-01-01

A paired watershed study consisting of agroforestry (trees plus grass buffer strips), contour strips (grass buffer strips), and control treatments with a corn (Zea mays L.)-soybean [Glycine max (L.) Merr.] rotation was used to examine treatment effects on runoff, sediment, and nutrient losses. During the (1991-1997) calibration and subsequent three-year treatment periods, runoff was measured in 0.91- and 1.37-m H-flumes with bubbler flow meters. Composite samples were analyzed for sediment, total phosphorus (TP), total nitrogen (TN), nitrate, and ammonium. Calibration equations developed to predict runoff, sediment, and nutrients losses explained 66 to 97% of the variability between treatment watersheds. The contour strip and agroforestry treatments reduced runoff by 10 and 1% during the treatment period. In both treatments, most runoff reductions occurred in the second and third years after treatment establishment. The contour strip treatment reduced erosion by 19% in 1999, while erosion in the agroforestry treatment exceeded the predicted loss. Treatments reduced TP loss by 8 and 17% on contour strip and agroforestry watersheds. Treatments did not result in reductions in TN during the first two years of the treatment period. The contour strip and agroforestry treatments reduced TN loss by 21 and 20%, respectively, during a large precipitation event in the third year. During the third year of treatments, nitrate N loss was reduced 24 and 37% by contour strip and agroforestry treatments. Contour strip and agroforestry management practices effectively reduced nonpoint-source pollution in runoff from a corn-soybean rotation in the clay pan soils of northeastern Missouri.

A protocol for conducting rainfall simulation to study soil runoff.

Science.gov (United States)

Kibet, Leonard C; Saporito, Louis S; Allen, Arthur L; May, Eric B; Kleinman, Peter J A; Hashem, Fawzy M; Bryant, Ray B

2014-04-03

Rainfall is a driving force for the transport of environmental contaminants from agricultural soils to surficial water bodies via surface runoff. The objective of this study was to characterize the effects of antecedent soil moisture content on the fate and transport of surface applied commercial urea, a common form of nitrogen (N) fertilizer, following a rainfall event that occurs within 24 hr after fertilizer application. Although urea is assumed to be readily hydrolyzed to ammonium and therefore not often available for transport, recent studies suggest that urea can be transported from agricultural soils to coastal waters where it is implicated in harmful algal blooms. A rainfall simulator was used to apply a consistent rate of uniform rainfall across packed soil boxes that had been prewetted to different soil moisture contents. By controlling rainfall and soil physical characteristics, the effects of antecedent soil moisture on urea loss were isolated. Wetter soils exhibited shorter time from rainfall initiation to runoff initiation, greater total volume of runoff, higher urea concentrations in runoff, and greater mass loadings of urea in runoff. These results also demonstrate the importance of controlling for antecedent soil moisture content in studies designed to isolate other variables, such as soil physical or chemical characteristics, slope, soil cover, management, or rainfall characteristics. Because rainfall simulators are designed to deliver raindrops of similar size and velocity as natural rainfall, studies conducted under a standardized protocol can yield valuable data that, in turn, can be used to develop models for predicting the fate and transport of pollutants in runoff.

Using a topographic index to distribute variable source area runoff predicted with the SCS curve-number equation

Science.gov (United States)

Lyon, Steve W.; Walter, M. Todd; Gérard-Marchant, Pierre; Steenhuis, Tammo S.

2004-10-01

Because the traditional Soil Conservation Service curve-number (SCS-CN) approach continues to be used ubiquitously in water quality models, new application methods are needed that are consistent with variable source area (VSA) hydrological processes in the landscape. We developed and tested a distributed approach for applying the traditional SCS-CN equation to watersheds where VSA hydrology is a dominant process. Predicting the location of source areas is important for watershed planning because restricting potentially polluting activities from runoff source areas is fundamental to controlling non-point-source pollution. The method presented here used the traditional SCS-CN approach to predict runoff volume and spatial extent of saturated areas and a topographic index, like that used in TOPMODEL, to distribute runoff source areas through watersheds. The resulting distributed CN-VSA method was applied to two subwatersheds of the Delaware basin in the Catskill Mountains region of New York State and one watershed in south-eastern Australia to produce runoff-probability maps. Observed saturated area locations in the watersheds agreed with the distributed CN-VSA method. Results showed good agreement with those obtained from the previously validated soil moisture routing (SMR) model. When compared with the traditional SCS-CN method, the distributed CN-VSA method predicted a similar total volume of runoff, but vastly different locations of runoff generation. Thus, the distributed CN-VSA approach provides a physically based method that is simple enough to be incorporated into water quality models, and other tools that currently use the traditional SCS-CN method, while still adhering to the principles of VSA hydrology.

Use of modified pine bark for removal of pesticides from stormwater runoff

Science.gov (United States)

Mandla A. Tshabalala

2003-01-01

Pesticide entrainment in stormwater runoff can contribute to non-point source pollution of surface waters. Granular activated carbon has been successfully used for removing pesticides from wastewater. However, implementation of granular activated carbon sorption media in stormwater filtration systems comes with high initial capital investment and operating costs....

Analysis of one dimension migration law from rainfall runoff on urban roof

Science.gov (United States)

Weiwei, Chen

2017-08-01

Research was taken on the hydrology and water quality process in the natural rain condition and water samples were collected and analyzed. The pollutant were included SS, COD and TN. Based on the mass balance principle, one dimension migration model was built for the rainfall runoff pollution in surface. The difference equation was developed according to the finite difference method, by applying the Newton iteration method for solving it. The simulated pollutant concentration process was in consistent with the measured value on model, and Nash-Sutcliffe coefficient was higher than 0.80. The model had better practicability, which provided evidence for effectively utilizing urban rainfall resource, non-point source pollution of making management technologies and measures, sponge city construction, and so on.

Impact of environment on mosquito response to pyrethroid insecticides: facts, evidences and prospects.

Science.gov (United States)

Nkya, Theresia Estomih; Akhouayri, Idir; Kisinza, William; David, Jean-Philippe

2013-04-01

By transmitting major human diseases such as malaria, dengue fever and filariasis, mosquito species represent a serious threat worldwide in terms of public health, and pose a significant economic burden for the African continent and developing tropical regions. Most vector control programmes aiming at controlling life-threatening mosquitoes rely on the use of chemical insecticides, mainly belonging to the pyrethroid class. However, resistance of mosquito populations to pyrethroids is increasing at a dramatic rate, threatening the efficacy of control programmes throughout insecticide-treated areas, where mosquito-borne diseases are still prevalent. In the absence of new insecticides and efficient alternative vector control methods, resistance management strategies are therefore critical, but these require a deep understanding of adaptive mechanisms underlying resistance. Although insecticide resistance mechanisms are intensively studied in mosquitoes, such adaptation is often considered as the unique result of the selection pressure caused by insecticides used for vector control. Indeed, additional environmental parameters, such as insecticides/pesticides usage in agriculture, the presence of anthropogenic or natural xenobiotics, and biotic interactions between vectors and other organisms, may affect both the overall mosquito responses to pyrethroids and the selection of resistance mechanisms. In this context, the present work aims at updating current knowledge on pyrethroid resistance mechanisms in mosquitoes and compiling available data, often from different research fields, on the impact of the environment on mosquito response to pyrethroids. Key environmental factors, such as the presence of urban or agricultural pollutants and biotic interactions between mosquitoes and their microbiome are discussed, and research perspectives to fill in knowledge gaps are suggested. Copyright © 2012 Elsevier Ltd. All rights reserved.

Detecting surface runoff location in a small catchment using distributed and simple observation method

Science.gov (United States)

Dehotin, Judicaël; Breil, Pascal; Braud, Isabelle; de Lavenne, Alban; Lagouy, Mickaël; Sarrazin, Benoît

2015-06-01

Surface runoff is one of the hydrological processes involved in floods, pollution transfer, soil erosion and mudslide. Many models allow the simulation and the mapping of surface runoff and erosion hazards. Field observations of this hydrological process are not common although they are crucial to evaluate surface runoff models and to investigate or assess different kinds of hazards linked to this process. In this study, a simple field monitoring network is implemented to assess the relevance of a surface runoff susceptibility mapping method. The network is based on spatially distributed observations (nine different locations in the catchment) of soil water content and rainfall events. These data are analyzed to determine if surface runoff occurs. Two surface runoff mechanisms are considered: surface runoff by saturation of the soil surface horizon and surface runoff by infiltration excess (also called hortonian runoff). The monitoring strategy includes continuous records of soil surface water content and rainfall with a 5 min time step. Soil infiltration capacity time series are calculated using field soil water content and in situ measurements of soil hydraulic conductivity. Comparison of soil infiltration capacity and rainfall intensity time series allows detecting the occurrence of surface runoff by infiltration-excess. Comparison of surface soil water content with saturated water content values allows detecting the occurrence of surface runoff by saturation of the soil surface horizon. Automatic records were complemented with direct field observations of surface runoff in the experimental catchment after each significant rainfall event. The presented observation method allows the identification of fast and short-lived surface runoff processes at a small spatial and temporal resolution in natural conditions. The results also highlight the relationship between surface runoff and factors usually integrated in surface runoff mapping such as topography, rainfall

Modelling water fluxes for the analysis of diffuse pollution at the river basin scale

NARCIS (Netherlands)

Wit, de M.; Meinardi, C.R.; Wendland, F.; Kunkel, R.

2000-01-01

Diffuse pollution is a significant and sometimes even major component of surface water pollution. Diffuse inputs of pollutants to the surface water are related to runoff of precipitation. This means that the analysis of diffuse pollutant fluxes from the land surface to the surface water requires an

Botanical Insecticides in Plant Protection

OpenAIRE

Grdiša, Martina; Gršić, Kristina

2013-01-01

Botanical insecticides are natural compounds with insecticidal properties and their use in crop protection is as old as agricultural practice. Although they have been in use for over one hundred years, the advent of synthetic insecticides has unfortunately displaced their use today. Due to fast action, low cost, easy application and efficiency against a wide range of harmful species, synthetic insecticides have become an important part of pest management in modern agricultural systems....

A Summary of Best Management Practices for Nonpoint Source Pollution

Science.gov (United States)

1992-08-01

and concrete block material, and structures and systems for soil stabilization including erosion checks, revetments , retaining structures, and...industrial storage areas, and coal/ slag piles. Rural NPS pollution includes runoff from Some of the above sources plus runoff from agriculture...water quality. The effectiveness of detention ponds is reduced, however, when maintenance is neglected. Common problems include blocked outlets

General assessment of estuarine pollution

Indian Academy of Sciences (India)

First page Back Continue Last page Overview Graphics. General assessment of estuarine pollution. Contamination of estuaries by untreated domestic wastewater is widespread, however, in absence of time-series studies the responses of native flora and fauna to modified environment are unclear. Agricultural runoff ...

[Characteristics of Nitrogen and Phosphorus Losses in Longhong Ravine Basin of Westlake in Rainstorm Runoff].

Science.gov (United States)

Yang, Fan; Jiang, Yi-feng; Wang, Cui-cui; Huang, Xiao-nan; Wu, Zhi-ying; Chen, Lin

2016-01-15

In order to understand the non-point source pollution status in Longhong ravine basin of Westlake, the characteristics of nutrient losses in runoff was investigated during three rainstorms in one year. The results showed that long duration rainstorm event generally formed several runoff peaks, and the time of its lag behind the peaks of rain intensity was dependent on the distribution of heavy rainfall. The first flush was related to the antecedent rainfall, and the less rainfall in the earlier period, the more total phosphorus (TP) and ammonia (NH4+ -N) in runoff was washed off. During the recession of runoff, more subsurface runoff would result in a concentration peak of total nitrogen (TN) and nitrogen (NO3- -N) . The event mean concentration (EMC) of runoff nitrogen had a negative correlation with rainfall, rainfall duration, maximum rain intensity and average rain intensity except for antecedent rainfall, whereas the change in TP EMC showed the opposite trend. The transport fluxes of nutrients increased with an elevation in runoffs, and Pearson analysis showed that the transport fluxes of TN and NO3- -N had good correlations with runoff depth. The average transport fluxes of TP, TN, NH4+ -N and NO3- -N were 34.10, 1195.55, 1006.62 and 52.38 g x hm(-2), respectively, and NO3- -N was the main nitrogen form and accounted for 84% of TN.

URBAN RUNOFF POLLUTION CONTROL - STATE-OF-THE-ART

Science.gov (United States)

Combined sewer overflows are major sources of water pollution problems, but even discharges of stormwater alone can seriously affect water quality. Current approaches involve control of overflows, treatment, and combinations of the two. Control may involve maximizing treatment wi...

The protection of urban areas from surface wastewater pollutions

Directory of Open Access Journals (Sweden)

Vialkova Elena

2017-01-01

Full Text Available In this paper it considered the problem of collection, treatment and discharge into waters of rain and melted wastewater. To reduce the load on the combined sewer system, there are engineering solutions collect rain and melt water for use in the irrigation of lawns and green spaces. Research carried out at the department “Water supply and sanitation”, (Russia, confirm the high pollution concentrations of meltwater and rainfall in urban arias. Series of measurements of heavy metal in rainwater runoff carried out in Hungary demonstrates clearly the differences in concentrations in the function of distance from the edge of the road. Also differences are introduced between pollution concentrations in runoff water from within and outside urban traffic roads. The quality of snow cover, forming meltwater is observed to be changing in dependence on roadway location. Quality characteristics of surface runoff and its sediments can be effectively improved with super-high frequency radiation (SHF treatment which is presented in this paper.

Event-based nonpoint source pollution prediction in a scarce data catchment

Science.gov (United States)

Chen, Lei; Sun, Cheng; Wang, Guobo; Xie, Hui; Shen, Zhenyao

2017-09-01

Quantifying the rainfall-runoff-pollutant (R-R-P) process is key to regulating non-point source (NPS) pollution; however, the impacts of scarce measured data on R-R-P simulations have not yet been reported. In this study, we conducted a comprehensive study of scarce data that addressed both rainfall-runoff and runoff-pollutant processes, whereby the impacts of data scarcity on two commonly used methods, including Unit Hydrograph (UH) and Loads Estimator (LOADEST), were quantified. A case study was performed in a typical small catchment of the Three Gorges Reservoir Region (TGRR) of China. Based on our results, the classification of rainfall patterns should be carried out first when analyzing modeling results. Compared to data based on a missing rate and a missing location, key information generates more impacts on the simulated flow and NPS loads. When the scarcity rate exceeds a certain threshold (20% in this study), measured data scarcity level has clear impacts on the model's accuracy. As the model of total nitrogen (TN) always performs better under different data scarcity conditions, researchers are encouraged to pay more attention to continuous the monitoring of total phosphorus (TP) for better NPS-TP predictions. The results of this study serve as baseline information for hydrologic forecasting and for the further control of NPS pollutants.

Relationship Between Accumulation and Influx of Pollutants in Highway Ponds

DEFF Research Database (Denmark)

Bentzen, Thomas Ruby; Larsen, Torben; Rasmussen, Michael R.

The paper discusses the long term mass balance of pollutants in highway ponds. The accumulations of five polycyclic aromatic hydrocarbons (PAHs) and six heavy metals have been measured in eight Danish detention ponds, which receive runoff from highways only. For each pollutant the accumulation has...... been compared to the long-term influx, estimated from short-term measurements of concentrations in highway runoff. The results show that a large proportion of the incoming heavy metals in short-term runoff events has accumulated in the ponds. This is not the case for the toxic organic compounds....... The results also show that the accumulation rates for the heavy metals depend significantly on the relative pond area (pond area divided by catchment area). The conclusion is that the mass balances of heavy metals and PAHs in highway ponds can be estimated with acceptable accuracy from a combination of short...

Export Mechanisms of Persistent Toxic Substances (PTSs) in Urban Land Uses during Rainfall-Runoff Events: Experimental and Modeling Studies

Science.gov (United States)

Zheng, Y.; Luo, X.; Lin, Z.

2016-12-01

The urban environment has a variety of Persistent Toxic Substances (PTS), such as Polycyclic Aromatic Hydrocarbons (PAHs) and mercury. Soil in pervious lands and dust deposited on impervious surfaces are two major sinks of PTSs in urbanized areas, which could contribute significant nonpoint source loadings of PTSs to adjacent waterbodies during rainfall-runoff events and therefore jeopardize aquatic ecosystems. However, PTSs have been much less understood regarding their export mechanisms in urban land uses, and efforts to model nonpoint source pollution processes of PTSs have been rare. We designed and performed in-lab rainfall-runoff simulation experiments to investigate transport of PAHs and mercury by runoff from urban soils. Organic petrology analysis (OPA) techniques were introduced to analyze the soil and sediment compositions. Our study revealed the limitation of the classic enrichment theory which attributes enrichment of pollutants in eroded sediment solely to the sediment's particle size distribution and adopts simple relationships between enrichment ratio and sediment flux. We found that carbonaceous materials (CMs) in soil are the direct and major sorbents for PAHs and mercury, and highly different in content, mobility and adsorption capacity for the PTSs. Anthropogenic CMs like black carbon components largely control the transport of soil PAHs, while humic substances have a dominant influence on the transport of soil mercury. A model was further developed to estimate the enrichment ratio of PAHs, which innovatively applies the fugacity concept.We also conducted field studies on export of PAHs by runoff from urban roads. A variable time-step model was developed to simulate the continuous cycles of PAH buildup and washoff on urban roads. The dependence of the pollution level on antecedent weather conditions was investigated and embodied in the model. The applicability of this approach and its value to environmental management was demonstrated by a case

Metamodeling as a tool to size vegetative filter strips for surface runoff pollution control in European watersheds.

Science.gov (United States)

Lauvernet, Claire; Muñoz-Carpena, Rafael; Carluer, Nadia

2015-04-01

In Europe, a significant presence of contaminants is found in surface water, partly due to pesticide applications. Vegetative filter strips or buffer zones (VFS), often located along rivers, are a common best management practice (BMP) to reduce non point source pollution of water by reducing surface runoff. However, they need to be adapted to the agro-ecological and climatic conditions, both in terms of position and size, in order to be efficient. The TOPPS-PROWADIS project involves European experts and stakeholders to develop and recommend BMPs to reduce pesticide transfer by drift or runoff in several European countries. In this context, IRSTEA developed a guide accompanying the use of different tools, which allows designing site-specific VFS by simulating their efficiency to limit transfers using the mechanistic model VFSMOD. This method which is very complete assumes that the user provides detailed field knowledge and data, which are not always easily available. The aim of this study is to assist the buffer sizing by using a unique tool with a reduced set of parameters, adapted to the available information from the end-users. In order to fill in the lack of real data in many practical applications, a set of virtual scenarios was selected to encompass a large range of agro-pedo-climatic conditions in Europe, considering both the upslope agricultural field and the VFS characteristics. As a first step first, in this work we present scenarios based on North-West of France climate consisting of different rainfall intensities and durations, hillslope lengths and slopes, humidity conditions, a large set of field rainfall/runoff characteristics for the contributing area, and several shallow water table depths and soil types for the VFS. The sizing method based on the mechanistic model VFSMOD was applied for all these scenarios, and a global sensitivity analysis (GSA) of the VFS optimal length was performed for all the input parameters in order to understand their

Assessment of heavy metals, pH and EC in effluent run-off, river and ...

African Journals Online (AJOL)

Heavy metal contents from effluent run-off, neighboring Holeta River, and adjacent soils around floriculture greenhouses in Holeta town, Ethiopia were determined using Atomic Absorption Spectrophotometer (AAS) to assess their potentialities as pollutants. Samples were taken from four sites for the effluent, two river bank ...

Phosphorus runoff from sewage sludge applied to different slopes of lateritic soil.

Science.gov (United States)

Chen, Yan Hui; Wang, Ming Kuang; Wang, Guo; Chen, Ming Hua; Luo, Dan; Ding, Feng Hua; Li, Rong

2011-01-01

Sewage sludge (SS) applied to sloping fields at rates that exceed annual forest nutrient requirements can be a source of phosphorus (P) in runoff. This study investigates the effects of different slopes (18, 27, 36, and 45%) on P in runoff from plots amended with SS (120 Mg ha). Lateritic soil (pH 5.2) was exposed to five simulated rainfalls (90 mm h) on outdoor plots. When sludge was broadcast and mixed with surface soils, the concentrations and loss in runoff of total P in the mixed sample (MTP), total P in the settled sample (STP), total particulate P (TPP), total suspended P (TSP), and total dissolved P (TDP) were highest at 1 or 18 d after application. Initially, pollution risks to surface waters generally increased to different degrees with steeper slopes, and then diminished gradually with dwindling differences between the slopes. The runoff losses coefficient of MTP increased in the order 36 > 45 > 27 > 18%. The initial event (1 and 18 d) accounted for 67.0 to 83.6% of total runoff P losses. Particulate fraction were dominant carriers for P losses, while with the lower slopes there was higher content of P per unit particulate fraction in runoff. Phosphorus losses were greatly affected by the interaction of sludge-soil-runoff and the modification of soil properties induced by sludge amendment. It is recommended to choose lower slopes (soils should be studied further in the field under a wider diversity of conditions. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

Exploration of Novel Botanical Insecticide Leads: Synthesis and Insecticidal Activity of β-Dihydroagarofuran Derivatives.

Science.gov (United States)

Zhao, Ximei; Xi, Xin; Hu, Zhan; Wu, Wenjun; Zhang, Jiwen

2016-02-24

The discovery of novel leads and new mechanisms of action is of vital significance to the development of pesticides. To explore lead compounds for botanical insecticides, 77 β-dihydroagarofuran derivatives were designed and synthesized. Their structures were mainly confirmed by (1)H NMR, (13)C NMR, DEPT-135°, IR, MS, and HRMS. Their insecticidal activity was evaluated against the third-instar larvae of Mythimna separata Walker, and the results indicated that, of these derivatives, eight exhibited more promising insecticidal activity than the positive control, celangulin-V. Particularly, compounds 5.7, 6.6, and 6.7 showed LD50 values of 37.9, 85.1, and 21.1 μg/g, respectively, which were much lower than that of celangulin-V (327.6 μg/g). These results illustrated that β-dihydroagarofuran ketal derivatives can be promising lead compounds for developing novel mechanism-based and highly effective botanical insecticides. Moreover, some newly discovered structure-activity relationships are discussed, which may provide some important guidance for insecticide development.

Improving risk estimates of runoff producing areas: formulating variable source areas as a bivariate process.

Science.gov (United States)

Cheng, Xiaoya; Shaw, Stephen B; Marjerison, Rebecca D; Yearick, Christopher D; DeGloria, Stephen D; Walter, M Todd

2014-05-01

Predicting runoff producing areas and their corresponding risks of generating storm runoff is important for developing watershed management strategies to mitigate non-point source pollution. However, few methods for making these predictions have been proposed, especially operational approaches that would be useful in areas where variable source area (VSA) hydrology dominates storm runoff. The objective of this study is to develop a simple approach to estimate spatially-distributed risks of runoff production. By considering the development of overland flow as a bivariate process, we incorporated both rainfall and antecedent soil moisture conditions into a method for predicting VSAs based on the Natural Resource Conservation Service-Curve Number equation. We used base-flow immediately preceding storm events as an index of antecedent soil wetness status. Using nine sub-basins of the Upper Susquehanna River Basin, we demonstrated that our estimated runoff volumes and extent of VSAs agreed with observations. We further demonstrated a method for mapping these areas in a Geographic Information System using a Soil Topographic Index. The proposed methodology provides a new tool for watershed planners for quantifying runoff risks across watersheds, which can be used to target water quality protection strategies. Copyright © 2014 Elsevier Ltd. All rights reserved.

Bioaccumulation of heavy metals in fauna from wet detention ponds for stormwater runoff

DEFF Research Database (Denmark)

Stephansen, Diana; Nielsen, Asbjørn Haaning; Hvitved-Jacobsen, Thorkild

2012-01-01

Stormwater detention ponds remove pollutants e.g. heavy metals and nutrients from stormwater runoff. These pollutants accumulate in the pond sediment and thereby become available for bioaccumulation in fauna living in the ponds. In this study the bioaccumulation was investigated by fauna samples...... from 5 wet detention ponds for analyses of heavy metal contents. Five rural shallow lakes were included in the study to survey the natural occurrence of heavy metals in water-dwelling fauna. Heavy metal concentrations in water-dwelling fauna were generally found higher in wet detention ponds compared...

Vegetated agricultural drainage ditches for the mitigation of pyrethroid-associated runoff.

Science.gov (United States)

Bennett, Erin R; Moore, Matthew T; Cooper, Charles M; Smith, Sammie; Shields, F Douglas; Drouillard, Ken G; Schulz, Ralf

2005-09-01

Drainage ditches are indispensable components of the agricultural production landscape. A benefit of these ditches is contaminant mitigation of agricultural storm runoff. This study determined bifenthrin and lambda-cyhalothrin (two pyrethroid insecticides) partitioning and retention in ditch water, sediment, and plant material as well as estimated necessary ditch length required for effective mitigation. A controlled-release runoff simulation was conducted on a 650-m vegetated drainage ditch in the Mississippi Delta, USA. Bifenthrin and lambda-cyhalothrin were released into the ditch in a water-sediment slurry. Samples of water, sediment, and plants were collected and analyzed for pyrethroid concentrations. Three hours following runoff initiation, inlet bifenthrin and lambda-cyhalothrin water concentrations ranged from 666 and 374 microg/L, respectively, to 7.24 and 5.23 microg/L at 200 m downstream. No chemical residues were detected at the 400-m sampling site. A similar trend was observed throughout the first 7 d of the study where water concentrations were elevated at the front end of the ditch (0-25 m) and greatly reduced by the 400-m sampling site. Regression formulas predicted that bifenthrin and lambda-cyhalothrin concentrations in ditch water were reduced to 0.1% of the initial value within 280 m. Mass balance calculations determined that ditch plants were the major sink and/or sorption site responsible for the rapid aqueous pyrethroid dissipation. By incorporating vegetated drainage ditches into a watershed management program, agriculture can continue to decrease potential non-point source threats to downstream aquatic receiving systems. Overall results of this study illustrate that aquatic macrophytes play an important role in the retention and distribution of pyrethroids in vegetated agricultural drainage ditches.

Methodology for Identifying and Quantifying Metal Pollutant Sources in Storm Water Runoff

Science.gov (United States)

2015-02-01

sanitary sewer are not viable options. In addition, visual inspections of the drainage areas have been insufficient in identifying and quantifying the...diverting the runoff into the sanitary sewer system, but the cost could exceed millions of dollars. Instead of capturing and treating all stormwater...Unknown Appears only if Building Siding is “metal” Roof Material roof_mat_d Built Up, Metal Panel, Asphalt, Fabric, Clay , Slate, Wood, Other

Estimating Subcatchment Runoff Coefficients using Weather Radar and a Downstream Runoff Sensor

DEFF Research Database (Denmark)

Ahm, Malte; Thorndahl, Søren Liedtke; Rasmussen, Michael R.

2013-01-01

This paper presents a method for estimating runoff coefficients of urban drainage subcatchments based on a combination of high resolution weather radar data and flow measurements from a downstream runoff sensor. By utilising the spatial variability of the precipitation it is possible to estimate...... the runoff coefficients of the separate subcatchments. The method is demonstrated through a case study of an urban drainage catchment (678 ha) located in the city of Aarhus, Denmark. The study has proven that it is possible to use corresponding measurements of the relative rainfall distribution over...... the catchment and downstream runoff measurements to identify the runoff coefficients at subcatchment level....

Estimating subcatchment runoff coefficients using weather radar and a downstream runoff sensor.

Science.gov (United States)

Ahm, Malte; Thorndahl, Søren; Rasmussen, Michael R; Bassø, Lene

2013-01-01

This paper presents a method for estimating runoff coefficients of urban drainage subcatchments based on a combination of high resolution weather radar data and flow measurements from a downstream runoff sensor. By utilising the spatial variability of the precipitation it is possible to estimate the runoff coefficients of the separate subcatchments. The method is demonstrated through a case study of an urban drainage catchment (678 ha) located in the city of Aarhus, Denmark. The study has proven that it is possible to use corresponding measurements of the relative rainfall distribution over the catchment and downstream runoff measurements to identify the runoff coefficients at subcatchment level.

Biological water contamination in some cattle production fields of Argentina subjected to runoff and erosion

Directory of Open Access Journals (Sweden)

Celio I. Chagas

2014-10-01

Full Text Available Grain production has displaced livestock to marginal lands in most of the productive regions in Argentina since 1990. In the fertile Rolling Pampa region, extensive cattle production has been concentrated in lowlands subjected to flooding, salt excess, erosion and sedimentation processes but also in some feedlots recently located in sloping arable lands prone to soil erosion. We studied the concentration of microbiological contamination indicators in runoff water and sediments accumulated in depressions along the tributary network from these lands devoted to cattle production. The aims of this work were: (i to gather a reliable set of data from different monitoring periods and scales, (ii to search for simple and sensible variables to be used as indicators for surface water quality advising purposes and (iii to corroborate previous biological contamination conceptual models for this region. Concentration of pollution indicators in these ponds was related to mean stocking rates from nearby fields and proved to depend significantly on the accumulated water and sediments. Viable mesophiles and total coliforms were found mainly attached to large sediments rather than in the runoff water phase. Seasonal sampling showed that the time period between the last significant runoff event and each sampling date regarding enterococci proved to be a sensible variable for predicting contamination. Enterococci concentration tended to increase gradually until the next extraordinary runoff event washed away contaminants. The mentioned relationship may be useful for designing early warning surface water contamination programs regarding enterococci dynamics and other related microbial pollutants as well.

How and when urban vehicular traffic pollutes the environment

International Nuclear Information System (INIS)

Cera, L.; Di Mascio, P.

1993-01-01

This paper first compares monitored values of urban traffic air and noise pollution with Italian and European Communities pollution limits to assess the efficacy of current and proposed pollution regulations. The paper then focuses on the environmental impacts of the generation and discharge of waste waters during the construction and use of road surfaces. The related problems discussed include: soil erosion due to the increased exposure of bordering terrestrial ecosystems to damaging atmospheric pollutants; and the reception by roadside land areas of pollutants absorbed in rainfall runoff which has come into contact with road surfaces. Some suggestions are made on how to abate these particular types of traffic derived pollutants

Field application of farmstead runoff to vegetated filter strips: surface and subsurface water quality assessment.

Science.gov (United States)

Larson, Rebecca A; Safferman, Steven I

2012-01-01

Farmstead runoff poses significant environmental impacts to ground and surface waters. Three vegetated filter strips were assessed for the treatment of dairy farmstead runoff at the soil surface and subsurface at 0.3- or 0. 46-m and 0. 76-m depths for numerous storm events. A medium-sized Michigan dairy was retrofitted with two filter strips on sandy loam soil and a third filter strip was implemented on a small Michigan dairy with sandy soil to collect and treat runoff from feed storage, manure storage, and other impervious farmstead areas. All filter strips were able to eliminate surface runoff via infiltration for all storm events over the duration of the study, eliminating pollutant contributions to surface water. Subsurface effluent was monitored to determine the contributing groundwater concentrations of numerous pollutants including chemical oxygen demand (COD), metals, and nitrates. Subsurface samples have an average reduction of COD concentrations of 20, 11, and 85% for the medium dairy Filter Strip 1 (FS1), medium dairy Filter Strip 2 (FS2), and the small Michigan dairy respectively, resulting in average subsurface concentrations of 355, 3960, and 718 mg L COD. Similar reductions were noted for ammonia and total Kjeldahl nitrogen (TKN) in the subsurface effluent. The small Michigan dairy was able to reduce the pollutant leachate concentrations of COD, TKN, and ammonia over a range of influent concentrations. Increased influent concentrations in the medium Michigan dairy filter strips resulted in an increase in COD, TKN, and ammonia concentrations in the leachate. Manganese was leached from the native soils at all filter strips as evidenced by the increase in manganese concentrations in the leachate. Nitrate concentrations were above standard drinking water limits (10 mg L), averaging subsurface concentrations of 11, 45, and 25 mg L NO-N for FS1, FS2, and the small Michigan dairy, respectively. Copyright © by the American Society of Agronomy, Crop Science

Enhanced degradation of spiro-insecticides and their leacher enol derivatives in soil by solarization and biosolarization techniques.

Science.gov (United States)

Fenoll, José; Garrido, Isabel; Vela, Nuria; Ros, Caridad; Navarro, Simón

2017-04-01

The leaching potential of three insecticides (spirodiclofen, spiromesifen, and spirotetramat) was assessed using disturbed soil columns. Small quantities of spirodiclofen and spiromesifen were detected in leachate fraction, while spirotetramat residues were not found in the leachates. In addition, the transformation products (enol derivatives) are relatively more mobile than the parent compounds and may leach into groundwater. Moreover, the use of disinfection soil techniques (solarization and biosolarization) to enhance their degradation rates in soil was investigated. The results show that both practices achieved a reduction in the number of juvenile nematodes, enhancing in a parallel way degradation rates of the insecticides and their enol derivatives as compared with the non-disinfected soil. This behavior can be mainly attributed to the increase in soil temperature and changes in microbial activity. All insecticides showed similar behavior under solarization and biosolarization conditions. As a consequence, both agronomic techniques could be considered as suitable strategies for detoxification of soils polluted with the studied pesticides.

Pollution loads from stormwater overflows

International Nuclear Information System (INIS)

Bonomo, L.

1991-01-01

The knowledge of the volume of combined effluents outflowing from overflows is not enough to allow a direct evaluation of polluting loads discharged into final receptors; the hypothesis of complete mixing between sewage and stormwater flow, fed in at a pollutant concentration level equal to zero, hasn't proved to be successful. The amount of the outflowing loads largely depends on the contamination of the stormwater runoff before inflow into the drainage system and on sedimentation and resuspension phenomena. This paper reports the main aspects connected with wet and dry atmospheric deposition of pollutants and with paved surface wash-out phenomena. The origin of pollutants flush, due to the resuspension and mass transport of polluting substances stored up in the sewer during draughts, is also described. Attention is drawn to the importance of the behaviour of the different pollutants with respect to the sedimentation phenomena. Reference is made to evaluations conducted on a drainage system for the recovery of a small pre-alpine lake

Can We Manage Nonpoint-Source Pollution Using Nutrient Concentrations during Seasonal Baseflow?

Directory of Open Access Journals (Sweden)

James A. McCarty

2016-05-01

Full Text Available Nationwide, a substantial amount of resources has been targeted toward improving water quality, particularly focused on nonpoint-source pollution. This study was conducted to evaluate the relationship between nutrient concentrations observed during baseflow and runoff conditions from 56 sites across five watersheds in Arkansas. Baseflow and stormflow concentrations for each site were summarized using geometric mean and then evaluated for directional association. A significant, positive correlation was found for NO–N, total N, soluble reactive P, and total P, indicating that sites with high baseflow concentrations also had elevated runoff concentrations. Those landscape factors that influence nutrient concentrations in streams also likely result in increased runoff, suggesting that high baseflow concentrations may reflect elevated loads from the watershed. The results highlight that it may be possible to collect water-quality data during baseflow to help define where to target nonpoint-source pollution best management practices within a watershed.

A comparative study of the grain-size distribution of surface dust and stormwater runoff quality on typical urban roads and roofs in Beijing, China.

Science.gov (United States)

Shen, Zhenyao; Liu, Jin; Aini, Guzhanuer; Gong, Yongwei

2016-02-01

The deposition of pollutants on impervious surfaces is a serious problem associated with rapid urbanization, which results in non-point-source pollution. Characterizing the build-up and wash-off processes of pollutants in urban catchments is essential for urban planners. In this paper, the spatial variation and particle-size distributions of five heavy metals and two nutrients in surface dust were analyzed, and the runoff water first-flush effect (FF30) and event-mean concentrations (EMCs) of 10 common constituents were characterized. The relationships between runoff variables and stormwater characteristics were examined from three typical urban impervious surfaces in Beijing, China. Dust on road surfaces with smaller grain sizes had higher pollutant concentrations, whereas concentrations of Mn, Zn, Fe, and TP in roof surface dust increased with grain size. Particles with grain sizes of 38-74 and 125-300 μm contributed most to the total pollutant load in roads, while particles with the smallest grain sizes (roads. The maximum intensity (I max) and the antecedent dry days (ADD) were critical parameters for EMCs in roads, while ADD was the only dominant parameter for EMCs on our studied roof. The rainfall intensity (RI) and maximum intensity (I max) were found to be the parameters with the strongest correlation to the first-flush effect on both roads and roofs. Significant correlations of total suspended solids (TSS) concentration in runoff with grain-size fractions of surface dust indicated that coarser particles (74-300 μm) are most likely to contribute to the solid-phase pollutants, and finer particles (<38 μm) are likely the main source of dissolved pollutants.

Evaluating the effectiveness of management practices on hydrology and water quality at watershed scale with a rainfall-runoff model.

Science.gov (United States)

Liu, Yaoze; Bralts, Vincent F; Engel, Bernard A

2015-04-01

The adverse influence of urban development on hydrology and water quality can be reduced by applying best management practices (BMPs) and low impact development (LID) practices. This study applied green roof, rain barrel/cistern, bioretention system, porous pavement, permeable patio, grass strip, grassed swale, wetland channel, retention pond, detention basin, and wetland basin, on Crooked Creek watershed. The model was calibrated and validated for annual runoff volume. A framework for simulating BMPs and LID practices at watershed scales was created, and the impacts of BMPs and LID practices on water quantity and water quality were evaluated with the Long-Term Hydrologic Impact Assessment-Low Impact Development 2.1 (L-THIA-LID 2.1) model for 16 scenarios. The various levels and combinations of BMPs/LID practices reduced runoff volume by 0 to 26.47%, Total Nitrogen (TN) by 0.30 to 34.20%, Total Phosphorus (TP) by 0.27 to 47.41%, Total Suspended Solids (TSS) by 0.33 to 53.59%, Lead (Pb) by 0.30 to 60.98%, Biochemical Oxygen Demand (BOD) by 0 to 26.70%, and Chemical Oxygen Demand (COD) by 0 to 27.52%. The implementation of grass strips in 25% of the watershed where this practice could be applied was the most cost-efficient scenario, with cost per unit reduction of $1m3/yr for runoff, while cost for reductions of two pollutants of concern was $445 kg/yr for Total Nitrogen (TN) and $4871 kg/yr for Total Phosphorous (TP). The scenario with very high levels of BMP and LID practice adoption (scenario 15) reduced runoff volume and pollutant loads from 26.47% to 60.98%, and provided the greatest reduction in runoff volume and pollutant loads among all scenarios. However, this scenario was not as cost-efficient as most other scenarios. The L-THIA-LID 2.1 model is a valid tool that can be applied to various locations to help identify cost effective BMP/LID practice plans at watershed scales. Copyright © 2014 Elsevier B.V. All rights reserved.

Insecticide-induced hormesis and arthropod pest management.

Science.gov (United States)

Guedes, Raul Narciso C; Cutler, G Christopher

2014-05-01

Ecological backlashes such as insecticide resistance, resurgence and secondary pest outbreaks are frequent problems associated with insecticide use against arthropod pest species. The last two have been particularly important in sparking interest in the phenomenon of insecticide-induced hormesis within entomology and acarology. Hormesis describes a biphasic dose-response relationship that is characterized by a reversal of response between low and high doses of a stressor (e.g. insecticides). Although the concept of insecticide-induced hormesis often does not receive sufficient attention, or has been subject to semantic confusion, it has been reported in many arthropod pest species and natural enemies, and has been linked to pest outbreaks and potential problems with insecticide resistance. The study of hormesis remains largely neglected in entomology and acarology. Here, we examined the concept of insecticide-induced hormesis in arthropods, its functional basis and potential fitness consequences, and its importance in arthropod pest management and other areas. © 2013 Society of Chemical Industry.

On-site infiltration of a copper roof runoff: role of clinoptilolite as an artificial barrier material.

Science.gov (United States)

Athanasiadis, Konstantinos; Helmreich, Brigitte; Horn, Harald

2007-08-01

On-site infiltration may be considered as a promising way of managing rainwater runoffs in urban areas, provided the hydrological and ecological conditions allow infiltration, and provided there is adequate treatment of the contaminants to avoid a risk of soil and groundwater pollution. The aim of this study was to evaluate the feasibility of the application of a new technical infiltration system equipped with clinoptilolite as an artificial barrier material for the treatment of the copper roof runoff of the Academy of Fine Arts in Munich, Germany. During the 2-yr sampling period, 30 rain events were examined. The cover material of the roof and the drainage system was responsible for the high copper concentrations in the roof runoff. The rain height and the rain intensity were of great significance regarding the establishment of the copper runoff rate. The technical infiltration system applied was able to reduce the copper from the roof runoff by a factor up to 96%. The mean measured copper concentration in percolation water was lower than the critical value of 50 microg/l set by the German Federal Soil Protection Act and Ordinance, indicating no risk for soil and groundwater contamination.

Non-point Source Pollution Modeling Using Geographic Information System (GIS for Representing Best Management Practices (BMP in the Gorganrood Watershed

Directory of Open Access Journals (Sweden)

Z. Pasandidehfard

2014-09-01

Full Text Available The most important pollutants that cause water pollution are nitrogen and phosphorus from agricultural runoff called Non-Point Source Pollution (NPS. To solve this problem, management practices known as BMPs or Best Management Practices are applied. One of the common methods for Non-Point Source Pollution prediction is modeling. By modeling, efficiency of many practices can be tested before application. In this study, land use changes were studied from the years 1984 till 2010 that showed an increase in agricultural lands from 516908.52 to 630737.19 ha and expansion of cities from 5237.87 to 15487.59 ha and roads from 9666.07 to 11430.24 ha. Using L-THIA model (from nonpoint source pollution models for both land use categories, the amount of pollutant and the volume of runoff were calculated that showed high growth. Then, the seventh sub-basin was recognized as a critical zone in terms of pollution among the sub-basins. In the end, land use change was considered as a BMP using Multi-Criteria Evaluation (MCE based on which a more suitable land use map was produced. After producing the new land use map, L-THIA model was run again and the result of the model was compared to the actual land use to show the effect of this BMP. Runoff volume decreased from 367.5 to 308.6 M3/ha and nitrogen in runoff was reduced from 3.26 to 1.58 mg/L and water BOD from 3.61 to 2.13 mg/L. Other pollutants also showed high reduction. In the end, land use change is confirmed as an effective BMP for Non-Point Source Pollution reduction.

Weevil x Insecticide: Does 'Personality' Matter?

Science.gov (United States)

Morales, Juliana A; Cardoso, Danúbia G; Della Lucia, Terezinha Maria C; Guedes, Raul Narciso C

2013-01-01

An insect's behavior is the expression of its integrated physiology in response to external and internal stimuli, turning insect behavior into a potential determinant of insecticide exposure. Behavioral traits may therefore influence insecticide efficacy against insects, compromising the validity of standard bioassays of insecticide activity, which are fundamentally based on lethality alone. By extension, insect 'personality' (i.e., an individual's integrated set of behavioral tendencies that is inferred from multiple empirical measures) may also be an important determinant of insecticide exposure and activity. This has yet to be considered because the behavioral studies involving insects and insecticides focus on populations rather than on individuals. Even among studies of animal 'personality', the relative contributions of individual and population variation are usually neglected. Here, we assessed behavioral traits (within the categories: activity, boldness/shyness, and exploration/avoidance) of individuals from 15 populations of the maize weevil (Sitophilus zeamais), an important stored-grain pest with serious problems of insecticide resistance, and correlated the behavioral responses with the activity of the insecticide deltamethrin. This analysis was performed at both the population and individual levels. There was significant variation in weevil 'personality' among individuals and populations, but variation among individuals within populations accounted for most of the observed variation (92.57%). This result emphasizes the importance of individual variation in behavioral and 'personality' studies. When the behavioral traits assessed were correlated with median lethal time (LT50) at the population level and with the survival time under insecticide exposure, activity traits, particularly the distance walked, significantly increased survival time. Therefore, behavioral traits are important components of insecticide efficacy, and individual variation should be

National Management Measures to Control Nonpoint Source Pollution from Forestry

Science.gov (United States)

This report helps forest owners protect lakes and streams from polluted runoff that can result from forestry activities. The report will also help states to implement their nonpoint source control programs.

Soils - Potential Runoff

Data.gov (United States)

Kansas Data Access and Support Center — This digital spatial data set provides information on the spatial distribution of potential runoff-contributing areas in Kansas. Potential runoff-contributing areas...

Organic pollution of rivers : Combined threats of urbanization, livestock farming and global climate change

NARCIS (Netherlands)

Wen, Y.; Schoups, G.H.W.; van de Giesen, N.C.

2017-01-01

Organic pollution of rivers by wastewater discharge from human activities negatively impacts people and ecosystems. Without treatment, pollution control relies on a combination of natural degradation and dilution by natural runoff to reduce downstream effects. We quantify here for the first time

Speciation distribution and mass balance of copper and zinc in urban rain, sediments, and road runoff.

Science.gov (United States)

Zuo, Xiaojun; Fu, Dafang; Li, He

2012-11-01

Heavy metal pollution in road runoff had caused widespread concern since the last century. However, there are little references on metal speciation in multiple environmental media (e.g., rain, road sediments, and road runoff). Our research targeted the investigation of metal speciation in rain, road sediments, and runoff; the analysis of speciation variation and mass balance of metals among rain, road sediments, and runoff; the selection of main factors by principal component analysis (PCA); and the establishment of equation to evaluate the impact of rain and road sediments to metals in road runoff. Sequential extraction procedure contains five steps for the chemical fractionation of metals. Flame atomic absorption spectrometry (Shimadzu, AA-6800) was used to determine metal speciation concentration, as well as the total and dissolved fractions. The dissolved fractions for both Cu and Zn were dominant in rain. The speciation distribution of Zn was different from that of Cu in road sediments, while speciation distribution of Zn is similar to that of Cu in runoff. The bound to carbonates for both Cu and Zn in road sediments were prone to be dissolved by rain. The levels of Cu and Zn in runoff were not obviously influenced by rain, but significantly influenced by road sediments. The masses for both Cu and Zn among rain, road sediments, and road runoff approximately meet the mass balance equation for all rainfall patterns. Five principal factors were selected for metal regression equation based on PCA, including rainfall, average rainfall intensity, antecedent dry periods, total suspended particles, and temperature. The established regression equations could be used to predict the effect of road runoff on receiving environments.

Effect of climate change on runoff of Campylobacter and Cryptosporidium from land to surface water.

Science.gov (United States)

Sterk, Ankie; Schijven, Jack; de Roda Husman, Ana Maria; de Nijs, Ton

2016-05-15

Faeces originating from wildlife, domestic animals or manure-fertilized fields, is considered an important source of zoonotic pathogens to which people may be exposed by, for instance, bathing or drinking-water consumption. An increase in runoff, and associated wash-off of animal faeces from fields, is assumed to contribute to the increase of disease outbreaks during periods of high precipitation. Climate change is expected to increase winter precipitation and extreme precipitation events during summer, but has simultaneously also other effects such as temperature rise and changes in evapotranspiration. The question is to what extent the combination of these effects influence the input of zoonotic pathogens to the surface waters. To quantitatively analyse the impacts of climate change on pathogen runoff, pathogen concentrations reaching surface waters through runoff were calculated by combining an input model for catchment pathogen loads with the Wageningen Lowland Runoff Simulator (WALRUS). Runoff of Cryptosporidium and Campylobacter was evaluated under different climate change scenarios and by applying different scenarios for sources of faecal pollution in the catchments, namely dairy cows and geese and manure fertilization. Model evaluation of these scenarios shows that climate change has little overall impact on runoff of Campylobacter and Cryptosporidium from land to the surface waters. Even though individual processes like runoff fluxes, pathogen release and dilution are affected, either positively or negatively, the net effect on the pathogen concentration in surface waters and consequently also on infection risks through recreation seems limited. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

Plant Essential Oils from Apiaceae Family as Alternatives to Conventional Insecticides

Directory of Open Access Journals (Sweden)

Asgar Ebadollahi

2013-06-01

Full Text Available Main method to control insect pest is using synthetic insecticides, but the development of insect resistance to this products, the high operational cost, environmental pollution, toxicity to humans and harmful effect on non-target organisms have created the need for developing alternative approaches to control insect pest. Furthermore, the demand for organic crops, especially vegetables for the fresh market, has greatly increased worldwide. The ideal insecticide should control target pests adequately and should be target-specific, rapidly degradable, and low in toxicity to humans and other mammals. Plant essential oils could be an alternative source for insect pest control because they constitute a rich source of bioactive chemicals and are commonly used as flavoring agents in foods. These materials may be applied to food crops shortly before harvest without leaving excessive residues. Moreover, medically safe of these plant derivatives has emphasized also. For these reasons, much effort has been focused on plant essential oils or their constituents as potential sources of insect control agents. In this context, Apiaceae (Umbelliferae family would rank among the most important families of plants. In the last few years more and more studies on the insecticidal properties of essential oils from Apiaceae family have been published and it seemed worthwhile to compile them. The focus of this review lies on the lethal (ovicidal, larvicidal, pupicidal and adulticidal and sublethal (antifeedant, repellent, oviposition deterrent, Growth inhibitory and progeny production activities of plant essential oils and theirmain components from Apiaceae family. These features indicate that pesticides based on Apiaceae essential oils could be used in a variety of ways to control a large number of pests. It can be concluded that essential oils and phytochemicals isolated from Apiaceae family may be efficacious and safe replacements for conventional synthetic

Malaria Vector Control Still Matters despite Insecticide Resistance.

Science.gov (United States)

Alout, Haoues; Labbé, Pierrick; Chandre, Fabrice; Cohuet, Anna

2017-08-01

Mosquito vectors' resistance to insecticides is usually considered a major threat to the recent progresses in malaria control. However, studies measuring the impact of interventions and insecticide resistance reveal inconsistencies when using entomological versus epidemiological indices. First, evaluation tests that do not reflect the susceptibility of mosquitoes when they are infectious may underestimate insecticide efficacy. Moreover, interactions between insecticide resistance and vectorial capacity reveal nonintuitive outcomes of interventions. Therefore, considering ecological interactions between vector, parasite, and environment highlights that the impact of insecticide resistance on the malaria burden is not straightforward and we suggest that vector control still matters despite insecticide resistance. Copyright © 2017 Elsevier Ltd. All rights reserved.

A renaissance for botanical insecticides?

Science.gov (United States)

Isman, Murray B

2015-12-01

Botanical insecticides continue to be a subject of keen interest among the international research community, reflected in the steady growth in scientific publications devoted to the subject. Until very recently though, the translation of that theory to practice, i.e. the commercialisation and adoption of new botanical insecticides in the marketplace, has seriously lagged behind. Strict regulatory regimes, long the bane of small pesticide producers, are beginning to relax some of the data requirements for 'low-risk' pesticide products, facilitating movement of more botanicals into the commercial arena. In this paper I discuss some of the jurisdictions where botanicals are increasingly finding favour, some of the newer botanical insecticides in the plant and animal health arsenal and some of the specific sectors where botanicals are most likely to compete effectively with other types of insecticidal product. © 2015 Society of Chemical Industry.

Treatment of highway runoff : engineered filter media for pollutant removal through enhanced sorption : final report.

Science.gov (United States)

2015-07-27

The work performed in this study focused on the investigation of the use of engineered biofiltration layers to enhance the removal of roadway stormwater runoff contaminants (specifically nutrients, solids, heavy metals, and pH). Six Georgia native gr...

Further insight into the mechanism of heavy metals partitioning in stormwater runoff.

Science.gov (United States)

Djukić, Aleksandar; Lekić, Branislava; Rajaković-Ognjanović, Vladana; Veljović, Djordje; Vulić, Tatjana; Djolić, Maja; Naunovic, Zorana; Despotović, Jovan; Prodanović, Dušan

2016-03-01

Various particles and materials, including pollutants, deposited on urban surfaces are washed off by stormwater runoff during rain events. The interactions between the solid and dissolved compounds in stormwater runoff are phenomena of importance for the selection and improvement of optimal stormwater management practices aimed at minimizing pollutant input to receiving waters. The objective of this research was to further investigate the mechanisms responsible for the partitioning of heavy metals (HM) between the solid and liquid phases in urban stormwater runoff. The research involved the collection of samples from urban asphalt surfaces, chemical characterization of the bulk liquid samples, solids separation, particle size distribution fractionation and chemical and physico-chemical characterization of the solid phase particles. The results revealed that a negligible fraction of HM was present in the liquid phase (less than 3% by weight), while there was a strong correlation between the total content of heavy metals and total suspended solids. Examinations of surface morphology and mineralogy revealed that the solid phase particles consist predominantly of natural macroporous materials: alpha quartz (80%), magnetite (11.4%) and silicon diphosphate (8.9%). These materials have a low surface area and do not have significant adsorptive capacity. These materials have a low surface area and do not have significant adsorptive capacity. The presence of HM on the surface of solid particles was not confirmed by scanning electron microscopy and energy dispersive X-ray microanalyses. These findings, along with the results of the liquid phase sample characterization, indicate that the partitioning of HM between the liquid and solid phases in the analyzed samples may be attributed to precipitation processes. Copyright © 2015 Elsevier Ltd. All rights reserved.

Characteristics of PAHs in farmland soil and rainfall runoff in Tianjin, China.

Science.gov (United States)

Shi, Rongguang; Xu, Mengmeng; Liu, Aifeng; Tian, Yong; Zhao, Zongshan

2017-10-14

Rainfall runoff can remove certain amounts of pollutants from contaminated farmland soil and result in a decline in water quality. However, the leaching behaviors of polycyclic aromatic hydrocarbons (PAHs) with rainfall have been rarely reported due to wide variations in the soil compositions, rainfall conditions, and sources of soil PAHs in complex farmland ecosystems. In this paper, the levels, spatial distributions, and composition profiles of PAHs in 30 farmland soil samples and 49 rainfall-runoff samples from the Tianjin region in 2012 were studied to investigate their leaching behaviors caused by rainfall runoff. The contents of the Σ 16 PAHs ranged from 58.53 to 3137.90 μg/kg in the soil and 146.58 to 3636.59 μg/L in the runoff. In total, most of the soil sampling sites (23 of 30) were contaminated, and biomass and petroleum combustion were proposed as the main sources of the soil PAHs. Both the spatial distributions of the soil and the runoff PAHs show a decreasing trend moving away from the downtown, which suggested that the leaching behaviors of PAHs in a larger region during rainfall may be mainly affected by the compounds themselves. In addition, 4- and 5-ring PAHs are the dominant components in farmland soil and 3- and 4-ring PAHs dominate the runoff. Comparisons of the PAH pairs and enrichment ratios showed that acenaphthylene, acenaphthene, benzo[a]anthracene, chrysene, and fluoranthene were more easily transferred into water systems from soil than benzo[b]fluoranthene, benzo[k]fluoranthene, benzo[ghi]perylene, and indeno[123-cd]pyrene, which indicated that PAHs with low molecular weight are preferentially dissolved due to their higher solubility compared to those with high molecular weight.

Systemic insecticides (neonicotinoids and fipronil): trends, uses, mode of action and metabolites : Environmental Science and Pollution Research

NARCIS (Netherlands)

Simon-Delso, N.; Amaral-Rogers, V.; Belzunces, L.P.; Bonmatin, J.M.; Chagnon, M.; Downs, C.; Furlan, L.; Gibbons, D.W.; Giorio, C.; Girolami, V.; Goulson, D.; Kreutzweiser, D.P.; Krupke, C.H.; Liess, M.; Long, E.; McField, M.; Mineau, P.; Mitchell, E.A.D.; Morrissey, C.A.; Noome, D.A.; Pisa, L.; Settele, J.; Stark, J.D.; Tapparo, A.; Van Dyck, H.; Van Praagh, J.; Van der Sluijs, J.P.; Whitehorn, P.R.; Wiemers, M.

2015-01-01

Since their discovery in the late 1980s, neonicotinoid pesticides have become the most widely used class of insecticides worldwide, with large-scale applications ranging from plant protection (crops, vegetables, fruits), veterinary products, and biocides to invertebrate pest control in fish farming.

Regulations for the peat production water pollution control

International Nuclear Information System (INIS)

Savolainen, M.; Heikkinen, K.; Ihme, R.

1996-01-01

The regulations for peat production water pollution control include the latest information on anti-pollution constructions applicable to peat production including field ditches, sedimentation basins, overland flow areas, forest soil saturation, evaporation basins, chemicalization, detention of runoff and artificial flood plains. Information on subsurface drainage in peat mining is also given. The regulations deal with environmental viewpoints, planning of water protection and information on how to build, use and maintain anti-pollution constructions. Special attention is given to the soil conditions, because they play an important role in the building of different constructions. (orig.) (48 refs.)

Quantifying climate change impacts on runoff of zoonotic pathogens from land

Science.gov (United States)

Sterk, Ankie; de Roda Husman, Ana Maria; Stergiadi, Maria; de Nijs, Ton; Schijven, Jack

2013-04-01

Several studies have shown a correlation between rainfall and waterborne disease outbreaks. One of the mechanisms whereby rainfall may cause outbreaks is through an increase in runoff of animal faeces from fields to surface waters. Faeces originating from wildlife, domestic animals or manure-fertilized fields, is considered an important source of zoonotic pathogens to which people may be exposed by water recreation or drinking-water consumption. Climate changes affect runoff because of increasing winter precipitation and more extreme precipitation events, as well as changes in evaporation. Furthermore, drier summers are leading to longer periods of high soil moisture deficits, increasing the hydrophobicity of soil and consequently changing infiltration capacities. A conceptual model is designed to describe the impacts of climate changes on the terrestrial and aquatic ecosystems, which are both directly and indirectly affecting pathogen loads in the environment and subsequent public health risks. One of the major outcomes was the lack of quantitative data and limited qualitative analyses of impacts of climate changes on pathogen runoff. Quantifying the processes by which micro-organisms are transported from fields to waters is important to be able to estimate such impacts to enable targeted implementation of effective intervention measures. A quantitative model using Mathematica software will be developed to estimate concentrations of pathogens originating from overland flow during runoff events. Different input sources will be included by applying different land-use scenarios, including point source faecal pollution from dairy cows and geese and diffuse source pollution by fertilization. Zoonotic pathogens, i.e. Cryptosporidium and Campylobacter, were selected based on transport properties, faecal loads and disease burden. Transport and survival rates of these pathogens are determined including effects of changes in precipitation but also temperature induced

Modeling Rainfall-Runoff Response to Land Use and Land Cover Change in Rwanda (1990–2016

Directory of Open Access Journals (Sweden)

Fidele Karamage

2017-02-01

Full Text Available Stormwater runoff poses serious environmental problems and public health issues in Rwanda, a tropical country that is increasingly suffering from severe floods, landslides, soil erosion and water pollution. Using the WetSpa Extension model, this study assessed the changes in rainfall runoff depth in Rwanda from 1990 to 2016 in response to precipitation and land use changes. Our results show that Rwanda has experienced a significant conversion of natural forest and grassland to cropland and built-up areas. During the period 1990–2016, 7090.02 km2 (64.5% and 1715.26 km2 (32.1% of forest and grassland covers were lost, respectively, while the cropland and built-up areas increased by 135.3% (8503.75 km2 and 304.3% (355.02 km2, respectively. According to our estimates, the land use change effect resulted in a national mean runoff depth increase of 2.33 mm/year (0.38%. Although precipitation change affected the inter-annual fluctuation of runoff, the long-term trend of runoff was dominated by land use change. The top five districts that experienced the annual runoff depth increase (all >3.8 mm/year are Rubavu, Nyabihu, Ngororero, Gakenke, and Musanze. Their annual runoff depths increased at a rate of >3.8 mm/year during the past 27 years, due to severe deforestation (ranging from 62% to 85% and cropland expansion (ranging from 123% to 293%. These areas require high priority in runoff control using terracing in croplands and rainwater harvesting systems such as dam/reservoirs, percolation tanks, storage tanks, etc. The wet season runoff was three times higher than the dry season runoff in Rwanda; appropriate rainwater management and reservation could provide valuable irrigation water for the dry season or drought years (late rainfall onsets or early rainfall cessations. It was estimated that a reservation of 30.5% (3.99 km3 of the runoff in the wet season could meet the cropland irrigation water gap during the dry season in 2016.

A glacier runoff extension to the Precipitation Runoff Modeling System

Science.gov (United States)

A. E. Van Beusekom; R. J. Viger

2016-01-01

A module to simulate glacier runoff, PRMSglacier, was added to PRMS (Precipitation Runoff Modeling System), a distributed-parameter, physical-process hydrological simulation code. The extension does not require extensive on-glacier measurements or computational expense but still relies on physical principles over empirical relations as much as is feasible while...

An at-grade stabilization structure impact on runoff and suspended sediment

Science.gov (United States)

Minks, Kyle R.; Lowery, Birl; Madison, Fred W.; Ruark, Matthew; Frame, Dennis R.; Stuntebeck, Todd D.; Komiskey, Matthew J.

2012-01-01

In recent years, agricultural runoff has received more attention as a major contributor to surface water pollution. This is especially true for the unglaciated area of Wisconsin, given this area's steep topography, which makes it highly susceptible to runoff and soil loss. We evaluated the ability of an at-grade stabilization structure (AGSS), designed as a conservation practice to reduce the amount of overland runoff and suspended sediment transported to the surface waters of an agricultural watershed. Eight years of storm and baseflow data collected by the US Geological Survey–Wisconsin Water Science Center on a farm in west central Wisconsin were analyzed for changes in precipitation, storm runoff volume, and suspended sediment concentration before and after installation of an AGSS. The agricultural research site was designed as a paired watershed study in which monitoring stations were installed on the perennial streams draining both control and treatment watersheds. Linear mixed effects model analyses were conducted to determine if any statistically significant changes occurred in the water quality parameters before and after the AGSS was installed. Results indicated no significant changes (p = 0.51) in average event precipitation and runoff volumes before and after installation of the AGSS in either the treatment (NW) or control (SW) watersheds. However, the AGSS did significantly reduce the average suspended sediment concentration in the event runoff water (p = 0.02) in the NW from 972 to 263 mg L–1. In addition, particle size analyses, using light diffraction techniques, were conducted on soil samples taken from within the AGSS and adjacent valley and ridge top to determine if suspended sediments were being retained within the structure. Statistical analysis revealed a significantly (p clay inside the AGSS (37%) than outside (30%). These results indicate that the AGSS was successful in reducing the amount of suspended sediment transported to nearby

The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation

Science.gov (United States)

de Almeida, Luis Gustavo; de Moraes, Luiz Alberto Beraldo; Trigo, José Roberto; Omoto, Celso

2017-01-01

The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects. PMID:28358907

The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation.

Directory of Open Access Journals (Sweden)

Luis Gustavo de Almeida

Full Text Available The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects.

A mathematical model for soil solute transfer into surface runoff as influenced by rainfall detachment.

Science.gov (United States)

Yang, Ting; Wang, Quanjiu; Wu, Laosheng; Zhao, Guangxu; Liu, Yanli; Zhang, Pengyu

2016-07-01

Nutrients transport is a main source of water pollution. Several models describing transport of soil nutrients such as potassium, phosphate and nitrate in runoff water have been developed. The objectives of this research were to describe the nutrients transport processes by considering the effect of rainfall detachment, and to evaluate the factors that have greatest influence on nutrients transport into runoff. In this study, an existing mass-conservation equation and rainfall detachment process were combined and augmented to predict runoff of nutrients in surface water in a Loess Plateau soil in Northwestern Yangling, China. The mixing depth is a function of time as a result of rainfall impact, not a constant as described in previous models. The new model was tested using two different sub-models of complete-mixing and incomplete-mixing. The complete-mixing model is more popular to use for its simplicity. It captured the runoff trends of those high adsorption nutrients, and of nutrients transport along steep slopes. While the incomplete-mixing model predicted well for the highest observed concentrations of the test nutrients. Parameters inversely estimated by the models were applied to simulate nutrients transport, results suggested that both models can be adopted to describe nutrients transport in runoff under the impact of rainfall. Copyright © 2016 Elsevier B.V. All rights reserved.

Anticholinesterase insecticide retrospective.

Science.gov (United States)

Casida, John E; Durkin, Kathleen A

2013-03-25

The anticholinesterase (antiChE) organophosphorus (OP) and methylcarbamate (MC) insecticides have been used very effectively as contact and systemic plant protectants for seven decades. About 90 of these compounds are still in use - the largest number for any insecticide chemotype or mode of action. In both insects and mammals, AChE inhibition and acetylcholine accumulation leads to excitation and death. The cholinergic system of insects is located centrally (where it is protected from ionized OPs and MCs) but not at the neuromuscular junction. Structural differences between insect and mammalian AChE are also evident in their genomics, amino acid sequences and active site conformations. Species selectivity is determined in part by inhibitor and target site specificity. Pest population selection with OPs and MCs has resulted in a multitude of modified AChEs of altered inhibitor specificity some conferring insecticide resistance and others enhancing sensitivity. Much of the success of antiChE insecticides results from a suitable balance of bioactivation and detoxification by families of CYP450 oxidases, hydrolases, glutathione S-transferases and others. Known inhibitors for these enzymes block detoxification and enhance potency which is particularly important in resistant strains. The current market for OPs and MCs of 19% of worldwide insecticide sales is only half of that of 10 years ago for several reasons: there have been no major new compounds for 30 years; resistance has eroded their effectiveness; human toxicity problems are still encountered; the patents have expired reducing the incentive to update registration packages; alternative chemotypes or control methods have been developed. Despite this decline, they still play a major role in pest control and the increasing knowledge on their target sites and metabolism may make it possible to redesign the inhibitors for insensitive AChEs and to target new sites in the cholinergic system. The OPs and MCs are down

Diagnostic Doses of Insecticides for Adult Aedes aegypti to Assess Insecticide Resistance in Cuba.

Science.gov (United States)

Rodríguez, María Magdalena; Crespo, Ariel; Hurtado, Daymi; Fuentes, Ilario; Rey, Jorge; Bisset, Juan Andrés

2017-06-01

The objective of this study was to determine diagnostic doses (DDs) of 5 insecticides for the Rockefeller susceptible strain of Aedes aegypti , using the Centers for Disease Control and Prevention (CDC) bottle bioassay as a tool for monitoring insecticide resistance in the Cuban vector control program. The 30-min DD values determined in this study were 13.5 μg/ml, 6.5 μg/ml, 6 μg/ml, 90.0 μg/ml, and 15.0 μg/ml for cypermethrin, deltamethrin, lambda-cyhalothrin, chlorpyrifos, and propoxur, respectively. To compare the reliability of CDC bottle bioassay with the World Health Organization susceptible test, 3 insecticide-resistant strains were evaluated for deltamethrin and lambda-cyhalothrin. Results showed that the bottles can be used effectively from 21 to 25 days after treatment and reused up to 4 times, depending on the storage time. The CDC bottle bioassay is an effective tool to assess insecticide resistance in field populations of Ae. aegypti in Cuba and can be incorporated into vector management programs using the diagnostic doses determined in this study.

Characteristics of the event mean concentration (EMCs) from rainfall runoff on mixed agricultural land use in the shoreline zone of the Yamuna River in Delhi, India

Science.gov (United States)

Sharma, Deepshikha; Gupta, Ruchi; Singh, Ram Karan; Kansal, Arun

2012-03-01

This paper is focused on the monitoring of the diffuse pollution characteristics from the agricultural land confining the River Yamuna in Delhi (capital of India). Agricultural fields surrounding the Yamuna river are direct nonpoint source of pollution impacting the river quality. The study includes watershed delineation for the River Yamuna using SWAT (2005) and land use classification for the city using GIS and remote sensing. Thereafter, the rainfall-runoff pollutant concentrations from the mixed agricultural land use were assessed for the 2006 and 2007 monsoon period (July-September). Runoff was measured using SCS method and grab samples of rainfall runoff were collected at three stations namely Old Delhi Railway Bridge (ODRB), Nizamuddin and Okhla bridge in Delhi. The samples were analysed for physico-chemical and biological parameters. Rainfall runoff and event mean concentrations (EMCs) for different water quality parameters were characterized and the effect of land use was analyzed. The average EMCs for BOD, COD, ammonia, nitrate, TKN, hardness, TDS, TSS, chlorides, sulfates, phosphate, fluorides and TC were 21.82 mg/L, 73.48 mg/L, 72.68 μg/L, 229.87 μg/L, 15.32 μg/L, 11.36 mg/L, 117.44 mg/L, 77.60 mg/L, 117.64 mg/L, 135.82 mg/L, 0.08 mg/L, 0.85 mg/L and 2,827.47 MPN/100 mL, respectively. The EMCs of TSS, nitrogen and its compounds, phosphate and BOD were high.

Sedimentary records of trace elements from large European lakes (Switzerland) document historic to recent freshwater pollution and climate-induced runoff variations

Science.gov (United States)

Thevenon, F.; Wirth, S. B.; Fujak, M.; Poté, J.; Thierry, A.; Chiaradia, M.; Girardclos, S.

2011-12-01

Continuous sedimentary records of anthropogenic and natural trace elements determined by ICPMS, from 5 large and deep perialpine lakes from Central Europe (Switzerland), evidence the environmental impacts of industrial fossil fuel pollution. In fact, the greatest increase in heavy metal pollution was registered at all the studied sites following the European industrial revolution of ca. AD 1800; with the highest values during the middle part of the 20th century. On a regional scale, anthropogenic heavy metal input subsequently stopped increasing thanks to remediation strategies such as the implementation of wastewater treatment plants (WWTPs). On the other hand, the discharge of industrial treated wastewaters into Vidy Bay of Lake Geneva during the second part of the 20th century involved the sedimentation of highly contaminated sediments in the area surrounding the WWTP outlet pipe discharge; less than 4 km from the main supply of drinking water of Lausanne (127'000 hab.). Microbial analyses furthermore reveal i) high increase in bacterial densities following the lake eutrophication in the 1970s, and that ii) the related sediments can be considered as a reservoir of antibiotic resistant bacteria/genes (of human origin). We finally compare instrumental hydrological data over the last century with variations of lithogenic trace elements (e.g., titanium) as registered in three large lakes (Brienz, Thun and Bienne) connected by the River Aar. This task allows to better constraining the runoff variations on a regional scale over the last decades for the the River Aar, and its possible increase under warming climate conditions in the European Alps.

Transport mechanisms of soil-bound mercury in the erosion process during rainfall-runoff events.

Science.gov (United States)

Zheng, Yi; Luo, Xiaolin; Zhang, Wei; Wu, Xin; Zhang, Juan; Han, Feng

2016-08-01

Soil contamination by mercury (Hg) is a global environmental issue. In watersheds with a significant soil Hg storage, soil erosion during rainfall-runoff events can result in nonpoint source (NPS) Hg pollution and therefore, can extend its environmental risk from soils to aquatic ecosystems. Nonetheless, transport mechanisms of soil-bound Hg in the erosion process have not been explored directly, and how different fractions of soil organic matter (SOM) impact transport is not fully understood. This study investigated transport mechanisms based on rainfall-runoff simulation experiments. The experiments simulated high-intensity and long-duration rainfall conditions, which can produce significant soil erosion and NPS pollution. The enrichment ratio (ER) of total mercury (THg) was the key variable in exploring the mechanisms. The main study findings include the following: First, the ER-sediment flux relationship for Hg depends on soil composition, and no uniform ER-sediment flux function exists for different soils. Second, depending on soil composition, significantly more Hg could be released from a less polluted soil in the early stage of large rainfall events. Third, the heavy fraction of SOM (i.e., the remnant organic matter coating on mineral particles) has a dominant influence on the enrichment behavior and transport mechanisms of Hg, while clay mineral content exhibits a significant, but indirect, influence. The study results imply that it is critical to quantify the SOM composition in addition to total organic carbon (TOC) for different soils in the watershed to adequately model the NPS pollution of Hg and spatially prioritize management actions in a heterogeneous watershed. Copyright © 2016 Elsevier Ltd. All rights reserved.

Soil Erodibility for Water Pollution Management of Melaka Watershed in Peninsular Malaysia

Directory of Open Access Journals (Sweden)

Md. Ibrahim Adham

2015-07-01

Full Text Available The relationships between surface runoffand soil erodibility are significant in water pollution and watershed management practices. Land use pattern, soil series and slope percentage are also major factors to develop the relationships. Daily rainfall data were collected and analyzed for variations in precipitation for calculating the surface runoff of these watersheds and surface runoff map was produced by GIS tools. Tew equation was utilized to predict soil erodibility of watershed soils.Results indicated that the weighted curve number varies from 82 to 85 and monthly runoff 23% to 30% among the five watersheds. Soil erodibility varies from 0.038 to 0.06 ton/ha (MJ.mm/ha/h. Linau-Telok-Local Alluvium, Malacca-Munchong, Munchong-Malacca-Serdang and Malacca-Munchong-Tavy are the dominant soil series of this region having the average soil erodibility of about 0.042 ton/ha (MJ.mm/ha/h. The main focus of this study is to provide the information of soil erodibility to reduce the water pollution of a watershed.

A multi-stakeholder framework for urban runoff quality management: Application of social choice and bargaining techniques.

Science.gov (United States)

Ghodsi, Seyed Hamed; Kerachian, Reza; Zahmatkesh, Zahra

2016-04-15

In this paper, an integrated framework is proposed for urban runoff management. To control and improve runoff quality and quantity, Low Impact Development (LID) practices are utilized. In order to determine the LIDs' areas and locations, the Non-dominated Sorting Genetic Algorithm-II (NSGA-II), which considers three objective functions of minimizing runoff volume, runoff pollution and implementation cost of LIDs, is utilized. In this framework, the Storm Water Management Model (SWMM) is used for stream flow simulation. The non-dominated solutions provided by the NSGA-II are considered as management scenarios. To select the most preferred scenario, interactions among the main stakeholders in the study area with conflicting utilities are incorporated by utilizing bargaining models including a non-cooperative game, Nash model and social choice procedures of Borda count and approval voting. Moreover, a new social choice procedure, named pairwise voting method, is proposed and applied. Based on each conflict resolution approach, a scenario is identified as the ideal solution providing the LIDs' areas, locations and implementation cost. The proposed framework is applied for urban water quality and quantity management in the northern part of Tehran metropolitan city, Iran. Results show that the proposed pairwise voting method tends to select a scenario with a higher percentage of reduction in TSS (Total Suspended Solid) load and runoff volume, in comparison with the Borda count and approval voting methods. Besides, the Nash method presents a management scenario with the highest cost for LIDs' implementation and the maximum values for percentage of runoff volume reduction and TSS removal. The results also signify that selection of an appropriate management scenario by stakeholders in the study area depends on the available financial resources and the relative importance of runoff quality improvement in comparison with reducing the runoff volume. Copyright © 2016 Elsevier

Infiltration of stormwater from highway operations to reduce coastal pollution.

Science.gov (United States)

2012-12-01

The coastal waters of Hawaii are extremely important for recreation as well as for the health of : the marine environment. Runoff from the construction and operation of highways can be a : source of pollution to coastal waters. Individual states in t...

Assessment of runoff contributing catchment areas in rainfall runoff modelling

DEFF Research Database (Denmark)

Thorndahl, Søren; Johansen, C.; Schaarup-Jensen, Kjeld

2006-01-01

In numerical modelling of rainfall caused runoff in urban sewer systems an essential parameter is the hydrological reduction factor which defines the percentage of the impervious area contributing to the surface flow towards the sewer. As the hydrological processes during a rainfall are difficult...... to determine with significant precision the hydrological reduction factor is implemented to account all hydrological losses except the initial loss. This paper presents an inconsistency between calculations of the hydrological reduction factor, based on measurements of rainfall and runoff, and till now...... recommended literature values for residential areas. It is proven by comparing rainfall-runoff measurements from four different residential catchments that the literature values of the hydrological reduction factor are over-estimated for this type of catchment. In addition, different catchment descriptions...

Rice Production without Insecticide in Smallholder Farmer's Field

Directory of Open Access Journals (Sweden)

M. P. Ali

2017-05-01

Full Text Available Highlights:Use of perching, sweeping, and need based insecticide (IPM technique useage produce at par yields compared to prophylactic insecticide useage in rice fields.There exists a technique that can reduce 75% of insecticide useage in rice field.The results were obtained in cooperation between smallholder rice farmers and researchers of Bangladesh.Currently rice protection from insect pests solely depends on chemical pesticides which have tremendous impact on biodiversity, environment, animal, and human health. To reduce their impact from our society we need to cut pesticide use from agricultural practices. To address this issue, we did an experiment to identify realistic solutions that could help farmers build sustainable crop protection systems and minimize useage of insecticides and thus reduce the impact of pesticides in the environment. Innovations developed jointly by farmers and researchers and evaluated for their potential to be adopted by more farmers. In this paper we tested four management practices jointly with smallholder farmer fields in order to select the best one. Four management practices were used namely, T1 = Prophylactic use of insecticide where insecticide was applied in rice field at every 15 days interval without judging the infestation level; T2 = Perching (that is, placing roosting (perching sites for insectivorous birds within the rice field and concurrent sweep net samples along with need-based insecticide application; T3 = Perching only; and T4 = Farmer's own practices. The results revealed that routine application of insecticides for crop protection is not mandatory which is commonly found at use in rice farmers. In our experiment, where prophylactic method or farmers used 3–4 times insecticides without judging the insect pests infestation level, the similar pest population was found when compared to the field where insecticide was not applied. Our management system reduced by 75% the use of insecticides even

CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Detailed Conceptual Diagram

Science.gov (United States)

Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Simple Conceptual Diagram

Science.gov (United States)

Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

Evaluation of four structural best management practices for highway runoff in Beaufort and Colleton Counties, South Carolina, 2005–2006

Science.gov (United States)

Conlon, Kevin J.; Journey, Celeste A.

2008-01-01

From 2005 to 2006, the U.S. Geological Survey worked cooperatively with the South Carolina Department of Transportation in Beaufort and Colleton Counties, South Carolina, to assess the performance of four different structural devices that served as best management practices (BMPs). These structural devices were installed to mitigate the effects of stormwater runoff on waterways near State roads. The South Carolina Department of Transportation is required to address the quality of stormwater runoff from State-maintained roadways as part of the National Pollutant Discharge Elimination System stormwater program mandated in the Clean Water Act.

Development and investigation of a pollution control pit for treatment of stormwater from metal roofs and traffic areas.

Science.gov (United States)

Dierkes, C; Göbel, P; Lohmann, M; Coldewey, W G

2006-01-01

Source control by on-site retention and infiltration of stormwater is a sustainable and proven alternative to classical drainage methods. Unfortunately, sedimentary particles and pollutants from drained surfaces cause clogging and endanger soil and groundwater during long-term operation of infiltration devices. German water authorities recommend the use of infiltration devices, such as swales or swale-trench-systems. Direct infiltration by underground facilities, such as pipes, trenches or sinks, without pretreatment of runoff is generally not permitted. Problems occur with runoff from metal roofs, traffic areas and industrial sites. However, due to site limitations, underground systems are often the only feasible option. To overcome this situation, a pollution control pit was developed with a hydrodynamic separator and a multistage filter made of coated porous concrete. The system treats runoff at source and protects soil, groundwater and receiving waterways. Typically, more than 90% of the pollutants such as sedimentary particles, hydrocarbons and heavy metals can be removed. Filters have been developed to treat even higher polluted stormwater loads from metal roofs and industrial sites. The treatment process is based on sedimentation, filtration, adsorption and chemical precipitation. Sediments are trapped in a special chamber within the pit and can be removed easily. Other pollutants are captured in the concrete filter upstream of the sediment separator chamber. Filters can be easily replaced.

5 CFR 2422.28 - Runoff elections.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Runoff elections. 2422.28 Section 2422.28... FEDERAL LABOR RELATIONS AUTHORITY REPRESENTATION PROCEEDINGS § 2422.28 Runoff elections. (a) When a runoff may be held. A runoff election is required in an election involving at least three (3) choices, one of...

Method for assessment of stormwater treatment facilities - Synthetic road runoff addition including micro-pollutants and tracer.

Science.gov (United States)

Cederkvist, Karin; Jensen, Marina B; Holm, Peter E

2017-08-01

Stormwater treatment facilities (STFs) are becoming increasingly widespread but knowledge on their performance is limited. This is due to difficulties in obtaining representative samples during storm events and documenting removal of the broad range of contaminants found in stormwater runoff. This paper presents a method to evaluate STFs by addition of synthetic runoff with representative concentrations of contaminant species, including the use of tracer for correction of removal rates for losses not caused by the STF. A list of organic and inorganic contaminant species, including trace elements representative of runoff from roads is suggested, as well as relevant concentration ranges. The method was used for adding contaminants to three different STFs including a curbstone extension with filter soil, a dual porosity filter, and six different permeable pavements. Evaluation of the method showed that it is possible to add a well-defined mixture of contaminants despite different field conditions by having a flexibly system, mixing different stock-solutions on site, and use bromide tracer for correction of outlet concentrations. Bromide recovery ranged from only 12% in one of the permeable pavements to 97% in the dual porosity filter, stressing the importance of including a conservative tracer for correction of contaminant retention values. The method is considered useful in future treatment performance testing of STFs. The observed performance of the STFs is presented in coming papers. Copyright © 2017 Elsevier Ltd. All rights reserved.

An Operational Framework for Insecticide Resistance Management Planning.

Science.gov (United States)

Chanda, Emmanuel; Thomsen, Edward K; Musapa, Mulenga; Kamuliwo, Mulakwa; Brogdon, William G; Norris, Douglas E; Masaninga, Freddie; Wirtz, Robert; Sikaala, Chadwick H; Muleba, Mbanga; Craig, Allen; Govere, John M; Ranson, Hilary; Hemingway, Janet; Seyoum, Aklilu; Macdonald, Michael B; Coleman, Michael

2016-05-01

Arthropod vectors transmit organisms that cause many emerging and reemerging diseases, and their control is reliant mainly on the use of chemical insecticides. Only a few classes of insecticides are available for public health use, and the increased spread of insecticide resistance is a major threat to sustainable disease control. The primary strategy for mitigating the detrimental effects of insecticide resistance is the development of an insecticide resistance management plan. However, few examples exist to show how to implement such plans programmatically. We describe the formulation and implementation of a resistance management plan for mosquito vectors of human disease in Zambia. We also discuss challenges, steps taken to address the challenges, and directions for the future.

Insecticide susceptibility status of human biting mosquitoes in ...

African Journals Online (AJOL)

Background: There has been a rapid emergence in insecticide resistance among mosquito population to commonly used public health insecticides. This situation presents a challenge to chemicals that are currently used to control mosquitoes in sub-Saharan African. Furthermore, there is limited information on insecticide ...

29 CFR 102.70 - Runoff election.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Runoff election. 102.70 Section 102.70 Labor Regulations... Runoff election. (a) The regional director shall conduct a runoff election, without further order of the... objections are filed as provided in § 102.69. Only one runoff shall be held pursuant to this section. (b...

Insecticide Resistance and Metabolic Mechanisms Involved in Larval and Adult Stages of Aedes aegypti Insecticide-Resistant Reference Strains from Cuba.

Science.gov (United States)

Bisset, Juan Andrés; Rodríguez, María Magdalena; French, Leydis; Severson, David W; Gutiérrez, Gladys; Hurtado, Daymi; Fuentes, Ilario

2014-12-01

Studies were conducted to compare levels of insecticide resistance and to determine the metabolic resistance mechanisms in larval and adult stages of Aedes aegypti from Cuba. Three insecticide-resistant reference strains of Ae. aegypti from Cuba were examined. These strains were derived from a Santiago de Cuba strain isolated in 1997; it was previously subjected to a strong selection for resistance to temephos (SAN-F6), deltamethrin (SAN-F12), and propoxur (SAN-F13) and routinely maintained in the laboratory under selection pressure up to the present time, when the study was carried out. In addition, an insecticide-susceptible strain was used for comparison. The insecticide resistance in larvae and adults was determined using standard World Health Organization methodologies. Insecticide resistance mechanisms were determined by biochemical assays. The esterases (α EST and β EST) and mixed function oxidase (MFO) activities were significantly higher in adults than in the larvae of the three resistant strains studied. The association of resistance level with the biochemical mechanism for each insecticide was established for each stage. The observed differences between larval and adult stages of Ae. aegypti in their levels of insecticide resistance and the biochemical mechanisms involved should be included as part of monitoring and surveillance activities in Ae. aegypti vector control programs.

Is Apis mellifera more sensitive to insecticides than other insects?

Science.gov (United States)

Hardstone, Melissa C; Scott, Jeffrey G

2010-11-01

Honey bees (Apis mellifera L.) are among the most important pollinators in natural and agricultural settings. They commonly encounter insecticides, and the effects of insecticides on honey bees have been frequently noted. It has been suggested that honey bees may be (as a species) uniquely sensitive to insecticides, although no comparative toxicology study has been undertaken to examine this claim. An extensive literature review was conducted, using data in which adult insects were topically treated with insecticides. The goal of this review was to summarize insecticide toxicity data between A. mellifera and other insects to determine the relative sensitivity of honey bees to insecticides. It was found that, in general, honey bees were no more sensitive than other insect species across the 62 insecticides examined. In addition, honey bees were not more sensitive to any of the six classes of insecticides (carbamates, nicotinoids, organochlorines, organophosphates, pyrethroids and miscellaneous) examined. While honey bees can be sensitive to individual insecticides, they are not a highly sensitive species to insecticides overall, or even to specific classes of insecticides. However, all pesticides should be used in a way that minimizes honey bee exposure, so as to minimize possible declines in the number of bees and/or honey contamination. Copyright © 2010 Society of Chemical Industry.

Insecticide Mixtures Could Enhance the Toxicity of Insecticides in a Resistant Dairy Population of Musca domestica L

Science.gov (United States)

Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin

2013-01-01

House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758

Vegetated Ditches for the Mitigation of Pesticides Runoff in the Po Valley.

Directory of Open Access Journals (Sweden)

Stefan Otto

Full Text Available In intensive agricultural systems runoff is one of the major potential diffuse pollution pathways for pesticides and poses a risk to surface water. Ditches are common in the Po Valley and can potentially provide runoff mitigation for the protection of watercourses. The effectiveness depends on ditch characteristics, so there is an urgent need for site-specific field trials. The use of a fugacity model (multimedia model can allows recognition of the mitigation main processes. A field experiment was conducted in order to evaluate the mitigation capacity of a typical vegetated ditch, and results were compared with predictions by a fugacity model. To evaluate herbicide mitigation after an extreme runoff, the ditch was flooded with water containing mesotrione, S-metolachlor and terbuthylazine. Two other subsequent floods with uncontaminated water were applied 27 and 82 days later to evaluate herbicides release. Results show that the ditch can immediately reduce runoff concentration of herbicides by at least 50% even in extreme flooding conditions. The half-distances were about 250 m. As a general rule, a runoff of 1 mm from 5 ha is mitigated by 99% in 100 m of vegetated ditch. Herbicides retention in the vegetated ditch was reversible, and the second flood mobilized 0.03-0.2% of the previous one, with a concentration below the drinking water limit of 0.1 μg L(-1. No herbicide was detected in the third flood, because the residual amount in the ditch was too low. Fugacity model results show that specific physical-chemical parameters may be used and a specific soil-sediment-plant compartment included for modelling herbicides behaviour in a vegetated ditch, and confirm that accumulation is low or negligible for herbicides with a half-life of 40 days or less. Shallow vegetated ditches can thus be included in a general agri-environment scheme for the mitigation of pesticides runoff together with wetlands and linear buffer strips. These structures are

Vegetated Ditches for the Mitigation of Pesticides Runoff in the Po Valley.

Science.gov (United States)

Otto, Stefan; Pappalardo, Salvatore E; Cardinali, Alessandra; Masin, Roberta; Zanin, Giuseppe; Borin, Maurizio

2016-01-01

In intensive agricultural systems runoff is one of the major potential diffuse pollution pathways for pesticides and poses a risk to surface water. Ditches are common in the Po Valley and can potentially provide runoff mitigation for the protection of watercourses. The effectiveness depends on ditch characteristics, so there is an urgent need for site-specific field trials. The use of a fugacity model (multimedia model) can allows recognition of the mitigation main processes. A field experiment was conducted in order to evaluate the mitigation capacity of a typical vegetated ditch, and results were compared with predictions by a fugacity model. To evaluate herbicide mitigation after an extreme runoff, the ditch was flooded with water containing mesotrione, S-metolachlor and terbuthylazine. Two other subsequent floods with uncontaminated water were applied 27 and 82 days later to evaluate herbicides release. Results show that the ditch can immediately reduce runoff concentration of herbicides by at least 50% even in extreme flooding conditions. The half-distances were about 250 m. As a general rule, a runoff of 1 mm from 5 ha is mitigated by 99% in 100 m of vegetated ditch. Herbicides retention in the vegetated ditch was reversible, and the second flood mobilized 0.03-0.2% of the previous one, with a concentration below the drinking water limit of 0.1 μg L(-1). No herbicide was detected in the third flood, because the residual amount in the ditch was too low. Fugacity model results show that specific physical-chemical parameters may be used and a specific soil-sediment-plant compartment included for modelling herbicides behaviour in a vegetated ditch, and confirm that accumulation is low or negligible for herbicides with a half-life of 40 days or less. Shallow vegetated ditches can thus be included in a general agri-environment scheme for the mitigation of pesticides runoff together with wetlands and linear buffer strips. These structures are present in the

Nitrogen and phosphorus removed from a subsurface flow multi-stage filtration system purifying agricultural runoff.

Science.gov (United States)

Zhao, Yaqi; Huang, Lei; Chen, Yucheng

2018-07-01

Agricultural nonpoint source pollution has been increasingly serious in China since the 1990s. The main causes were excessive inputs of nitrogen fertilizer and pesticides. A multi-stage filtration system was built to test the purification efficiencies and removal characteristics of nitrogen and phosphorus when treating agricultural runoff. Simulated runoff pollution was prepared by using river water as source water based on the monitoring of local agricultural runoff. Experimental study had been performed from September to November 2013, adopting 12 h for flooding and 12 h for drying. The results showed that the system was made adaptive to variation of inflow quality and quantity, and had good removal for dissolved total nitrogen, total nitrogen, dissolved total phosphorus (DTP), and total phosphorus, and the average removal rate was 27%, 36%, 32%, and 48%, respectively. Except nitrate ([Formula: see text]), other forms of nitrogen and phosphorus all decreased with the increase of stages. Nitrogen was removed mainly in particle form the first stage, and mostly removed in dissolved form the second and third stage. Phosphorus was removed mainly in particulate during the first two stages, but the removal of particulate phosphorus and DTP were almost the same in the last stage. An approximate logarithmic relationship between removal loading and influent loading to nitrogen and phosphorus was noted in the experimental system, and the correlation coefficient was 0.78-0.94. [Formula: see text]: ammonium; [Formula: see text]: nitrite; [Formula: see text]: nitrate; DTN: dissolved total nitrogen; TN: total nitrogen; DTP: dissolved total phosphorus; TP: total phosphorus; PN: particulate nitrogen; PP: particulate phosphorus.

Ecotoxicological impact of highway runoff using brown trout (Salmo trutta L.) as an indicator model.

Science.gov (United States)

Meland, Sondre; Salbu, Brit; Rosseland, Bjørn Olav

2010-03-01

The ecotoxicological impact of highway runoff on brown trout (Salmo trutta L.) was studied in an in situ experiment consisting of four 24 h simulated runoff episodes. Fish were maintained in 5 tanks and exposed to highway runoff from a sedimentation pond close to E6 outside the city of Oslo, Norway. The tanks had the following contaminant loadings during the episodes: stream water (control), pond inlet, pond outlet, pond inlet + stream water and pond outlet + stream water. Opposite to road salt and compared to earlier findings, the first two episodes had rather low concentrations of trace metals, hydrocarbons and polycyclic aromatic hydrocarbons. A heavy rainfall before episode 3 increased the concentrations of all the contaminants except road salt which was diluted. In addition, lowered oxygen levels led to hypoxic conditions. Overall the fish exposed to highway runoff had, compared to the control fish, higher concentrations of trace metals in gills and liver, increased activity of the antioxidant defense system represented by superoxide dismutase, catalase and metallothionein, problems with the regulation of plasma Cl and Na, as well as increased levels of blood glucose and pCO(2). Finally, this seemed to affect the metabolism of the fish through reduced condition factor. The observed effects were likely caused by multiple stressors and not by a single contaminant. The sedimentation pond clearly reduced the toxicity of the highway runoff. But even in the least polluted exposure tank (pond outlet + stream water) signs of physiological disturbances were evident.

Monitoring of priority pollutants in dynamic stormwater discharges from urban areas

DEFF Research Database (Denmark)

Birch, Heidi

The European Water Framework Directive (WFD) from 2000 has put focus on the chemical status of surface waters by the specified Environmental Quality Standard (EQSs) and the requirements for monitoring of surface water quality throughout Europe. When considering the water quality of urban stormwater...... runoff it is evident that surface waters receiving large amount of urban stormwater runoff will be at risk of failing to meet the EQSs. Therefore stormwater treatment is crucial. However, as stormwater quality varies orders of magnitude between sites, stormwater monitoring is important in order to design...... discharges. Sorption of pollutants to particulate matter and dissolved organic carbon is important for both the toxicity of the pollutants and for removal in stormwater treatment systems. Furthermore sorption is important for sampling using the most common types of passive samplers, which are based on uptake...

Effect of urban stormwater runoff on ground water beneath recharge basins on Long Island, New York

Science.gov (United States)

Ku, H.F.; Simmons, D.L.

1986-01-01

Urban stormwater runoff was monitored during 1980-82 to investigate the source, type, quantity, and fate of contaminants routed to the more than 3,000 recharge basins on Long Island and to determine whether this runoff might be a significant source of contamination to the groundwater reservoir. Forty-six storms were monitored at five recharge basins in representative land use areas (strip commercial, shopping-mall parking lot, major highway, low-density residential, and medium-density residential). Runoff:precipitation ratios indicate that all storm runoff is derived from precipitation on impervious surfaces in the drainage area, except during storms of high intensity or long duration, when additional runoff can be derived from precipitation on permeable surfaces. Lead was present in highway runoff in concentrations up to 3300 micrograms/L, and chloride was found in parking lot runoff concentrations up to 1,100 mg/L during winter, when salt is used for deicing. In the five composite stormwater samples and nine groundwater grab samples that were analyzed for 113 EPA-designated ' priority pollutants, ' four constituents were detected in concentrations exceeding New York State guidelines of 50 micrograms/L for an individual organic compound in drinking water: p-chloro-m-cresol (79 micrograms/L); 2 ,4-dimethylphenol (96 micrograms/L); 4-nitrophenol (58 micrograms/L); and methylene chloride (230 micrograms/L in either groundwater or stormwater at the highway basin). One stormwater sample and two groundwater samples exceeded New York State guidelines for total organic compounds in drinking water (100 micrograms/L). The presence of these constituents is attributed to contamination from point sources rather than to the quality of runoff from urban areas. The median number of indicator bacteria in stormwater ranged from 0.1 to 10 billion MPN/100 ml. Fecal coliforms and fecal streptococci increased by 1 to 2 orders of magnitude during the warm season. The use of recharge

Seasonal herbicide monitoring in soil, runoff and sediments of an olive orchard under conventional tillage

Science.gov (United States)

Calderón, Maria Jesus; de Luna, Elena; Gómez, José Alfonso; Cornejo, Juan; Hermosín, M. Carmen

2015-04-01

Several pollution episodes in surface and groundwaters with pesticides have occurred in areas where olive crops are established. For that reason, it is necessary to know the evolution of some pesticides in olive trees plantation depending on their seasonal application. This is especially important when conventional tillage is used. A monitoring of two herbicides (terbuthylazine and oxyfluorfen)in the first cm of soil and, in runoff and sediment yield was carried out after several rainfall events. The rainfall occurred during the study was higher in winter than in spring giving rise more runoff in winter. However, no differences in sediment yields were observed between spring and winter. Terbuthylazine depletion from soil is associated to the first important rainfall events in both seasons (41 mm in spring and 30 mm in winter). At the end of the experiment, no terbuthylazine soil residues were recovered in winter whereas 15% of terbuthylazine applied remained in spring. Oxyfluorfen showed a character more persistent than terbuthylazine remaining 48% of the applied at the end of the experiment due to its low water solubility. Higher percentage from the applied of terbuthylazine was recovered in runoff in winter (0.55%) than in spring (0.17%). Nevertheless, no differences in terbuthylazine sediments yields between both seasons were observed. That is in agreement with the values of runoff and sediment yields accumulated in tanks in both seasons. Due to the low water solubility of oxyfluorfen very low amount of this herbicide was recovered in runoff. Whereas, in sediment yields the 39.5% of the total applied was recovered. These data show that the dissipation of terbuthylazine from soil is closely related with leaching processes and in less extent with runoff. However, oxyfluorfen dissipation is more affected by runoff processes since this herbicide is co-transported in sediment yields. Keywords: olive crop, pesticide, runoff, sediments, surface water, groundwater

The capture and destruction of E. coli from simulated urban runoff using conventional bioretention media and iron oxide-coated sand

Science.gov (United States)

Given the magnitude of the threat to the quality of receiving water bodies posed by microbial pollutants in urban stormwater runoff, and the untested potential for their removal in bioretention systems, studies were performed to evaluate the removal efficiency of bacteria from simulated urban stormw...

Conifer flavonoid compounds inhibit detoxification enzymes and synergize insecticides.

Science.gov (United States)

Wang, Zhiling; Zhao, Zhong; Cheng, Xiaofei; Liu, Suqi; Wei, Qin; Scott, Ian M

2016-02-01

Detoxification by glutathione S-transferases (GSTs) and esterases are important mechanisms associated with insecticide resistance. Discovery of novel GST and esterase inhibitors from phytochemicals could provide potential new insecticide synergists. Conifer tree species contain flavonoids, such as taxifolin, that inhibit in vitro GST activity. The objectives were to test the relative effectiveness of taxifolin as an enzyme inhibitor and as an insecticide synergist in combination with the organophosphorous insecticide, Guthion (50% azinphos-methyl), and the botanical insecticide, pyrethrum, using an insecticide-resistant Colorado potato beetle (CPB) Leptinotarsa decemlineata (Say) strain. Both taxifolin and its isomer, quercetin, increased the mortality of 1(st) instar CPB larvae after 48h when combined with Guthion, but not pyrethrum. Taxifolin had greater in vitro esterase inhibition compared with the commonly used esterase inhibitor, S, S, S-tributyl phosphorotrithioate (DEF). An in vivo esterase and GST inhibition effect after ingestion of taxifolin was measured, however DEF caused a greater suppression of esterase activity. This study demonstrated that flavonoid compounds have both in vitro and in vivo esterase inhibition, which is likely responsible for the insecticide synergism observed in insecticide-resistant CPB. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.

Distributions of typical contaminant species in urban short-term storm runoff and their fates during rain events: a case of Xiamen City.

Science.gov (United States)

Wei, Qunshan; Zhu, Gefu; Wu, Peng; Cui, Li; Zhang, Kaisong; Zhou, Jingjing; Zhang, Wenru

2010-01-01

The pollutants in urban storm runoff, which lead to an non-point source contamination of water environment around cities, are of great concerns. The distributions of typical contaminants and the variations of their species in short term storm runoff from different land surfaces in Xiamen City were investigated. The concentrations of various contaminants, including organic matter, nutrients (i.e., N and P) and heavy metals, were significantly higher in parking lot and road runoff than those in roof and lawn runoff. The early runoff samples from traffic road and parking lot contained much high total nitrogen (TN 6-19 mg/L) and total phosphorus (TP 1-3 mg/L). A large proportion (around 60%) of TN existed as total dissolved nitrogen (TDN) species in most runoff. The percentage of TDN and the percentage of total dissolved phosphorus remained relatively stable during the rain events and did not decrease as dramatically as TN and TP. In addition, only parking lot and road runoff were contaminated by heavy metals, and both Pb (25-120 microg/L) and Zn (0.1-1.2 mg/L) were major heavy metals contaminating both runoff. Soluble Pb and Zn were predominantly existed as labile complex species (50%-99%), which may be adsorbed onto the surfaces of suspended particles and could be easily released out when pH decreased. This would have the great impact to the environment.

Regulations for the peat production water pollution control; Turvetuotannon vesiensuojeluohjeisto

Energy Technology Data Exchange (ETDEWEB)

Savolainen, M.; Heikkinen, K.; Ihme, R. [ed.] [VTT Communities and Infrastructure, Espoo (Finland)

1996-12-31

The regulations for peat production water pollution control include the latest information on anti-pollution constructions applicable to peat production including field ditches, sedimentation basins, overland flow areas, forest soil saturation, evaporation basins, chemicalization, detention of runoff and artificial flood plains. Information on subsurface drainage in peat mining is also given. The regulations deal with environmental viewpoints, planning of water protection and information on how to build, use and maintain anti-pollution constructions. Special attention is given to the soil conditions, because they play an important role in the building of different constructions. (orig.) (48 refs.)

Trees and Streets as Drivers of Urban Stormwater Nutrient Pollution.

Science.gov (United States)

Janke, Benjamin D; Finlay, Jacques C; Hobbie, Sarah E

2017-09-05

Expansion of tree cover is a major management goal in cities because of the substantial benefits provided to people, and potentially to water quality through reduction of stormwater volume by interception. However, few studies have addressed the full range of potential impacts of trees on urban runoff, which includes deposition of nutrient-rich leaf litter onto streets connected to storm drains. We analyzed the influence of trees on stormwater nitrogen and phosphorus export across 19 urban watersheds in Minneapolis-St. Paul, MN, U.S.A., and at the scale of individual streets within one residential watershed. Stormwater nutrient concentrations were highly variable across watersheds and strongly related to tree canopy over streets, especially for phosphorus. Stormwater nutrient loads were primarily related to road density, the dominant control over runoff volume. Street canopy exerted opposing effects on loading, where elevated nutrient concentrations from trees near roads outweighed the weak influence of trees on runoff reduction. These results demonstrate that vegetation near streets contributes substantially to stormwater nutrient pollution, and therefore to eutrophication of urban surface waters. Urban landscape design and management that account for trees as nutrient pollution sources could improve water quality outcomes, while allowing cities to enjoy the myriad benefits of urban forests.

Mixture for Controlling Insecticide-Resistant Malaria Vectors

OpenAIRE

Pennetier, Cédric; Costantini, Carlo; Corbel, Vincent; Licciardi, Séverine; Dabire, R. K.; Lapied, B.; Chandre, Fabrice; Hougard, Jean-Marc

2008-01-01

The spread of resistance to pyrethroids in the major Afrotropical malaria vectors Anopheles gambiae s.s. necessitates the development of new strategies to control resistant mosquito populations. To test the efficacy of nets treated with repellent and insecticide against susceptible and insecticide-resistant An. gambiae mosquito populations, we impregnated mosquito bed nets with an insect repellent mixed with a low dose of organophosphorous insecticide and tested them in a rice-growing area ne...

Effects of neonicotinoids and fipronil on non-target invertebrates : Environmental Science and Pollution Research

NARCIS (Netherlands)

Pisa, L.W.; Amaral-Rogers, V.; Belzunces, L.P.; Bonmatin, J.M.; Downs, C.A.; Goulson, D.; Kreutzweiser, D.P.; Krupke, C.; Liess, M.; McField, M.; Morrissey, C.A.; Noome, D.A.; Settele, J.; Simon-Delso, N.; Stark, J.D.; Van der Sluijs, J.P.; Van Dyck, H.; Wiemers, M.

2015-01-01

We assessed the state of knowledge regarding the effects of large-scale pollution with neonicotinoid insecticides and fipronil on non-target invertebrate species of terrestrial, freshwater and marine environments. A large section of the assessment is dedicated to the state of knowledge on sublethal

Radioligand Recognition of Insecticide Targets.

Science.gov (United States)

Casida, John E

2018-04-04

Insecticide radioligands allow the direct recognition and analysis of the targets and mechanisms of toxic action critical to effective and safe pest control. These radioligands are either the insecticides themselves or analogs that bind at the same or coupled sites. Preferred radioligands and their targets, often in both insects and mammals, are trioxabicyclooctanes for the γ-aminobutyric acid (GABA) receptor, avermectin for the glutamate receptor, imidacloprid for the nicotinic receptor, ryanodine and chlorantraniliprole for the ryanodine receptor, and rotenone or pyridaben for NADH + ubiquinone oxidoreductase. Pyrethroids and other Na + channel modulator insecticides are generally poor radioligands due to lipophilicity and high nonspecific binding. For target site validation, the structure-activity relationships competing with the radioligand in the binding assays should be the same as that for insecticidal activity or toxicity except for rapidly detoxified or proinsecticide analogs. Once the radioligand assay is validated for relevance, it will often help define target site modifications on selection of resistant pest strains, selectivity between insects and mammals, and interaction with antidotes and other chemicals at modulator sites. Binding assays also serve for receptor isolation and photoaffinity labeling to characterize the interactions involved.

Botanical insecticides inspired by plant-herbivore chemical interactions.

Science.gov (United States)

Miresmailli, Saber; Isman, Murray B

2014-01-01

Plants have evolved a plethora of secondary chemicals to protect themselves against herbivores and pathogens, some of which have been used historically for pest management. The extraction methods used by industry render many phytochemicals ineffective as insecticides despite their bioactivity in the natural context. In this review, we examine how plants use their secondary chemicals in nature and compare this with how they are used as insecticides to understand why the efficacy of botanical insecticides can be so variable. If the commercial production of botanical insecticides is to become a viable pest management option, factors such as production cost, resource availability, and extraction and formulation techniques need be considered alongside innovative application technologies to ensure consistent efficacy of botanical insecticides. Copyright © 2013 Elsevier Ltd. All rights reserved.

Spot Spraying Reduces Herbicide Concentrations in Runoff.

Science.gov (United States)

Melland, Alice R; Silburn, D Mark; McHugh, Allen D; Fillols, Emilie; Rojas-Ponce, Samuel; Baillie, Craig; Lewis, Stephen

2016-05-25

Rainfall simulator trials were conducted on sugar cane paddocks across dry-tropical and subtropical Queensland, Australia, to examine the potential for spot spraying to reduce herbicide losses in runoff. Recommended rates of the herbicides glyphosate, 2,4-D, fluoroxypyr, atrazine, and diuron were sprayed onto 0, 20, 40, 50, 70, or 100% of the area of runoff plots. Simulated rainfall was applied 2 days after spraying to induce runoff at one plant cane and three ratoon crop sites. Over 50% of all herbicides were transported in the dissolved phase of runoff, regardless of the herbicide's sediment-water partition coefficient. For most sites and herbicides, runoff herbicide concentrations decreased with decreasing spray coverage and with decreasing herbicide load in the soil and cane residues. Importantly, sites with higher infiltration prior to runoff and lower total runoff had lower runoff herbicide concentrations.

Degradation of Insecticides in Poultry Manure: Determining the Insecticidal Treatment Interval for Managing House Fly (Diptera: Muscidae) Populations in Poultry Farms.

Science.gov (United States)

Ong, Song-Quan; Ab Majid, Abdul Hafiz; Ahmad, Hamdan

2016-04-01

It is crucial to understand the degradation pattern of insecticides when designing a sustainable control program for the house fly, Musca domestica (L.), on poultry farms. The aim of this study was to determine the half-life and degradation rates of cyromazine, chlorpyrifos, and cypermethrin by spiking these insecticides into poultry manure, and then quantitatively analyzing the insecticide residue using ultra-performance liquid chromatography. The insecticides were later tested in the field in order to study the appropriate insecticidal treatment intervals. Bio-assays on manure samples were later tested at 3, 7, 10, and 15 d for bio-efficacy on susceptible house fly larvae. Degradation analysis demonstrated that cyromazine has the shortest half-life (3.01 d) compared with chlorpyrifos (4.36 d) and cypermethrin (3.75 d). Cyromazine also had a significantly greater degradation rate compared with chlorpyrifos and cypermethrin. For the field insecticidal treatment interval study, 10 d was the interval that had been determined for cyromazine due to its significantly lower residue; for ChCy (a mixture of chlorpyrifos and cypermethrin), the suggested interval was 7 d. Future work should focus on the effects of insecticide metabolites on targeted pests and the poultry manure environment.

Heavy Metal and PAH Concentrations in Highway Runoff Deposits Fractionated on Settling Velocities

DEFF Research Database (Denmark)

Bentzen, Thomas Ruby; Larsen, Torben

2009-01-01

The correlation between settling velocity and associated pollutant concentrations is of major importance for best management practice in designing, redesigning, or evaluation of the efficiency of existing pond facilities for retaining unwanted pollutants. The prospect of this note is to state...... the relationship between the settling velocity of the runoff particles and the corresponding metal and polyaromatic hydrocarbon (PAH) concentration directly instead of dealing with two unknowns-the density and the shape of a single particle fraction in a settling velocity calculations. The measurements show...... and copper and there is no significant correlation between PAH concentration and settling velocity. The largest mass of metals and PAH within each pond can be found on the particle fraction with a settling velocity of 5.5-2.5 mm/s....

Influence of land development on stormwater runoff from a mixed land use and land cover catchment.

Science.gov (United States)

Paule-Mercado, M A; Lee, B Y; Memon, S A; Umer, S R; Salim, I; Lee, C-H

2017-12-01

Mitigating for the negative impacts of stormwater runoff is becoming a concern due to increased land development. Understanding how land development influences stormwater runoff is essential for sustainably managing water resources. In recent years, aggregate low impact development-best management practices (LID-BMPs) have been implemented to reduce the negative impacts of stormwater runoff on receiving water bodies. This study used an integrated approach to determine the influence of land development and assess the ecological benefits of four aggregate LID-BMPs in stormwater runoff from a mixed land use and land cover (LULC) catchment with ongoing land development. It used data from 2011 to 2015 that monitored 41 storm events and monthly LULC, and a Personalized Computer Storm Water Management Model (PCSWMM). The four aggregate LID-BMPs are: ecological (S1), utilizing pervious covers (S2), and multi-control (S3) and (S4). These LID-BMPs were designed and distributed in the study area based on catchment characteristics, cost, and effectiveness. PCSWMM was used to simulate the monitored storm events from 2014 (calibration: R 2 and NSE>0.5; RMSE 0.5; RMSE runoff data and LULC change patterns (only 2015 for LID-BMPs) were used. Results show that the expansion of bare land and impervious cover, soil alteration, and high amount of precipitation influenced the stormwater runoff variability during different phases of land development. The four aggregate LID-BMPs reduced runoff volume (34%-61%), peak flow (6%-19%), and pollutant concentrations (53%-83%). The results of this study, in addition to supporting local LULC planning and land development activities, also could be applied to input data for empirical modeling, and designing sustainable stormwater management guidelines and monitoring strategies. Copyright © 2017 Elsevier B.V. All rights reserved.

Water quality of surface runoff and lint yield in cotton under furrow irrigation in Northeast Arkansas.

Science.gov (United States)

Adviento-Borbe, M Arlene A; Barnes, Brittany D; Iseyemi, Oluwayinka; Mann, Amanda M; Reba, Michele L; Robertson, William J; Massey, Joseph H; Teague, Tina G

2018-02-01

Use of furrow irrigation in row crop production is a common practice through much of the Midsouth US and yet, nutrients can be transported off-site through surface runoff. A field study with cotton (Gossypium hirsutum, L.) was conducted to understand the impact of furrow tillage practices and nitrogen (N) fertilizer placement on characteristics of runoff water quality during the growing season. The experiment was designed as a randomized complete block design with conventional (CT) and conservation furrow tillage (FT) in combination with either urea (URN) broadcast or 32% urea ammonium nitrate (UAN) injected, each applied at 101kgNha -1 . Concentrations of ammonium (NH 4 -N), nitrate (NO 3 -N), nitrite (NO 2 -N), and dissolved phosphorus (P) in irrigation runoff water and lint yields were measured in all treatments. The intensity and chemical form of nutrient losses were primarily controlled by water runoff volume and agronomic practice. Across tillage and fertilizer N treatments, median N concentrations in the runoff were water. Water pH, specific electrical conductivity, alkalinity and hardness were within levels that common to local irrigation water and less likely to impair pollution in waterways. Lint yields averaged 1111kgha -1 and were higher (P-value=0.03) in FT compared to CT treatments. Runoff volumes across irrigation events were greater (P-value=0.02) in CT than FT treatments, which increased NO 3 -N mass loads in CT treatments (394gNO 3 -Nha -1 season -1 ). Nitrate-N concentrations in CT treatments were still low and pose little threat to N contaminations in waterways. The findings support the adoption of conservation practices for furrow tillage and N fertilizer placement that can reduce nutrient runoff losses in furrow irrigation systems. Published by Elsevier B.V.

Impact of animal waste application on runoff water quality in field experimental plots.

Science.gov (United States)

Hill, Dagne D; Owens, William E; Tchoounwou, Paul B

2005-08-01

present after the simulated rainfall events were above 200/100 ml of sample water. It can be concluded that: 1) non-point source pollution has a significant effect on bacterial and nutrients levels in runoff water and in water resources; 2) land application of animal waste for soil fertilization makes a significant contribution to water pollution; 3) the use of tilling can significantly reduce the amount of nutrients available in runoff water.

Organic pollutant levels in an agricultural watershed: the importance of analyzing multiple matrices for assessing stream water pollution.

Science.gov (United States)

Gonzalez, Mariana; Miglioranza, Karina S B; Grondona, Sebastían I; Silva Barni, Maria Florencia; Martinez, Daniel E; Peña, Aránzazu

2013-04-01

This study is aimed at analyzing the occurrence and transport of organochlorine pesticides (OCPs), polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs) in the Quequén Grande river basin, as representative of a catchment under diffuse pollution sources. Pollutant levels in soils, river bottom sediments (RBS), streamwater (Sw), suspended particle materials (SPMs), macrophytes and muscle of silverside were determined by GC-ECD. Soil K(d) values for the current-used insecticides, endosulfans and cypermethrin, were established. Total levels (ng g(-1) dry weight) in soil ranged between 0.07–0.9 for OCPs, 0.03–0.37 for PCBs and 0.01–0.05 for PBDEs. Endosulfan insecticide (α- + b- + sulfate metabolite) represented up to 72.5% of OCPs. The low soil retention for α-endosulfan (K(d): 77) and endosulfan sulfate (K(d): 100) allows their transport to Sw, SPM and RBS. Levels of endosulfan in Sw in some cases exceeded the value postulated by international guidelines for aquatic biota protection (3 ng L(-1)). PCB and PBDE pollution was related to harbour, dumping sites and pile tire burning. Tri and hexa PCB congeners predominated in all matrices and exceeded the quality guideline value of 0.04 ng L(-1) in Sw. Considering levels in silverside muscle, none of the oral reference doses were exceeded, however, PCBs accounted for 18.6% of the total daily allowed ingest for a 70 kg individual. Although the levels of PCBs and OCPs in soil and RBS were low and did not go beyond quality guidelines, these compounds could still represent a risk to aquatic biota and humanbeings, and thus actions towards preventing this situation should be undertaken.

Insecticide mixtures could enhance the toxicity of insecticides in a resistant dairy population of Musca domestica L [corrected].

Directory of Open Access Journals (Sweden)

Hafiz Azhar Ali Khan

Full Text Available House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-"A" and LC50: LC50-"B" significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies.

Reduced nutrient pollution in a rural stream following septic tank upgrade and installation of runoff retention measures.

Science.gov (United States)

Ockenden, M C; Quinton, J N; Favaretto, N; Deasy, C; Surridge, B

2014-07-01

Surface water quality in the UK and much of Western Europe has improved in recent decades, in response to better point source controls and the regulation of fertilizer, manure and slurry use. However, diffuse sources of pollution, such as leaching or runoff of nutrients from agricultural fields, and micro-point sources including farmyards, manure heaps and septic tank sewerage systems, particularly systems without soil adsorption beds, are now hypothesised to contribute a significant proportion of the nutrients delivered to surface watercourses. Tackling such sources in an integrated manner is vital, if improvements in freshwater quality are to continue. In this research, we consider the combined effect of constructing small field wetlands and improving a septic tank system on stream water quality within an agricultural catchment in Cumbria, UK. Water quality in the ditch-wetland system was monitored by manual sampling at fortnightly intervals (April-October 2011 and February-October 2012), with the septic tank improvement taking place in February 2012. Reductions in nutrient concentrations were observed through the catchment, by up to 60% when considering total phosphorus (TP) entering and leaving a wetland with a long residence time. Average fluxes of TP, soluble reactive phosphorus (SRP) and ammonium-N (NH4-N) at the head of the ditch system in 2011 (before septic tank improvement) compared to 2012 (after septic tank improvement) were reduced by 28%, 9% and 37% respectively. However, TP concentration data continue to show a clear dilution with increasing flow, indicating that the system remained point source dominated even after the septic tank improvement.

From a microcosm to the catchment scale: studying the fate of organic runoff pollutants in aquatic ecosystems

Science.gov (United States)

Böttcher, T.; Schroll, R.

2009-04-01

Spray-drift, drainage, erosion and runoff events are the major causes responsible for deportation of agrochemicals as micropollutants to aquatic non-target sites. These processes can lead to the contamination of nearby freshwater ecosystems with considerably high concentrations of xenobiotics. Thus, it is important to unravel the fate of these pollutants and to evaluate their ecological effects. A novel approach to address this goal was established by the development of a microcosm with multiple sampling abilities enabling quantitative assessment of organic volatilisation, mineralization, metabolization and distribution within the aquatic ecosystem. This microcosm system was designed to support modelling approaches of the catchment scale and gain insights into the fate of pesticides simulating a large scale water body. The potential of this microcosm was exemplified for Isoproturon (IPU), a phenylurea derived systemic herbicide, which is frequently found as contaminant in water samples and with the free-floating macrophyte Lemna minor as non-target species, that is common to occur in rural water bodies. During 21 days exposure time, only a small amount of 14C labeled IPU was removed from the aquatic medium. The major portion (about 5%) was accumulated by Lemna minor resulting in a BCF of 15.8. IPU-volatilisation was very low with 0.13% of the initially applied herbicide. Only a minor amount of IPU was completely metabolized, presumably by rhizosphere microorganisms and released as 14CO2. The novel experimental system allowed to quantitatively investigate the fate of IPU and showed a high reproducibility with a mean average 14C-recovery rate of 97.1

Runoff from armored slopes

International Nuclear Information System (INIS)

Codell, R.B.

1986-01-01

Models exist for calculating overland flow on hillsides but no models have been found which explicitly deal with runoff from armored slopes. Flow on armored slopes differs from overland flow, because substantial flow occurs beneath the surface of the rock layer at low runnoff, and both above and below the surface for high runoff. In addition to the lack of a suitable model, no estimates of the PMP exist for such small areas and for very short durations. This paper develops a model for calculating runoff from armored embankments. The model considers the effect of slope, drainage area and ''flow concentration'' caused by irregular grading or slumping. A rainfall-duration curve based on the PMP is presented which is suitable for very small drainage areas. The development of the runoff model and rainfall-duration curve is presented below, along with a demonstration of the model on the design of a hypothetical tailings embankment

Microbes as interesting source of novel insecticides: A review ...

African Journals Online (AJOL)

... strains with good insecticidal properties can be identified, evaluated and utilized for pest control. This paper reviews the insecticidal properties of microbes and their potential utility in pest management. Keywords: Microbes, insecticides, metabolites, pest management. African Journal of Biotechnology, Vol 13(26) 2582- ...

Mechanistic modeling of insecticide risks to breeding birds in ...

Science.gov (United States)

Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of the insecticide and the risk the insecticide poses to the environment and non-target wildlife. At the present time, current USEPA risk assessments do not include population-level endpoints. In this paper, we present a new mechanistic model, which allows risk assessors to estimate the effects of insecticide exposure on the survival and seasonal productivity of birds known to use agricultural fields during their breeding season. The new model was created from two existing USEPA avian risk assessment models, the Terrestrial Investigation Model (TIM v.3.0) and the Markov Chain Nest Productivity model (MCnest). The integrated TIM/MCnest model has been applied to assess the relative risk of 12 insecticides used to control corn pests on a suite of 31 avian species known to use cornfields in midwestern agroecosystems. The 12 insecticides that were assessed in this study are all used to treat major pests of corn (corn root worm borer, cutworm, and armyworm). After running the integrated TIM/MCnest model, we found extensive differences in risk to birds among insecticides, with chlorpyrifos and malathion (organophosphates) generally posing the greatest risk, and bifenthrin and ë-cyhalothrin (

Ecdysone Agonist: New Insecticides with Novel Mode of Action

Directory of Open Access Journals (Sweden)

Y. Andi Trisyono

2002-12-01

Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists

Simulation on Change Law of Runoff, Sediment and Non-point Source Nitrogen and Phosphorus Discharge under Different Land uses Based on SWAT Model: A Case Study of Er hai Lake Small Watershed

Science.gov (United States)

Tong, Xiao Xia; Lai Cui, Yuan; Chen, Man Yu; Hu, Bo; Xu, Wen Sheng

2018-05-01

The Er yuan watershed of Er hai district is chosen as the research area, the law of runoff and sediment and non-point source nitrogen and phosphorus discharges under different land uses during 2001 to 2014 are simulated based on SWAT model. Results of simulation indicate that the order of total runoff yield of different land use type from high to low is grassland, paddy fields, dry land. Specifically, the order of surface runoff yield from high to low is paddy fields, dry land, grassland, the order of lateral runoff yield from high to low is paddy fields, dry land, grassland, the order of groundwater runoff yield from high to low is grassland, paddy fields, dry land. The orders of sediment and nitrogen and phosphorus yield per unit area of different land use type are the same, grassland> paddy fields> dry land. It can be seen, nitrogen and phosphorus discharges from paddy fields and dry land are the main sources of agricultural non-point pollution of the irrigated area. Therefore, reasonable field management measures which can decrease the discharge of nitrogen and phosphorus of paddy fields and dry land are the key to agricultural non-point source pollution prevention and control.

Assessment of Runoff Contributing Catchment Areas in Rainfall Runoff Modelling

DEFF Research Database (Denmark)

Thorndahl, Søren Liedtke; Johansen, C.; Schaarup-Jensen, Kjeld

2005-01-01

to determine with significant precision the hydrological reduction factor is implemented to account all hydrological losses except the initial loss. This paper presents an inconsistency between calculations of the hydrological reduction factor, based on measurements of rainfall and runoff, and till now...... recommended literary values for residential areas. It is proven by comparing rainfall-runoff measurements from four different residential catchments that the literary values of the hydrological reduction factor are over-estimated for this type of catchments. In addition, different catchment descriptions...

Improving runoff risk estimates: Formulating runoff as a bivariate process using the SCS curve number method

Science.gov (United States)

Shaw, Stephen B.; Walter, M. Todd

2009-03-01

The Soil Conservation Service curve number (SCS-CN) method is widely used to predict storm runoff for hydraulic design purposes, such as sizing culverts and detention basins. As traditionally used, the probability of calculated runoff is equated to the probability of the causative rainfall event, an assumption that fails to account for the influence of variations in soil moisture on runoff generation. We propose a modification to the SCS-CN method that explicitly incorporates rainfall return periods and the frequency of different soil moisture states to quantify storm runoff risks. Soil moisture status is assumed to be correlated to stream base flow. Fundamentally, this approach treats runoff as the outcome of a bivariate process instead of dictating a 1:1 relationship between causative rainfall and resulting runoff volumes. Using data from the Fall Creek watershed in western New York and the headwaters of the French Broad River in the mountains of North Carolina, we show that our modified SCS-CN method improves frequency discharge predictions in medium-sized watersheds in the eastern United States in comparison to the traditional application of the method.

Study on Water Quality of Surface Runoff and Groundwater Runoff on the Basis of Separation by a Numerical Filter

OpenAIRE

Kawara, Osami; Fukumoto, Kohji

1994-01-01

In this study we investigated the water quality of surface runoff and groundwater runoff from the basins of the Yodo River and the Asahi River based on that separated by a numerical filter. The water quality of the surface runoff is greatly different from the groundwater runoff. The tendency of concentration change in accordance with river discharges is different from each other. The water qtiality of groundwater runoff changes with river discharges clockwise in many cases. The differences of...

Behaviour of arsenic in forested catchments following a high-pollution period

International Nuclear Information System (INIS)

Novak, Martin; Erbanova, Lucie; Fottova, Daniela; Cudlin, Pavel; Kubena, Ales

2011-01-01

Due to high availability of adsorption sites, forested catchments could be net sinks for pollutant arsenic both during the period of increasing and decreasing pollution. We tested this hypothesis along a north-south pollution gradient in spruce die-back affected areas of Central Europe. For two water years (2007-2008), we monitored As fluxes via spruce-canopy throughfall, open-area precipitation, and runoff in four headwater catchments (Czech Republic). Since 1980, atmospheric As inputs decreased 26 times in the north, and 13 times in the south. Arsenic export by runoff was similar to atmospheric inputs at three sites, resulting in a near-zero As mass balance. One site exhibited a net export of As (2.2 g ha -1 yr -1 ). In contrast, the preceding period (1995-2006) showed much higher As fluxes, and higher As export. Czech catchments do not serve as net sinks of atmospheric As. A considerable proportion of old industrial arsenic is flushed out of the soil. - Following a period of high atmospheric As deposition, a considerable proportion of old industrial arsenic is flushed out of soil and exported from forested catchments.

Insecticide Resistance Reducing Effectiveness of Malaria Control

Centers for Disease Control (CDC) Podcasts

Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.

The status of pesticide pollution in surface waters (rivers and lakes) of Greece. Part I. Review on occurrence and levels

International Nuclear Information System (INIS)

Konstantinou, Ioannis K.; Hela, Dimitra G.; Albanis, Triantafyllos A.

2006-01-01

This review evaluates and summarizes the results of long-term research projects, monitoring programs and published papers concerning the pollution of surface waters (rivers and lakes) of Greece by pesticides. Pesticide classes mostly detected involve herbicides used extensively in corn, cotton and rice production, organophosphorus insecticides as well as the banned organochlorines insecticides due to their persistence in the aquatic environment. The compounds most frequently detected were atrazine, simazine, alachlor, metolachlor and trifluralin of the herbicides, diazinon, parathion methyl of the insecticides and lindane, endosulfan and aldrin of the organochlorine pesticides. Rivers were found to be more polluted than lakes. The detected concentrations of most pesticides follow a seasonal variation, with maximum values occurring during the late spring and summer period followed by a decrease during winter. Nationwide, in many cases the reported concentrations ranged in low ppb levels. However, elevated concentrations were recorded in areas of high pesticide use and intense agricultural practices. Generally, similar trends and levels of pesticides were found in Greek rivers compared to pesticide contamination in other European rivers. Monitoring of the Greek water resources for pesticide residues must continue, especially in agricultural regions, because the nationwide patterns of pesticide use are constantly changing. Moreover, emphasis should be placed on degradation products not sufficiently studied so far. - Information on pesticide pollution of surface waters in Greece is reviewed

Method for assessment of stormwater treatment facilities – Synthetic road runoff addition including micro-pollutants and tracer

DEFF Research Database (Denmark)

Cederkvist, Karin; Jensen, Marina Bergen; Holm, Peter Engelund

2017-01-01

Stormwater treatment facilities (STFs) are becoming increasingly widespread but knowledge on their performance is limited. This is due to difficulties in obtaining representative samples during storm events and documenting removal of the broad range of contaminants found in stormwater runoff...

Assessment of the environmental significance of nutrients and heavy metal pollution in the river network of Serbia.

Science.gov (United States)

Dević, Gordana; Sakan, Sanja; Đorđević, Dragana

2016-01-01

In this paper, the data for ten water quality variables collected during 2009 at 75 monitoring sites along the river network of Serbia are considered. The results are alarming because 48% of the studied sites were contaminated by Ni, Mn, Pb, As, and nutrients, which are key factors impairing the water quality of the rivers in Serbia. Special attention should be paid to Zn and Cu, listed in the priority toxic pollutants of US EPA for aquatic life protection. The employed Q-model cluster analysis grouped the data into three major pollution zones (low, moderate, and high). Most sites classified as "low pollution zones" (LP) were in the main rivers, whereas those classified as "moderate and high pollution zones" (MP and HP, respectively) were in the large and small tributaries/hydro-system. Principal component analysis/factor analysis (PCA/FA) showed that the dissolved metals and nutrients in the Serbian rivers varied depending on the river, the heterogeneity of the anthropogenic activities in the basins (influenced primarily by industrial wastewater, agricultural activities, and urban runoff pollution), and natural environmental variability, such as geological characteristics. In LP dominated non-point source pollution, such as agricultural and urban runoff, whereas mixed source pollution dominated in the MP and HP zones. These results provide information to be used for developing better pollution control strategies for the river network of Serbia.

The role of catchment vegetation in reducing atmospheric inputs of pollutant aerosols in Ganga river.

Science.gov (United States)

Shubhashish, Kumar; Pandey, Richa; Pandey, Jitendra

2012-08-01

The role of woody perennials in the Ganga river basin in modifying the run-off quality as influenced by atmospheric deposition of pollutant aerosols was investigated. The concentration of seven nutrients and eight metals were measured in atmospheric deposits as well as in run-off water under the influence of five woody perennials. Nutrient retention was recorded maximum for Bougainvillea spectabilis ranged from 4.30 % to 33.70 %. Metal retention was recorded highest for Ficus benghalensis ranged from 5.15 % to 36.98 %. Although some species showed nutrient enrichment, all the species considered in the study invariably contribute to reduce nutrients and metal concentration in run-off water. Reduction in run off was recorded maximum for B. spectabilis (nutrient 6.48 %-40.66 %; metal 7.86 %-22.85 %) and minimum for Ficus religiosa (nutrient 1.68 %-27.19 %; metal 6.55 %-31.55 %). The study forms the first report on the use of woody perennials in reducing input of atmospheric pollutants to Ganga river and has relevance in formulating strategies for river basin management.

ISLSCP II UNH/GRDC Composite Monthly Runoff

Data.gov (United States)

National Aeronautics and Space Administration — ABSTRACT: The University of New Hampshire (UNH)/Global Runoff Data Centre (GRDC) composite runoff data combines simulated water balance model runoff estimates...

Systemic insecticides (neonicotinoids and fipronil): trends, uses, mode of action and metabolites : Environmental Science and Pollution Research

OpenAIRE

Simon-Delso, N.; Amaral-Rogers, V.; Belzunces, L.P.; Bonmatin, J.M.; Chagnon, M.; Downs, C.; Furlan, L.; Gibbons, D.W.; Giorio, C.; Girolami, V.; Goulson, D.; Kreutzweiser, D.P.; Krupke, C.H.; Liess, M.; Long, E.

2015-01-01

Since their discovery in the late 1980s, neonicotinoid pesticides have become the most widely used class of insecticides worldwide, with large-scale applications ranging from plant protection (crops, vegetables, fruits), veterinary products, and biocides to invertebrate pest control in fish farming. In this review, we address the phenyl-pyrazole fipronil together with neonicotinoids because of similarities in their toxicity, physicochemical profiles, and presence in the environment. Neonicoti...

Methodology for agricultural and rural NPS pollution in a typical county of the North China Plain

International Nuclear Information System (INIS)

Yang Yong; Chen Ying; Zhang Xiaolan; Ongley, Edwin; Zhao Lei

2012-01-01

Agricultural non-point source (NPS) pollution has been recently identified by the Chinese government as a major source of aquatic pollution. Methodologies commonly used to make basin-wide or area-wide assessments are problematic and regional distinctions have not been made relative to rainfall and runoff. Using a typical agricultural county in the Hai River basin of the North China Plan we developed methodology to estimate potential load and delivered load for crops (field crops + rice), animal production, rural living and from atmospheric N input. We use scenarios to allow for uncertainty in delivery to estimate the relative roles of different rural forms of pollution. Livestock raising is the major source of NPS pollution. Despite a 75% rural population, rural living contributes almost nothing to surface water pollution. While over-fertilization is typical, nutrient runoff from crops is low. Our results have implications for policies now under development for NPS control in China. - Highlights: ► Provides specific methods guidance for agricultural NPS assessment in China. ► Crops do not contribute significant N and P to watercourses in North China Plain. ► Rural living contributes almost no N and P to watercourses. ► Livestock is the only significant agricultural source of COD, N and P. - We address the methodology for agricultural NPS pollution assessment. We show that livestock, not rural living or crops, is the significant pollutant source.

A Fuzzy Control System for Reducing Urban Runoff by a Stormwater Storage Tank

Science.gov (United States)

Zhang, P.; Cai, Y.; Wang, J.

2017-12-01

Stormwater storage tank (SST) is a popular low impact development technology for reducing stormwater runoff in the construction of sponge city. Most researches on SST were mainly the design, pollutants removal effect, and operation assessment. While there were few researches on the automatic control of SST for reducing peak flow. In this paper, fuzzy control was introduced into the peak control of SST to improve the efficiency of reducing stormawter runoff. Firstly, the design of SST was investigated. A catchment area and return period were assumed, a SST model was manufactured, and then the storage capacity of the SST was verified. Secondly, the control parameters of the SST based on reducing stormwater runoff was analyzed, and a schematic diagram of real-time control (RTC) system based on peak control SST was established. Finally, fuzzy control system of a double input (flow and water level) and double output (inlet and outlet valve) was designed. The results showed that 1) under the different return periods (one year, three years, five years), the SST had the effect of delayed peak control and storage by increasing the detention time, 2) rainfall, pipeline flow, the influent time and the water level in the SST could be used as RTC parameters, and 3) the response curves of flow velocity and water level fluctuated very little and reached equilibrium in a short time. The combination of online monitoring and fuzzy control was feasible to control the SST automatically. This paper provides a theoretical reference for reducing stormwater runoff and improving the operation efficiency of SST.

Additional selection for insecticide resistance in urban malaria vectors: DDT resistance in Anopheles arabiensis from Bobo-Dioulasso, Burkina Faso.

Directory of Open Access Journals (Sweden)

Christopher M Jones

Full Text Available In the city of Bobo-Dioulasso in Burkina Faso, Anopheles arabiensis has superseded Anopheles gambiae s.s. as the major malaria vector and the larvae are found in highly polluted habitats normally considered unsuitable for Anopheles mosquitoes. Here we show that An. gambiae s.l. adults emerging from a highly polluted site in the city centre (Dioulassoba have a high prevalence of DDT resistance (percentage mortality after exposure to diagnostic dose=65.8% in the dry season and 70.4% in the rainy season, respectively. An investigation into the mechanisms responsible found an unexpectedly high frequency of the 1014S kdr mutation (allele frequency=0.4, which is found at very low frequencies in An. arabiensis in the surrounding rural areas, and an increase in transcript levels of several detoxification genes, notably from the glutathione transferase and cytochrome P450 gene families. A number of ABC transporter genes were also expressed at elevated levels in the DDT resistant An. arabiensis. Unplanned urbanisation provides numerous breeding grounds for mosquitoes. The finding that Anopheles mosquitoes adapted to these urban breeding sites have a high prevalence of insecticide resistance has important implications for our understanding of the selective forces responsible for the rapid spread of insecticide resistant populations of malaria vectors in Africa.

The Treatment Train approach to reducing non-point source pollution from agriculture

Science.gov (United States)

Barber, N.; Reaney, S. M.; Barker, P. A.; Benskin, C.; Burke, S.; Cleasby, W.; Haygarth, P.; Jonczyk, J. C.; Owen, G. J.; Snell, M. A.; Surridge, B.; Quinn, P. F.

2016-12-01

An experimental approach has been applied to an agricultural catchment in NW England, where non-point pollution adversely affects freshwater ecology. The aim of the work (as part of the River Eden Demonstration Test Catchment project) is to develop techniques to manage agricultural runoff whilst maintaining food production. The approach used is the Treatment Train (TT), which applies multiple connected mitigation options that control nutrient and fine sediment pollution at source, and address polluted runoff pathways at increasing spatial scale. The principal agricultural practices in the study sub-catchment (1.5 km2) are dairy and stock production. Farm yards can act as significant pollution sources by housing large numbers of animals; these areas are addressed initially with infrastructure improvements e.g. clean/dirty water separation and upgraded waste storage. In-stream high resolution monitoring of hydrology and water quality parameters showed high-discharge events to account for the majority of pollutant exports ( 80% total phosphorus; 95% fine sediment), and primary transfer routes to be surface and shallow sub-surface flow pathways, including drains. To manage these pathways and reduce hydrological connectivity, a series of mitigation features were constructed to intercept and temporarily store runoff. Farm tracks, field drains, first order ditches and overland flow pathways were all targeted. The efficacy of the mitigation features has been monitored at event and annual scale, using inflow-outflow sampling and sediment/nutrient accumulation measurements, respectively. Data presented here show varied but positive results in terms of reducing acute and chronic sediment and nutrient losses. An aerial fly-through of the catchment is used to demonstrate how the TT has been applied to a fully-functioning agricultural landscape. The elevated perspective provides a better understanding of the spatial arrangement of mitigation features, and how they can be

Effect of selected insecticides on SF9 insect cell line

International Nuclear Information System (INIS)

Saleh, M.; Rahmo, A.; Hajjar, J.

2013-01-01

The toxic effect of three insecticides: dimethoate (organophosphate insecticide), acetamiprid (neonicotinoid insecticide) and deltamethrin (pyrethroid insecticide) were evaluated in vitro on cultured Sf9 cell line. Cell growth inhibition was measured by the 3- (4,5- dimethylthiazol - 2-yl) - 2,5 - diphenyl tetrazolium bromide (MTT) assay. Regression Analysis was used to estimate the 20% inhibition of cells growth (IC 20). The IC 20 values obtained for deltamethrin, acetamipridand dimethoate were: 46.8, 61.6 and 68.9 μM, respectively. The proportion of phagocytic cells was positively correlated with the applied concentrations of the insecticides. (author)

Modelling of recharge and pollutant fluxes to urban groundwaters

International Nuclear Information System (INIS)

Thomas, Abraham; Tellam, John

2006-01-01

Urban groundwater resources are of considerable importance to the long-term viability of many cities world-wide, yet prediction of the quantity and quality of recharge is only rarely attempted at anything other than a very basic level. This paper describes the development of UGIf, a simple model written within a GIS, designed to provide estimates of spatially distributed recharge and recharge water quality in unconfined but covered aquifers. The following processes (with their calculation method indicated) are included: runoff and interception (curve number method); evapotranspiration (Penman-Grindley); interflow (empirical index approach); volatilization (Henry's law); sorption (distribution coefficient); and degradation (first order decay). The input data required are: meteorological data, landuse/cover map with event mean concentration attributes, geological maps with hydraulic and geochemical attributes, and topographic and water table elevation data in grid form. Standard outputs include distributions of: surface runoff, infiltration, potential recharge, ground level slope, interflow, actual recharge, pollutant fluxes in surface runoff, travel times of each pollutant through the unsaturated zone, and the pollutant fluxes and concentrations at the water table. The process of validation has commenced with a study of the Triassic Sandstone aquifer underlying Birmingham, UK. UGIf predicts a similar average recharge rate for the aquifer as previous groundwater flow modelling studies, but with significantly more spatial detail: in particular the results indicate that recharge through paved areas may be more important than previously thought. The results also highlight the need for more knowledge/data on the following: runoff estimation; interflow (including the effects of lateral flow and channelling on flow times and therefore chemistry); evapotranspiration in paved areas; the nature of unsaturated zone flow below paved areas; and the role of the pipe network

Water quality of storm runoff and comparison of procedures for estimating storm-runoff loads, volume, event-mean concentrations, and the mean load for a storm for selected properties and constituents for Colorado Springs, southeastern Colorado, 1992

Science.gov (United States)

Von Guerard, Paul; Weiss, W.B.

1995-01-01

The U.S. Environmental Protection Agency requires that municipalities that have a population of 100,000 or greater obtain National Pollutant Discharge Elimination System permits to characterize the quality of their storm runoff. In 1992, the U.S. Geological Survey, in cooperation with the Colorado Springs City Engineering Division, began a study to characterize the water quality of storm runoff and to evaluate procedures for the estimation of storm-runoff loads, volume and event-mean concentrations for selected properties and constituents. Precipitation, streamflow, and water-quality data were collected during 1992 at five sites in Colorado Springs. Thirty-five samples were collected, seven at each of the five sites. At each site, three samples were collected for permitting purposes; two of the samples were collected during rainfall runoff, and one sample was collected during snowmelt runoff. Four additional samples were collected at each site to obtain a large enough sample size to estimate storm-runoff loads, volume, and event-mean concentrations for selected properties and constituents using linear-regression procedures developed using data from the Nationwide Urban Runoff Program (NURP). Storm-water samples were analyzed for as many as 186 properties and constituents. The constituents measured include total-recoverable metals, vola-tile-organic compounds, acid-base/neutral organic compounds, and pesticides. Storm runoff sampled had large concentrations of chemical oxygen demand and 5-day biochemical oxygen demand. Chemical oxygen demand ranged from 100 to 830 milligrams per liter, and 5.-day biochemical oxygen demand ranged from 14 to 260 milligrams per liter. Total-organic carbon concentrations ranged from 18 to 240 milligrams per liter. The total-recoverable metals lead and zinc had the largest concentrations of the total-recoverable metals analyzed. Concentrations of lead ranged from 23 to 350 micrograms per liter, and concentrations of zinc ranged from 110

The effect of the runoff size on the pesticide concentration in runoff water and in FOCUS streams simulated by PRZM and TOXSWA.

Science.gov (United States)

Adriaanse, Paulien I; Van Leerdam, Robert C; Boesten, Jos J T I

2017-04-15

Within the European Union the exposure of aquatic organisms to pesticides is assessed by simulations with the so-called FOCUS Surface Water Scenarios. Runoff plays an important role in these scenarios. As little is known about the effect of runoff size on the exposure, we investigated the effect of runoff size on the concentration in the runoff water and in streams simulated with the PRZM and TOXSWA models for two FOCUS runoff scenarios. For weakly sorbing pesticides (K F,oc runoff water decreased exponentially with increasing daily runoff size. The runoff size hardly affected the pesticide concentration in the runoff water of strongly sorbing pesticides (K F,oc ≥1000Lkg -1 ). For weakly sorbing pesticides the concentration in the FOCUS stream reached a maximum at runoff sizes of about 0.3 to 1mm. The concentration increased rapidly when the runoff size increased from 0 to 0.1mm and gradually decreased when runoff exceeded 1mm. For strongly sorbing pesticides the occurrence of the maximum concentration in the stream is clearly less pronounced and lies approximately between 1 and 20mm runoff. So, this work indicates that preventing small runoff events (e.g. by vegetated buffer strips) reduces exposure concentrations strongly for weakly sorbing pesticides. A simple metamodel was developed for the ratio between the concentrations in the stream and in the runoff water. This model predicted the ratios simulated by TOXSWA very well and it demonstrated that (in addition to runoff size and concentration in runoff) the size of the pesticide-free base flow and pesticide treatment ratio of the catchment determine the stream concentration to a large extent. Copyright © 2016 Elsevier B.V. All rights reserved.

Disulfide polymer grafted porous carbon composites for heavy metal removal from stormwater runoff

DEFF Research Database (Denmark)

Ko, Dongah; Mines, Paul D.; Jakobsen, Mogens Havsteen

2018-01-01

The emerging concern of heavy metal pollution derived from stormwater runoff has triggered a demand for effective heavy metal sorbents. To be an effective sorbent, high affinity along with rapid sorption kinetics for environmental relevant concentrations of heavy metals is important. Herein, we...... have introduced a new composite suitable for trace metal concentration removal, which consists of cheap and common granular activated carbon covered with polymers containing soft bases, thiols, through acyl chlorination (DiS-AC). Material characterization demonstrated that the polymer was successfully...

Study of heavy metals in urban runoff

International Nuclear Information System (INIS)

Nabizadeh, R.; Mahvi, A.; Mardani, G.; Yunesian, M.

2005-01-01

A cross-sectional survey was conducted through Tehran city and a field study was conducted to prepare main and accessory drainage channels map. Three main drainage channels were identified for this research and some sampling stations were chosen. Three stations selected in south of Tehran. The reason for selecting these stations is that all urban surface run off completely pass through these points and samples taken from these points are representative of all kinds of pollutants that transit from city surface. Another three stations were selected in center and further three stations were selected at north of Tehran. Surface runoff flow in three main channels, from north of south of Tehran, converge at south of Rey city and finally end up to Ghom Salt lake. The stations were chosen at three trajectories Sorkhe Hesar, Emad Avard, Kan. At each month two samples were from nine different stations. After collection of samples with respect to standard methods, they were dissolved in nitric acid and then analyzed by atomic absorption device. The results show that the concentrations of pollutants increased from north to south. For instance, Zinc had most concentration with monthly average of 0.98 mg/l and Nickel had the lowest amount with 0.02 mg/l in southern stations. Average concentration of Zn, Pb, Cd, Cu and Ni were: 0.638, 0.97, 0.04 and 0.035 mg/l respectively. Total average concentrations of heavy metals at three main channels were of 0.177, 0.176 and 0.145 mg/l. Emad Avard was the most polluted channel

Trifluoromethylphenyl amides as novel insecticides and fungicides

Science.gov (United States)

Because of increased resistance to insecticides in arthropods, it is necessary to identify new chemicals that may have novel modes of action. Following an extensive literature search for compounds with insecticidal and mosquito repellent activity, we have designed and synthesized a set of 20 trifluo...

Time focused measurements of roof runoff quality

International Nuclear Information System (INIS)

Schriewer, A.; Horn, H.; Helmreich, B.

2008-01-01

Runoff properties and their changes during runoff of a 14 year old zinc roof were investigated. Zinc, lead, cadmium, pH value, rain intensity and electric conductivity have been measured for a period of one year. A runoff rate of 3.73 g/m 2 a and a volume weighted mean zinc concentration of 4.9 mg/L were determined. First flush behaviour was observed in 93% of runoff events. Low rain intensities are correlating with higher zinc concentrations in runoff, whereas the duration of antecedent dry periods could not directly be linked with initial zinc concentrations

Catchment-scale evaluation of pollution potential of urban snow at two residential catchments in southern Finland.

Science.gov (United States)

Sillanpää, Nora; Koivusalo, Harri

2013-01-01

Despite the crucial role of snow in the hydrological cycle in cold climate conditions, monitoring studies of urban snow quality often lack discussions about the relevance of snow in the catchment-scale runoff management. In this study, measurements of snow quality were conducted at two residential catchments in Espoo, Finland, simultaneously with continuous runoff measurements. The results of the snow quality were used to produce catchment-scale estimates of areal snow mass loads (SML). Based on the results, urbanization reduced areal snow water equivalent but increased pollutant accumulation in snow: SMLs in a medium-density residential catchment were two- to four-fold higher in comparison with a low-density residential catchment. The main sources of pollutants were related to vehicular traffic and road maintenance, but also pet excrement increased concentrations to a high level. Ploughed snow can contain 50% of the areal pollutant mass stored in snow despite its small surface area within a catchment.

The effects of atmospheric pollutants upon standstone: evidence from real time measurements and analysis of decay features on historic buildings

Energy Technology Data Exchange (ETDEWEB)

Halsey, D.P.; Dews, J.; Harris, F.C. [Wolverhampton Univ. (United Kingdom). School of Construction, Engineering and Technology; Mitchell, D.J. [Wolverhampton Univ. (United Kingdom). School of Applied Sciences

1995-12-31

Due to the urbanisation and industrialisation of the West Midlands, UK, historic sandstone buildings are exposed to atmospheric pollution. In order to assess the impact of this pollution upon their deterioration, chemical analysis of runoff water, from sandstone and control surfaces, has been carried out. The amount of stone affected by atmospheric pollution has been quantified by surveying selected sandstone buildings. (author)

The effects of atmospheric pollutants upon standstone: evidence from real time measurements and analysis of decay features on historic buildings

Energy Technology Data Exchange (ETDEWEB)

Halsey, D P; Dews, J; Harris, F C [Wolverhampton Univ. (United Kingdom). School of Construction, Engineering and Technology; Mitchell, D J [Wolverhampton Univ. (United Kingdom). School of Applied Sciences

1996-12-31

Due to the urbanisation and industrialisation of the West Midlands, UK, historic sandstone buildings are exposed to atmospheric pollution. In order to assess the impact of this pollution upon their deterioration, chemical analysis of runoff water, from sandstone and control surfaces, has been carried out. The amount of stone affected by atmospheric pollution has been quantified by surveying selected sandstone buildings. (author)

[Empirical study on non-point sources pollution based on landscape pattern & ecological processes theory: a case of soil water loss on the Loess Plateau in China].

Science.gov (United States)

Suo, An-ning; Wang, Tian-ming; Wang, Hui; Yu, Bo; Ge, Jian-ping

2006-12-01

Non-point sources pollution is one of main pollution modes which pollutes the earth surface environment. Aimed at soil water loss (a typical non-point sources pollution problem) on the Losses Plateau in China, the paper applied a landscape patternevaluation method to twelve watersheds of Jinghe River Basin on the Loess Plateau by means of location-weighted landscape contrast index(LCI) and landscape slope index(LSI). The result showed that LSI of farm land, low density grass land, forest land and LCI responded significantly to soil erosion modulus and responded to depth of runoff, while the relationship between these landscape index and runoff variation index and erosion variation index were not statistically significant. This tell us LSI and LWLCI are good indicators of soil water loss and thus have big potential in non-point source pollution risk evaluation.

ArcCN-Runoff: An ArcGIS tool for generating curve number and runoff maps

Science.gov (United States)

Zhan, X.; Huang, M.-L.

2004-01-01

The development and the application of ArcCN-Runoff tool, an extension of ESRI@ ArcGIS software, are reported. This tool can be applied to determine curve numbers and to calculate runoff or infiltration for a rainfall event in a watershed. Implementation of GIS techniques such as dissolving, intersecting, and a curve-number reference table improve efficiency. Technical processing time may be reduced from days, if not weeks, to hours for producing spatially varied curve number and runoff maps. An application example for a watershed in Lyon County and Osage County, Kansas, USA, is presented. ?? 2004 Elsevier Ltd. All rights reserved.

Non point source pollution modelling in the watershed managed by Integrated Conctructed Wetlands: A GIS approach.

OpenAIRE

Vyavahare, Nilesh

2008-01-01

The non-point source pollution has been recognised as main cause of eutrophication in Ireland (EPA Ireland, 2001). Integrated Constructed Wetland (ICW) is a management practice adopted in Annestown stream watershed, located in the south county of Waterford in Ireland, used to cleanse farmyard runoff. Present study forms the annual pollution budget for the Annestown stream watershed. The amount of pollution from non-point sources flowing into the stream was simulated by using GIS techniques; u...

An insecticidal toxin from Nephila clavata spider venom.

Science.gov (United States)

Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

2017-07-01

Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

Retrofitting impervious urban infrastructure with green technology for rainfall-runoff restoration, indirect reuse and pollution load reduction.

Science.gov (United States)

Sansalone, John; Raje, Saurabh; Kertesz, Ruben; Maccarone, Kerrilynn; Seltzer, Karl; Siminari, Michele; Simms, Peter; Wood, Brandon

2013-12-01

The built environs alter hydrology and water resource chemistry. Florida is subject to nutrient criteria and is promulgating "no-net-load-increase" criteria for runoff and constituents (nutrients and particulate matter, PM). With such criteria, green infrastructure, hydrologic restoration, indirect reuse and source control are potential design solutions. The study simulates runoff and constituent load control through urban source area re-design to provide long-term "no-net-load-increases". A long-term continuous simulation of pre- and post-development response for an existing surface parking facility is quantified. Retrofits include a biofiltration area reactor (BAR) for hydrologic and denitrification control. A linear infiltration reactor (LIR) of cementitious permeable pavement (CPP) provides infiltration, adsorption and filtration. Pavement cleaning provided source control. Simulation of climate and source area data indicates re-design achieves "no-net-load-increases" at lower costs compared to standard construction. The retrofit system yields lower cost per nutrient load treated compared to Best Management Practices (BMPs). Copyright © 2013 Elsevier Ltd. All rights reserved.

Runoff and soil loss from bench terraces. 1. An event-based model of rainfall infiltration and surface runoff.

NARCIS (Netherlands)

van Dijk, A.I.J.M.; Bruijnzeel, L.A.

2004-01-01

Overland flow resulting from an excess of rain over infiltration is an essential component of many models of runoff and erosion from fields or catchments. The spatially variable infiltration (SVI) model and a set of associated equations relating depth of runoff and maximum rate of 'effective' runoff

Sensitivity of Bemisia Tabaci (Hemiptera: Aleyrodidae) to Several New Insecticides in China: Effects of Insecticide Type and Whitefly Species, Strain, and Stage

Science.gov (United States)

Xie, Wen; Liu, Yang; Wang, Shaoli; Wu, Qingjun; Pan, Huipeng; Yang, Xin; Guo, Litao; Zhang, Youjun

2014-01-01

Abstract Whitefly biotypes B and Q are the two most damaging members of the Bemisia tabaci (Hemiptera: Aleyrodidae) species complex. Control of B. tabaci (and especially of Q) has been impaired by resistance to commonly used insecticides. To find new insecticides for B. tabaci management in China, we investigated the sensitivity of eggs, larvae, and adults of laboratory strains of B and Q (named Lab-B and Lab-Q) and field strains of Q to several insecticides. For eggs, larvae, and adults of B. tabaci and for six insecticides (cyantraniliprole, chlorantraniliprole, pyriproxyfen, buprofezin, acetamiprid, and thiamethoxam), LC 50 values were higher for Lab-Q than for Lab-B; avermectin LC 50 values, however, were low for adults of both Lab-Q and Lab-B. Based on the laboratory results, insecticides were selected to test against eggs, larvae, and adults of four field strains of B. tabaci Q. Although the field strains differed in their sensitivity to the insecticides, the eggs and larvae of all strains were highly sensitive to cyantraniliprole, and the adults of all strains were highly sensitive to avermectin. The eggs, larvae, and adults of B. tabaci Q were generally more resistant than those of B. tabaci B to the tested insecticides. B. tabaci Q eggs and larvae were sensitive to cyantraniliprole and pyriproxyfen, whereas B. tabaci Q adults were sensitive to avermectin. Field trials should be conducted with cyantraniliprole, pyriproxyfen, and avermectin for control of B. tabaci Q and B in China. PMID:25434040

Tackling non-point source water pollution in British Columbia : an action plan

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-03-01

British Columbia`s approach to water quality management is discussed. The BC efforts include regulating `end of pipe` point discharges from industrial and municipal outfalls. The major remaining cause of water pollution is from non-point sources (NPS). NPS water pollution is caused by the release of pollutants from different and diffuse sources, mostly unregulated and associated with urbanization, agriculture and other forms of land development. The importance of dealing with such problems on an immediate basis to avoid a decline in water quality in the province is emphasized. Major sources of water pollution in British Columbia include: land development, agriculture, storm water runoff, onsite sewage systems, forestry, atmospheric deposition, and marine activities. 3 tabs.

A Probabilistic Model for Propagating Ungauged Basin Runoff Prediction Variability and Uncertainty Into Estuarine Water Quality Dynamics and Water Quality-Based Management Decisions

Science.gov (United States)

Anderson, R.; Gronewold, A.; Alameddine, I.; Reckhow, K.

2008-12-01

The latest official assessment of United States (US) surface water quality indicates that pathogens are a leading cause of coastal shoreline water quality standard violations. Rainfall-runoff and hydrodynamic water quality models are commonly used to predict fecal indicator bacteria (FIB) concentrations in these waters and to subsequently identify climate change, land use, and pollutant mitigation scenarios which might improve water quality and lead to reinstatement of a designated use. While decay, settling, and other loss kinetics dominate FIB fate and transport in freshwater systems, previous authors identify tidal advection as a dominant fate and transport process in coastal estuaries. As a result, acknowledging hydrodynamic model input (e.g. watershed runoff) variability and parameter (e.g tidal dynamics parameter) uncertainty is critical to building a robust coastal water quality model. Despite the widespread application of watershed models (and associated model calibration procedures), we find model inputs and parameters are commonly encoded as deterministic point estimates (as opposed to random variables), an approach which effectively ignores potential sources of variability and uncertainty. Here, we present an innovative approach to building, calibrating, and propagating uncertainty and variability through a coupled data-based mechanistic (DBM) rainfall-runoff and tidal prism water quality model. While we apply the model to an ungauged tributary of the Newport River Estuary (one of many currently impaired shellfish harvesting waters in Eastern North Carolina), our model can be used to evaluate water quality restoration scenarios for coastal waters with a wide range of designated uses. We begin by calibrating the DBM rainfall-runoff model, as implemented in the IHACRES software package, using a regionalized calibration approach. We then encode parameter estimates as random variables (in the rainfall-runoff component of our comprehensive model) via the

Insecticides suppress natural enemies and increase pest damage in cabbage.

Science.gov (United States)

Bommarco, Riccardo; Miranda, Freddy; Bylund, Helena; Björkman, Christer

2011-06-01

Intensive use of pesticides is common and increasing despite a growing and historically well documented awareness of the costs and hazards. The benefits from pesticides of increased yields from sufficient pest control may be outweighed by developed resistance in pests and killing of beneficial natural enemies. Other negative effects are human health problems and lower prices because of consumers' desire to buy organic products. Few studies have examined these trade-offs in the field. Here, we demonstrate that Nicaraguan cabbage (Brassica spp.) farmers may suffer economically by using insecticides as they get more damage by the main pest diamondback moth, Plutella xylostella (L.) (Lepidoptera: Plutellidae), at the same time as they spend economic resources on insecticides. Replicated similarly sized cabbage fields cultivated in a standardized manner were either treated with insecticides according common practice or not treated with insecticides over two seasons. Fields treated with insecticides suffered, compared with nontreated fields, equal or, at least in some periods of the seasons, higher diamondback moth pest attacks. These fields also had increased leaf damage on the harvested cabbage heads. Weight and size of the heads were not affected. The farmers received the same price on the local market irrespective of insecticide use. Rates of parasitized diamondback moth were consistently lower in the treated fields. Negative effects of using insecticides against diamondback moth were found for the density of parasitoids and generalist predatory wasps, and tended to affect spiders negatively. The observed increased leaf damages in insecticide-treated fields may be a combined consequence of insecticide resistance in the pest, and of lower predation and parasitization rates from naturally occurring predators that are suppressed by the insecticide applications. The results indicate biological control as a viable and economic alternative pest management strategy

The influence of dual-substrate-layer extensive green roofs on rainwater runoff quantity and quality.

Science.gov (United States)

Wang, Xiaoou; Tian, Yimei; Zhao, Xinhua

2017-08-15

This study investigates the ability of dual-substrate-layer extensive green roofs to retain rainwater and reduce pollutant leaching. The substrates in dual-substrate-layer green roofs consist of an upper organic nutrition layer for plant growth and a lower inorganic adsorption layer for water retention and pollutant reduction. One traditional single-substrate-layer extensive green roof was built for comparison with dual-substrate-layer green roofs. During the experimental period, dual-substrate-layer green roofs supported better natural vegetation growth, with coverage exceeding 90%, while the coverage in single-substrate-layer green roof was over 80%. Based on the average retention value of the total rainfall for four types of simulated rains (the total rainfall depth (mm) was 43.2, 54.6, 76.2 and 86.4, respectively), the dual-substrate-layer green roofs, which used the mixture of activated charcoal with perlite and vermiculite as the adsorption substrate, possessed better rainfall retention performance (65.9% and 55.4%) than the single-substrate-layer green roof (52.5%). All of the dual-substrate-layer green roofs appeared to be sinks for organics, heavy metals and all forms of nitrogen in all cases, while acted as sources of phosphorus contaminants in the case of heavy rains. In consideration of the factors of water retention, pollution reduction and service life of the green roof, a mixture of activated charcoal and/or pumice with perlite and vermiculite is recommended as the adsorption substrate. The green roofs were able to mitigate mild acid rain, raising the pH from approximately 5.6 in rainfall to 6.5-7.6 in green roof runoff. No signs of a first flush effect for phosphate, total phosphorus, ammonia nitrogen, nitrate nitrogen, total nitrogen, organics, zinc, lead, chromium, manganese, copper, pH or turbidity were found in the green roof runoff. Cost analysis further proved the practicability of dual-substrate-layer green roofs in retaining rainwater, and

Protective effect and economic impact of insecticide application methods on barley

Directory of Open Access Journals (Sweden)

Alfred Stoetzer

2014-03-01

Full Text Available The objective of this work was to evaluate the protective effect of different forms of insecticide application on the transmission of yellow dwarf disease in barley cultivars, as well as to determine the production costs and the net profit of these managements. The experiments were carried out during 2011 and 2012 growing seasons, using the following managements at main plots: T1, seed treatment with insecticide (ST + insecticide on shoots at 15-day interval; T2, just ST; T3, insecticide applied on shoots, when aphid control level (CL was reached; T4, without insecticide; and T5, ST + insecticide on shoots when CL was reached. Different barley cultivars - BRS Cauê, BRS Brau and MN 6021 - were arranged in the subplots. Insecticides lambda cyhalothrin (pyrethroid and thiamethoxam (neonicotinoid were used. There were differences on yellow dwarf disease index in both seasons for the different treatments, while damage to grain yield was influenced by year and aphid population. Production costs and net profit were different among treatments. Seed treatment with insecticide is sufficient to reduce the transmission of yellow dwarf disease in years with low aphid population pressure, while in years with larger populations, the application of insecticide on shoots is also required.

ArcAPEX modeling of optimum widths and placement of grass and agroforestry buffers to reduce runoff and sediment transport in claypan watersheds

Science.gov (United States)

Existence of a claypan layer in soils at depths ranging from 4 to 37 cm restricts vertical water movement and has contributed significantly to high rates of runoff, sediment transport, and other non-point source loadings from croplands in watersheds. The deposition of these pollutants in rivers, st...

Impact of Animal Waste Application on Runoff Water Quality in Field Experimental Plots

Directory of Open Access Journals (Sweden)

Paul B. Tchounwou

2005-08-01

. Bacteria numbers present after the simulated rainfall events were above 200/100 ml of sample water. It can be concluded that: 1 non-point source pollution has a significant effect on bacterial and nutrients levels in runoff water and in water resources; 2 land application of animal waste for soil fertilization makes a significant contribution to water pollution; 3 the use of tilling can significantly reduce the amount of nutrients available in runoff water.

RUNOFF POTENTIAL OF MUREŞ RIVER UPPER BASIN TRIBUTARIES

Directory of Open Access Journals (Sweden)

V. SOROCOVSCHI

2012-03-01

Full Text Available Runoff Potential of Mureş River Upper Basin Tributaries. The upper basin of the Mureş River includes a significant area of the Eastern Carpathians central western part with different runoff formation conditions. In assessing the average annual runoff potential we used data from six gauging stations and made assessments on three distinct periods. Identifying the appropriate areas of the obtained correlations curves (between specific average runoff and catchments mean altitude allowed the assessment of potential runoff at catchment level and on geographical units. The potential average runoff is also assessed on altitude intervals of the mentioned areas. The runoff potential analysis on hydrographic basins, geographical units and altitude intervals highlights the variant spatial distribution of this general water resources indicator in the different studied areas.

Optimal design and real time control of the integrated urban run-off system

DEFF Research Database (Denmark)

Harremoës, Poul; Rauch, Wolfgang

1999-01-01

Traditional design of urban run-off systems is based on fixed rules with respect to the points of demarcation between the three systems involved: the sewer system, the treatment plant and the receiving water. An alternative to fixed rules is to model the total system. There is still uncertainty...... and evaluation of competing alternatives for design. However, the complexity of these systems is such that the parameters associated with pollution are hardly identifiable on the basis of reasonable monitoring programmes. The empirical-iterative approach: structures are built on simplified assumptions...

Evaluation of pollution levels due to the use of consumer fertilizers under Florida conditions : summary.

Science.gov (United States)

2010-01-01

Many surface waters in Florida are polluted with excessive nitrogen and phosphorus. Applied as fertilizer to turf and landscape plants, excess nutrients are deposited into rivers, lakes, and other surface waters through stormwater runoff. These nutri...

Tebuthiuron Movement via Leaching and Runoff from Grazed Vertisol and Alfisol Soils in the Brigalow Belt Bioregion of Central Queensland, Australia.

Science.gov (United States)

Thornton, Craig M; Elledge, Amanda E

2016-05-25

Tebuthiuron is one of five priority herbicides identified as a water pollutant entering the Great Barrier Reef. A review of tebuthiuron research in Australia found 13 papers, 6 of which focused on water quality at the basin scale (>10,000 km(2)) with little focus on process understanding. This study examined the movement of tebuthiuron in soil and runoff at the plot (1.7 m(2)) and small catchment (12.7 ha) scales. The greatest concentration and mass in soil occurred from 0 to 0.05 m depth 30-57 days after application. Concentrations at all depths tended to decrease after 55-104 days. Runoff at the small catchment scale contained high concentrations of tebuthiuron (average = 103 μg/L) 100 days after application, being 0.05% of the amount applied. Tebuthiuron concentrations in runoff declined over time with the majority of the chemical in the dissolved phase.

An approximate analytical solution for describing surface runoff and sediment transport over hillslope

Science.gov (United States)

Tao, Wanghai; Wang, Quanjiu; Lin, Henry

2018-03-01

Soil and water loss from farmland causes land degradation and water pollution, thus continued efforts are needed to establish mathematical model for quantitative analysis of relevant processes and mechanisms. In this study, an approximate analytical solution has been developed for overland flow model and sediment transport model, offering a simple and effective means to predict overland flow and erosion under natural rainfall conditions. In the overland flow model, the flow regime was considered to be transitional with the value of parameter β (in the kinematic wave model) approximately two. The change rate of unit discharge with distance was assumed to be constant and equal to the runoff rate at the outlet of the plane. The excess rainfall was considered to be constant under uniform rainfall conditions. The overland flow model developed can be further applied to natural rainfall conditions by treating excess rainfall intensity as constant over a small time interval. For the sediment model, the recommended values of the runoff erosion calibration constant (cr) and the splash erosion calibration constant (cf) have been given in this study so that it is easier to use the model. These recommended values are 0.15 and 0.12, respectively. Comparisons with observed results were carried out to validate the proposed analytical solution. The results showed that the approximate analytical solution developed in this paper closely matches the observed data, thus providing an alternative method of predicting runoff generation and sediment yield, and offering a more convenient method of analyzing the quantitative relationships between variables. Furthermore, the model developed in this study can be used as a theoretical basis for developing runoff and erosion control methods.

Insecticidal activity and fungitoxicity of plant extracts and components of horseradish (Armoracia rusticana) and garlic (Allium sativum).

Science.gov (United States)

Tedeschi, Paola; Leis, Marilena; Pezzi, Marco; Civolani, Stefano; Maietti, Annalisa; Brandolini, Vincenzo

2011-01-01

To avoid environmental pollution and health problems caused by the use of traditional synthetic pesticides, there is a trend to search for naturally occurring toxicants from plants. Among the compounds discussed for anti-fungal and insecticidal activity, the natural extracts from garlic and horseradish have attracted considerable attention. The objective of this study is to determine the insecticidal and anti-fungal activity of Armoracia rusticana and Allium sativum L. extracts against larvae of Aedes albopictus (Skuse) and some pathogenic fungi. For the insecticidal test, horseradish and garlic extracts were prepared from fresh plants (cultivated in Emilia Romagna region) in a solution of ethanol 80 % and the two different solutions were used at different concentrations (for the determination of the lethal dose) against the fourth instar mosquito's larvae. The fungicidal test was carried out by the agar plates technique using garlic and horseradish extracts in a 10 % ethanol solution against the following organisms: Sclerotium rolfsii Sacc., Trichoderma longibrachiatum, Botrytis cinerea Pers., Fusarium oxysporum Schlecht. and Fusarium culmorum (Wm. G. Sm.) Sacc. The first results demonstrated that the horseradish ethanol extracts present only a fungistatic activity against Sclerotium rolfsii Sacc., Fusarium oxysporum Schlecht. and F. culmorum (Wm.G. Sm) Sacc. while garlic extracts at the same concentration provided a good fungicidal activity above all against Botrytis cinerea Pers. and S. rolfsii. A. rusticana and A. sativum preparations showed also an interesting and significant insecticidal activity against larvae of A. albopictus, even if horseradish presented a higher efficacy (LC₅₀ value of 2.34 g/L), approximately two times higher than garlic one (LC₅₀ value of 4.48 g/L).

Sensitivity of Bemisia tabaci (Hemiptera: Aleyrodidae) to several new insecticides in China: effects of insecticide type and whitefly species, strain, and stage.

Science.gov (United States)

Xie, Wen; Liu, Yang; Wang, Shaoli; Wu, Qingjun; Pan, Huipeng; Yang, Xin; Guo, Litao; Zhang, Youjun

2014-01-01

Whitefly biotypes B and Q are the two most damaging members of the Bemisia tabaci (Hemiptera: Aleyrodidae) species complex. Control of B. tabaci (and especially of Q) has been impaired by resistance to commonly used insecticides. To find new insecticides for B. tabaci management in China, we investigated the sensitivity of eggs, larvae, and adults of laboratory strains of B and Q (named Lab-B and Lab-Q) and field strains of Q to several insecticides. For eggs, larvae, and adults of B. tabaci and for six insecticides (cyantraniliprole, chlorantraniliprole, pyriproxyfen, buprofezin, acetamiprid, and thiamethoxam), LC50 values were higher for Lab-Q than for Lab-B; avermectin LC50 values, however, were low for adults of both Lab-Q and Lab-B. Based on the laboratory results, insecticides were selected to test against eggs, larvae, and adults of four field strains of B. tabaci Q. Although the field strains differed in their sensitivity to the insecticides, the eggs and larvae of all strains were highly sensitive to cyantraniliprole, and the adults of all strains were highly sensitive to avermectin. The eggs, larvae, and adults of B. tabaci Q were generally more resistant than those of B. tabaci B to the tested insecticides. B. tabaci Q eggs and larvae were sensitive to cyantraniliprole and pyriproxyfen, whereas B. tabaci Q adults were sensitive to avermectin. Field trials should be conducted with cyantraniliprole, pyriproxyfen, and avermectin for control of B. tabaci Q and B in China. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.

Hydrology in a mediterranean mountain environment. The Vallcebre research catchment (north eastern Spain) II. Rainfall-runoff relationships and runoff processes

International Nuclear Information System (INIS)

Latron, J.; Solar, M.; Nord, G.; Llorens, P.; Gallart, F.

2009-01-01

Hydrological response and runoff processes have been studied in the Vallcebre research basins (North Eastern Spain) for almost 20 years. Results obtained allowed to build a more complete perceptual model of the hydrological functioning of Mediterranean mountains basins. On a seasonal and monthly scale, there was no simple relationship between rainfall and runoff depths. Monthly rainfall and runoff values revealed the existence of a threshold in the relationship between rainfall and runoff depths. At the event scale, the storm-flow coefficient had a clear seasonal pattern. The effect of the water table position on how rainfall and runoff volumes relate was observed. Examination of soil water potential and water table dynamics during representative floods helped to identify 3 types of characteristic hydrological behaviour during the year. Under dry conditions, runoff was generated essentially as infiltration excess runoff in low permeable areas, whereas saturation excess runoff dominated during wetting-up and wet conditions. During wetting-up transition, saturated areas resulted from the development of scattered perched water tables, whereas in wet conditions they were linked to the rise of the shallow water table. (Author) 8 refs.

Estimating Runoff Coefficients Using Weather Radars

DEFF Research Database (Denmark)

Ahm, Malte; Thorndahl, Søren Liedtke; Rasmussen, Michael R.

2012-01-01

This paper presents a method for estimating runoff coefficients of urban drainage catchments based on a combination of high resolution weather radar data and insewer flow measurements. By utilising the spatial variability of the precipitation it is possible to estimate the runoff coefficients...... of separate subcatchments. The method is demonstrated through a case study of an urban drainage catchment (678ha) located in the municipality of Aarhus, Denmark. The study has proven it is possible to use corresponding measurements of the relative rainfall distribution over the catchment and runoff...... measurements to identify the runoff coefficients at subcatchment level. The number of potential subcatchments is limited by the number of available rainfall events with a sufficient spatial variability....

Insecticides promote viral outbreaks by altering herbivore competition.

Science.gov (United States)

Pan, Huipeng; Preisser, Evan L; Chu, Dong; Wang, Shaoli; Wu, Qingjun; Carriére, Yves; Zhou, Xuguo; Zhang, Youjun

2015-09-01

While the management of biological invasions is often characterized by a series of single-specieg decisions, invasive species exist within larger food webs. These biotic interactions can alter the impact of control/eradication programs and may cause suppression efforts to inadvertently facilitate invasion spread and impact. We document the rapid replacement of the invasive Bemisia Middle East-Asia Minor I (MEAM1) cryptic biotype by the cryptic Mediterranean (MED) biotype throughout China and demonstrate that MED is more tolerant of insecticides and a better vector of tomato yellow leaf curl virus (TYLCV) than MEAMJ. While MEAM1 usually excludes MED under natural conditions, insecticide application reverses the MEAM1-MED competitive hierarchy and allows MED to exclude MEAMI. The insecticide-mediated success of MED has led to TYLCV outbreaks throughout China. Our work strongly supports the hypothesis that insecticide use in China reverses the MEAMl-MED competitive hierarchy and allows MED to displace MEAM1 in managed landscapes. By promoting the dominance of a Bemisia species that is a competent viral vector, insecticides thus increase the spread and impact of TYLCV in heterogeneous agroecosystems.

Runoff, sediment, nitrogen, and phosphorus losses from agricultural land converted to sweetgum and switchgrass bioenergy feedstock production in north Alabama

Energy Technology Data Exchange (ETDEWEB)

Nyakatawa, E.Z.; Mays, D.A. [Alabama A and M University, Normal (United States). Department of Plant and Soil Science; Tolbert, V.R. [Oak Ridge National Laboratory, Oak Ridge, TN (United States). Bionergy Feedstock Development Project; Green, T.H.; Bingham, L. [Alabama A and M University, Normal (United States). Center for Forestry and Ecology

2006-07-15

Renewable energy sources such as bioenergy crops have significant potential as alternatives to fossil fuels. Potential environmental problems arising from soil sediment and nutrient losses in runoff water from bioenergy crops need to be evaluated in order to determine the sustainability and overall feasibility of implementing bioenergy development strategies. This paper discusses runoff, sediment, N, and total P losses from agricultural land (continuous cotton (Gossypium hirsutum L.)) converted to short-rotation sweetgum (Liquidamber styraciflua L.) plantations with and without fescue (Festuca elatior L.) and switchgrass (Panicum virgatum L.) bioenergy crops, compared to corn (Zea mays L.), on a Decatur silt loam soil in north Alabama, from 1995 to 1999. Runoff volume was significantly correlated to total rainfall and sediment yield in each year, but treatment differences were not significant. Sweetgum plots produced the highest mean sediment yield of up to 800kgha{sup -1}compared to corn and switchgrass plots, which averaged less than 200kgha{sup -1}. Runoff NH{sub 4}{sup +} N losses averaged over treatments and years for spring season (3.1kgha{sup -1}) were three to five times those for summer, fall, and winter seasons. Runoff NO{sub 3}{sup -} N for no-till corn and switchgrass plots in spring and summer were five to ten times that for sweetgum plots. No-till corn and switchgrass treatments had 2.4 and 2.1kgha{sup -1} average runoff total P, respectively, which were two to three times that for sweetgum treatments. Growing sweetgum with a fescue cover crop provides significantly lower risk of water pollution from sediment, runoff NH{sub 4}{sup +} N, and NO{sub 3}{sup -} N. (author)

Novel and viable acetylcholinesterase target site for developing effective and environmentally safe insecticides.

Science.gov (United States)

Pang, Yuan-Ping; Brimijoin, Stephen; Ragsdale, David W; Zhu, Kun Yan; Suranyi, Robert

2012-04-01

Insect pests are responsible for human suffering and financial losses worldwide. New and environmentally safe insecticides are urgently needed to cope with these serious problems. Resistance to current insecticides has resulted in a resurgence of insect pests, and growing concerns about insecticide toxicity to humans discourage the use of insecticides for pest control. The small market for insecticides has hampered insecticide development; however, advances in genomics and structural genomics offer new opportunities to develop insecticides that are less dependent on the insecticide market. This review summarizes the literature data that support the hypothesis that an insect-specific cysteine residue located at the opening of the acetylcholinesterase active site is a promising target site for developing new insecticides with reduced off-target toxicity and low propensity for insect resistance. These data are used to discuss the differences between targeting the insect-specific cysteine residue and targeting the ubiquitous catalytic serine residue of acetylcholinesterase from the perspective of reducing off-target toxicity and insect resistance. Also discussed is the prospect of developing cysteine-targeting anticholinesterases as effective and environmentally safe insecticides for control of disease vectors, crop damage, and residential insect pests within the financial confines of the present insecticide market.

Characterization of polycyclic aromatic hydrocarbons in urban stormwater runoff flowing into the tidal Anacostia River, Washington, DC, USA

International Nuclear Information System (INIS)

Hwang, H.-M.; Foster, Gregory D.

2006-01-01

To investigate the sources, fate, and transport dynamics of PAHs (polycyclic aromatic hydrocarbons) in stormwater runoff that is a leading source of pollution in urban watersheds, storm and base flow samples were collected in six branches along the lower Anacostia River. PAHs in storm flow (1510-12,500 ng/L) were significantly enriched in the particle phase, which accounted for 68-97% of the total PAHs. It suggests that reducing particles in stormwater using post-treatment system would decrease PAHs considerably. The solid-water distribution coefficients (K D ) of PAHs in the storm flow samples were up to 340 times higher than predicted values. A greater portion of high molecular weight PAHs and their distribution patterns indicate higher contribution of automobile originated pyrogenic PAHs. Total suspended solids in storm flow had a positive relationship with flow rates and exceeded benchmark level for the protection of aquatic biota in some samples. - PAHs in urban stormwater runoff degrade the quality of watersheds and need to be removed before runoff enters into receiving water bodies

[A landscape ecological approach for urban non-point source pollution control].

Science.gov (United States)

Guo, Qinghai; Ma, Keming; Zhao, Jingzhu; Yang, Liu; Yin, Chengqing

2005-05-01

Urban non-point source pollution is a new problem appeared with the speeding development of urbanization. The particularity of urban land use and the increase of impervious surface area make urban non-point source pollution differ from agricultural non-point source pollution, and more difficult to control. Best Management Practices (BMPs) are the effective practices commonly applied in controlling urban non-point source pollution, mainly adopting local repairing practices to control the pollutants in surface runoff. Because of the close relationship between urban land use patterns and non-point source pollution, it would be rational to combine the landscape ecological planning with local BMPs to control the urban non-point source pollution, which needs, firstly, analyzing and evaluating the influence of landscape structure on water-bodies, pollution sources and pollutant removal processes to define the relationships between landscape spatial pattern and non-point source pollution and to decide the key polluted fields, and secondly, adjusting inherent landscape structures or/and joining new landscape factors to form new landscape pattern, and combining landscape planning and management through applying BMPs into planning to improve urban landscape heterogeneity and to control urban non-point source pollution.

A Synopsis of Technical Issues for Monitoring Sediment in Highway and Urban Runoff

Science.gov (United States)

Bent, Gardner C.; Gray, John R.; Smith, Kirk P.; Glysson, G. Douglas

2000-01-01

Accurate and representative sediment data are critical for assessing the potential effects of highway and urban runoff on receiving waters. The U.S. Environmental Protection Agency identified sediment as the most widespread pollutant in the Nation's rivers and streams, affecting aquatic habitat, drinking water treatment processes, and recreational uses of rivers, lakes, and estuaries. Representative sediment data are also necessary for quantifying and interpreting concentrations, loads, and effects of trace elements and organic constituents associated with highway and urban runoff. Many technical issues associated with the collecting, processing, and analyzing of samples must be addressed to produce valid (useful for intended purposes), current, complete, and technically defensible data for local, regional, and national information needs. All aspects of sediment data-collection programs need to be evaluated, and adequate quality-control data must be collected and documented so that the comparability and representativeness of data obtained for highway- and urban-runoff studies may be assessed. Collection of representative samples for the measurement of sediment in highway and urban runoff involves a number of interrelated issues. Temporal and spatial variability in runoff result from a combination of factors, including volume and intensity of precipitation, rate of snowmelt, and features of the drainage basin such as area, slope, infiltration capacity, channel roughness, and storage characteristics. In small drainage basins such as those found in many highway and urban settings, automatic samplers are often the most suitable method for collecting samples of runoff for a variety of reasons. Indirect sediment-measurement methods are also useful as supplementary and(or) surrogate means for monitoring sediment in runoff. All of these methods have limitations in addition to benefits, which must be identified and quantified to produce representative data. Methods for

Nature and analysis of chemical species: pollution effects on surface waters and groundwater

International Nuclear Information System (INIS)

Young, R.H.F.

1975-01-01

A literature review of 103 items covers: nutrients in surface waters; runoff and waste discharges primarily from energy-intensive activities; groundwater pollution causes, effects, controls and monitoring; land and subsurface wastewater disposal; radionuclides; biological effects; thermal effluents; and biological and mathematical models for rivers

2 Assessmen of the Efficiency of Insecticide

African Journals Online (AJOL)

Administrator

malaria vectors and nuisance in West Africa – a-part. 2. Field evaluation. Malar J. 9: 341. Mosqueira B., Duchon S., Chandre F., Hougard, J. M., Carnevale P. and Mas-Coma S. (2010). Efficacy of an insecticide paint against insecticide- susceptible and resistant mosquitoes – b- Part 1: Laboratory evaluation. Malar J. 9: 340.

Insecticide Resistance Reducing Effectiveness of Malaria Control

Centers for Disease Control (CDC) Podcasts

2007-01-24

Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.  Created: 1/24/2007 by Emerging Infectious Diseases.   Date Released: 3/13/2007.

Modelling nonpoint source pollution of MUDA river basin using GIS (Geographic Information System)

International Nuclear Information System (INIS)

Nyon Yong Chik; Taher Buyong

2000-01-01

The management of our rivers is under increasing pressure to conserve and sustain as it remains the focus of human civilization and subjected to increasing demand from man and its activities. Integrated river basin management represents comprehensive form of terrestrial water resources management while GIS is a promising tool to be used in the management strategy. In efforts to display the true capabilities of GIS in analysing nonpoint source pollution (NPS), an assessment of NPS was carried out at MUDA river basin using Arc View 3.0 Spatial Analyst. Expected Mean Concentration (EMC) which is associated with land use was used to predict the amount of pollutants constituents. A runoff grid was then processed to model the flow domain. Finally, the modelling of the pollutant loads downstreams towards the basin outlet is achieved by flow direction and accumulation analysis of the product of EMC and runoff grid. A user interface was programmed to display each application data theme via a pop-up window. In addition, users will be able to enter EMG values for the corresponding land use through an application dialog developed in Visual Basic. (Author)

Influence of Cattle Trails on Runoff Quantity and Quality.

Science.gov (United States)

Miller, Jim J; Curtis, Tony; Chanasyk, David S; Willms, Walter D

2017-03-01

Cattle trails in grazed pastures close to rivers may adversely affect surface water quality of the adjacent river by directing runoff to it. The objective of this 3-yr study (2013-2015) in southern Alberta, Canada, was to determine if cattle trails significantly increased the risk of runoff and contaminants (sediment, nutrients) compared with the adjacent grazed pasture (control). A portable rainfall simulator was used to generate artificial rainfall (140 mm h) and runoff. The runoff properties measured were time to runoff and initial abstraction (infiltration), total runoff depth and average runoff rates, as well as concentrations and mass loads of sediment, N, and P fractions. Cattle trails significantly ( ≤ 0.10) decreased time to runoff and initial abstraction (26-32%) in the 2 yr measured and increased total runoff depth, runoff coefficients, and average runoff rates (21-51%) in 2 of 3 yr. Concentrations of sediment, N, and P fractions in runoff were not significantly greater for cattle trails than for control areas. However, mass loads of total suspended solids (57-85% increase), NH-N (31-90%), and dissolved reactive P (DRP) (30-92%) were significantly greater because of increased runoff volumes. Overall, runoff quantity and loads of sediment, NH-N, and DRP were greater for cattle trails compared with the adjacent grazed pasture, and hydrologic connection with cattle-access sites on the riverbank suggests that this could adversely affect water quality in the adjacent river. Extrapolation of the study results should be tempered by the specific conditions represented by this rainfall simulation study. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

Degradation of Organophosphorus and Pyrethroid Insecticides in Beverages: Implications for Risk Assessment

Directory of Open Access Journals (Sweden)

Samantha A. Radford

2018-02-01

Full Text Available Since urinary insecticide metabolites are commonly used as biomarkers of exposure, it is important that we quantify whether insecticides degrade in food and beverages in order to better perform risk assessment. This study was designed to quantify degradation of organophosphorus and pyrethroid insecticides in beverages. Purified water, white grape juice, orange juice, and red wine were fortified with 500 ng/mL diazinon, malathion, chlorpyrifos, permethrin, cyfluthrin, cypermethrin, and deltamethrin, and aliquots were extracted several times over a 15-day storage period at 2.5 °C. Overall, statistically significant loss of at least one insecticide was observed in each matrix, and at least five out of seven insecticides demonstrated a statistically significant loss in all matrices except orange juice. An investigation of an alternative mechanism of insecticide loss—adsorption onto the glass surface of the storage jars—was carried out, which indicated that this mechanism of loss is insignificant. Results of this work suggest that insecticides degrade in these beverages, and this degradation may lead to pre-existing insecticide degradates in the beverages, suggesting that caution should be exercised when using urinary insecticide metabolites to assess exposure and risk.

Biological efficacy of the ecotoxically favourable insecticides and ...

African Journals Online (AJOL)

Administrator

2011-05-30

May 30, 2011 ... different, studies done in natural conditions should be favored. Key words: Insecticides ... insecticide was applied on synthetic or natural food of the target insect ..... Pozsgay M, Fast P, Kaplan H, Carey PR (1987). The effect of ...

Induced tolerance from a sublethal insecticide leads to cross-tolerance to other insecticides.

Science.gov (United States)

Hua, Jessica; Jones, Devin K; Relyea, Rick A

2014-04-01

As global pesticide use increases, the ability to rapidly respond to pesticides by increasing tolerance has important implications for the persistence of nontarget organisms. A recent study of larval amphibians discovered that increased tolerance can be induced by an early exposure to low concentrations of a pesticide. Since natural systems are often exposed to a variety of pesticides that vary in mode of action, we need to know whether the induction of increased tolerance to one pesticide confers increased tolerance to other pesticides. Using larval wood frogs (Lithobates sylvaticus), we investigated whether induction of increased tolerance to the insecticide carbaryl (AChE-inhibitor) can induce increased tolerance to other insecticides that have the same mode of action (chlorpyrifos, malathion) or a different mode of action (Na(+)channel-interfering insecticides; permethrin, cypermethrin). We found that embryonic exposure to sublethal concentrations of carbaryl induced higher tolerance to carbaryl and increased cross-tolerance to malathion and cypermethrin but not to chlorpyrifos or permethrin. In one case, the embryonic exposure to carbaryl induced tolerance in a nonlinear pattern (hormesis). These results demonstrate that that the newly discovered phenomenon of induced tolerance also provides induced cross-tolerance that is not restricted to pesticides with the same mode of action.

Toxicity and chemical analyses of airport runoff waters in Poland.

Science.gov (United States)

Sulej, Anna Maria; Polkowska, Zaneta; Wolska, Lidia; Cieszynska, Monika; Namieśnik, Jacek

2014-05-01

The aim of this study was to assess the ecotoxicological effects of various compounds in complex airport effluents using a chemical and ecotoxicological integrated strategy. The present work deals with the determination of sum of PCBs, PAHs, pesticides, cations, anions, phenols, anionic, cationic, non-ionic detergents, formaldehyde and metals--as well as TOC and conductivity--in runoff water samples collected from 2009 to 2011 at several locations on two Polish international airports. Two microbiotests (Vibrio fischeri bacteria and the crustacean Thamnocephalus platyurus) have been used to determine the ecotoxicity of airport runoff waters. The levels of many compounds exceeded several or even several tens of times the maximum permissible levels. Analysis of the obtained data shows that samples that displayed maximum toxicity towards the bioindicators Vibrio fischeri were not toxic towards Thamnocephalus platyurus. Levels of toxicity towards T. platyurus are strongly correlated with pollutants that originate from the technological operations related to the maintenance of airport infrastructure. The integrated (chemical-ecotoxicological) approach to environmental contamination assessment in and around airports yields extensive information on the quality of the environment. These methodologies can be then used as tools for tracking the environmental fate of these compounds and for assessing the environmental effect of airports. Subsequently, these data will provide a basis for airport infrastructure management.

Decaleside: a new class of natural insecticide targeting tarsal gustatory sites

Science.gov (United States)

Rajashekar, Yallappa; Rao, Lingamallu J. M.; Shivanandappa, Thimmappa

2012-10-01

Natural sources for novel insecticide molecules hold promise in view of their eco-friendly nature, selectivity, and mammalian safety. Recent progress in understanding the biology of insect olfaction and taste offers new strategies for developing selective pest control agents. We have isolated two natural insecticidal molecules from edible roots of Decalepis hamiltonii named Decalesides I and II, which are novel trisaccharides, highly toxic to household insect pests and stored-product insects. We have experimentally shown that insecticidal activity requires contact with tarsi on the legs but is not toxic orally. The insecticidal activity of molecules is lost by hydrolysis, and various sugars modify toxic response, showing that the insecticidal activity is via gustatory sites on the tarsi. Selective toxicity to insects by virtue of their gustatory site of action and the mammalian safety of the new insecticides is inherent in their chemical structure with 1-4 or 1-1 α linkage that is easily hydrolyzed by digestive enzymes of mammals. Decalesides represent a new chemical class of natural insecticides with a unique mode of action targeting tarsal chemosensory/gustatory system of insects.

Impact of some selected insecticides application on soil microbial respiration.

Science.gov (United States)

Latif, M A; Razzaque, M A; Rahman, M M

2008-08-15

The aim of present study was to investigate the impact of selected insecticides used for controlling brinjal shoot and fruit borer on soil microorganisms and to find out the insecticides or nontoxic to soil microorganism the impact of nine selected insecticides on soil microbial respiration was studied in the laboratory. After injection of different insecticides solutions, the soil was incubated in the laboratory at room temperature for 32 days. The amount of CO2 evolved due to soil microbial respiration was determined at 2, 4, 8, 16, 24 and 32 days of incubation. Flubendiamide, nimbicidine, lambda-cyhalothrin, abamectin and thiodicarb had stimulatory effect on microbial respiration during the initial period of incubation. Chlorpyriphos, cartap and carbosulfan had inhibitory effect on microbial respiration and cypermethrin had no remarkable effect during the early stage of incubation. The negative effect of chlorpyriphos, cartap and carbosulfan was temporary, which was disappeared after 4 days of insecticides application. No effect of the selected insecticides on soil microorganisms was observed after 24 or 32 days of incubation.

Effectiveness and profitability of insecticide formulations used for ...

African Journals Online (AJOL)

To identify optimal pest control with lower economic risks to farmers, we investigated the effectiveness and profitability of different insecticides and insecticide formulations against bean fly (Ophiomyia spp.) and bean flower thrips (Megalurothrips sjostedtii). Two separate experiments were conducted during 2009 to 2012.

Purification of waters and elimination of organochloric insecticides by means of active coal

Directory of Open Access Journals (Sweden)

DRAGAN MARINOVIĆ

2010-04-01

Full Text Available Pollution of water and the determination of the degree of its pollution with numerous physical, chemical and biological polluters have become general, ever increasing social and health related problems. Within this study, the concentrations of some most frequently used organochloric insecticides (OCI: a-hexachlorocyclohexane (a-HCH, γ-hexachlorocyclohexane (lindane, heptachlor, aldrin, dieldrin, endrin, dichlorodiphenyl trichlorethane (DDT were investigated. OCI are highly toxic substances for the human population and their effective elimination from the environment is of paramount interest. To determine the OCI concentration in water samples, the EPA–608 method and the liquid–liquid extraction principle were applied. A procedure for OCI elimination was realized by passing the water over four columns filled with various active coals: KRF, K-81/B, NORIT ROW-0.8 and AQUA SORB CS. These active coals are carbonized coconut shells activated by different procedures. The obtained results indicated that best purification of potable and waste water achieved using a column with Norit Row-0.8 filling. Research proved that small quantities of OCI can also be effectively removed using a Norit Row-0.8 active coal filled column, without altering the organoleptic properties of the water, which meets the requirements of water purification processes.

Impact of reduced-risk insecticides on soybean aphid and associated natural enemies.

Science.gov (United States)

Ohnesorg, Wayne J; Johnson, Kevin D; O'Neal, Matthew E

2009-10-01

Insect predators in North America suppress Aphis glycines Matsumura (Hemiptera: Aphididae) populations; however, insecticides are required when populations reach economically damaging levels. Currently, insecticides used to manage A. glycines are broad-spectrum (pyrethroids and organophosphates), and probably reduce beneficial insect abundance in soybean, Glycine max (L.) Merr. Our goal was to determine whether insecticides considered reduced-risk by the Environmental Protection Agency could protect soybean yield from A. glycines herbivory while having a limited impact on the aphid's natural enemies. We compared three insecticides (imidacloprid, thiamethoxam, and pymetrozine,) to a broad-spectrum insecticide (lamda-cyhalothrin) and an untreated control using two application methods. We applied neonicotinoid insecticides to seeds (imidacloprid and thiamethoxam) as well as foliage (imidacloprid); pymetrozine and lamda-cyhalothrin were applied only to foliage. Foliage-applied insecticides had lower A. glycines populations and higher yields than the seed-applied insecticides. Among foliage-applied insecticides, pymetrozine and imidacloprid had an intermediate level of A. glycines population and yield protection compared with lamda-cyhalothrin and the untreated control. We monitored natural enemies with yellow sticky cards, sweep-nets, and direct observation. Before foliar insecticides were applied (i.e., before aphid populations developed) seed treatments had no observable effect on the abundance of natural enemies. After foliar insecticides were applied, differences in natural enemy abundance were observed when sampled with sweep-nets and direct observation but not with yellow sticky cards. Based on the first two sampling methods, pymetrozine and the foliage-applied imidacloprid had intermediate abundances of natural enemies compared with the untreated control and lamda-cyhalothrin.

Analysis of long-term trends (1950–2009) in precipitation, runoff and runoff coefficient in major urban watersheds in the United States

International Nuclear Information System (INIS)

Velpuri, N M; Senay, G B

2013-01-01

This study investigates the long-term trends in precipitation, runoff and runoff coefficient in major urban watersheds in the United States. The seasonal Mann–Kendall trend test was performed on monthly precipitation, runoff and runoff coefficient data from 1950 to 2009 obtained from 62 urban watersheds covering 21 major urban centers in the United States. The results indicate that only five out of 21 urban centers in the United States showed an uptrend in precipitation. Twelve urban centers showed an uptrend in runoff coefficient. However, six urban centers did not show any trend in runoff coefficient, and three urban centers showed a significant downtrend. The highest rate of change in precipitation, runoff and runoff coefficient was observed in the Houston urban watershed. Based on the results obtained, we also attributed plausible causes for the trends. Our analysis indicated that while a human only influence is observed in most of the urban watersheds, a combined climate and human influence is observed in the central United States. (letter)

Performance of a pilot-scale constructed wetland for stormwater runoff and domestic sewage treatment on the banks of a polluted urban river.

Science.gov (United States)

Guo, Weijie; Li, Zhu; Cheng, Shuiping; Liang, Wei; He, Feng; Wu, Zhenbin

2014-01-01

To examine the performance of a constructed wetland system on stormwater runoff and domestic sewage (SRS) treatment in central east China, two parallel pilot-scale integrated constructed wetland (ICW) systems were operated for one year. Each ICW consisted of a down-flow bed, an up-flow bed and a horizontal subsurface flow bed. The average removal rates of chemical oxygen demand (CODCr), total suspended solids (TSS), ammonia (NH4(+)-N), total nitrogen (TN) and total phosphorus (TP) were 63.6, 91.9, 38.7, 43.0 and 70.0%, respectively, and the corresponding amounts of pollutant retention were approximately 368.3, 284.9, 23.2, 44.6 and 5.9 g m(-2) yr(-1), respectively. High hydraulic loading rate (HLR) of 200 mm/d and low water temperatures (<15 °C) resulted in significant decrease in removals for TP and NH4(+)-N, but had no significant effects on removals of COD and TSS. These results indicated that the operation of this ICW at higher HLR (200 mm/d) might be effective and feasible for TSS and COD removal, but for acceptable removal efficiencies of nitrogen and phosphorus it should be operated at lower HLR (100 mm/d). This kind of ICW could be employed as an effective technique for SRS treatment.

Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth

OpenAIRE

David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

2013-01-01

The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementat...

Insecticide Exposure in Parkinsonism

National Research Council Canada - National Science Library

Bloomquist, Jeffrey

2002-01-01

Behavioral, neurochemical, and immunocytochemical studies characterized the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and permethrin (PM...

Insecticide Exposure in Parkinsonism

National Research Council Canada - National Science Library

Bloomquist, Jeffrey

2001-01-01

Behavioral, neurochemical, and immunocytochemical studies characterized the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and permethrin (PM...

Water erosion in surface soil conditions: runoff velocity, concentration and D50 index of sediments in runoff

OpenAIRE

Ramos,Júlio César; Bertol,Ildegardis; Barbosa,Fabrício Tondello; Bertól,Camilo; Mafra,Álvaro Luiz; Miquelluti,David José; Mecabô Júnior,José

2016-01-01

ABSTRACT Water erosion and contamination of water resources are influenced by concentration and diameter of sediments in runoff. This study aimed to quantify runoff velocity and concentration and the D50 index of sediments in runoff under different soil surface managements, in the following treatments: i) cropped systems: no-tilled soil covered by ryegrass (Lolium multiflorum Lam.) residue, with high soil cover and minimal roughness (HCR); no tilled soil covered by vetch (Vicia sativa L.) res...

Runoff load estimation of particulate and dissolved nitrogen in Lake Inba watershed using continuous monitoring data on turbidity and electric conductivity.

Science.gov (United States)

Kim, J; Nagano, Y; Furumai, H

2012-01-01

Easy-to-measure surrogate parameters for water quality indicators are needed for real time monitoring as well as for generating data for model calibration and validation. In this study, a novel linear regression model for estimating total nitrogen (TN) based on two surrogate parameters is proposed based on evaluation of pollutant loads flowing into a eutrophic lake. Based on their runoff characteristics during wet weather, electric conductivity (EC) and turbidity were selected as surrogates for particulate nitrogen (PN) and dissolved nitrogen (DN), respectively. Strong linear relationships were established between PN and turbidity and DN and EC, and both models subsequently combined for estimation of TN. This model was evaluated by comparison of estimated and observed TN runoff loads during rainfall events. This analysis showed that turbidity and EC are viable surrogates for PN and DN, respectively, and that the linear regression model for TN concentration was successful in estimating TN runoff loads during rainfall events and also under dry weather conditions.

Insecticidal and Nematicidal Activities of Novel Mimosine Derivatives

Directory of Open Access Journals (Sweden)

Binh Cao Quan Nguyen

2015-09-01

Full Text Available Mimosine, a non-protein amino acid, is found in several tropical and subtropical plants, which has high value for medicine and agricultural chemicals. Here, in continuation of works aimed to development of natural product-based pesticidal agents, we present the first significant findings for insecticidal and nematicidal activities of novel mimosine derivatives. Interestingly, mimosinol and deuterated mimosinol (D-mimosinol from mimosine had strong insecticidal activity which could be a result of tyrosinase inhibition (IC50 = 31.4 and 46.1 μM, respectively. Of synthesized phosphoramidothionate derivatives from two these amino alcohols, two compounds (1a and 1b showed high insecticidal activity (LD50 = 0.5 and 0.7 μg/insect, respectively with 50%–60% mortality at 50 μg/mL which may be attributed to acetylcholinesterase inhibition. Compounds 1a and 1b also had strong nematicidal activity with IC50 = 31.8 and 50.2 μM, respectively. Our results suggest that the length of the alkyl chain and the functional group at the C5-position of phosphoramidothionates derived from mimosinol and d-mimosinol are essential for the insecticidal and nematicidal activities. These results reveal an unexplored scaffold as new insecticide and nematicide.

Insecticide mixtures for mosquito net impregnation against malaria vectors

Directory of Open Access Journals (Sweden)

Corbel V.

2002-09-01

Full Text Available Insecticides belonging to the pyrethroid family are the only compounds currently available for the treatment of mosquito nets. Unfortunately, some malaria vector species have developed resistance to pyrethroids and the lack of alternative chemical categories is a great concern. One strategy for resistance management would be to treat mosquito nets with a mixture associating two insecticides having different modes of action. This study presents the results obtained with insecticide mixtures containing several proportions of bifenthrin (a pyrethroid insecticide and carbosulfan (a carbamate insecticide. The mixtures were sprayed on mosquito net samples and their efficacy were tested against a susceptible strain of Anopheles gambiae, the major malaria vector in Africa. A significant synergism was observed with a mixture containing 25 mg/m2 of bifenthrin (half the recommended dosage for treated nets and 6.25 mg/m2 of carbosulfan (about 2 % of the recommended dosage. The observed mortality was significantly more than expected in the absence of any interaction (80 % vs 41 % and the knock-down effect was maintained, providing an effective barrier against susceptible mosquitoes.

Testing the Runoff Tool in Sicilian vineyards: adopting best management practices to prevent agricultural surface runoff

Science.gov (United States)

Singh, Manpriet; Dyson, Jeremy; Capri, Ettore

2016-04-01

Over the last decades rainfall has become more intense in Sicily, making large proportions of steeply sloping agricultural land more vulnerable to soil erosion, mainly orchards and vineyards (Diodato and Bellocchi 2010). The prevention of soil degradation is indirectly addressed in the European Union's Water Framework Directive (2000/60/EC) and Sustainable Use Directive (2009/128/EC). As a consequence, new EU compliance conditions for food producers requires them to have tools and solutions for on-farm implementation of sustainable practices (Singh et al. 2014). The Agricultural Runoff and Best Management Practice Tool has been developed by Syngenta to help farm advisers and managers diagnose the runoff potential from fields with visible signs of soil erosion. The tool consists of 4 steps including the assessment of three key landscape factors (slope, topsoil permeability and depth to restrictive horizon) and 9 mainly soil and crop management factors influencing the runoff potential. Based on the runoff potential score (ranging from 0 to 10), which is linked to a runoff potential class, the Runoff Tool uses in-field and edge-of-the-field Best Management Practices (BMPs) to mitigate runoff (aligned with advice from ECPA's TOPPS-prowadis project). The Runoff tool needs testing in different regions and crops to create a number of use scenarios with regional/crop specific advice on BMPs. For this purpose the Tool has been tested in vineyards of the Tasca d'Almerita and Planeta wineries, which are large family-owned estates with long-standing tradition in viticulture in Sicily. In addition to runoff potential scores, Visual Soil Assessment (VSA) scores have been calculated to allow for a comparison between different diagnostic tools. VSA allows for immediate diagnosis of soil quality (a higher score means a better soil quality) including many indicators of runoff (Shepherd 2008). Runoff potentials were moderate to high in all tested fields. Slopes were classified as

Gut Microbiota Mediate Insecticide Resistance in the Diamondback Moth, Plutella xylostella (L.).

Science.gov (United States)

Xia, Xiaofeng; Sun, Botong; Gurr, Geoff M; Vasseur, Liette; Xue, Minqian; You, Minsheng

2018-01-01

The development of insecticide resistance in insect pests is a worldwide concern and elucidating the underlying mechanisms is critical for effective crop protection. Recent studies have indicated potential links between insect gut microbiota and insecticide resistance and these may apply to the diamondback moth, Plutella xylostella (L.), a globally and economically important pest of cruciferous crops. We isolated Enterococcus sp. (Firmicutes), Enterobacter sp. (Proteobacteria), and Serratia sp. (Proteobacteria) from the guts of P. xylostella and analyzed the effects on, and underlying mechanisms of insecticide resistance. Enterococcus sp. enhanced resistance to the widely used insecticide, chlorpyrifos, in P. xylostella , while in contrast, Serratia sp. decreased resistance and Enterobacter sp. and all strains of heat-killed bacteria had no effect. Importantly, the direct degradation of chlorpyrifos in vitro was consistent among the three strains of bacteria. We found that Enterococcus sp., vitamin C, and acetylsalicylic acid enhanced insecticide resistance in P. xylostella and had similar effects on expression of P. xylostella antimicrobial peptides. Expression of cecropin was down-regulated by the two compounds, while gloverin was up-regulated. Bacteria that were not associated with insecticide resistance induced contrasting gene expression profiles to Enterococcus sp. and the compounds. Our studies confirmed that gut bacteria play an important role in P. xylostella insecticide resistance, but the main mechanism is not direct detoxification of insecticides by gut bacteria. We also suggest that the influence of gut bacteria on insecticide resistance may depend on effects on the immune system. Our work advances understanding of the evolution of insecticide resistance in this key pest and highlights directions for research into insecticide resistance in other insect pest species.

Gut Microbiota Mediate Insecticide Resistance in the Diamondback Moth, Plutella xylostella (L.

Directory of Open Access Journals (Sweden)

Xiaofeng Xia

2018-01-01

Full Text Available The development of insecticide resistance in insect pests is a worldwide concern and elucidating the underlying mechanisms is critical for effective crop protection. Recent studies have indicated potential links between insect gut microbiota and insecticide resistance and these may apply to the diamondback moth, Plutella xylostella (L., a globally and economically important pest of cruciferous crops. We isolated Enterococcus sp. (Firmicutes, Enterobacter sp. (Proteobacteria, and Serratia sp. (Proteobacteria from the guts of P. xylostella and analyzed the effects on, and underlying mechanisms of insecticide resistance. Enterococcus sp. enhanced resistance to the widely used insecticide, chlorpyrifos, in P. xylostella, while in contrast, Serratia sp. decreased resistance and Enterobacter sp. and all strains of heat-killed bacteria had no effect. Importantly, the direct degradation of chlorpyrifos in vitro was consistent among the three strains of bacteria. We found that Enterococcus sp., vitamin C, and acetylsalicylic acid enhanced insecticide resistance in P. xylostella and had similar effects on expression of P. xylostella antimicrobial peptides. Expression of cecropin was down-regulated by the two compounds, while gloverin was up-regulated. Bacteria that were not associated with insecticide resistance induced contrasting gene expression profiles to Enterococcus sp. and the compounds. Our studies confirmed that gut bacteria play an important role in P. xylostella insecticide resistance, but the main mechanism is not direct detoxification of insecticides by gut bacteria. We also suggest that the influence of gut bacteria on insecticide resistance may depend on effects on the immune system. Our work advances understanding of the evolution of insecticide resistance in this key pest and highlights directions for research into insecticide resistance in other insect pest species.

Expression of melanin and insecticidal protein from Rhodotorula ...

African Journals Online (AJOL)

Both the salmon/red melanin and the insecticidal producing genes of Rhodotorula glutinis was successfully expressed in Escherichia coli using plasmid pZErO-1. This work suggests that in Rhodotorula species melanin and insecticidal toxin are co-expressed and therefore possibly co-evolved. Keywords: Rhodotorula ...

Metaflumizone is a novel sodium channel blocker insecticide.

Science.gov (United States)

Salgado, V L; Hayashi, J H

2007-12-15

Metaflumizone is a novel semicarbazone insecticide, derived chemically from the pyrazoline sodium channel blocker insecticides (SCBIs) discovered at Philips-Duphar in the early 1970s, but with greatly improved mammalian safety. This paper describes studies confirming that the insecticidal action of metaflumizone is due to the state-dependent blockage of sodium channels. Larvae of the moth Spodoptera eridania injected with metaflumizone became paralyzed, concomitant with blockage of all nerve activity. Furthermore, tonic firing of abdominal stretch receptor organs from Spodoptera frugiperda was blocked by metaflumizone applied in the bath, consistent with the block of voltage-dependent sodium channels. Studies on native sodium channels, in primary-cultured neurons isolated from the CNS of the larvae of the moth Manduca sexta and on Para/TipE sodium channels heterologously expressed in Xenopus (African clawed frog) oocytes, confirmed that metaflumizone blocks sodium channels by binding selectively to the slow-inactivated state, which is characteristic of the SCBIs. The results confirm that metaflumizone is a novel sodium channel blocker insecticide.

Water Quality Assessment of River Soan (Pakistan) and Source Apportionment of Pollution Sources Through Receptor Modeling.

Science.gov (United States)

Nazeer, Summya; Ali, Zeshan; Malik, Riffat Naseem

2016-07-01

The present study was designed to determine the spatiotemporal patterns in water quality of River Soan using multivariate statistics. A total of 26 sites were surveyed along River Soan and its associated tributaries during pre- and post-monsoon seasons in 2008. Hierarchical agglomerative cluster analysis (HACA) classified sampling sites into three groups according to their degree of pollution, which ranged from least to high degradation of water quality. Discriminant function analysis (DFA) revealed that alkalinity, orthophosphates, nitrates, ammonia, salinity, and Cd were variables that significantly discriminate among three groups identified by HACA. Temporal trends as identified through DFA revealed that COD, DO, pH, Cu, Cd, and Cr could be attributed for major seasonal variations in water quality. PCA/FA identified six factors as potential sources of pollution of River Soan. Absolute principal component scores using multiple regression method (APCS-MLR) further explained the percent contribution from each source. Heavy metals were largely added through industrial activities (28 %) and sewage waste (28 %), nutrients through agriculture runoff (35 %) and sewage waste (28 %), organic pollution through sewage waste (27 %) and urban runoff (17 %) and macroelements through urban runoff (39 %), and mineralization and sewage waste (30 %). The present study showed that anthropogenic activities are the major source of variations in River Soan. In order to address the water quality issues, implementation of effective waste management measures are needed.

Investigating the Influence of Various Stormwater Runoff Control Facilities on Runoff Control Efficiency in a Small Catchment Area

Directory of Open Access Journals (Sweden)

Rei Itsukushima

2018-02-01

Full Text Available Urbanization causes an increase in the flood discharge because of the infiltration capacity. Furthermore, extreme precipitation events have been an increasing concern for many regions worldwide. This study aimed to investigate the influence of different outflow control facilities on runoff reduction in a small watershed. We focused on the soil-improvement technology and rainwater tanks as outflow control facilities and conducted a runoff calculation using a rainfall event of a magnitude that is likely to occur once in a hundred years. The calculation showed that the soil-improvement technology reduced runoff during long-term continuous rainfall, whereas in a concentrated short-term rainfall event, a significant difference in the runoff reduction effect between rainfall tanks of various volumes was observed. Since effective countermeasures for runoff reduction differ depending on the rainfall distribution pattern, we suggested both facilities for storing initial rainfall and initiating countermeasures for penetration improvement over the long term.

Sampling and chemical analysis of urban street runoff

International Nuclear Information System (INIS)

Daub, J.; Striebel, T.; Robien, A.; Herrmann, R.

1993-01-01

In order to characterize the environmentally relevant physical and chemical properties of urban street runoff, an automatic sampling device was developed. Precipitation samples were collected together with runoff samples. Organic and inorganic compounds were analysed in the runoff. Dissolved and particle bound substances were analysed separately. The concentrations in runoff are generally considerably higher than in precipitation. Concentrations of lead, fluoranthene and benzo(a)pyrene, in particular are higher in runoffs at sites with high traffic densities than at sites with low traffic densities. Preceding dry period normally has no effect on the measured concentrations. The typical chemograph of a dissolved substance shows a maximum at the beginning of the event dropping quickly to a minimum, which often coincides with the maximum in runoff rate. A slight rise is observed with decreasing runoff rates at the end of the event. Applying a mathematical model, chemographs may be described by three terms: - Relatively large amounts of easily soluble material at the beginning of the event decrease with increasing runoff. Conservative behaviour is assumed. - A part which varies inversely to the runoff rate. This term assumes zero-order kinetics; the amount dissolved from surfaces is constant with time. - A small constant term. Concentrations of particle bound substances correlate with amounts of total suspended solids. Frequently a negative correlation between the specific concentration of substances and the concentration of total suspended solids is observed. (orig.) [de

Insecticide Exposure in Parkinsonism

National Research Council Canada - National Science Library

Bloomquist, Jeffrey

2003-01-01

Behavioral, neurochemical, and immunocytochemical studies are characterizing the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and/or permethrin (PM...

Insecticides and Biological Control

Science.gov (United States)

Furness, G. O.

1972-01-01

Use of insecticides has been questioned due to their harmful effects on edible items. Biological control of insects along with other effective practices for checking spread of parasites on crops are discussed. (PS)

A comparison of the cost associated with pollution prevention measures to that required to treat polluted water resources

CSIR Research Space (South Africa)

Oelofse, Suzanna HH

2012-03-01

Full Text Available by nitrogen and particularly phosphorous (Hart, 2006). The main sources of nutrient pollution are sewage effluent and agricultural run-off. The discharge of nitrogen (as nitrates) and phosphorus (as phosphates) to inland rivers, lakes and dams causes... mg/ℓ (DWAF, 1996a). Table 2: TDS of natural water (DWAF, 1996a) Geological formations in contact with water TDS (mg/ℓ) Granite, siliceous sand and well-leached soils < 30 Precambium shield areas < 65 Palaeozoic and Mesozoic sedimentary rock...

Operational methods for minimising soil compaction and diffuse pollution risk from wheelings in winter cereals

Science.gov (United States)

Jackson, Bob; Silgram, Martyn; Quinton, John

2010-05-01

Recent UK government-funded research has shown that compacted, unvegetated tramlines wheelings can represent an important source and transport pathway, which can account for 80% of surface runoff, sediment and phosphorus losses to edge-of-field from cereals on moderate slopes. For example, recent research found 5.5-15.8% of rainfall lost as runoff, and losses of 0.8-2.9 kg TP/ha and 0.3-4.8 T/ha sediment from tramline wheelings. When compaction was released by shallow cultivation, runoff was reduced to 0.2-1.7% of rainfall with losses of 0.0-0.2 kg TP/ha and 0.003-0.3 T/ha sediment respectively i.e. close to reference losses from control areas without tramlines. Recent independent assessments using novel tracer techniques have also shown that tramline wheelings can represent important sediment sources at river catchment scale. In response to these latest findings, a new project is now underway investigating the most cost-effective and practical ways of operationalising methods for managing tramline wheelings in autumn-sown cereal systems to reduce the risk of soil compaction from the autumn spray operation and the associated risk of surface runoff and diffuse pollution loss of sediment, phosphorus and nitrogen to edge of field. Research is focusing on the over-winter period when soils are close to field capacity and the physical protection of the soil surface granted by growing crop is limited. This paper outlines this new multi-disciplinary project and associated methodologies, which include hillslope-scale event-based evaluations of the effectiveness of novel mitigation methods on surface runoff and diffuse pollution losses to edge of field, assessments of the economic and practical viability of mitigation methods, and modelling the impact on water quality of implementation of the most promising techniques at both farm and catchment scale. The study involves a large consortium with 20 partners, including many industrial organisations representing tractor, crop

Ecotoxicity of binary mixtures of Microcystis aeruginosa and insecticides to Daphnia pulex

International Nuclear Information System (INIS)

Asselman, J.; Janssen, C.R.; Smagghe, G.; De Schamphelaere, K.A.C.

2014-01-01

In aquatic ecosystems, mixtures of chemical and natural stressors can occur which may significantly complicate risk assessment approaches. Here, we show that effects of binary combinations of four different insecticides and Microcystis aeruginosa, a toxic cyanobacteria, on Daphnia pulex exhibited distinct interaction patterns. Combinations with chlorpyrifos and tetradifon caused non-interactive effects, tebufenpyrad caused an antagonistic interaction and fenoyxcarb yielded patterns that depended on the reference model used (i.e. synergistic with independent action, additive with concentration addition). Our results demonstrate that interactive effects cannot be generalised across different insecticides, not even for those targeting the same biological pathway (i.e. tebufenpyrad and tetradifon both target oxidative phosphorylation). Also, the concentration addition reference model provided conservative predictions of effects in all investigated combinations for risk assessment. These predictions could, in absence of a full mechanistic understanding, provide a meaningful solution for managing water quality in systems impacted by both insecticides and cyanobacterial blooms. - Highlights:: • 2 of 4 insecticide-Microcystis combinations showed no interactive effect on Daphnia. • One insecticide showed antagonistic deviation patterns. • For one other insecticide the results depended on the reference model used. • Interactive effects between insecticides and Microcystis cannot be generalized. • The concentration addition model provides conservative estimates of mixture effects. - Interactive effects between insecticides and cyanobacterial stressors cannot be generalized, not even for insecticides with closely related known modes of action

The influence of combustion derived pollutants on limestone deterioration

DEFF Research Database (Denmark)

Johnson, JB; Montgomery, Melanie; Thompson, GE

1996-01-01

This study concerns quantification of the relative chemical degradation effects of dry deposition of combustion-derived atmospheric pollutants, HCl, SO2 and NO2, on Portland and Monks Park limestones, employing laboratory exposure chambers for periods of 30 days. Using presentation rates up to 40 x...... 10(-4) mu g cm(-2) s(-1), the pollutants were assessed individually and in various combinations, along with ozone as oxidant, at 84% RH with dry or water-wetted surfaces. The degradation was followed by analysis of exposed stone, for Cl-, SO42- and NO3-, and of run-off solution for Ca2+, in addition...... to the anions. From these data, the total calcium released from limestone to reaction ions and products and the percentages of each pollutant reacted (and so the deposition velocity (V-D)) in each exposure regime were calculated. HCl acted independently of the presence of other pollutants, showed 40 and 100...

Variation of microorganism concentrations in urban stormwater runoff with land use and seasons.

Science.gov (United States)

Selvakumar, Ariamalar; Borst, Michael

2006-03-01

Stormwater runoff samples were collected from outfalls draining small municipal separate storm sewer systems. The samples were collected from three different land use areas based on local designation (high-density residential, low-density residential and landscaped commercial). The concentrations of microorganisms in the stormwater runoff were found to be similar in magnitude to, but less variable than, those reported in the stormwater National Pollutant Discharge Elimination System (NPDES) database. Microorganism concentrations from high-density residential areas were higher than those associated with low-density residential and landscaped commercial areas. Since the outfalls were free of sanitary wastewater cross-connections, the major sources of microorganisms to the stormwater runoff were most likely from the feces of domestic animals and wildlife. Concentrations of microorganisms were significantly affected by the season during which the samples were collected. The lowest concentrations were observed during winter except for Staphylococcus aureus. The Pearson correlation coefficients among different indicators showed weak linear relationships and the relationships were statistically significant. However, the relationships between indicators and pathogens were poorly correlated and were not statistically significant, suggesting the use of indicators as evidence of the presence of pathogens is not appropriate. Further, the correlation between the concentration of the traditionally monitored indicators (total coliforms and fecal coliforms) and the suggested substitutes (enterococci and E. coli) is weak, but statistically significant, suggesting that historical time series will be only a qualitative indicator of impaired waters under the revised criteria for recreational water quality by the US EPA.

The activity of the pyrrole insecticide chlorfenapyr in mosquito bioassay: towards a more rational testing and screening of non-neurotoxic insecticides for malaria vector control.

Science.gov (United States)

Oxborough, Richard M; N'Guessan, Raphael; Jones, Rebecca; Kitau, Jovin; Ngufor, Corine; Malone, David; Mosha, Franklin W; Rowland, Mark W

2015-03-24

The rapid selection of pyrethroid resistance throughout sub-Saharan Africa is a serious threat to malaria vector control. Chlorfenapyr is a pyrrole insecticide which shows no cross resistance to insecticide classes normally used for vector control and is effective on mosquito nets under experimental hut conditions. Unlike neurotoxic insecticides, chlorfenapyr owes its toxicity to disruption of metabolic pathways in mitochondria that enable cellular respiration. A series of experiments explored whether standard World Health Organization (WHO) guidelines for evaluation of long-lasting insecticidal nets, developed through testing of pyrethroid insecticides, are suitable for evaluation of non-neurotoxic insecticides. The efficacy of WHO recommended cone, cylinder and tunnel tests was compared for pyrethroids and chlorfenapyr. To establish bioassay exposure times predictive of insecticide-treated net (ITN) efficacy in experimental hut trials, standard three-minute bioassays of pyrethroid and chlorfenapyr ITNs were compared with longer exposures. Mosquito behaviour and response to chlorfenapyr ITN in bioassays conducted at night were compared to day and across a range of temperatures representative of highland and lowland transmission. Standard three-minute bioassay of chlorfenapyr produced extremely low levels of mortality compared to pyrethroids. Thirty-minute day-time bioassay produced mortality closer to hut efficacy of chlorfenapyr ITN but still fell short of the WHO threshold. Overnight tunnel test with chlorfenapyr produced 100% mortality and exceeded the WHO threshold of 80%. The endogenous circadian activity rhythm of anophelines results in inactivity by day and raised metabolism and flight activity by night. A model which explains improved toxicity of chlorfenapyr ITN when tested at night, and during the day at higher ambient temperature, is that activation of chlorfenapyr and disruption of respiratory pathways is enhanced when the insect is more metabolically

Regulations Concerning Agriculture and Air Pollution

Directory of Open Access Journals (Sweden)

Chiara Bertora

2010-03-01

Full Text Available The main issues related to the atmospheric pollution are the stratospheric ozone depletion, the transboundary air pollution, the troposphere air quality and the climate change. The three last decades have seen the birth of several measures for the atmosphere safeguard. Agricultural activities play a key role in determining, preventing and mitigating atmospheric pollution. The emission to atmosphere of different ozone-depleting substances is regulated by the Montreal Protocol. The role of agriculture activity in ozone depletion is linked to the utilization of methyl bromide as soil sterilant and to the emission of nitrogen oxides and nitrous oxide, from agricultural soils. The Convention on long-range transboundary air pollution regulates the emission of several pollutants, i.e. sulphur dioxide, nitrogen oxides, ammonia, non methane volatile organic compounds, carbon monoxide, heavy metals, persistent organic pollutants, and tropospheric ozone. The agriculture sector is responsible for a large part of the emissions of ammonia and nitrogen oxides, mainly through manure management and nitrogen fertilization, and of most persistent organic pollutants, largely used in the past as insecticides and fungicides. The increase of the greenhouse gases (GHGs concentration in the atmosphere is under the control of the Kyoto Protocol. Agriculture accounts for 59-63% of global non-CO2 GHGs emissions but at the same time it contributes to the atmospheric CO2 concentration stabilisation through the substitution of fossil fuels by biofuels and the sequestration of C in soil and vegetal biomass. In this paper we provide an outline of the numerous scientific and legislative initiatives aimed at protecting the atmosphere, and we analyse in detail the agriculture sector in order to highlight both its contribution to atmospheric pollution and the actions aimed at preventing and mitigating it.

Evaluation of Environmental Risks in the Use of Insecticide in Hashtgerd Area using EIQ

Directory of Open Access Journals (Sweden)

seyae jala yadollahi Nooshabadi

2018-02-01

Full Text Available Introduction Recently, there is an increasing concern about the effects of pesticides on non-target organisms. Residual of pesticides cause environmental pollution and put in danger the human health. The problem is always in contact with pesticides, there are numerous risks related to the environmental and human health threat at different levels of their cycle, including production, sale, use in the field and ultimately for residue in food occurs. This study consider the harmful effects of pesticides in Hashtgerd study area and their potential and environmental risks using EIQ index. Environmental Impact Quotient (EIQ is a model based on algebraic equations which by it can be classification chemical pesticides based on environmental hazards and risks to human health and toxins that cause minimal risk are selected. The ultimate purpose of this study was to determine 5 insecticide have been the highest consumption in the region Hashtgerd and then determine the potential environmental risks of them by EIQ index, so that eventually we can identify and eliminate hazardous insecticides. Materials and Methods Hashtgerd study area is one of 609 countries study area that is located in the Alborz province. This area with an extent of about 1170 square km because of the proximity to the metropolis of Tehran and focus a large number of agricultural, industrial and service units has an important economic and political position. The numerical value of the EIQ is average of the three main components include of the potential damage to the health of farm workers, the potential damage to consumers through the direct effect of toxic residues in food products or through ground water contamination and potential negative effects on the environment, including aquatic and terrestrial organisms show. The describes components of the EIQ are contains 11 variables. All input data for the impact of low, medium and high are judged to be harmful than, the one, three or five

Field and Laboratory Evaluations of Insecticides for Southern Pine Beetle Control

Science.gov (United States)

Felton L. Hastings; Jack E. Coster; [Editors

1981-01-01

Reports results of laboratory screenings and field studies of insecticides for use against the southern pine beetle. Preventive as webas remedial efficacywere observed, along with phytotoxicity to pine and understory hardwood species, effects of insecticides on soil microbial and mesofaunal populations, and degradation of insecticides by selected soil microbes.

Missing (in-situ) snow cover data hampers climate change and runoff studies in the Greater Himalayas.

Science.gov (United States)

Rohrer, Mario; Salzmann, Nadine; Stoffel, Markus; Kulkarni, Anil V

2013-12-01

The Himalayas are presently holding the largest ice masses outside the polar regions and thus (temporarily) store important freshwater resources. In contrast to the contemplation of glaciers, the role of runoff from snow cover has received comparably little attention in the past, although (i) its contribution is thought to be at least equally or even more important than that of ice melt in many Himalayan catchments and (ii) climate change is expected to have widespread and significant consequences on snowmelt runoff. Here, we show that change assessment of snowmelt runoff and its timing is not as straightforward as often postulated, mainly as larger partial pressure of H2O, CO2, CH4, and other greenhouse gases might increase net long-wave input for snowmelt quite significantly in a future atmosphere. In addition, changes in the short-wave energy balance - such as the pollution of the snow cover through black carbon - or the sensible or latent heat contribution to snowmelt are likely to alter future snowmelt and runoff characteristics as well. For the assessment of snow cover extent and depletion, but also for its monitoring over the extremely large areas of the Himalayas, remote sensing has been used in the past and is likely to become even more important in the future. However, for the calibration and validation of remotely-sensed data, and even more so in light of possible changes in snow-cover energy balance, we strongly call for more in-situ measurements across the Himalayas, in particular for daily data on new snow and snow cover water equivalent, or the respective energy balance components. Moreover, data should be made accessible to the scientific community, so that the latter can more accurately estimate climate change impacts on Himalayan snow cover and possible consequences thereof on runoff. © 2013 Elsevier B.V. All rights reserved.

3 Insecticide Use Practice

African Journals Online (AJOL)

Administrator

500,000 metric tonnes in the 1964/1965 season. Problems ... insecticides on the open market. ... effective in the management of insect pests of cocoa. .... Effectiveness and profitability of pest ... Youth in Agriculture; Programme Policy, Strategy.

A Theory of Strategic Voting in Runoff Elections

OpenAIRE

Laurent Bouton

2013-01-01

This paper analyzes the properties of runoff electoral systems when voters are strategic. A model of three-candidate runoff elections is presented, and two new features are included: the risk of upset victory in the second round is endogenous, and many types of runoff systems are considered. Three main results emerge. First, runoff elections produce equilibria in which only two candidates receive a positive fraction of the votes. Second, a sincere voting equilibrium does not always exist. Fin...

Biological alterations and self-reported symptoms among insecticides-exposed workers in Burkina Faso.

Science.gov (United States)

Toe, Adama M; Ilboudo, Sylvain; Ouedraogo, Moustapha; Guissou, Pierre I

2012-03-01

Occupationally exposed workers, farm workers and plant protection agents in the Sahel region of Burkina Faso were interviewed to assess adverse health effects of insecticides. The subjects were also examined for changes in both hematological and biochemical parameters. The prevalence of liver and kidney dysfunction was found to be quite high among insecticide applicators, especially among plant protection agents. The prevalence of biochemical alterations seems to be correlated to the frequency of insecticide use. However, no significant differences were found between the hematological parameters among farm workers and plant protection agents. The hematological parameters of all the insecticide applicators were normal. The great majority of insecticide applicators (85%) reported symptoms related to insecticide exposure. The use of insecticides in the agriculture of Burkina Faso is threatening to human health.

Long-term runoff changes in regions of Slovakia

International Nuclear Information System (INIS)

Miklanek, Pavol; Pekarova; Pavla

2004-01-01

Mean annual runoff variability includes both natural and anthropogenic (climate change) impacts. Aim of the paper is to identify the long-term trends and the cyclic runoff components of selected Slovak rivers for the period 1931-2000, and of the Danube river for the period 1840-2000. The variability is analysed by the long-term runoff trends of 27 Slovak rivers for the period 1931-2000. The stations were included into the Slovak National Climate Program and they are supposed not to be influenced by anthropogenic activities except of possible climate change. Comparison of the monthly runoff series of the 27 rivers allowed us to draw 3 regions with different runoff trends on the territory of Slovakia (constant trend in Northern and Eastern Slovakia, slow decrease in Central Slovakia, and rapid decrease in Southern Slovakia; The identification of different cyclic components of the runoff series is included. The length of the series allows to identify the 22-year cycles as maximum. By means of the longer runoff series of the Danube river it is shown that the more dry periods occurred in the central Europe and Slovakia in mid 19 th century. The longer Danube series were used also to find the longer runoff cycles of about 31 and 46 years. The mean annual temperature in Europe was lower by 0.6 o C in mid 19 th century compared to 1990s. The temperature increase is put down to climate change impact. The driest period shown by Danube runoff series in mid 19 th century occurred before the start of the climate change. Therefore it is probable that the long-term runoff variability has its own dynamics as well. (Author)

Stormwater Runoff Plumes in Southern California Detected with Satellite SAR and MODIS Imagery - Areas of Increased Contamination Risk

Science.gov (United States)

Trinh, R. C.; Holt, B.; Gierach, M.

2016-12-01

Coastal pollution poses both a major health and environmental hazard, not only for beachgoers and coastal communities, but for marine organisms as well. Stormwater runoff is the largest source of pollution in the coastal waters of the Southern California Bight (SCB). The SCB is the final destination of four major urban watersheds and associated rivers, Ballona Creek, the Los Angeles River, the San Gabriel River, and the Santa Ana River, which act as channels for runoff and pollution during and after episodic rainstorms. Previous studies of SCB water quality have made use of both fine resolution Synthetic Aperture Radar (SAR) imagery and wide-swath medium resolution optical "ocean color" imagery from SeaWiFS and MODIS. In this study, we expand on previous SAR efforts, compiling a more extensive collection of multi-sensor SAR data, spanning from 1992 to 2014, analyzing the surface slick component of stormwater plumes. We demonstrate the use of SAR data in early detection of coastal stormwater plumes, relating plume extent to cumulative river discharge, and shoreline fecal bacteria loads. Intensity maps of the primary extent and direction of plumes were created, identifying coastal areas that may be subject to the greatest risk of environmental contamination. Additionally, we illustrate the differences in the detection of SAR surface plumes with the sediment-related discharge plumes derived from MODIS ocean color imagery. Finally, we provide a concept for satellite monitoring of stormwater plumes, combining both optical and radar sensors, to be used to guide the collection of in situ water quality data and enhance the assessment of related beach closures.

APPLICATION OF GIS IN MODELING ZILBERCHAI BASIN RUNOFF

Directory of Open Access Journals (Sweden)

L. Malekani