RRM Strategies in LTE&WiMAX Interworking System

DEFF Research Database (Denmark)

Zakrzewska, Anna; Ruepp, Sarah Renée; Berger, Michael Stübert

, that could be applied in 4G systems (LTE interworking with WiMAX is considered). Furthermore, it will also discuss the Radio Resource Management (RRM) problem addressing the challenges of designing a RRM system for such a multi-RAT wireless environment. Different functionalities and possibilities...

Enhanced control and sensing for the REMOTEC ANDROS Mk VI robot. CRADA final report

International Nuclear Information System (INIS)

Spelt, P.F.; Harvey, H.W.

1998-01-01

This Cooperative Research and Development Agreement (CRADA) between Lockheed Martin Energy Systems, Inc., and REMOTEC, Inc., explored methods of providing operator feedback for various work actions of the ANDROS Mk VI teleoperated robot. In a hazardous environment, an extremely heavy workload seriously degrades the productivity of teleoperated robot operators. This CRADA involved the addition of computer power to the robot along with a variety of sensors and encoders to provide information about the robot's performance in and relationship to its environment. Software was developed to integrate the sensor and encoder information and provide control input to the robot. ANDROS Mk VI robots are presently used by numerous electric utilities to perform tasks in reactors where substantial exposure to radiation exists, as well as in a variety of other hazardous environments. Further, this platform has potential for use in a number of environmental restoration tasks, such as site survey and detection of hazardous waste materials. The addition of sensors and encoders serves to make the robot easier to manage and permits tasks to be done more safely and inexpensively (due to time saved in the completion of complex remote tasks). Prior research on the automation of mobile platforms with manipulators at Oak Ridge National Laboratory's Center for Engineering Systems Advanced Research (CESAR, B ampersand R code KC0401030) Laboratory, a BES-supported facility, indicated that this type of enhancement is effective. This CRADA provided such enhancements to a successful working teleoperated robot for the first time. Performance of this CRADA used the CESAR laboratory facilities and expertise developed under BES funding

Micromagnetic Code Development of Advanced Magnetic Structures Final Report CRADA No. TC-1561-98

Energy Technology Data Exchange (ETDEWEB)

Cerjan, Charles J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Shi, Xizeng [Read-Rite Corporation, Fremont, CA (United States)

2017-11-09

The specific goals of this project were to: Further develop the previously written micromagnetic code DADIMAG (DOE code release number 980017); Validate the code. The resulting code was expected to be more realistic and useful for simulations of magnetic structures of specific interest to Read-Rite programs. We also planned to further the code for use in internal LLNL programs. This project complemented LLNL CRADA TC-840-94 between LLNL and Read-Rite, which allowed for simulations of the advanced magnetic head development completed under the CRADA. TC-1561-98 was effective concurrently with LLNL non-exclusive copyright license (TL-1552-98) to Read-Rite for DADIMAG Version 2 executable code.

First Principles Diffusion Modeling Final Report CRADA No. TC-1540-98

Energy Technology Data Exchange (ETDEWEB)

delaRubia, T. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Foad, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Giles, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-19

The CRADA participants built on the capabilities LLNL had already developed for ab initio diffusion modeling, extending them to higher doping and damage levels, and applying them to improve the understanding of implant and annealing tradeoffs for technology-relevant conditions. The calculation results and some of the simulation capabilities developed here were transferred to Intel and Applied Materials.

Development of XRMF techniques for measurement of multi-layer film thicknesses on semiconductors for VLSI and ULSI integrated circuits. Final CRADA report for CRADA number Y-1292-0130

International Nuclear Information System (INIS)

Carpenter, D.A.; Golijanin, D.L.; Wherry, D.

1997-01-01

A CRADA with Kevex Instruments was carried out to develop improved XRMF instrumentation for the nondestructive analysis of electronic components during manufacture. Experiments conducted at Y-12 proved the feasibility of a new Kevex x-ray tube design. Tests also show that the current commercial supply of straight glass capillaries is unreliable; however, other vendors of tapered single and multiple glass capillaries were identified. The stability of the Y-12 x-ray microprobe was significantly enhanced as a result of this CRADA

Development of an X-Ray Catheter Final Report CRADA No. TC-1265-96

Energy Technology Data Exchange (ETDEWEB)

Trebes, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Schlossberg, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-11-01

Toe goal of this CRADA project was to develop a catheter-based x-ray source to provide treatment of restenosis in arteries with a radiation source which can be precisely controlled and turned on and off at will.

Nano-Filament Field Emission Cathode Development Final Report CRADA No. TSB-0731-93

Energy Technology Data Exchange (ETDEWEB)

Bernhardt, Tony [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Fahlen, Ted [Candescent Technologies Corporation, San Jose, CA (United States)

2018-01-17

At the time the CRADA was established, Silicon Video Corporation, of Cupertino, CA was a one-year-old rapidly growing start-up company. SVC was developing flat panel displays (FPDs) to replace Cathode Ray Terminals (CRTs) for personal computers, work stations and televisions. They planned to base their products on low cost and energy efficient field emission technology. It was universally recognized that the display was both the dominant cost item and differentiating feature of many products such as laptop computers and hand-held electronics and that control of the display technology through U.S. sources was essential to success in these markets. The purpose of this CRADA project was to determine if electrochemical planarization would be a viable, inexpensive alternative to current optical polishing techniques for planarizing the surface of a ceramic backplate of a thin film display.

Non-Invasive Pneumothorax Detector Final Report CRADA No. TC02110.0

Energy Technology Data Exchange (ETDEWEB)

Chang, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Purcell, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-29

This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and ElectroSonics Medical Inc. (formerly known as BIOMEC, Inc.), to develop a non-invasive pneumothorax detector based upon the micropower impulse radar technology invented at LLNL. Under a Work for Others Subcontract (L-9248), LLNL and ElectroSonics successfully demonstrated the feasibility of a novel device for non-invasive detection of pneumothorax for emergency and long-term monitoring. The device is based on Micropower Impulse Radar (MIR) Ultra Wideband (UWB) technology. Phase I experimental results were promising, showing that a pneumothorax volume even as small as 30 ml was clearly detectable from the MIR signals. Phase I results contributed to the award of a National Institute of Health (NIH) SBIR Phase II grant to support further research and development. The Phase II award led to the establishment of a LLNL/ElectroSonics CRADA related to Case No. TC02045.0. Under the subsequent CRADA, LLNL and ElectroSonics successfully demonstrated the feasibility of the pneumothorax detection in human subject research trials. Under this current CRADA TC02110.0, also referred to as Phase II Type II, the project scope consisted of seven tasks in Project Year 1; five tasks in Project Year 2; and four tasks in Project Year 3. Year 1 tasks were aimed toward the delivery of the pneumothorax detector design package for the pre-production of the miniaturized CompactFlash dockable version of the system. The tasks in Project Years 2 and 3 critically depended upon the accomplishments of Task 1. Since LLNL’s task was to provide subject matter expertise and performance verification, much of the timeline of engagement by the LLNL staff depended upon the overall project milestones as determined by the lead organization ElectroSonics. The scope of efforts were subsequently adjusted accordingly to commensurate with funding

Pulsed Plasma Processing of Diesel Engine Exhaust Final Report CRADA No. TC-0336-92-1-C

Energy Technology Data Exchange (ETDEWEB)

Merritt, Bernard T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Broering, Louis [Cummins Engine Company, Inc., Columbus, IN (United States)

2017-11-09

The goal was to develop an exhaust-gas treatment process for the reduction of NO_x and hydrocarbon from diesel engines. The project began believing that direct chemical reduction on NO_x was possible through the use of non-thermal plasmas. The original CRADA began in 1993 and was scheduled to finish in 1996. It had as its goals three metrics: 1) remove two grams/brake-horse-power-hour of NOx, 2) have no more than five percent energy penalty, and 3) cost no more than ten percent of the engine cost. These goals were all aimed at heavy-duty diesel trucks. This CRADA had its Defense Program funding eliminated by DOE prior to completion in 1995. Prior to loss of funding from DOE, LLNL discovered that due to the large oxygen content in diesel exhaust, direct chemical reduction was not possible. In understanding why, a breakthrough was achieved that combined the use of a non-thermal plasma and a catalyst. This process was named Plasma Assisted Catalytic Reduction (P ACR). Because of this breakthrough, the CRADA became a funds-in only CRADA, once DOE DP funding ended. As a result, the funding decreased from about 1M dollars per year to about $400k per year. Subsequently, progress slowed as well. The CRADA was amended several times to reflect the funds-in nature. At each amendment, the deliverables were modified; the goals remained the same but the focus changed from heavy-duty to lightduty to SUVs. The diesel-engine NO_x problem is similar to the furnace and boiler NO_x emission problem with the added constraint that ammonia-like additives are impractical for a mobile source. Lean-burning gasoline engines are an additional area of application because the standard three-way catalyst is rendered ineffective by the presence of oxygen. In the P ACR process an electrical discharge is used to create a non-thermal plasma that contains oxidative radicals O and OH. These oxidative radicals convert NO to NO₂. Selective catalytic

Complex Multi-Chamber Airbag Performance Simulation Final Report CRADA No. TSB-961-94

Energy Technology Data Exchange (ETDEWEB)

Kay, Gregory [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kithil, Philip [Advanced Safety Concepts, Inc. (ASCI), Santa Fe, NM (United States)

2018-01-22

The purpose of this small business CRADA was to evaluate the performance of new airbag concepts which were developed by the Advanced Safety Concepts, Inc. (ASCI). These new airbag concepts, if successful, could have major potential savings to society in terms of fewer injuries, lost time and lives.

Application of a Barrier Filter at a High Purity Synthetic Graphite Plant, CRADA 99-F035, Final Report

Energy Technology Data Exchange (ETDEWEB)

National Energy Technology Laboratory

2000-08-31

Superior Graphite Company and the US Department of Energy have entered into a Cooperative Research and Development Agreement (CRADA) to study the application of ceramic barrier filters at its Hopkinsville, Kentucky graphite plant. Superior Graphite Company is a worldwide leader in the application of advanced thermal processing technology to produce high purity graphite and carbons. The objective of the CRADA is to determine the technical and economic feasibility of incorporating the use of high-temperature filters to improve the performance of the offgas treatment system. A conceptual design was developed incorporating the ceramic filters into the offgas treatment system to be used for the development of a capital cost estimate and economic feasibility assessment of this technology for improving particulate removal. This CRADA is a joint effort of Superior Graphite Company, Parsons Infrastructure and Technology Group, and the National Energy Technology Laboratory (NETL) of the US Department of Energy (DOE).

Regional blood flows in the established stage of reduced renal mass (RRM) hypertension in rats

International Nuclear Information System (INIS)

Smits, G.J.; Lombard, J.H.

1986-01-01

Regional blood flows were measured with 15 μm 153 Gd-labelled microspheres in 21 anesthetized (pentobarbital-50 mg/kg, i.p.) male Sprague Dawley rats 5-6 weeks after a 75% reduction in renal mass and in 6 sham operated controls (SOC). RRM rats were maintained on either a high salt (HS-RRM) diet, i.e., choice of 1% NaCl or tap water (n = 11), or on a salt-restricted (SR-RRM) diet (n = 10). Mean arterial blood pressure was significantly elevated (mean +/- SE) in the HS-RRM (168 +/- 5 mmHg) vs. either the SR-RRM (147 +/- 6 mmHg) or the SOC (138 +/- 4 mmHg). Although blood flow to the skin and femur were elevated in HS-RRM and SR-RRM relative to SOC, there were no significant differences in blood flow to skeletal muscle, spleen, liver, small intestine, stomach or testes between any of the groups. Absolute renal blood flow and renal blood flow/gm of tissue were significantly lower in HS-RRM (7.2 +/- 0.7 ml/min or 3.4 +/- 0.5 ml/min/gm) and SR-RRM (6.3 +/- 0.6 ml/min or 3.2 +/- 0.3 ml/min/gm) than in SOC (15.1 +/- 0.97 ml/min or 5.5 +/- 0.2 ml/min/gm). The present results suggest that regional blood flow is unchanged in most vascular beds during the established stage of RRM hypertension in rats

Trinitromethyl Heterocyclic Oxidizers as a Solid Propellant Ingredient Final Report CRADA No TC02146.0

Energy Technology Data Exchange (ETDEWEB)

Pagoria, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Racoveanu, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-15

This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and Physical Sciences, Inc. (PSI), to develop a synthesis of two novel energetic heterocyclic oxidizers as possible replacements for ammonium perchlorate (AP) in rocket propellant formulations. This CRADA resulted from the award of the Phase I Small Business Technology Transfer (STTR) from DOD. The CRADA consisted of two phases. The goal for Phase 1 was to produce a new oxidizer called TNMDNP. Phase 2 is optional (based on the success of Phase 1) and the goal of Phase 2 (optional) was to produce a new oxidizer called TNMDNT. Phase 2 tasks would be performed based on the successful results of Phase 1.

Mobile Ocean Test Berth Support: Cooperative Research and Development Final Report, CRADA Number CRD-10-413

Energy Technology Data Exchange (ETDEWEB)

LiVecchi, Albert [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2015-12-01

The Northwest National Marine Renewable Energy Center (NNMREC), headquartered at the Oregon State University, is establishing the capabilities to test prototype wave energy conversion devices in the ocean. This CRADA will leverage the technical expertise and resources at NREL in the wind industry and in ocean engineering to support and enhance the development of the NNMREC Mobile Ocean Test Berth (MOTB). This CRADA will provide direct support to NNMREC by providing design evaluation and review of the MOTB, developing effective protocols for testing of the MOTB and wave energy conversion devices in the ocean, assisting in the specification of appropriate instrumentation and data acquisition packages, and providing guidance on obtaining and maintaining A2LA (American Association for Laboratory Accreditation) accreditation.

Data summary report for M.W. Kellogg Z-sorb sorbent tests. CRADA 92-008 Final report

Energy Technology Data Exchange (ETDEWEB)

Everett, C E; Monaco, S J

1994-05-01

A series of tests were undertaken from August 6, 1992 through July 6, 1993 at METC`s High Pressure Bench-Scale Hot Gas Desulfurization Unit to support a Cooperative Research and Development Agreement (CRADA) between METC`s Sorbent Development Cluster and M.W. Kellogg. The M.W. Kellogg Company is currently developing a commercial offering of a hot gas clean-up system to be used in Integrated Gasification Combined Cycle (IGCC) systems. The intent of the CRADA agreement was to identify a suitable zinc-based desulfurization sorbent for the Sierra Pacific Power Company Clean Coal Technology Project, to identify optimum operating conditions for the sorbent, and to estimate potential sorbent loss per year. This report presents results pertaining to Phillips Petroleum`s Z-Sorb III sorbent.

Development of a Multi-Sensor Cancer Detection Probe Final Report CRADA No. TC-2026-01

Energy Technology Data Exchange (ETDEWEB)

Marion, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hular, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-16

This collaboration continued work started under a previous CRADA (TSB-2023-00) to take a detailed concept specification for a multi-sensor needle/probe suitable for breast cancer analysis and produce a prototype system suitable for human FDA trials.

Optical Mode Converters Final Report CRADA No. TC-0838-94

Energy Technology Data Exchange (ETDEWEB)

Pocha, Michael D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Carey, Kent [Hewlett-Packard Company, Palo Alto, CA (United States). Agilent Technologies

2017-11-09

The information age was maturing, and photonics was emerging as a significant technology with important'national security and commercial implications at the time of the CRADA. This was largely due to the vast information carrying capacity of optical beams and the availability of cheap.and effective optical fiber waveguides to guide the light. However, a major limitation to the widespread deployment of photonic systems was the high-cost (in an economic and performance sense) associated with coupling optical power between optoelectronic waveguide devices or between a device and an optical fiber. The problem was critical in the case of single-mode waveguide devices. Mitigating these costs would be a significant and pervasive enabler of the technology for a wide variety of applications that would have crucial defense and economic impact. The partners worked together to develop optical mode size converters on silicon substrates. Silicon was chosen because of its compatibility with the required photolithographic and micromachining techniques. By choosing silicon, these techniques could enable the close coupling of high-speed, high density silicon electronic circuitry to efficient low-cost photonics. The efficient coupling of electronics and photonics technologies would be important for many information age technologies. The joint nature of this project was intended to allow HP to benefit from some unique LLNL capabilities, and LLNL would be in a position to learn from HP and enhance its value to fundamental DP missions. Although the CRADA began as a hardware development project to develop the mode converter, it evolved into a software development venture. LLNL and HP researchers examined literature, performed some preliminary calculations, and evaluated production trade-offs of several known techniques to determine the best candidates for an integrated system.

Electrical Resistance Tomography for Subsurface Imaging Final Report CRADA No. TC-609-93

Energy Technology Data Exchange (ETDEWEB)

Daily, William [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Mondt, William [RIMtech, Inc., Westminster, CO (United States)

2018-01-22

The purpose of this CRADA was to develop a useful and commercially viable version of ERT technology for use in the oil, mining, engineering, and geotechnical industries. The goals required to accomplish these tasks included (1) developing commercial-grade data-acquisition systems and data analysis software, and (2) completing transfer of the state-of-the-art know-how, held by LLNL scientists and engineers, to personnel at RIMtech, Inc.

EnergyPlus Hysteresis PCM Model: Cooperative Research and Development Final Report, CRADA Number CRD-16-639

Energy Technology Data Exchange (ETDEWEB)

Lee, Edwin S. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2018-02-22

Under the CRADA, NREL will provide assistance to NRGsim to debug and convert the EnergyPlus Hysteresis Phase Change Material ('PCM') model to C++ for adoption into the main code package of the EnergyPlus simulation engine.

CRADA Final Report for CRADA Number ORNL00-0605: Advanced Engine/Aftertreatment System R&D

Energy Technology Data Exchange (ETDEWEB)

Pihl, Josh A [ORNL; West, Brian H [ORNL; Toops, Todd J [ORNL; Adelman, Brad [Navistar; Derybowski, Edward [Navistar

2011-10-01

Navistar and ORNL established this CRADA to develop diesel engine aftertreatment configurations and control strategies that could meet emissions regulations while maintaining or improving vehicle efficiency. The early years of the project focused on reducing the fuel penalty associated with lean NOx trap (LNT), also known as NOx adsorber catalyst regeneration and desulfation. While Navistar pursued engine-based (in-cylinder) approaches to LNT regeneration, complementary experiments at ORNL focused on in-exhaust fuel injection. ORNL developed a PC-based controller for transient electronic control of EGR valve position, intake throttle position, and actuation of fuel injectors in the exhaust system of a Navistar engine installed at Oak Ridge. Aftertreatment systems consisting of different diesel oxidation catalysts (DOCs) in conjunction with a diesel particle filter and LNT were evaluated under quasi-steady-state conditions. Hydrocarbon (HC) species were measured at multiple locations in the exhaust system with Gas chromatograph mass spectrometry (GC-MS) and Fourier transform infrared (FTIR) spectroscopy. Under full-load, rated speed conditions, injection of fuel upstream of the DOC reduced the fuel penalty for a given level of NOx reduction by 10-20%. GC-MS showed that fuel compounds were 'cracked' into smaller hydrocarbon species over the DOC, particularly light alkenes. GC-MS analysis of HC species entering and exiting the LNT showed high utilization of light alkenes, followed by mono-aromatics; branched alkanes passed through the LNT largely unreacted. Follow-on experiments at a 'road load' condition were conducted, revealing that the NOx reduction was better without the DOC at lower temperatures. The improved performance was attributed to the large swings in the NOx adsorber core temperature. Split-injection experiments were conducted with ultra-low sulfur diesel fuel and three pure HC compounds: 1-pentene, toluene, and iso-octane. The pure

The binding of TIA-1 to RNA C-rich sequences is driven by its C-terminal RRM domain.

Science.gov (United States)

Cruz-Gallardo, Isabel; Aroca, Ángeles; Gunzburg, Menachem J; Sivakumaran, Andrew; Yoon, Je-Hyun; Angulo, Jesús; Persson, Cecilia; Gorospe, Myriam; Karlsson, B Göran; Wilce, Jacqueline A; Díaz-Moreno, Irene

2014-01-01

T-cell intracellular antigen-1 (TIA-1) is a key DNA/RNA binding protein that regulates translation by sequestering target mRNAs in stress granules (SG) in response to stress conditions. TIA-1 possesses three RNA recognition motifs (RRM) along with a glutamine-rich domain, with the central domains (RRM2 and RRM3) acting as RNA binding platforms. While the RRM2 domain, which displays high affinity for U-rich RNA sequences, is primarily responsible for interaction with RNA, the contribution of RRM3 to bind RNA as well as the target RNA sequences that it binds preferentially are still unknown. Here we combined nuclear magnetic resonance (NMR) and surface plasmon resonance (SPR) techniques to elucidate the sequence specificity of TIA-1 RRM3. With a novel approach using saturation transfer difference NMR (STD-NMR) to quantify protein-nucleic acids interactions, we demonstrate that isolated RRM3 binds to both C- and U-rich stretches with micromolar affinity. In combination with RRM2 and in the context of full-length TIA-1, RRM3 significantly enhanced the binding to RNA, particularly to cytosine-rich RNA oligos, as assessed by biotinylated RNA pull-down analysis. Our findings provide new insight into the role of RRM3 in regulating TIA-1 binding to C-rich stretches, that are abundant at the 5' TOPs (5' terminal oligopyrimidine tracts) of mRNAs whose translation is repressed under stress situations.

76 FR 78808 - Airworthiness Directives; Teledyne Continental Motors (TCM) and Rolls-Royce Motors Ltd. (R-RM...

Science.gov (United States)

2011-12-20

... Airworthiness Directives; Teledyne Continental Motors (TCM) and Rolls-Royce Motors Ltd. (R-RM) Series... superseding an existing airworthiness directive (AD) for certain TCM and R-RM series reciprocating engines... adds R-RM C-125, C- 145, O-300, IO-360, TSIO-360, and LTSIO-520-AE series reciprocating engines to the...

CRADA Final Report for CRADA Number NFE-10-02991 "Development and Commercialization of Alternative Carbon Precursors and Conversion Technologies"

Energy Technology Data Exchange (ETDEWEB)

Norris, Rober [ORNL; Paulauskas, Felix [ORNL; Naskar, Amit [ORNL; Kaufman, Michael [ORNL; Yarborough, Ken [ORNL; Derstine, Chris [The Dow Chemical Company

2013-10-01

The overall objective of the collaborative research performed by the Oak Ridge National Laboratory (ORNL) and the Dow Chemical Company under this Cooperative Research And Development Agreement (CRADA NFE-10-02991) was to develop and establish pathways to commercialize new carbon fiber precursor and conversion technology. This technology is to produce alternative polymer fiber precursor formulations as well as scaled energy-efficient advanced conversion technology to enable continuous mode conversion to obtain carbonized fibers that are technically and economically viable in industrial markets such as transportation, wind energy, infrastructure and oil drilling applications. There have been efforts in the past to produce a low cost carbon fiber. These attempts have to be interpreted against the backdrop of the market needs at the time, which were strictly military aircraft and high-end aerospace components. In fact, manufacturing costs have been reduced from those days to current practice, where both process optimization and volume production have enabled carbon fiber to become available at prices below $20/lb. However, the requirements of the lucrative aerospace market limits further price reductions from current practice. This approach is different because specific industrial applications are targeted, most specifically wind turbine blade and light vehicle transportation, where aircraft grade carbon fiber is not required. As a result, researchers are free to adjust both manufacturing process and precursor chemistry to meet the relaxed physical specifications at a lower cost. This report documents the approach and findings of this cooperative research in alternative precursors and advanced conversion for production of cost-effective carbon fiber for energy missions. Due to export control, proprietary restrictions, and CRADA protected data considerations, specific design details and processing parameters are not included in this report.

Improved Advanced Actuated Hybrid Mirrors Final Report CRADA No. TC02130.0

Energy Technology Data Exchange (ETDEWEB)

Barbee, T. W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ealey, M. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-25

This was a collaborative effort to develop and demonstrate an improved Advanced Actuated Hybrid Mirrors (AAHM) for commercial or Government purposes. The AAHM consists of a nanolaminate film replicating a precision optical surface bonded to a Silicon Carbide (SiC) substrate with active figure control capability. The goal of this project was to further the development of specific AAHM technologies. The intent of the CRADA was to combine the expertise of LLNL and NG Xinetics in the manufacture and test of a very high quality AAHM, incorporating lessons learned from earlier joint efforts.

Development of Personal Decontamination System Final Report CRADA No. TC-02078-04

Energy Technology Data Exchange (ETDEWEB)

Smith, W. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); O' Dell, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-27

This was a collaborative effort between The Regents of the University of California, Lawrence Livermore National Laboratory (LLNL) and O’Dell Engineering, Ltd. (O’Dell) to develop an improved low-cost personal decontamination system for Toxic Industrial Chemicals (TICs) and chemical agents. The significant change to the project was that COTS (Commercial Off-the Shelf Components) were identified that performed as well, or better than, the proprietary materials created and tested as part of this CRADA. These COTS components were combined to create a new LPDS (low-cost personal decontamination system) that met all specifications.

The final technical report of the CRADA, 'Medical Accelerator Technology'

International Nuclear Information System (INIS)

Chu, W.T.; Rawls, J.M.

2000-01-01

Under this CRADA, Berkeley Lab and the industry partner, General Atomics (GA), have cooperatively developed hadron therapy technologies for commercialization. Specifically, Berkeley Lab and GA jointly developed beam transport systems to bring the extracted protons from the accelerator to the treatment rooms, rotating gantries to aim the treatment beams precisely into patients from any angle, and patient positioners to align the patient accurately relative to the treatment beams. We have also jointly developed a patient treatment delivery system that controls the radiation doses in the patient, and hardware to improve the accelerator performances, including a radio-frequency ion source and its low-energy beam transport (LEBT) system. This project facilitated the commercialization of the DOE-developed technologies in hadron therapy by the private sector in order to improve the quality of life of the nation

Development of a Laser for Landmine Destruction Final Report CRADA No. TC02126.0

Energy Technology Data Exchange (ETDEWEB)

Yamamoto, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Sheppard, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-31

This was one of two CRADAs between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and First Alliance Technologies, LLC (First Alliance), to conduct research and development activity toward an integrated system for the detecting, locating, and destroying of landmines and unexploded ordinance using a laser to destroy landmines and unexploded ordinance and First Alliance’s Land Mine Locator (LML) system.

Recycling end-of-life vehicles of the future. Final CRADA report.

Energy Technology Data Exchange (ETDEWEB)

Jody, B. J.; Pomykala, J. A.; Spangenberger, J. S.; Daniels, E.; Energy Systems

2010-01-14

Argonne National Laboratory (the Contractor) entered into a Cooperative Research and Development Agreement (CRADA) with the following Participants: Vehicle Recycling Partnership, LLC (VRP, which consists of General Motors [GM], Ford, and Chrysler), and the American Chemistry Council - Plastics Division (ACC-PD). The purpose of this CRADA is to provide for the effective recycling of automotive materials. The long-term goals are to (1) enable the optimum recycling of automotive materials, thereby obviating the need for legislative mandates or directives; (2) enable the recovery of automotive materials in a cost-competitive manner while meeting the performance requirements of the applications and markets for the materials; and (3) remove recycling barriers/reasons, real or perceived, to the use of advanced lightweighting materials or systems in future vehicles. The issues, technical requirements, and cost and institutional considerations in achieving that goal are complex and will require a concerted, focused, and systematic analysis, together with a technology development program. The scope and tasks of this program are derived from 'A Roadmap for Recycling End-of-Life Vehicles of the Future,' prepared in May 2001 for the DOE Office of Energy, Efficiency, and Renewable Energy (EERE)-Vehicle Technologies Program. The objective of this research program is to enable the maximum recycling of automotive materials and obsolete vehicles through the development and commercialization of technologies for the separation and recovery of materials from end-of-life vehicles (ELVs). The long-term goals are to (1) enable the optimum recycling of automotive materials, thereby obviating the need for legislative mandates or directives; (2) enable the recovery of automotive materials in a cost-competitive manner while meeting the performance requirements of the applications and markets for the materials; and (3) remove recycling barriers/reasons, real or perceived, to the use

Hyperspectral Sensors Final Report CRADA No. TC02173.0

Energy Technology Data Exchange (ETDEWEB)

Priest, R. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Sauvageau, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-30

This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and Science Applications International Corporation (SAIC), National Security Space Operations/SRBU, to develop longwave infrared (LWIR) hyperspectral imaging (HSI) sensors for airborne and potentially ground and space, platforms. LLNL has designed and developed LWIR HSI sensors since 1995. The current generation of these sensors has applications to users within the U.S. Department of Defense and the Intelligence Community. User needs are for multiple copies provided by commercial industry. To gain the most benefit from the U.S. Government’s prior investments in LWIR HSI sensors developed at LLNL, transfer of technology and know-how from LLNL HSI experts to commercial industry was needed. The overarching purpose of the CRADA project was to facilitate the transfer of the necessary technology from LLNL to SAIC thereby allowing the U.S. Government to procure LWIR HSI sensors from this company.

Development of YBCO Superconductor for Electric Systems: Cooperative Research and Development Final Report, CRADA Number CRD-04-150

Energy Technology Data Exchange (ETDEWEB)

Bhattacharya, R.

2013-03-01

The proposed project will be collaborative in exploration of high temperature superconductor oxide films between SuperPower, Inc. and the National Renewable Energy Laboratory. This CRADA will attempt to develop YBCO based high temperature oxide technology.

A Novel Rrm3 Function in Restricting DNA Replication via an Orc5-Binding Domain Is Genetically Separable from Rrm3 Function as an ATPase/Helicase in Facilitating Fork Progression

Science.gov (United States)

Syed, Salahuddin; Desler, Claus; Rasmussen, Lene J.; Schmidt, Kristina H.

2016-01-01

In response to replication stress cells activate the intra-S checkpoint, induce DNA repair pathways, increase nucleotide levels, and inhibit origin firing. Here, we report that Rrm3 associates with a subset of replication origins and controls DNA synthesis during replication stress. The N-terminal domain required for control of DNA synthesis maps to residues 186–212 that are also critical for binding Orc5 of the origin recognition complex. Deletion of this domain is lethal to cells lacking the replication checkpoint mediator Mrc1 and leads to mutations upon exposure to the replication stressor hydroxyurea. This novel Rrm3 function is independent of its established role as an ATPase/helicase in facilitating replication fork progression through polymerase blocking obstacles. Using quantitative mass spectrometry and genetic analyses, we find that the homologous recombination factor Rdh54 and Rad5-dependent error-free DNA damage bypass act as independent mechanisms on DNA lesions that arise when Rrm3 catalytic activity is disrupted whereas these mechanisms are dispensable for DNA damage tolerance when the replication function is disrupted, indicating that the DNA lesions generated by the loss of each Rrm3 function are distinct. Although both lesion types activate the DNA-damage checkpoint, we find that the resultant increase in nucleotide levels is not sufficient for continued DNA synthesis under replication stress. Together, our findings suggest a role of Rrm3, via its Orc5-binding domain, in restricting DNA synthesis that is genetically and physically separable from its established catalytic role in facilitating fork progression through replication blocks. PMID:27923055

A Novel Rrm3 Function in Restricting DNA Replication via an Orc5-Binding Domain Is Genetically Separable from Rrm3 Function as an ATPase/Helicase in Facilitating Fork Progression.

Science.gov (United States)

Syed, Salahuddin; Desler, Claus; Rasmussen, Lene J; Schmidt, Kristina H

2016-12-01

In response to replication stress cells activate the intra-S checkpoint, induce DNA repair pathways, increase nucleotide levels, and inhibit origin firing. Here, we report that Rrm3 associates with a subset of replication origins and controls DNA synthesis during replication stress. The N-terminal domain required for control of DNA synthesis maps to residues 186-212 that are also critical for binding Orc5 of the origin recognition complex. Deletion of this domain is lethal to cells lacking the replication checkpoint mediator Mrc1 and leads to mutations upon exposure to the replication stressor hydroxyurea. This novel Rrm3 function is independent of its established role as an ATPase/helicase in facilitating replication fork progression through polymerase blocking obstacles. Using quantitative mass spectrometry and genetic analyses, we find that the homologous recombination factor Rdh54 and Rad5-dependent error-free DNA damage bypass act as independent mechanisms on DNA lesions that arise when Rrm3 catalytic activity is disrupted whereas these mechanisms are dispensable for DNA damage tolerance when the replication function is disrupted, indicating that the DNA lesions generated by the loss of each Rrm3 function are distinct. Although both lesion types activate the DNA-damage checkpoint, we find that the resultant increase in nucleotide levels is not sufficient for continued DNA synthesis under replication stress. Together, our findings suggest a role of Rrm3, via its Orc5-binding domain, in restricting DNA synthesis that is genetically and physically separable from its established catalytic role in facilitating fork progression through replication blocks.

Proximity sensor system development. CRADA final report

Energy Technology Data Exchange (ETDEWEB)

Haley, D.C. [Oak Ridge National Lab., TN (United States); Pigoski, T.M. [Merrit Systems, Inc. (United States)

1998-01-01

Lockheed Martin Energy Research Corporation (LMERC) and Merritt Systems, Inc. (MSI) entered into a Cooperative Research and Development Agreement (CRADA) for the development and demonstration of a compact, modular proximity sensing system suitable for application to a wide class of manipulator systems operated in support of environmental restoration and waste management activities. In teleoperated modes, proximity sensing provides the manipulator operator continuous information regarding the proximity of the manipulator to objects in the workspace. In teleoperated and robotic modes, proximity sensing provides added safety through the implementation of active whole arm collision avoidance capabilities. Oak Ridge National Laboratory (ORNL), managed by LMERC for the United States Department of Energy (DOE), has developed an application specific integrated circuit (ASIC) design for the electronics required to support a modular whole arm proximity sensing system based on the use of capacitive sensors developed at Sandia National Laboratories. The use of ASIC technology greatly reduces the size of the electronics required to support the selected sensor types allowing deployment of many small sensor nodes over a large area of the manipulator surface to provide maximum sensor coverage. The ASIC design also provides a communication interface to support sensor commands from and sensor data transmission to a distributed processing system which allows modular implementation and operation of the sensor system. MSI is a commercial small business specializing in proximity sensing systems based upon infrared and acoustic sensors.

Proximity sensor system development. CRADA final report

International Nuclear Information System (INIS)

Haley, D.C.; Pigoski, T.M.

1998-01-01

Lockheed Martin Energy Research Corporation (LMERC) and Merritt Systems, Inc. (MSI) entered into a Cooperative Research and Development Agreement (CRADA) for the development and demonstration of a compact, modular proximity sensing system suitable for application to a wide class of manipulator systems operated in support of environmental restoration and waste management activities. In teleoperated modes, proximity sensing provides the manipulator operator continuous information regarding the proximity of the manipulator to objects in the workspace. In teleoperated and robotic modes, proximity sensing provides added safety through the implementation of active whole arm collision avoidance capabilities. Oak Ridge National Laboratory (ORNL), managed by LMERC for the United States Department of Energy (DOE), has developed an application specific integrated circuit (ASIC) design for the electronics required to support a modular whole arm proximity sensing system based on the use of capacitive sensors developed at Sandia National Laboratories. The use of ASIC technology greatly reduces the size of the electronics required to support the selected sensor types allowing deployment of many small sensor nodes over a large area of the manipulator surface to provide maximum sensor coverage. The ASIC design also provides a communication interface to support sensor commands from and sensor data transmission to a distributed processing system which allows modular implementation and operation of the sensor system. MSI is a commercial small business specializing in proximity sensing systems based upon infrared and acoustic sensors

CRADAs: They're Not Just for NCI Anymore | Poster

Science.gov (United States)

By Karen Surabian, Thomas Stackhouse, and Jeffrey Thomas, Contributing Writers, and Bruce Crise, Guest Writer Advancing scientific discovery is increasingly dependent on diverse and innovative partnerships, and the Cooperative Research and Development Agreement (CRADA) is an essential tool for establishing partnerships. CRADAs allow a federal laboratory to enter into collaborative research and development (R&D) projects with outside parties (commercial or nonprofit).

Mitochondrial DNA depletion syndrome due to mutations in the RRM2B gene.

Science.gov (United States)

Bornstein, Belén; Area, Estela; Flanigan, Kevin M; Ganesh, Jaya; Jayakar, Parul; Swoboda, Kathryn J; Coku, Jorida; Naini, Ali; Shanske, Sara; Tanji, Kurenai; Hirano, Michio; DiMauro, Salvatore

2008-06-01

Mitochondrial DNA depletion syndrome (MDS) is characterized by a reduction in mtDNA copy number and has been associated with mutations in eight nuclear genes, including enzymes involved in mitochondrial nucleotide metabolism (POLG, TK2, DGUOK, SUCLA2, SUCLG1, PEO1) and MPV17. Recently, mutations in the RRM2B gene, encoding the p53-controlled ribonucleotide reductase subunit, have been described in seven infants from four families, who presented with various combinations of hypotonia, tubulopathy, seizures, respiratory distress, diarrhea, and lactic acidosis. All children died before 4 months of age. We sequenced the RRM2B gene in three unrelated cases with unexplained severe mtDNA depletion. The first patient developed intractable diarrhea, profound weakness, respiratory distress, and died at 3 months. The other two unrelated patients had a much milder phenotype and are still alive at ages 27 and 36 months. All three patients had lactic acidosis and severe depletion of mtDNA in muscle. Muscle histochemistry showed RRF and COX deficiency. Sequencing the RRM2B gene revealed three missense mutations and two single nucleotide deletions in exons 6, 8, and 9, confirming that RRM2B mutations are important causes of MDS and that the clinical phenotype is heterogeneous and not invariably fatal in infancy.

Laser Materials Processing Final Report CRADA No. TC-1526-98

Energy Technology Data Exchange (ETDEWEB)

Crane, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Lehane, C. J. [United Technologies Corp., East Hartford, CT (United States)

2017-09-08

This CRADA project was a joint effort between Lawrence Livermore National Laboratory (LLNL) and United Technologies Corporation (UTC)/Pratt & Whitney (P&W) to demonstrate process capability for drilling holes in turbine airfoils using LLNL-developed femtosecond laser machining technology. The basis for this development was the ability of femtosecond lasers to drill precision holes in variety of materials with little or no collateral damage. The ultimate objective was to develop a laser machine tool consisting of an extremely advanced femtosecond laser subsystem to be developed by LLNL on a best-effort basis and a drilling station for turbine blades and vanes to be developed by P&W. In addition, P&W was responsible for commercializing the system. The goal of the so called Advanced Laser Drilling (ALD) system was to drill specified complex hole-shapes in turbine blades and vanes with a high degree precision and repeatability and simultaneously capable of very high speed processing.

The Use of Vaporous Hydrogen Peroxide for Building Decontamination Final Report CRADA No. TC-2053-02

Energy Technology Data Exchange (ETDEWEB)

Verce, M. F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Schwartz, L. I. [Strategic Technology Enterprises, Inc., Mentor, OH (United States)

2017-09-08

This was a collaborative effort between LLNL and STE to investigate the use of vaporized hydrogen peroxide (VHP®) to decontaminate spore-contaminated heating, ventilation, and cooling (HV AC) systems in a trailer sized room. LLNL's effort under this CRADA was funded by DOE's Chemical and Biological National Security Program (CBNP), which later became part of Department of Homeland Security in 2004.

Scale Up of Malonic Acid Fermentation Process: Cooperative Research and Development Final Report, CRADA Number CRD-16-612

Energy Technology Data Exchange (ETDEWEB)

Schell, Daniel J [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2018-04-16

The goal of this work is to use the large fermentation vessels in the National Renewable Energy Laboratory's (NREL) Integrated Biorefinery Research Facility (IBRF) to scale-up Lygos' biological-based process for producing malonic acid and to generate performance data. Initially, work at the 1 L scale validated successful transfer of Lygos' fermentation protocols to NREL using a glucose substrate. Outside of the scope of the CRADA with NREL, Lygos tested their process on lignocellulosic sugars produced by NREL at Lawrence Berkeley National Laboratory's (LBNL) Advanced Biofuels Process Development Unit (ABPDU). NREL produced these cellulosic sugar solutions from corn stover using a separate cellulose/hemicellulose process configuration. Finally, NREL performed fermentations using glucose in large fermentors (1,500- and 9,000-L vessels) to intermediate product and to demonstrate successful performance of Lygos' technology at larger scales.

A national laboratory/private industry cooperative research and development agreement (CRADA)

International Nuclear Information System (INIS)

Pritchard, D.A.

1996-01-01

This paper provides an overview of the history and process of establishing a cooperative research and development agreement (CRADA) between Sandia National Laboratories and Magnavox Electronic Systems Company for the design, development, and testing of a 360-degree scanning, imaging, intrusion detection sensor. The subject of the CRADA is the Advanced Exterior Sensor (AES). It is intended for exterior use at ranges from 50 to 1,500 meters and uses a combination of three sensing technologies (infrared, visible, and radar) and a new data processing method to provide low false-alarm intrusion detection and tracking combined with immediate visual assessment. The establishment of this CRADA represents a new paradigm in the cooperation between the Department of Defense, the Department of Energy, the National Laboratories and Private Industry. Although a formal document has now been executed, a CRADA is, nonetheless, primarily an agreement to work with each other to achieve goals that might otherwise be unattainable. For the DoD, a program continues in the face of uncertain funding. For the DOE, a CRADA is in place that meets congressionally mandated guidelines. For Sandia, sponsors are in agreement on requirements and synergistic funding. And for Magnavox, an opportunity is in hand to work with researchers in developing advanced security technology

Manufacturing and Characterization of Ultra Pure Ferrous Alloys Final Report CRADA No. TC02069.0

Energy Technology Data Exchange (ETDEWEB)

Lesuer, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McGreevy, T. E. [Caterpillar Inc., Mossville, IL (United States)

2017-09-06

This CRADA was a.collaborative effort between the Lawrence Livermore National Security LLC (formerly University of California)/Lawrence Livermore National Laboratory (LLNL),and Caterpillar Inc. (CaterpiHar), to further advance levitation casting techniques (developed at the Central Research Institute for Material (CRIM) in St. Petersburg, Russia) for use in manufacturing high purity metal alloys. This DOE Global Initiatives for Proliferation Prevention Program (IPP) project was to develop and demonstrate the levitation casting technology for producing ultra-pure alloys.

High Resolution Sub-MM Fiberoptic Endoscope Final Report CRADA No. TSB-1447-97

Energy Technology Data Exchange (ETDEWEB)

Stone, Gary F. [Univ. of California, Livermore, CA (United States); Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Smith, John [CML Fiberoptics, Inc., Auburn, NY (United States)

2018-01-22

At the time of the CRADA, LLNL needed to develop a sub-mm outer diameter fiberoptic endoscope with 25pm or better resolution at 3-lOmm working distance to support the Enhanced Surveillance Program (ESP) and the Core Surveillance Program for DOE. The commercially available systems did not meet the image resolution requirements and development work was needed to reach three goals. We also needed to perform preliminary investigations into the production of such an endoscope with a steerable-articulated distal end. The goal of such an endoscope was to allow for a 45 degree inspection cone including the lens field of view.

Fiber Based Optical Amplifier for High Energy Laser Pulses Final Report CRADA No. TC02100.0

Energy Technology Data Exchange (ETDEWEB)

Messerly, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Cunningham, P. [Boeing Company, Springfield, VA (United States)

2017-09-06

This was a collaborative effort between Lawrence Livermore National Security, LLC (formerly The Regents of the University of California)/Lawrence Livermore National Laboratory (LLNL), and The Boeing Company to develop an optical fiber-based laser amplifier capable of producing and sustaining very high-energy, nanosecond-scale optical pulses. The overall technical objective of this CRADA was to research, design, and develop an optical fiber-based amplifier that would meet specific metrics.

High Performance Parallel Processing (HPPP) Finite Element Simulation of Fluid Structure Interactions Final Report CRADA No. TC-0824-94-A

Energy Technology Data Exchange (ETDEWEB)

Couch, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ziegler, D. P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2018-01-24

This project was a muki-partner CRADA. This was a partnership between Alcoa and LLNL. AIcoa developed a system of numerical simulation modules that provided accurate and efficient threedimensional modeling of combined fluid dynamics and structural response.

Biodiesel/Cummins CRADA Report

Science.gov (United States)

2014-07-01

dedicated totes). This change provided uncontaminated containers to transport the delivery of biodiesel to the ANT, and better control for dosing as...emissions calculations. Each approach makes assumptions for farming practices, the biodiesel production process, and transportation and distribution... Biodiesel /Cummins CRADA Report Distribution Statement A: Approved for Public Release; distribution is unlimited. July 2014 Report

Practical Implementation of Cooperative RRM for IMT-Advanced Systems

DEFF Research Database (Denmark)

Mihovska, Albena D.; Tragos, Elias; Kyriazakos, Sofoklis

2008-01-01

This paper describes a practical implementation of a radio resource management (RRM) framework for support of cooperation between radio access networks (RANs). The platform supports the inter-working between a next generation RAN and legacy systems (i.e., WLAN, UMTS). The platform is based on rea...

In-service testing of Ni{sub 3}Al coupons and trays in carburizing furnaces at Delphi Saginaw. CRADA final report

Energy Technology Data Exchange (ETDEWEB)

Sikka, V.K.; Santella, M.L.; Viswanathan, S.; Swindeman, R.W. [Oak Ridge National Lab., TN (United States); Chatterjee, M. [General Motors Corporaion, Saginaw Division (United States)

1998-08-01

This Cooperative Research and Development Agreement (CRADA) report deals with the development of nickel aluminide alloy for improved longer life heat-resistant fixture assemblies for batch and continuous pusher carburizing furnaces. The nickel aluminide development was compared in both coupon and component testing with the currently used Fe-Ni-Cr heat-resisting alloy known as HU. The specific goals of the CRADA were: (1) casting process development, (2) characterization and possible modification of the alloy composition to optimize its manufacturing ability and performance under typical furnace operating conditions, and (3) testing and evaluation of specimens and prototype fixtures. In support of the CRADA objectives, coupons of nickel aluminide and the HU alloy were installed in both batch and pusher furnaces. The coupons were taken from two silicon levels and contained welds made with two different filler compositions (IC-221LA and IC-221W). Both nickel-aluminide and HU coupons were removed from the batch and pusher carburizing furnace at time intervals ranging from one month to one year. The exposed coupons were cut and mounted for metallographic, hardness, and microprobe analysis. The results of the microstructural analysis have been transmitted to General Motors Corporation, Saginaw Division (Delphi Saginaw) through reports that were presented at periodic CRADA review meetings. Based on coupon testing and verification of the coupon results with the testing of trays, Delphi Saginaw moved forward with the use of six additional trays in a batch furnace and two assemblies in a pusher furnace. Fifty percent of the trays and fixtures are in the as-cast condition and the remaining trays and fixtures are in the preoxidized condition. The successful operating experience of two assemblies in the pusher furnace for nearly a year formed the basis for a production run of 63 more assemblies. The production run required melting of 94 heats weighing 500 lb. each. Twenty

Structural basis underlying CAC RNA recognition by the RRM domain of dimeric RNA-binding protein RBPMS

Energy Technology Data Exchange (ETDEWEB)

Teplova, Marianna; Farazi, Thalia A.; Tuschl, Thomas; Patel, Dinshaw J.

2015-09-08

RNA-binding protein with multiple splicing (designated RBPMS) is a higher vertebrate mRNA-binding protein containing a single RNA recognition motif (RRM). RBPMS has been shown to be involved in mRNA transport, localization and stability, with key roles in axon guidance, smooth muscle plasticity, as well as regulation of cancer cell proliferation and migration. We report on structure-function studies of the RRM domain of RBPMS bound to a CAC-containing single-stranded RNA. These results provide insights into potential topologies of complexes formed by the RBPMS RRM domain and the tandem CAC repeat binding sites as detected by photoactivatable-ribonucleoside-enhanced crosslinking and immunoprecipitation. These studies establish that the RRM domain of RBPMS forms a symmetrical dimer in the free state, with each monomer binding sequence-specifically to all three nucleotides of a CAC segment in the RNA bound state. Structure-guided mutations within the dimerization and RNA-binding interfaces of RBPMS RRM on RNA complex formation resulted in both disruption of dimerization and a decrease in RNA-binding affinity as observed by size exclusion chromatography and isothermal titration calorimetry. As anticipated from biochemical binding studies, over-expression of dimerization or RNA-binding mutants of Flag-HA-tagged RBPMS were no longer able to track with stress granules in HEK293 cells, thereby documenting the deleterious effects of such mutationsin vivo.

Tire Development for Effective Transportation and Utilization of Used Tires, CRADA 01-N044, Final Report

Energy Technology Data Exchange (ETDEWEB)

Susan M. Maley

2004-03-31

Scrap tires represent a significant disposal and recycling challenge for the United States. Over 280 million tires are generated on an annual basis, and several states have large stockpiles or abandoned tire piles that are slated for remediation. While most states have programs to address the accumulation and generation of scrap tires, most of these states struggle with creating and sustaining recycling or beneficial end use markets. One of the major issues with market development has been the costs associated with transporting and processing the tires into material for recycling or disposal. According to a report by the Rubber Manufactures Association tire-derived fuel (TDF) represents the largest market for scrap tires, and approximately 115 million tires were consumed in 2001 as TDF (U.S. Scrap Tire Markets, 2001, December 2002, www.rma.org/scraptires). This market is supported primarily by cement kilns, followed by various industries including companies that operate utility and industrial boilers. However the use of TDF has not increased and the amount of TDF used by boiler operators has declined. The work completed through this cooperative research and development agreement (CRADA) has shown the potential of a mobile tire shredding unit to economically produce TDF and to provide an alterative low cost fuel to suitable coal-fired power systems. This novel system addresses the economic barriers by processing the tires at the retailer, thereby eliminating the costs associated with hauling whole tires. The equipment incorporated into the design allow for small 1-inch chunks of TDF to be produced in a timely fashion. The TDF can then be co-fired with coal in suitable combustion systems, such as a fluidized bed. Proper use of TDF has been shown to boost efficiency and reduce emissions from power generation systems, which is beneficial to coal utilization in existing power plants. Since the original scope of work outlined in the CRADA could not be completed because

Application of rrm as behavior mode choice on modelling transportation

Science.gov (United States)

Surbakti, M. S.; Sadullah, A. F.

2018-03-01

Transportation mode selection, the first step in transportation planning process, is probably one of the most important planning elements. The development of models that can explain the preference of passengers regarding their chosen mode of public transport option will contribute to the improvement and development of existing public transport. Logit models have been widely used to determine the mode choice models in which the alternative are different transport modes. Random Regret Minimization (RRM) theory is a theory developed from the behavior to choose (choice behavior) in a state of uncertainty. During its development, the theory was used in various disciplines, such as marketing, micro economy, psychology, management, and transportation. This article aims to show the use of RRM in various modes of selection, from the results of various studies that have been conducted both in north sumatera and western Java.

Structural Dynamics of the GW182 Silencing Domain Including its RNA Recognition motif (RRM) Revealed by Hydrogen-Deuterium Exchange Mass Spectrometry

Science.gov (United States)

Cieplak-Rotowska, Maja K.; Tarnowski, Krzysztof; Rubin, Marcin; Fabian, Marc R.; Sonenberg, Nahum; Dadlez, Michal; Niedzwiecka, Anna

2018-01-01

The human GW182 protein plays an essential role in micro(mi)RNA-dependent gene silencing. miRNA silencing is mediated, in part, by a GW182 C-terminal region called the silencing domain, which interacts with the poly(A) binding protein and the CCR4-NOT deadenylase complex to repress protein synthesis. Structural studies of this GW182 fragment are challenging due to its predicted intrinsically disordered character, except for its RRM domain. However, detailed insights into the properties of proteins containing disordered regions can be provided by hydrogen-deuterium exchange mass spectrometry (HDX/MS). In this work, we applied HDX/MS to define the structural state of the GW182 silencing domain. HDX/MS analysis revealed that this domain is clearly divided into a natively unstructured part, including the CCR4-NOT interacting motif 1, and a distinct RRM domain. The GW182 RRM has a very dynamic structure, since water molecules can penetrate the whole domain in 2 h. The finding of this high structural dynamics sheds new light on the RRM structure. Though this domain is one of the most frequently occurring canonical protein domains in eukaryotes, these results are - to our knowledge - the first HDX/MS characteristics of an RRM. The HDX/MS studies show also that the α2 helix of the RRM can display EX1 behavior after a freezing-thawing cycle. This means that the RRM structure is sensitive to environmental conditions and can change its conformation, which suggests that the state of the RRM containing proteins should be checked by HDX/MS in regard of the conformational uniformity. [Figure not available: see fulltext.

RRM domain of Arabidopsis splicing factor SF1 is important for pre-mRNA splicing of a specific set of genes

KAUST Repository

Lee, Keh Chien

2017-04-11

The RNA recognition motif of Arabidopsis splicing factor SF1 affects the alternative splicing of FLOWERING LOCUS M pre-mRNA and a heat shock transcription factor HsfA2 pre-mRNA. Splicing factor 1 (SF1) plays a crucial role in 3\\' splice site recognition by binding directly to the intron branch point. Although plant SF1 proteins possess an RNA recognition motif (RRM) domain that is absent in its fungal and metazoan counterparts, the role of the RRM domain in SF1 function has not been characterized. Here, we show that the RRM domain differentially affects the full function of the Arabidopsis thaliana AtSF1 protein under different experimental conditions. For example, the deletion of RRM domain influences AtSF1-mediated control of flowering time, but not the abscisic acid sensitivity response during seed germination. The alternative splicing of FLOWERING LOCUS M (FLM) pre-mRNA is involved in flowering time control. We found that the RRM domain of AtSF1 protein alters the production of alternatively spliced FLM-β transcripts. We also found that the RRM domain affects the alternative splicing of a heat shock transcription factor HsfA2 pre-mRNA, thereby mediating the heat stress response. Taken together, our results suggest the importance of RRM domain for AtSF1-mediated alternative splicing of a subset of genes involved in the regulation of flowering and adaptation to heat stress.

Growth of large detector crystals. CRADA final report

International Nuclear Information System (INIS)

Boatner, L.A.; Samuelson, S.

1997-01-01

In the course of a collaborative research effort between L.A. Boatner of Oak Ridge National Laboratory and Prof. Alex Lempicki of the Department of Chemistry of Boston University, a new highly efficient and very fast scintillator for the detection of gamma-rays was discovered. This new scintillator consists of a single crystal of lutetium orthophosphate (LuPO 4 ) to which a small percentage of trivalent cerium is added as an activator ion. The new lutetium orthophosphate-cerium scintillator was found to be superior in performance to bismuth germanium oxide--a material that is currently widely used as a gamma-ray detector in a variety of medical, scientific, and technical applications. Single crystals of LuPO 4 and related rare-earth orthophosphates had been grown for a number of years in the ORNL Solid State Division prior to the discovery of the efficient gamma-ray-scintillation response of LuPO 4 :Ce. The high-temperature-solvent (flux-growth) method used for the growth of these crystals was capable of producing crystals in sizes that were adequate for research purposes but that were inadequate for commercial-scale production and widespread application. The CRADA between ORNL and Deltronic Crystal Industries of Dover, NJ was undertaken for the purpose of investigating alternate approaches, such as top-seeded-solution growth, to the growth of LuPO 4 :Ce scintillator crystals in sizes significantly larger than those obtainable through the application of standard flux-growth methods and, therefore, suitable for commercial sales and applications

Final Project Report Project 10749-4.2.2.1 2007-2009

Energy Technology Data Exchange (ETDEWEB)

Zacher, Alan H.; Holladay, Johnathan E.; Frye, J. G.; Brown, Heather M.; Santosa, Daniel M.; Oberg, Aaron A.

2009-05-11

This is the final report for the DOE Project 10749-4.2.2.1 for the FY2007 - FY2009 period. This report is non-proprietary, and will be submitted to DOE as a final project report. The report covers activities under the DOE Project inside CRADA 269 (Project 53231) as well as project activites outside of that CRADA (Project 56662). This is the final report that is summarized from the non-proprietary quarterlies submitted to DOE over the past 2.5 years, which in turn are summaries from the proprietary technical reporting to UOP.

Cell cycle dependent RRM2 may serve as proliferation marker and pharmaceutical target in adrenocortical cancer.

Science.gov (United States)

Grolmusz, Vince Kornél; Karászi, Katalin; Micsik, Tamás; Tóth, Eszter Angéla; Mészáros, Katalin; Karvaly, Gellért; Barna, Gábor; Szabó, Péter Márton; Baghy, Kornélia; Matkó, János; Kovalszky, Ilona; Tóth, Miklós; Rácz, Károly; Igaz, Péter; Patócs, Attila

2016-01-01

Adrenocortical cancer (ACC) is a rare, but agressive malignancy with poor prognosis. Histopathological diagnosis is challenging and pharmacological options for treatment are limited. By the comparative reanalysis of the transcriptional malignancy signature with the cell cycle dependent transcriptional program of ACC, we aimed to identify novel biomarkers which may be used in the histopathological diagnosis and for the prediction of therapeutical response of ACC. Comparative reanalysis of publicly available microarray datasets included three earlier studies comparing transcriptional differences between ACC and benign adrenocortical adenoma (ACA) and one study presenting the cell cycle dependent gene expressional program of human ACC cell line NCI-H295R. Immunohistochemical analysis was performed on ACC samples. In vitro effects of antineoplastic drugs including gemcitabine, mitotane and 9-cis-retinoic acid alone and in combination were tested in the NCI-H295R adrenocortical cell line. Upon the comparative reanalysis, ribonucleotide reductase subunit 2 (RRM2), responsible for the ribonucleotide dezoxyribonucleotide conversion during the S phase of the cell cycle has been validated as cell cycle dependently expressed. Moreover, its expression was associated with the malignancy signature, as well. Immunohistochemical analysis of RRM2 revealed a strong correlation with Ki67 index in ACC. Among the antiproliferative effects of the investigated compounds, gemcitabine showed a strong inhibition of proliferation and an increase of apoptotic events. Additionally, RRM2 has been upregulated upon gemcitabine treatment. Upon our results, RRM2 might be used as a proliferation marker in ACC. RRM2 upregulation upon gemcitabine treatment might contribute to an emerging chemoresistance against gemcitabine, which is in line with its limited therapeutical efficacy in ACC, and which should be overcome for successful clinical applications.

Low Voltage Electron Beam Processing Final Report CRADA No. TC-645-93-A

Energy Technology Data Exchange (ETDEWEB)

Chen, H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wakalopulos, G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-16

This CRADA project was established to develop a small, inexpensive sealed-tube electron beam processing system having immediate applications in industrial, high speed manufacturing processes, and in the Department of Energy (DOE) waste treatment/cleanup operations. The technical work involved the development and demonstration of a compact, sealed, 50-75 kilovolt (kV) EB generator prototype, including controls and power supply. The specific goals of this project were to develop a low cost vacuum tube capable of shooting an electron beam several inches into the air, and to demonstrate that wide area materials processing is feasible by stacking the tubes to produce continuous beams. During the project, we successfully demonstrated the producibility of a low cost electron beam system and several material processing operations of interest to US industry, DOE and, since September 11, 2001, the Homeland Security.

The prognostic value of ERCC1 and RRM1 gene expression in completely resected non-small cell lung cancer: tumor recurrence and overall survival

International Nuclear Information System (INIS)

Tantraworasin, Apichat; Saeteng, Somcharoen; Lertprasertsuke, Nirush; Arayawudhikul, Nuttapon; Kasemsarn, Choosak; Patumanond, Jayanton

2013-01-01

The roles of excision repair cross-complementing group 1 gene (ERCC1) expression and ribonucleotide reductase subunit M1 gene (RRM1) expression in completely resected non-small cell lung cancer (NSCLC) are still debatable. Previous studies have shown that both genes affected the overall survival and outcomes of patients who received platinum-based chemotherapy; however, some studies did not show this correlation. The aim of this study was to evaluate the prognostic values of ERCC1 and RRM1 gene expression in predicting tumor recurrence and overall survival in patients with completely resected NSCLC who received adjuvant chemotherapy and in those who did not. A retrospective cohort study was conducted in 247 patients with completely resected NSCLC. All patients had been treated with anatomic resection (lobectomy or pneumonectomy) with systematic mediastinal lymphadenectomy between January 2002 and December 2011 at Chiang Mai University Hospital, Chiang Mai, Thailand. They were divided into two groups: recurrence and no recurrence. Protein expression of ERCC1 and RRM1 was determined by immunohistochemistry. Correlations between clinicopathologic variables, including ERCC1 and RRM1 expression and tumor recurrence, were analyzed. Univariate and multivariate Cox proportional hazards regression analysis stratified by nodal involvement, tumor staging, intratumoral blood vessel invasion, intratumoral lymphatic invasion, and tumor necrosis was used to identify the prognostic roles of ERCC1 and RRM1. ERCC1 and RRM1 expression did not demonstrate prognostic value for tumor recurrence and overall survival in patients with completely resected NSCLC. In patients who did not receive adjuvant chemotherapy treatment, those with high ERCC1 and high RRM1 expression seemed to have greater potential for tumor recurrence and shorter overall survival than did those who had low ERCC1 and low RRM1 (hazard ratio [HR] =1.7, 95% confidence interval [CI] =0.6–4.3, P=0.292 and HR =1.6, 95% CI

Commercialization of Ultra-Hard Ceramics for Cutting Tools Final Report CRADA No. TC0279.0

Energy Technology Data Exchange (ETDEWEB)

Landingham, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Neumann, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-15

This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and Greenleaf Corporation (Greenleaf) to develop the technology for forming unique precursor nano-powders process that can be consolidated into ceramic products for industry. LLNL researchers have developed a solgel process for forming nano-ceramic powders. The nano powders are highly tailorable, allowing the explicit design of desired properties that lead to ultra hard materials with fine grain size. The present CRADA would allow the two parties to continue the development of the sol-gel process and the consolidation process in order to develop an industrially sound process for the manufacture of these ultra-hard materials.

Development of improved x-ray optics for analytical x-ray microbeams. CRADA final report for CRADA Number Y-1294-0283

International Nuclear Information System (INIS)

Carpenter, D.A.; Gao, N.; Xiao, Q.F.; Ponomarev, I.

1996-01-01

The purpose of this CRADA was to develop improved glass capillary, x-ray optics for analytical x-ray microbeam applications. X-Ray Optical Systems, Inc. (XOS) designed and fabricated capillary optics and LMES tested those optics for x-ray microanalytical applications using its unique X-Ray Microprobe. Tapered capillaries with 3-microm and 8-microm output openings were fabricated and tested. The tapered capillaries had better spectral quality for x-ray microfluorescence (XRMF) analysis, than non-tapered, straight capillaries that are currently used in the system. X-ray beam count-rates for the tapered capillaries were also greater than the straight capillaries. Two monolithic, polycapillary optics were fabricated and tested. The polycapillary optics produced focal spots of 40 and 100 microm. Beam intensities for the polycapillaries were, respective, 44 and 18 times the intensities found in straight 50-microm and 100-microm capillaries. High-sensitivity scanning will be possible because of the enhanced intensity of the polycapillary optic. LMES and the DP program will benefit from improved capabilities for nondestructive x-ray microanalysis, while XOS will benefit from test results that will enhance the marketability of their products

CRADA Payment Options | NCI Technology Transfer Center | TTC

Science.gov (United States)

NCI TTC CRADA PAYMENT OPTIONS: Electronic Payments by Wire Transfer via Fedwire, Mail a check to the Institute or Center, or Automated Clearing House (ACH)/Electronic Funds Transfer (ETF) payments via Pay.gov (NCI ONLY).

CRADA Final Report for CRADA No. ORNL99-0544, Interfacial Properties of Electron Beam Cured Composites

Energy Technology Data Exchange (ETDEWEB)

Janke, C.J.

2005-10-17

Electron beam (EB) curing is a technology that promises, in certain applications, to deliver lower cost and higher performance polymer matrix composite (PMC) structures compared to conventional thermal curing processes. PMCs enhance performance by making products lighter, stronger, more durable, and less energy demanding. They are essential in weight- and performance-dominated applications. Affordable PMCs can enhance US economic prosperity and national security. US industry expects rapid implementation of electron beam cured composites in aircraft and aerospace applications as satisfactory properties are demonstrated, and implementation in lower performance applications will likely follow thereafter. In fact, at this time and partly because of discoveries made in this project, field demonstrations are underway that may result in the first fielded applications of electron beam cured composites. Serious obstacles preventing the widespread use of electron beam cured PMCs in many applications are their relatively poor interfacial properties and resin toughness. The composite shear strength and resin toughness of electron beam cured carbon fiber reinforced epoxy composites were about 25% and 50% lower, respectively, than those of thermally cured composites of similar formulations. The essential purpose of this project was to improve the mechanical properties of electron beam cured, carbon fiber reinforced epoxy composites, with a specific focus on composite shear properties for high performance aerospace applications. Many partners, sponsors, and subcontractors participated in this project. There were four government sponsors from three federal agencies, with the US Department of Energy (DOE) being the principal sponsor. The project was executed by Oak Ridge National Laboratory (ORNL), NASA and Department of Defense (DOD) participants, eleven private CRADA partners, and two subcontractors. A list of key project contacts is provided in Appendix A. In order to properly

Multifunctional G-rich and RRM-containing domains of TbRGG2 perform separate yet essential functions in trypanosome RNA editing.

Science.gov (United States)

Foda, Bardees M; Downey, Kurtis M; Fisk, John C; Read, Laurie K

2012-09-01

Efficient editing of Trypanosoma brucei mitochondrial RNAs involves the actions of multiple accessory factors. T. brucei RGG2 (TbRGG2) is an essential protein crucial for initiation and 3'-to-5' progression of editing. TbRGG2 comprises an N-terminal G-rich region containing GWG and RG repeats and a C-terminal RNA recognition motif (RRM)-containing domain. Here, we perform in vitro and in vivo separation-of-function studies to interrogate the mechanism of TbRGG2 action in RNA editing. TbRGG2 preferentially binds preedited mRNA in vitro with high affinity attributable to its G-rich region. RNA-annealing and -melting activities are separable, carried out primarily by the G-rich and RRM domains, respectively. In vivo, the G-rich domain partially complements TbRGG2 knockdown, but the RRM domain is also required. Notably, TbRGG2's RNA-melting activity is dispensable for RNA editing in vivo. Interactions between TbRGG2 and MRB1 complex proteins are mediated by both G-rich and RRM-containing domains, depending on the binding partner. Overall, our results are consistent with a model in which the high-affinity RNA binding and RNA-annealing activities of the G-rich domain are essential for RNA editing in vivo. The RRM domain may have key functions involving interactions with the MRB1 complex and/or regulation of the activities of the G-rich domain.

A Novel Rrm3 Function in Restricting DNA Replication via an Orc5-Binding Domain Is Genetically Separable from Rrm3 Function as an ATPase/Helicase in Facilitating Fork Progression

DEFF Research Database (Denmark)

Syed, Salahuddin; Madsen, Claus Desler; Rasmussen, Lene J.

2016-01-01

hydroxyurea. This novel Rrm3 function is independent of its established role as an ATPase/helicase in facilitating replication fork progression through polymerase blocking obstacles. Using quantitative mass spectrometry and genetic analyses, we find that the homologous recombination factor Rdh54 and Rad5...

An evaluation of optical tool inspection and compensation technologies. CRADA final report for CRADA Number Y-1291-0052

Energy Technology Data Exchange (ETDEWEB)

Babelay, E.F. [Lockheed Martin Energy Systems, Inc., Oak Ridge, TN (United States); Centola, J.; Zorger, W.; Serafin, W. [United Technologies, East Hartford, CT (United States). Pratt and Whitney Div.

1994-05-15

A Cooperative Research And Development Agreement (CRADA) was established April 1992 between Martin Marietta Energy Systems, Inc. and United Technologies Corporation, Pratt and Whitney Division to evaluate the existing applicability of the Energy Systems optical tool inspection and compensation system (OTICS) for use at Pratt and Whitney`s East Hartford Plant. The OTICS was developed at the Oak Ridge Y-12 Plant and optically measures the shape of a single point cutting tool. The tool shape inspection provides process information relating to tool wear and if desired the tool shape geometry can be used to generate a new numerical control machining program that is compensated for the tool forms errors. The tool wear measurement capability of OTICS was successfully evaluated in the Phase-1 testing. The testing verified that OTICS can easily detect tool wear and the {+-} 0.0001 inch resolution obtained was sufficient for the larger cutter inserts used by Pratt and Whitney (P and W). During the tool wear experiments at P and W, a second potential use identified for OTICS was the accurate on-machine dimensional verification of special ground contour forming tools. The OTICS tool path compensation experiment demonstrated the varied technologies that are integrated in the tool path compensation process. The OTICS system was successful at inspecting the 0.125 in. radius tool and compensating the tool path for tool form errors. The need for automated interfaces between the OTICS computer and controller along with the part program requirements and the overall compensation methodology were highlighted in the demonstration.

High RRM1 Expression Is Associated with Adverse Outcome in Patients with Cisplatin/Vinorelbine-treated Malignant Pleural Mesothelioma

DEFF Research Database (Denmark)

Zimling, Zarah Glad; Santoni-Rugiu, Eric; Bech, Cecilia

2015-01-01

BACKGROUND/AIM: A possible predictive impact of ribonucleotide-reductase subunit-1 (RRM1) on vinorelbine efficacy in non-small cell lung cancer (NSCLC) has been previously reported. The present study aimed to further explore this finding in malignant pleural mesothelioma (MPM). MATERIALS AND METH......BACKGROUND/AIM: A possible predictive impact of ribonucleotide-reductase subunit-1 (RRM1) on vinorelbine efficacy in non-small cell lung cancer (NSCLC) has been previously reported. The present study aimed to further explore this finding in malignant pleural mesothelioma (MPM). MATERIALS...

Development of Operational Free-Space-Optical (FSO) Laser Communication Systems Final Report CRADA No. TC02093.0

Energy Technology Data Exchange (ETDEWEB)

Ruggiero, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Orgren, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-15

This project was a collaborative effort between Lawrence Livermore National Security, LLC (formerly The Regents of the University of California)/Lawrence Livermore National Laboratory (LLNL) and LGS Innovations, LLC (formerly Lucent Technologies, Inc.), to develop long-range and mobile operational free-space optical (FSO) laser communication systems for specialized government applications. LLNL and LGS Innovations formerly Lucent Bell Laboratories Government Communications Systems performed this work for a United States Government (USG) Intelligence Work for Others (I-WFO) customer, also referred to as "Government Customer", or "Customer" and "Government Sponsor." The CRADA was a critical and required part of the LLNL technology transfer plan for the customer.

Development of HANAA to Achieve Commercialization Final Report CRADA No. TC-2025-01

Energy Technology Data Exchange (ETDEWEB)

Koopman, R. P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Schmidt, J. C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-16

The objective of this project was to provide DOD and the intelligence agencies with highly portable, advanced, bio-detection instruments and to further the DOE objective of putting advanced instrumentation for the detection of biological terrorism agents into the hands of first responders. All sponsors of the HANAA development work at LLNL believed that the technology must be commercialized to fully contribute to their missions. Intelligence organizations, military teams, and first responders must be able to purchase the instruments for a reasonable price and obtain maintenance services and support equipment from a reliable supplier in order for the instrument to be useful to them. The goal was to efficiently transfer HANAA technology from LLNL to ETG, a company that would manufacture the instrument and make it commercially available to the constituencies important to our sponsors. This was to include a current beta test instrument and all knowledge of problems with the instrument and recommendations for solving those problems in a commercial version. The following tasks were to be completed under this CRADA.

Atrial Model Development and Prototype Simulations: CRADA Final Report on Tasks 3 and 4

Energy Technology Data Exchange (ETDEWEB)

O' Hara, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Zhang, X. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Villongco, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Lightstone, F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Richards, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2016-10-28

The goal of this CRADA was to develop essential tools needed to simulate human atrial electrophysiology in 3-dimensions using an anatomical image-based anatomy and physiologically detailed human cellular model. The atria were modeled as anisotropic, representing the preferentially longitudinal electrical coupling between myocytes. Across the entire anatomy, cellular electrophysiology was heterogeneous, with left and right atrial myocytes defined differently. Left and right cell types for the “control” case of sinus rhythm (SR) was compared with remodeled electrophysiology and calcium cycling characteristics of chronic atrial fibrillation (cAF). The effects of Isoproterenol (ISO), a beta-adrenergic agonist that represents the functional consequences of PKA phosphorylation of various ion channels and transporters, was also simulated in SR and cAF to represent atrial activity under physical or emotional stress. Results and findings from Tasks 3 & 4 are described. Tasks 3 and 4 are, respectively: Input parameters prepared for a Cardioid simulation; Report including recommendations for additional scenario development and post-processing analytic strategy.

Non-canonical binding interactions of the RNA recognition motif (RRM) domains of P34 protein modulate binding within the 5S ribonucleoprotein particle (5S RNP).

Science.gov (United States)

Kamina, Anyango D; Williams, Noreen

2017-01-01

RNA binding proteins are involved in many aspects of RNA metabolism. In Trypanosoma brucei, our laboratory has identified two trypanosome-specific RNA binding proteins P34 and P37 that are involved in the maturation of the 60S subunit during ribosome biogenesis. These proteins are part of the T. brucei 5S ribonucleoprotein particle (5S RNP) and P34 binds to 5S ribosomal RNA (rRNA) and ribosomal protein L5 through its N-terminus and its RNA recognition motif (RRM) domains. We generated truncated P34 proteins to determine these domains' interactions with 5S rRNA and L5. Our analyses demonstrate that RRM1 of P34 mediates the majority of binding with 5S rRNA and the N-terminus together with RRM1 contribute the most to binding with L5. We determined that the consensus ribonucleoprotein (RNP) 1 and 2 sequences, characteristic of canonical RRM domains, are not fully conserved in the RRM domains of P34. However, the aromatic amino acids previously described to mediate base stacking interactions with their RNA target are conserved in both of the RRM domains of P34. Surprisingly, mutation of these aromatic residues did not disrupt but instead enhanced 5S rRNA binding. However, we identified four arginine residues located in RRM1 of P34 that strongly impact L5 binding. These mutational analyses of P34 suggest that the binding site for 5S rRNA and L5 are near each other and specific residues within P34 regulate the formation of the 5S RNP. These studies show the unique way that the domains of P34 mediate binding with the T. brucei 5S RNP.

High Temperature Catalytic Combustion Suppports Final Report CRADA No. TSB-0841-94

Energy Technology Data Exchange (ETDEWEB)

Hair, Lucy [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Magno, Scott [Catalytic Combustion Systems, Inc., Mountain View, CA (United States)

2018-01-19

This Small Business CRADA between LLNL and Catalytica was executed on January 25, 1995. The total estimated cost of this project was 113K. LLNL's contribution was estimated at $50K funded under the DOE/Defense Program Small Business Initiative. Catalytica's in-kind contribution was estimated at 63K. Catalytic combusion catalyst systems operate at temperatures from 600°C to above 1300°C. Catalytica has developed technology that limits the catalyst temperature to below 1000°C. At temperatures in the range of 850 to 1000°C, the thermal stability of the catalyst is an important issue. Typical supports such as stabilized aluminas, hexaluminates, zirconia and stabilized zirconia supports are typically used but lack either thermal stability or other desirable properties. Catalytica had developed a new concept for thermally stable mixed oxide supports but this concept required the preparation of molecularly uniform precursors; that is, prior to high temperature treatment of these materials, the elements that make up the mixed oxide must be as nearly uniform as possible on a molecular level. The technique of sol gel processing appeared to be the preferred technique to make these molecularly uniform precursors, and a cooperative program with LLNL was established to prepare and test the proposed compounds. Catalytica proposed the composition and concentration levels for the materials to be prepared.

Predictive Model and Methodology for Heat Treatment Distortion Final Report CRADA No. TC-298-92

Energy Technology Data Exchange (ETDEWEB)

Nikkel, D. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McCabe, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-16

This project was a multi-lab, multi-partner CRADA involving LLNL, Los Alamos National Laboratory, Sandia National Laboratories, Oak Ridge National Laboratory, Martin Marietta Energy Systems and the industrial partner, The National Center of Manufacturing Sciences (NCMS). A number of member companies of NCMS participated including General Motors Corporation, Ford Motor Company, The Torrington Company, Gear Research, the Illinois Institute of Technology Research Institute, and Deformation Control Technology •. LLNL was the lead laboratory for metrology technology used for validation of the computational tool/methodology. LLNL was also the lead laboratory for the development of the software user interface , for the computational tool. This report focuses on the participation of LLNL and NCMS. The purpose of the project was to develop a computational tool/methodology that engineers would use to predict the effects of heat treatment on the _size and shape of industrial parts made of quench hardenable alloys. Initially, the target application of the tool was gears for automotive power trains.

Assessment of Veritainer's Spreader-Bar-Mounted Radiation Detection Systems Final Report CRADA No. TC02150.0

Energy Technology Data Exchange (ETDEWEB)

Labov, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Alioto, J. I. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2012-05-29

This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and VeriTainer Corporation, to develop algorithms and testing of VeriTainer’s spreader-bar mounted radiation detection system, the VeriSpreader™. The goal of the project was to improve the VeriSpreader™ System to the point where it would meet or exceed "DOE Guidance" for radiation detection, in order to be deployed for commercial and government applications. The VeriSpreader™ had gone through several rounds of testing by DHS and DOE. NNSA had requested that VeriTainer engage in a CRADA with a national lab in order to further develop and test the VeriSpreader™ System.

Laboratory Testing of the Boundary Layer Momentum Transfer Rotational Filter Systems, NETL-Innovatech, Inc., CRADA 98-F026, Final Report; FINAL

International Nuclear Information System (INIS)

National Energy Technology Laboratory

2000-01-01

A patented dynamic mechanical filter developed by InnovaTech was previously shown to remove fine particulate matter from industrial process gas streams at ambient temperatures and pressures. An all-metal, high-temperature version of this novel media-less filter was fabricated under this Cooperative Research and Development Agreement (CRADA) with DOE/NETL-Morgantown for hot gas testing of the device. The technology is entirely different in both concept and design from conventional vortex separators, cyclones, or porous media filters. This new filtration concept is capable of separating heavy loading of fine particles without blinding, fouling or bridging, and would require minimal operational costs over its anticipated multi-year service life. The all-metal filter design eliminates thermal stress cracking and premature failure prevalent in conventional porous ceramic filters. In contrast, conventional porous media filters (i.e., ceramic cross-flow or candles) easily foul, require periodic cleaning (typically backpulsing), frequent replacement and subsequent disposal

Conversion of Indigenous Agricultural Waste Feedstocks to Fuel Ethanol. Cooperative Research and Development Final Report, CRADA Number CRD-13-504

Energy Technology Data Exchange (ETDEWEB)

Elander, Richard [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2016-03-27

This Cooperative Research and Development Agreement (CRADA) is between the National Renewable Energy Laboratory (NREL), a world leader in biomass conversion research and Ecopetrol American Inc., Ecopetrol S.A.'s U.S. subsidiary. The research and development efforts described in the Joint Work Statement (JWS) will take advantage of the strengths of both parties. NREL will use its Integrated Biorefinery Facility and vast experience in the conversion of lignocellulosic feedstocks to fuel ethanol to develop processes for the conversion of Ecopetrol's feedstocks. Ecopetrol will establish the infrastructure in Columbia to commercialize the conversion process.

Molecular insights into the specific recognition between the RNA binding domain qRRM2 of hnRNP F and G-tract RNA: A molecular dynamics study.

Science.gov (United States)

Wang, Lingyun; Yan, Feng

2017-12-09

Heterogeneous nuclear ribonucleoprotein F (hnRNP F) controls the expression of various genes through regulating the alternative splicing of pre-mRNAs in the nucleus. It uses three quasi-RNA recognition motifs (qRRMs) to recognize G-tract RNA which contains at least three consecutive guanines. The structures containing qRRMs of hnRNP F in complex with G-tract RNA have been determined by nuclear magnetic resonance (NMR) spectroscopy, shedding light on the recognition mechanism of qRRMs with G-tract RNA. However, knowledge of the recognition details is still lacking. To investigate how qRRMs specifically bind with G-tract RNA and how the mutations of any guanine to an adenine in the G-tract affect the binding, molecular dynamics simulations with binding free energy analysis were performed based on the NMR structure of qRRM2 in complex with G-tract RNA. Simulation results demonstrate that qRRM2 binds strongly with G-tract RNA, but any mutation of the G-tract leads to a drastic reduction of the binding free energy. Further comparisons of the energetic components reveal that van der Waals and non-polar interactions play essential roles in the binding between qRRM2 and G-tract RNA, but the interactions are weakened by the effect of RNA mutations. Structural and dynamical analyses indicate that when qRRM2 binds with G-tract RNA, both qRRM2 and G-tract maintain stabilized structures and dynamics; however, the stability is disrupted by the mutations of the G-tract. These results provide novel insights into the recognition mechanism of qRRM2 with G-tract RNA that are not elucidated by the NMR technique. Copyright © 2017 Elsevier Inc. All rights reserved.

Structure of the second RRM domain of Nrd1, a fission yeast MAPK target RNA binding protein, and implication for its RNA recognition and regulation

Energy Technology Data Exchange (ETDEWEB)

Kobayashi, Ayaho; Kanaba, Teppei [Graduate School of Science and Engineering, Tokyo Metropolitan University, Minamiosawa 1-1, Hachioji 192-0397 (Japan); Satoh, Ryosuke [Institute of Microbial Chemistry, 3-14-23 Kamiosaki, Shinagawa-ku 141-0021, Tokyo (Japan); Fujiwara, Toshinobu [Institute of Microbial Chemistry, 3-14-23 Kamiosaki, Shinagawa-ku 141-0021, Tokyo (Japan); Graduate School of Pharmaceutical Sciences, Nagoya City University, 3-1 Tanabe-dori, Mizuho-ku,Nagoya 467-8603 (Japan); Ito, Yutaka [Graduate School of Science and Engineering, Tokyo Metropolitan University, Minamiosawa 1-1, Hachioji 192-0397 (Japan); Sugiura, Reiko [Laboratory of Molecular Pharmacogenomics, School of Pharmaceutical Sciences, Kinki University, 3-4-1 Kowakae, Higashi-Osaka 577-8502 (Japan); Mishima, Masaki, E-mail: mishima-masaki@tmu.ac.jp [Graduate School of Science and Engineering, Tokyo Metropolitan University, Minamiosawa 1-1, Hachioji 192-0397 (Japan)

2013-07-19

Highlights: •Solution structure of the second RRM of Nrd1 was determined. •RNA binding site of the second RRM was estimated. •Regulatory mechanism of RNA binding by phosphorylation is discussed. -- Abstract: Negative regulator of differentiation 1 (Nrd1) is known as a negative regulator of sexual differentiation in fission yeast. Recently, it has been revealed that Nrd1 also regulates cytokinesis, in which physical separation of the cell is achieved by a contractile ring comprising many proteins including actin and myosin. Cdc4, a myosin II light chain, is known to be required for cytokinesis. Nrd1 binds and stabilizes Cdc4 mRNA, and thereby suppressing the cytokinesis defects of the cdc4 mutants. Interestingly, Pmk1 MAPK phosphorylates Nrd1, resulting in markedly reduced RNA binding activity. Furthermore, Nrd1 localizes to stress granules in response to various stresses, and Pmk1 phosphorylation enhances the localization. Nrd1 consists of four RRM domains, although the mechanism by which Pmk1 regulates the RNA binding activity of Nrd1 is unknown. In an effort to delineate the relationship between Nrd1 structure and function, we prepared each RNA binding domain of Nrd1 and examined RNA binding to chemically synthesized oligo RNA using NMR. The structure of the second RRM domain of Nrd1 was determined and the RNA binding site on the second RRM domain was mapped by NMR. A plausible mechanism pertaining to the regulation of RNA binding activity by phosphorylation is also discussed.

Structure of the second RRM domain of Nrd1, a fission yeast MAPK target RNA binding protein, and implication for its RNA recognition and regulation

International Nuclear Information System (INIS)

Kobayashi, Ayaho; Kanaba, Teppei; Satoh, Ryosuke; Fujiwara, Toshinobu; Ito, Yutaka; Sugiura, Reiko; Mishima, Masaki

2013-01-01

Highlights: •Solution structure of the second RRM of Nrd1 was determined. •RNA binding site of the second RRM was estimated. •Regulatory mechanism of RNA binding by phosphorylation is discussed. -- Abstract: Negative regulator of differentiation 1 (Nrd1) is known as a negative regulator of sexual differentiation in fission yeast. Recently, it has been revealed that Nrd1 also regulates cytokinesis, in which physical separation of the cell is achieved by a contractile ring comprising many proteins including actin and myosin. Cdc4, a myosin II light chain, is known to be required for cytokinesis. Nrd1 binds and stabilizes Cdc4 mRNA, and thereby suppressing the cytokinesis defects of the cdc4 mutants. Interestingly, Pmk1 MAPK phosphorylates Nrd1, resulting in markedly reduced RNA binding activity. Furthermore, Nrd1 localizes to stress granules in response to various stresses, and Pmk1 phosphorylation enhances the localization. Nrd1 consists of four RRM domains, although the mechanism by which Pmk1 regulates the RNA binding activity of Nrd1 is unknown. In an effort to delineate the relationship between Nrd1 structure and function, we prepared each RNA binding domain of Nrd1 and examined RNA binding to chemically synthesized oligo RNA using NMR. The structure of the second RRM domain of Nrd1 was determined and the RNA binding site on the second RRM domain was mapped by NMR. A plausible mechanism pertaining to the regulation of RNA binding activity by phosphorylation is also discussed

Development of a Delivery System for Treating Cerebrovascular Aneurysms Final Report CRADA No. TC-1440-97

Energy Technology Data Exchange (ETDEWEB)

Lee, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Derbin, J. T. [Micrus Corp., Mountain View, CA (United States)

2018-01-24

The objective of the project was to develop a system for delivering an implantable medical device used to treat cerebrovascular aneurysms, which can cause disability or hemorrhagic stroke (over 15,000 strokes in the U.S. each year are caused by ruptured aneurysms). Micrus has developed an implantable device with the potential to significantly improve the treatment of cerebrovascular aneurysms. This implantable device should significantly reduce the number of hemorrhagic strokes. LLNL has performed proof-of-concept experiments for a delivery system that could be modified to deploy the Micrus device into aneurysms. The purpose of this CRADA was to complete development of the LLNL delivery system and to integrate it with the Micrus device. The goal of the project was to develop an integrated minimally-invasive medical device for treating cerebrovascular aneurysms. The device was designed to access aneurysms through commercially-available catheters which are introduced into the patient through a small incision in the leg.

Exploring synchrotron radiation capabilities: The ALS-Intel CRADA

International Nuclear Information System (INIS)

Gozzo, F.; Cossy-Favre, A.; Padmore, H.

1997-01-01

Synchrotron radiation spectroscopy and spectromicroscopy were applied, at the Advanced Light Source, to the analysis of materials and problems of interest to the commercial semiconductor industry. The authors discuss some of the results obtained at the ALS using existing capabilities, in particular the small spot ultra-ESCA instrument on beamline 7.0 and the AMS (Applied Material Science) endstation on beamline 9.3.2. The continuing trend towards smaller feature size and increased performance for semiconductor components has driven the semiconductor industry to invest in the development of sophisticated and complex instrumentation for the characterization of microstructures. Among the crucial milestones established by the Semiconductor Industry Association are the needs for high quality, defect free and extremely clean silicon wafers, very thin gate oxides, lithographies near 0.1 micron and advanced material interconnect structures. The requirements of future generations cannot be met with current industrial technologies. The purpose of the ALS-Intel CRADA (Cooperative Research And Development Agreement) is to explore, compare and improve the utility of synchrotron-based techniques for practical analysis of substrates of interest to semiconductor chip manufacturing. The first phase of the CRADA project consisted in exploring existing ALS capabilities and techniques on some problems of interest. Some of the preliminary results obtained on Intel samples are discussed here

CENER/NREL Collaboration in Testing Facility and Code Development: Cooperative Research and Development Final Report, CRADA Number CRD-06-207

Energy Technology Data Exchange (ETDEWEB)

Moriarty, P.

2014-11-01

Under the funds-in CRADA agreement, NREL and CENER will collaborate in the areas of blade and drivetrain testing facility development and code development. The project shall include NREL assisting in the review and instruction necessary to assist in commissioning the new CENER blade test and drivetrain test facilities. In addition, training will be provided by allowing CENER testing staff to observe testing and operating procedures at the NREL blade test and drivetrain test facilities. CENER and NREL will exchange blade and drivetrain facility and equipment design and performance information. The project shall also include exchanging expertise in code development and data to validate numerous computational codes.

Position and Orientation Tracking System graphical user interface. CRADA final report

International Nuclear Information System (INIS)

Barry, R.E.; Armstrong, G.A.; Burks, B.L.

1997-01-01

Under the Department of Energy's Robotics Technology Development Program (RTDP) Tank Waste Retrieval (TWR) program, a major effort is under way to develop technology for remediating the waste in underground storage tanks that contain radioactive and hazardous waste. A large part of the program's effort has gone towards development of remotely operable robotics equipment, including the Houdini Vehicle and the Position and Orientation Tracking System (POTS). Since planned operation of this equipment is to be completely remote, a significant effort is needed to ensure that operators have sufficient system information to operate the equipment efficiently and safely. ORNL developed POTS and RedZone Robotics, Inc. developed Houdini which can be operated together to provide both position and orientation descriptions of the Houdini vehicle, relative to a world reference frame, while operating inside an underground storage tank. The Houdini vehicle has been outfitted with an optical detection system that houses infrared detectors. The infrared detectors are part of the POTS tracking system. The sensors provide a set of timing pulses to the POTS control computer whenever a laser beam from one of the four POTS laser scanners strikes a detector. Using the pointing angle information from each POTS laser scanners, the POTS control computer is able to compute the pose of the Houdini vehicle at a rate of approximately 25 Hz. This information, along with the orientation of the Houdini's Schilling Titan II robot arm, is used to present the pose information to the operator in a 3-D graphical user interface using software that has been developed by this Cooperative Research and Development Agreement (CRADA). The graphical display presents the data to the operator in a format that is readily understood. The equipment operators are able to use the information in real-time to enhance the operator's ability to safely and efficiently control the remotely-operated vehicle

Advanced BorobondTM Shields for Nuclear Materials Containment and BorobondTM Immobilization of Volatile Fission Products - Final CRADA Report

International Nuclear Information System (INIS)

Wagh, Arun S.

2016-01-01

Borobond is a company-proprietary material developed by the CRADA partner in collaboration with Argonne, and is based on Argonne's Ceramicrete technology. It is being used by DOE for nuclear materials safe storage, and Boron Products, LLC is the manufacturer and supplier of Borobond. The major objective of this project was to produce a more versatile composition of this material and find new applications. Major target applications were use for nuclear radiation shields, such as in dry storage casks; use in immobilization of most difficult waste streams, such as Hanford K-Basin waste; use for soluble and volatile fission products, such as Cs, Tc, Sr, and I; and use for corrosion and fire protection applications in nuclear facilities.

Evaluation of advanced gas chromatographs for on-site analysis. Final CRADA report for number Y-1295-0374

Energy Technology Data Exchange (ETDEWEB)

Wise, M.B.; Guerin, M.R.; Palausky, A.; Merriweather, R. [Lockheed Martin Energy Research, Oak Ridge, TN (United States); Forsberg, R.E. [Mine Safety Appliances-Baseline Industries, Lyons, CO (United States)

1997-02-21

The EKHO gas chromatography (GC) is being marketed by Mine Safety Appliances as an instrument for on-site environmental analysis and for process applications. This GC utilizes a unique bundled capillary column produced in Russia that provides very fast analysis and a wide linear dynamic range. Oak Ridge National Laboratory (ORNL) has been involved in a CRADA with Mine Safety Appliances in order to evaluate the analytical performance of the EKHO GC and is suitability for on-site environmental applications. Tests that were performed at ORNL included the analysis of air, water, and soil samples for aromatic hydrocarbons including benzene, toluene, xylene, and ethylbenzene (BTEX). These compounds were selected in order to simulate contamination by gasoline and other petroleum fuels. Performance factors that were studied included the instrument detection limits, the linearity, dynamic range, and precision for replicate samples. Other factors that were evaluated include the ease of set-up and operation.

National Security Science and Technology Initiative: Air Cargo Screening, Final Report for CRADA Number NFE-07-01081

Energy Technology Data Exchange (ETDEWEB)

Bingham, Philip [ORNL; Bush, John [Battelle Memorial Institute; Bowerman, Biays [Brookhaven National Laboratory; Cespedes, Ernesto [Idaho National Laboratory; White, Timothy [Pacific Northwest National Laboratory

2004-12-01

The non-intrusive inspection (NII) of consolidated air cargo carried on commercial passenger aircraft continues to be a technically challenging, high-priority requirement of the Department of Homeland Security’s Science and Technology Directorate (DHS S&T), the Transportation Security Agency and the Federal Aviation Administration. The goal of deploying a screening system that can reliably and cost-effectively detect explosive threats in consolidated cargo without adversely affecting the flow of commerce will require significant technical advances that will take years to develop. To address this critical National Security need, the Battelle Memorial Institute (Battelle), under a Cooperative Research and Development Agreement (CRADA) with four of its associated US Department of Energy (DOE) National Laboratories (Oak Ridge, Pacific Northwest, Idaho, and Brookhaven), conducted a research and development initiative focused on identifying, evaluating, and integrating technologies for screening consolidated air cargo for the presence of explosive threats. Battelle invested $8.5M of internal research and development funds during fiscal years 2007 through 2009.

Centralized Cryptographic Key Management and Critical Risk Assessment - CRADA Final Report For CRADA Number NFE-11-03562

Energy Technology Data Exchange (ETDEWEB)

Abercrombie, R. K. [ORNL; Peters, Scott [Sypris Electronics, LLC

2014-05-28

The Department of Energy Office of Electricity Delivery and Energy Reliability (DOE-OE) Cyber Security for Energy Delivery Systems (CSEDS) industry led program (DE-FOA-0000359) entitled "Innovation for Increasing Cyber Security for Energy Delivery Systems (12CSEDS)," awarded a contract to Sypris Electronics LLC to develop a Cryptographic Key Management System for the smart grid (Scalable Key Management Solutions for Critical Infrastructure Protection). Oak Ridge National Laboratory (ORNL) and Sypris Electronics, LLC as a result of that award entered into a CRADA (NFE-11-03562) between ORNL and Sypris Electronics, LLC. ORNL provided its Cyber Security Econometrics System (CSES) as a tool to be modified and used as a metric to address risks and vulnerabilities in the management of cryptographic keys within the Advanced Metering Infrastructure (AMI) domain of the electric sector. ORNL concentrated our analysis on the AMI domain of which the National Electric Sector Cyber security Organization Resource (NESCOR) Working Group 1 (WG1) has documented 29 failure scenarios. The computational infrastructure of this metric involves system stakeholders, security requirements, system components and security threats. To compute this metric, we estimated the stakes that each stakeholder associates with each security requirement, as well as stochastic matrices that represent the probability of a threat to cause a component failure and the probability of a component failure to cause a security requirement violation. We applied this model to estimate the security of the AMI, by leveraging the recently established National Institute of Standards and Technology Interagency Report (NISTIR) 7628 guidelines for smart grid security and the International Electrotechnical Commission (IEC) 63351, Part 9 to identify the life cycle for cryptographic key management, resulting in a vector that assigned to each stakeholder an estimate of their average loss in terms of dollars per day of system

78 FR 42532 - Cooperative Research and Development Agreement (CRADA) Opportunity With the Department of...

Science.gov (United States)

2013-07-16

... DEPARTMENT OF HOMELAND SECURITY Cooperative Research and Development Agreement (CRADA) Opportunity With the Department of Homeland Security for the Development of a Foot-and-Mouth Disease 3ABC ELISA Diagnostic Kit; Correction AGENCY: Science and Technology Directorate, Plum Island Animal Disease Center...

Development of a General-Purpose Analysis System Based on a Programmable Fluid Processor Final Report CRADA No. TC-2027-01

Energy Technology Data Exchange (ETDEWEB)

McConaghy, C. F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gascoyne, P. R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-28

The purpose ofthis project was to develop a general-purpose analysis system based on a programmable fluid processor (PFP). The PFP is an array of electrodes surrounded by fluid reservoirs and injectors. Injected droplets of various reagents are manjpulated and combined on the array by Dielectrophoretic (DEP) forces. The goal was to create a small handheld device that could accomplish the tasks currently undertaken by much larger, time consuming, manual manipulation in the lab. The entire effo1t was funded by DARPA under the Bio-Flips program. MD Anderson Cancer Center was the PI for the DARPA effort. The Bio-Flips program was a 3- year program that ran from September 2000 to September 2003. The CRADA was somewhat behind the Bi-Flips program running from June 2001 to June 2004 with a no cost extension to September 2004.

78 FR 71632 - Cooperative Research and Development Agreement (CRADA) Opportunity With the Department of...

Science.gov (United States)

2013-11-29

... processes leading to efficiencies while also saving money over time than employing single-use ISO bolts... automate processes leading to efficiencies and cost savings. Cross-border Commerce: Conveyance security... CRADA does not imply the future purchase of any materials, equipment, or services from the collaborating...

Performance improvement of silicon nitride ball bearings by ion implantation. CRADA final report

International Nuclear Information System (INIS)

Williams, J.M.; Miner, J.

1998-01-01

The present report summarizes technical results of CRADA No. ORNL 92-128 with the Pratt and Whitney Division of United Technologies Corporation. The stated purpose of the program was to assess the 3effect of ion implantation on the rolling contact performance of engineering silicon nitride bearings, to determine by post-test analyses of the bearings the reasons for improved or reduced performance and the mechanisms of failure, if applicable, and to relate the overall results to basic property changes including but not limited to swelling, hardness, modulus, micromechanical properties, and surface morphology. Forty-two control samples were tested to an intended runout period of 60 h. It was possible to supply only six balls for ion implantation, but an extended test period goal of 150 h was used. The balls were implanted with C-ions at 150 keV to a fluence of 1.1 x 10 17 /cm 2 . The collection of samples had pre-existing defects called C-cracks in the surfaces. As a result, seven of the control samples had severe spalls before reaching the goal of 60 h for an unacceptable failure rate of 0.003/sample-h. None of the ion-implanted samples experienced engineering failure in 150 h of testing. Analytical techniques have been used to characterize ion implantation results, to characterize wear tracks, and to characterize microstructure and impurity content. In possible relation to C-cracks. It is encouraging that ion implantation can mitigate the C-crack failure mode. However, the practical implications are compromised by the fact that bearings with C-cracks would, in no case, be acceptable in engineering practice, as this type of defect was not anticipated when the program was designed. The most important reason for the use of ceramic bearings is energy efficiency

Phase II CRADA ORNL99-0568 Report : Developing Transmission-Less Inverter Drive Systems for Axial-Gap Permanent magnet Accessory and Traction Motors and Generators; FINAL

International Nuclear Information System (INIS)

McKeever, J.W.

2001-01-01

Researchers of the Oak Ridge National Laboratory's (ORNLs) Power Electronics and Electric Machine Research Center (PEEMRC) collaborated with Visual Computing Systems (VCS) to develop an electric axial-gap permanent magnet (PM) motor controlled by a self-sensing inverter for driving vehicle accessories such as power steering, air conditioning, and brakes. VCS designed an 8 kW motor based on their Segmented Electromagnetic Array (SEMA) technology. ORNL designed a 10 kW inverter to fit within the volume of a housing, which had been integrated with the motor. This modular design was pursued so that multiple modules could be used for higher power applications. ORNL built the first inverter under the cooperative research and development agreement (CRADA) ORNL 98-0514 and drove a refurbished Delta motor with no load during the Merit Review at ORNL on Monday, May 17, 1999. Inverter circuitry and instructions for assembling the inverters were sent to VCS. A report was prepared and delivered during the Future Car Congress in April 2000, at Arlington, Virginia. Collaboration continued under CRADA ORNL 99-0568 as VCS designed and built a SEMA motor with a dual coil platter to be the traction motor for an electric truck. VCS and ORNL assembled two 45 kW inverters. Each inverter drove one coil, which was designed to deliver 15 kW continuous power and 45 kW peak power for 90 s. The vehicle was road tested as part of the Future Truck Competition. A report was prepared and delivered during the PCIM in October 2000, at Boston, Massachusetts

RRM domain of Arabidopsis splicing factor SF1 is important for pre-mRNA splicing of a specific set of genes

KAUST Repository

Lee, Keh Chien; Jang, Yun Hee; Kim, SoonKap; Park, Hyo-Young; Thu, May Phyo; Lee, Jeong Hwan; Kim, Jeong-Kook

2017-01-01

, but not the abscisic acid sensitivity response during seed germination. The alternative splicing of FLOWERING LOCUS M (FLM) pre-mRNA is involved in flowering time control. We found that the RRM domain of AtSF1 protein alters the production of alternatively spliced FLM

Laboratory Testing of the Boundary Layer Momentum Transfer Rotational Filter Systems, NETL-Innovatech, Inc., CRADA 98-F026, Final Report

Energy Technology Data Exchange (ETDEWEB)

National Energy Technology Laboratory

2000-08-22

A patented dynamic mechanical filter developed by InnovaTech was previously shown to remove fine particulate matter from industrial process gas streams at ambient temperatures and pressures. An all-metal, high-temperature version of this novel media-less filter was fabricated under this Cooperative Research and Development Agreement (CRADA) with DOE/NETL-Morgantown for hot gas testing of the device. The technology is entirely different in both concept and design from conventional vortex separators, cyclones, or porous media filters. This new filtration concept is capable of separating heavy loading of fine particles without blinding, fouling or bridging, and would require minimal operational costs over its anticipated multi-year service life. The all-metal filter design eliminates thermal stress cracking and premature failure prevalent in conventional porous ceramic filters. In contrast, conventional porous media filters (i.e., ceramic cross-flow or candles) easily foul, require periodic cleaning (typically backpulsing), frequent replacement and subsequent disposal.

High Specific Stiffness Shafts and Advanced Bearing Coatings for Gas Turbine Engines Final Report CRADA No. TC-1089-95

Energy Technology Data Exchange (ETDEWEB)

Barbee, Troy [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Chin, Herbert [United Technologies Corporation, East Hartford, CT (United States)

2017-11-09

At the time of the CRADA, the largest in-service gas-turbine aircraft engines strove for increased thrust and power density to meet the requirements for take-off thrust, given the increase in take-off gross weight (TOGW) associated with longer range transport requirements. The trend in modem turbo shaft engines was toward turbine shafts with higher and higher length-to-diameter ratios, which reduced the shaft critical speed. Using co nventional shaft materials, this lead to shafts that needed to operate near or above sensitive shaft bending critical speeds, therefore requiring multiple bearings and/ or multiple squeeze-film dampers to control the dynamic response. Using new materials and d esign concepts this project demonstrated the use of new shaft materials which could provide increased shaft speed range above existing maximum engine speeds without encountering a critic al speed event and high vector deflections. This increased main shaft speed also resulted in decreased bearing life associated with lower heat dissipation and higher centrifugal forces. Thus, a limited effort was devoted to feasibility of higher performance bearing coatings to mitigate the speed effects.

Particulate Emissions Control using Advanced Filter Systems: Final Report for Argonne National Laboratory, Corning Inc. and Hyundai Motor Company CRADA Project

Energy Technology Data Exchange (ETDEWEB)

Seong, Hee Je [Argonne National Lab. (ANL), Argonne, IL (United States); Choi, Seungmok [Argonne National Lab. (ANL), Argonne, IL (United States)

2015-10-09

This is a 3-way CRADA project working together with Corning, Inc. and Hyundai Motor Co. (HMC). The project is to understand particulate emissions from gasoline direct-injection engines (GDI) and their physico-chemical properties. In addition, this project focuses on providing fundamental information about filtration and regeneration mechanisms occurring in gasoline particulate filter (GPF) systems. For the work, Corning provides most advanced filter substrates for GPF applications and HMC provides three-way catalyst (TWC) coating services of these filter by way of a catalyst coating company. Then, Argonne National Laboratory characterizes fundamental behaviors of filtration and regeneration processes as well as evaluated TWC functionality for the coated filters. To examine aging impacts on TWC and GPF performance, the research team evaluates gaseous and particulate emissions as well as back-pressure increase with ash loading by using an engine-oil injection system to accelerate ash loading in TWC-coated GPFs.

78 FR 28866 - Cooperative Research and Development Agreement (CRADA) Opportunity With the Department of...

Science.gov (United States)

2013-05-16

... commercialization access to critical assay components such as the recombinant 3ABC* protein (* indicates that the 3C... and Mouth Disease virus (FMDV) non-structural proteins (NSP): 3A, 3B, or 3C. This new FMDV 3ABC ELISA... this CRADA will be to develop and validate the FMDV 3ABC ELISA assay in collaboration with DHS S&T and...

Rice MEL2, the RNA recognition motif (RRM) protein, binds in vitro to meiosis-expressed genes containing U-rich RNA consensus sequences in the 3'-UTR.

Science.gov (United States)

Miyazaki, Saori; Sato, Yutaka; Asano, Tomoya; Nagamura, Yoshiaki; Nonomura, Ken-Ichi

2015-10-01

Post-transcriptional gene regulation by RNA recognition motif (RRM) proteins through binding to cis-elements in the 3'-untranslated region (3'-UTR) is widely used in eukaryotes to complete various biological processes. Rice MEIOSIS ARRESTED AT LEPTOTENE2 (MEL2) is the RRM protein that functions in the transition to meiosis in proper timing. The MEL2 RRM preferentially associated with the U-rich RNA consensus, UUAGUU[U/A][U/G][A/U/G]U, dependently on sequences and proportionally to MEL2 protein amounts in vitro. The consensus sequences were located in the putative looped structures of the RNA ligand. A genome-wide survey revealed a tendency of MEL2-binding consensus appearing in 3'-UTR of rice genes. Of 249 genes that conserved the consensus in their 3'-UTR, 13 genes spatiotemporally co-expressed with MEL2 in meiotic flowers, and included several genes whose function was supposed in meiosis; such as Replication protein A and OsMADS3. The proteome analysis revealed that the amounts of small ubiquitin-related modifier-like protein and eukaryotic translation initiation factor3-like protein were dramatically altered in mel2 mutant anthers. Taken together with transcriptome and gene ontology results, we propose that the rice MEL2 is involved in the translational regulation of key meiotic genes on 3'-UTRs to achieve the faithful transition of germ cells to meiosis.

[The receptorial responsiveness method (RRM): a new possibility to estimate the concentration of pharmacologic agonists at their receptors].

Science.gov (United States)

Pák, Krisztián; Kiss, Zsuzsanna; Erdei, Tamás; Képes, Zita; Gesztelyi, Rudolf

2014-01-01

Cardiovascular disease is the biggest challenge in terms of life expectancy in developed countries. Adenosine contributes to the adaptation of the heart to ischemia and hypoxia, because adenosine, in addition to its metabolite role in the nucleic acid metabolism, is the endogenous agonist of the ubiquitous adenosine receptor family. Adenosine receptor activation is beneficial in most cases, it improves the balance between energy supply and consumption, reduces injury caused by stressors and inhibits the unfavorable tissue remodeling. Pharmacological manipulation of cardioprotective effects evoked by adenosine is an important, although to date not sufficiently utilized endeavor that may have therapeutic and preventive implications in cardiovascular diseases. As the ligand binding site of adenosine receptors is accessible from the extracellular space, it is especially important to know the adenosine concentration of the interstitial fluid ([Ado](ISF)). However, in the functioning heart, [Ado](ISF) values range in an extremely wide interval, spanning from nano- to micromolar concentrations, as estimated by the commonly used methods. Our recently developed procedure, the receptorial responsiveness method (RRM), may resolve this problem in certain cases. RRM enables quantification of an acute increase in the concentration of a pharmacological agonist, uniquely in the microenvironment of the receptors of the given agonist. As a limitation, concentration of agonists with short half-life (just like adenosine) at their receptors can only be quantified with the equieffective concentration of a stable agonist exerting the same action. In a previous study using RRM, inhibition of the transmembrane nucleoside transport in the euthyroid guinea pig atrium produced an increase in [Ado](ISF) that was equieffective with 18.8 +/- 3 nM CPA (N6-cyclopentyladenosine, a stable, selective A1 adenosine receptor agonist). This finding is consistent with observations of others, i.e., in the

Concepts for the Design of a Diagnostic Device to Detect Malignancies in Human Tissues Final Report CRADA No. TSB-2023-00

Energy Technology Data Exchange (ETDEWEB)

DaSilva, L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Marion, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Chase, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-19

BioLuminate, Inc. planned to develop, produce and market a revolutionary diagnostic device for early breast cancer diagnosis. The device was originally invented by NASA; and exclusively licensed to BioLuminate for commercialization. At the time of the CRADA, eighty-five percent (85%) of all biopsies in the United States were found negative each year. The number of biopsies cost the health care system $23 billio n annually. A multi-sensor probe would allow surgeons to improve breast cancer scre ening and significantly reduce the number of biopsies. BioLuminate was developing an in-vivo system for the detection of cancer using a multi-sensor needle/probe. The first system would be developed for the detection of breast cancer. LLNL, in collaboration with BioLuminate worked toward a detailed concept specification for the prototype multi-sensor needle/probe suitable for breast cancer analysis. BioLuminate in collaboration with LLNL, worked to develop a new version of the needle probe that would be the same size as needles commonly used to draw blood.

Reconciling Basin-Scale Top-Down and Bottom-Up Methane Emission Measurements for Onshore Oil and Gas Development: Cooperative Research and Development Final Report, CRADA Number CRD-14-572

Energy Technology Data Exchange (ETDEWEB)

Heath, Garvin A. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2017-12-04

The overall objective of the Research Partnership to Secure Energy for America (RPSEA)-funded research project is to develop independent estimates of methane emissions using top-down and bottom-up measurement approaches and then to compare the estimates, including consideration of uncertainty. Such approaches will be applied at two scales: basin and facility. At facility scale, multiple methods will be used to measure methane emissions of the whole facility (controlled dual tracer and single tracer releases, aircraft-based mass balance and Gaussian back-trajectory), which are considered top-down approaches. The bottom-up approach will sum emissions from identified point sources measured using appropriate source-level measurement techniques (e.g., high-flow meters). At basin scale, the top-down estimate will come from boundary layer airborne measurements upwind and downwind of the basin, using a regional mass balance model plus approaches to separate atmospheric methane emissions attributed to the oil and gas sector. The bottom-up estimate will result from statistical modeling (also known as scaling up) of measurements made at selected facilities, with gaps filled through measurements and other estimates based on other studies. The relative comparison of the bottom-up and top-down estimates made at both scales will help improve understanding of the accuracy of the tested measurement and modeling approaches. The subject of this CRADA is NREL's contribution to the overall project. This project resulted from winning a competitive solicitation no. RPSEA RFP2012UN001, proposal no. 12122-95, which is the basis for the overall project. This Joint Work Statement (JWS) details the contributions of NREL and Colorado School of Mines (CSM) in performance of the CRADA effort.

Agreement Execution Process Study: CRADAs and NF-WFO Agreements and the Speed of Business

Energy Technology Data Exchange (ETDEWEB)

Harrer, Bruce J.; Cejka, Cheryl L.; Macklin, Richard; Miksovic, Ann

2011-02-01

This report summarizes the findings of a study on the execution of Cooperative Research and Development Agreements (CRADAs) and Non-Federal Work for Others (NF-WFO) agreements across the U.S. Department of Energy (DOE) laboratory complex. The study provides quantitiative estimates of times required to negotiate and execute these agreements across the DOE complex. It identifies factors impacting on cycle times and describes best practicies used at various laboratories and site offices that reduce cycle times.

Advanced variable speed air source integrated heat pump (AS-IHP) development - CRADA final report

Energy Technology Data Exchange (ETDEWEB)

Baxter, Van D. [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States); Rice, C. Keith [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States); Munk, Jeffrey D. [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States); Ally, Moonis Raza [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States); Shen, Bo [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States)

2015-09-30

Between August 2011 and September 2015, Oak Ridge National Laboratory (ORNL) and Nordyne, LLC (now Nortek Global HVAC LLC, NGHVAC) engaged in a Cooperative Research and Development Agreement (CRADA) to develop an air-source integrated heat pump (AS-IHP) system for the US residential market. Two generations of laboratory prototype systems were designed, fabricated, and lab-tested during 2011-2013. Performance maps for the system were developed using the latest research version of the DOE/ORNL Heat Pump Design Model, or HPDM, (Rice 1991; Rice and Jackson 2005; Shen et al 2012) as calibrated against the lab test data. These maps were the input to the TRNSYS (SOLAR Energy Laboratory, et al, 2010) system to predict annual performance relative to a baseline suite of equipment meeting minimum efficiency standards in effect in 2006 (combination of 13 SEER air-source heat pump (ASHP) and resistance water heater with Energy Factor (EF) of 0.9). Predicted total annual energy savings, while providing space conditioning and water heating for a tight, well insulated 2600 ft2 (242 m2) house at 5 U.S. locations, ranged from 46 to 61%, averaging 52%, relative to the baseline system (lowest savings at the cold-climate Chicago location). Predicted energy use for water heating was reduced 62 to 76% relative to resistance WH. Based on these lab prototype test and analyses results a field test prototype was designed and fabricated by NGHVAC. The unit was installed in a 2400 ft2 (223 m2) research house in Knoxville, TN and field tested from May 2014 to April 2015. Based on the demonstrated field performance of the AS-IHP prototype and estimated performance of a baseline system operating under the same loads and weather conditions, it was estimated that the prototype would achieve ~40% energy savings relative to the minimum efficiency suite. The estimated WH savings were >60% and SC mode savings were >50%. But estimated SH savings were only about 20%. It is believed that had the test

Phase I ResonantSonic CRADA report

International Nuclear Information System (INIS)

Richterich, L.R.; Amos, L.O.; Fancher, J.D.; McLellan, G.W.; Setzer, W.V.; Tuttle, B.G.; Hockey, R.L.; Ferris, R.H.; Riechers, D.M.; Pitman, S.G.

1994-01-01

This test report describes the Phase 1 testing and results of the ResonantSonic drilling method. This effort was conducted as part of a Cooperative Research and Development Agreement (CRADA) between the US Department of Energy, Pacific Northwest Laboratory, Westinghouse Hanford Company and Water Development Corporation. The purpose of this demonstration was to evaluate the Water Development Corporation's ResonantSonic drilling system, modify components as necessary and determine compatible drilling applications for the ResonantSonic drilling method for use at facilities in the DOE complex and private industry. Initially, the ResonantSonic drill was used to drill several test holes at the Drilling Technology Test Site to assess the feasibility of drilling vertical and angle holes. After this initial phase, a 45 degree angle vapor extraction well was drilled to a depth of 168 feet at the 200 West Carbon Tetrachloride Site. This well was drilled and completed in nine days. Extensive geologic and vapor sampling were conducted while drilling this well. In addition, testing was also conducted at the test site to evaluated drilling with larger diameter casing (8 5/8 inch). Evaluation of the Resonant Sonic drilling method will be continued during the Phase 2 portion of testing to determine if improvements to the ResonantSonic system will make it a more viable method for drilling and sampling

Purification and characterization of a protease produced by Bacillus megaterium RRM2: application in detergent and dehairing industries.

Science.gov (United States)

Rajkumar, Renganathan; Jayappriyan, Kothilmozhian Ranishree; Rengasamy, Ramasamy

2011-12-01

An alkaline serine protease produced by Bacillus megaterium RRM2 isolated from the red alga, Kappaphycus alvarezii (Doty) Doty ex Silva was studied for the first time and the same analyzed for the production of protease in the present study. Identification of the bacterium was done on the basis of both biochemical analysis and by 16S rDNA sequence analysis. The extracellular protease obtained from B. megaterium RRM2 was purified by a three-step process involving ammonium sulphate precipitation, gel filtration (Sephadex G100) and Q-Sepharose column chromatography. The purity was found to be 30.6-fold with a specific activity of 3591.5 U/mg protein with a molecular weight of 27 kDa. The metal ions Ca(2+), Mg(2+), K(+) and Na(+) marginally enhanced the activity of the purified enzyme while Hg(2+), Cu(2+), Fe(2+), CO(2+) and Zn(2+), had reduced the activity. The enzyme was found to be active in the pH range of 9.0-10.0 and remained active up to 60 °C. Phenyl Methyl Sulfonyl Fluoride (PMSF) inhibited the enzyme activity, thus, confirming that this enzyme is an alkaline serine protease. Likewise, DTT also inhibited the enzyme thus confirming the disulfide nature of the enzyme. The enzyme exhibited a high degree of tolerance to Sodium Dodecyl Sulphate (SDS). The partially purified protease when used as an additive in the commercial detergents was found to be a suitable source for washing clothes especially those stained with blood. Further, it showed good dehairing activity within a short duration in goat skin without affecting its collagen component. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Plug and Play Solar Power: Simplifying the Integration of Solar Energy in Hybrid Applications; Cooperative Research and Development Final Report, CRADA Number CRD-13-523

Energy Technology Data Exchange (ETDEWEB)

Lundstrom, Blake R. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2017-07-05

The Commonwealth Scientific and Industrial Research Organisation (CSIRO) is Australia's national science agency. CSIRO received funding from the Australian Solar Institute (ASI) for the United States-Australia Solar Energy Collaboration (USASEC) project 1-USO032 Plug and Play Solar Power: Simplifying the Integration of Solar Energy in Hybrid Applications (Broader Project). The Australian Solar Institute (ASI) operated from August 2009 to December 2012 before being merged into the Australian Renewable Energy Agency (ARENA). The Broader Project sought to simplify the integration, accelerate the deployment, and lower the cost of solar energy in hybrid distributed generation applications by creating plug and play solar technology. CSIRO worked with the National Renewable Energy Laboratory (NREL) as set out in a Joint Work Statement to review communications protocols relevant to plug-and-play technology and perform prototype testing in its Energy System Integration Facility (ESIF). For the avoidance of doubt, this CRADA did not cover the whole of the Broader Project and only related to the work described in the Joint Work Statement, which was carried out by NREL.

Burrell, Pennsylvania, vicinty property Long-Term Surveillance Plan. Final report

International Nuclear Information System (INIS)

1993-09-01

The purpose of this document is to establish elements of the US Department of Energy (DOE) Long-Term Surveillance Plan (LTSP) for the Burrell, Pennsylvania, vicinity property. The US Nuclear Regulatory Commission (NRC) will use this plan to support the issuance of a license for the long-term surveillance and maintenance of the Burrell vicinity property. The DOE and the NRC previously reached agreement regarding the issuance of a license for the Burrell vicinity property. This is a departure from the Uranium Mill Tailings Radiation Control Act (UMTRCA) of 1978, which requires the licensing only of disposal sites, not vicinity properties. However, given the unusually large volume of wastes and the distance from the Canonsburg disposal cell of the Burrell vicinity property, it was agreed that a license for a designed disposal cell with surveillance requirements constituted a reasonable and prudent approach in keeping with the spirit of UMTRCA. The Burrell vicinity property covers approximately 29 hectares (72 acres). Disposal of the 10,500 tonnes (I 1,600 tons) of residual radioactive material (RRM) removed from the Canonsburg Uranium Mill Tailings Remedial Action (UMTRA) Project site took place within an approximately 0.6-hectare (1.6-acre) section in the western portion and an approximately 0.6-hectare (1.6-acre) section in the eastern portion of the Burrell vicinity property. The RRM was brought in as fill for under the ConRail railroad tracks. The excess RRM was placed in a storage location adjacent to the Conemaugh River at Burrell, which was later added to the disposal area. The disposal area contains a total of 78,000 tonnes (86,000 tons) of RRM

OCP TECD Report - TARDEC Blast Mitigation Program (BMP) and National Defense Industrial Association (NDIA) Michigan (MI) Chapter Cooperative Research and Development Agreement (CRADA) Summary

Science.gov (United States)

2017-09-26

Standard, MIL-STD-3058, Occupant-Centric Protection for Military Ground Vehicles. 15. SUBJECT TERMS Occupant Centric Platform Technology-Enabled...Capability Demonstration (OCP TECD), Occupant-centric, Occupant Protection , Underbody Blast, National Defense Industrial Association (NDIA...Cooperative Research and Development Agreement (CRADA) 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT 18. NUMBER OF PAGES 19a. NAME OF

Development of a modular integrated control architecture for flexible manipulators. Final report

International Nuclear Information System (INIS)

Burks, B.L.; Battiston, G.

1994-01-01

In April 1994, ORNL and SPAR completed the joint development of a manipulator controls architecture for flexible structure controls under a CRADA between the two organizations. The CRADA project entailed design and development of a new architecture based upon the Modular Integrated Control Architecture (MICA) previously developed by ORNL. The new architecture, dubbed MICA-II, uses an object-oriented coding philosophy to provide a highly modular and expandable architecture for robotic manipulator control. This architecture can be readily ported to control of many different manipulator systems. The controller also provides a user friendly graphical operator interface and display of many forms of data including system diagnostics. The capabilities of MICA-II were demonstrated during oscillation damping experiments using the Flexible Beam Experimental Test Bed at Hanford

New Materials for Electric Drive Vehicles - Final CRADA Report

Energy Technology Data Exchange (ETDEWEB)

Carter, J. David [Argonne National Lab. (ANL), Argonne, IL (United States)

2016-10-18

This project was sponsored by the US DOE Global Initiatives for Proliferation Prevention. The object was for Ukrainian and US partners, including Argonne, AETC, and Dontech to develop special carbon materials and factory production equipment with the goal of making better car batteries to achieve DOE's goals for all-electric and plug-in hybrid electric vehicles. Carbon materials are used in designs for lithium-ion batteries and metal-air batteries, both leading contenders for future electric cars. Specifically, the collaborators planned to use the equipment derived from this project to develop a rechargeable battery system that will use the carbon materials produced by the innovative factory process equipment. The final outcome of the project was that the Ukrainian participants consisting of the Kharkov Institute of Physics and Technology (KIPT), the Institute of Gas of National Academy of Sciences of Ukraine and the Materials Research Center, Ltd. designed, built, tested and delivered 14 pieces of processing equipment for pilot scale carbon production lines at the AETC, Arlington Heights facilities. The pilot scale equipment will be used to process materials such as activated carbon, thermally expanded graphite and carbon coated nano-particles. The equipment was shipped from Ukraine to the United States and received by AETC on December 3, 2013. The equipment is on loan from Argonne, control # 6140. Plug-in hybrid electric vehicles (PHEV) and all-electric vehicles have already demostrated success in the U.S. as they begin to share the market with older hybrid electric designs. When the project was conceived, PHEV battery systems provided a ~40 mile driving range (2011 figures). DOE R&D targets increased this to >100 miles at reduced cost less than $250/kWh (2011 figures.) A 2016 Tesla model S has boasted 270 miles. The project object was to develop pilot-production line equipment for advanced hybrid battery system that achieves cycle life of 1000, an energy

Heat transfer enhanced microwave process for stabilization of liquid radioactive waste slurry. Final report

International Nuclear Information System (INIS)

White, T.L.

1995-01-01

The objectve of this CRADA is to combine a polymer process for encapsulation of liquid radioactive waste slurry developed by Monolith Technology, Inc. (MTI), with an in-drum microwave process for drying radioactive wastes developed by Oak Ridge National Laboratory (ORNL), for the purpose of achieving a fast, cost-effectve commercial process for solidification of liquid radioactive waste slurry. Tests performed so far show a four-fold increase in process throughput due to the direct microwave heating of the polymer/slurry mixture, compared to conventional edge-heating of the mixer. We measured a steady-state throughput of 33 ml/min for 1.4 kW of absorbed microwave power. The final waste form is a solid monolith with no free liquids and no free particulates

Bioremediation of PCBs. CRADA final report

International Nuclear Information System (INIS)

Klasson, K.T.; Abramowicz, D.A.

1996-06-01

The Cooperative Research and Development Agreement was signed between Oak Ridge National Laboratory (ORNL) and General Electric Company (GE) on August 12, 1991. The objective was a collaborative venture between researchers at GE and ORNL to develop bioremediation of polychlorinated biphenyls (PCBs). The work was conducted over three years, and this report summarizes ORNL's effort. It was found that the total concentration of PCBs decreased by 70% for sequential anaerobic-aerobic treatment compared with a 67% decrease for aerobic treatment alone. The sequential treatment resulted in PCB products with fewer chlorines and shorter halflives in humans compared with either anaerobic or aerobic treatment alone. The study was expected to lead to a technology applicable to a field experiment that would be performed on a DOE contaminated site

Bioremediation of PCBs. CRADA final report

Energy Technology Data Exchange (ETDEWEB)

Klasson, K.T. [Oak Ridge National Lab., TN (United States). Chemical Technology Div., TN (United States); Abramowicz, D.A. [General Electric Co. Corporate Research and Development, Niskayuna, NY (United States)

1996-06-01

The Cooperative Research and Development Agreement was signed between Oak Ridge National Laboratory (ORNL) and General Electric Company (GE) on August 12, 1991. The objective was a collaborative venture between researchers at GE and ORNL to develop bioremediation of polychlorinated biphenyls (PCBs). The work was conducted over three years, and this report summarizes ORNL`s effort. It was found that the total concentration of PCBs decreased by 70% for sequential anaerobic-aerobic treatment compared with a 67% decrease for aerobic treatment alone. The sequential treatment resulted in PCB products with fewer chlorines and shorter halflives in humans compared with either anaerobic or aerobic treatment alone. The study was expected to lead to a technology applicable to a field experiment that would be performed on a DOE contaminated site.

CRADA Final Report: Weld Predictor App

Energy Technology Data Exchange (ETDEWEB)

Billings, Jay Jay [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

2018-01-25

Welding is an important manufacturing process used in a broad range of industries and market sectors, including automotive, aerospace, heavy manufacturing, medical, and defense. During welded fabrication, high localized heat input and subsequent rapid cooling result in the creation of residual stresses and distortion. These residual stresses can significantly affect the fatigue resistance, cracking behavior, and load-carrying capacity of welded structures during service. Further, additional fitting and tacking time is often required to fit distorted subassemblies together, resulting in non-value added cost. Using trial-and-error methods to determine which welding parameters, welding sequences, and fixture designs will most effectively reduce distortion is a time-consuming and expensive process. For complex structures with many welds, this approach can take several months. For this reason, efficient and accurate methods of mitigating distortion are in-demand across all industries where welding is used. Analytical and computational methods and commercial software tools have been developed to predict welding-induced residual stresses and distortion. Welding process parameters, fixtures, and tooling can be optimized to reduce the HAZ softening and minimize weld residual stress and distortion, improving performance and reducing design, fabrication and testing costs. However, weld modeling technology tools are currently accessible only to engineers and designers with a background in finite element analysis (FEA) who work with large manufacturers, research institutes, and universities with access to high-performance computing (HPC) resources. Small and medium enterprises (SMEs) in the US do not typically have the human and computational resources needed to adopt and utilize weld modeling technology. To allow an engineer with no background in FEA and SMEs to gain access to this important design tool, EWI and the Ohio Supercomputer Center (OSC) developed the online weld application software tool “WeldPredictor” ( https://eweldpredictor.ewi.org ). About 1400 users have tested this application. This project marked the beginning of development on the next version of WeldPredictor that addresses many outstanding features of the original, including 3D models, allow more material hardening laws, model material phase transformation, and uses open source finite element solvers to quickly solve problems (as opposed to expensive commercial tools).

Final report on the Vitro CRADA

International Nuclear Information System (INIS)

1994-02-01

ORNL and Vitro investigated the application of advanced Geographic Information System (GIS) technologies to site characterization and environmental remediation work. The six tasks were to do feasibility studies for integrating GIS tools with DBMS, graphics, and other packages to aid in environmental analyses, develop environmental and geographic data standards and guidelines including data structures/quality assurance practices/metadata, investigate environmental and remediation predictive modeling and their integration with GIS, study remote sensing techniques including Global Positioning Systems techniques, and investigate display enhancement techniques including 2D/3D visualization coupled with GIS data bases

Admission and Preventive Load Control for Delivery of Multicast and Broadcast Services via S-UMTS

Science.gov (United States)

Angelou, E.; Koutsokeras, N.; Andrikopoulos, I.; Mertzanis, I.; Karaliopoulos, M.; Henrio, P.

2003-07-01

An Admission Control strategy is proposed for unidirectional satellite systems delivering multicast and broadcast services to mobile users. In such systems, both the radio interface and the targeted services impose particular requirements on the RRM task. We briefly discuss the RRM requirements that stem from the services point of view and from the features of the SATIN access scheme that differentiate it from the conventional T-UMTS radio interface. The main functional entities of RRM and the alternative modes of operation are outlined and the proposed Admission Control algorithm is described in detail. The results from the simulation study that demonstrate its performance for a number of different scenarios are finally presented and conclusions derived.

Radiation Hardened Telerobotic Dismantling System Development Final Report CRADA No. TC-1340-96

Energy Technology Data Exchange (ETDEWEB)

Smith, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Lightman, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-27

This project was a collaborative effort between the University of California, LLNL and RedZone Robotics, Inc. for the development of radiation-hardened telerobotic dismantling systems for use in applications such as nuclear facility remediation, nuclear accident response, and Chemobyltype remediation. The project supported the design, development, fabrication and testing of a Ukrainian robotic systems. The project was completed on time and within budget. All deliverables were completed. The final project deliverables were consistent with the plans developed in the original project with the exception that the fabricated systems remained in Ukraine.

Properties of calcium silicate-monobasic calcium phosphate materials for endodontics containing tantalum pentoxide and zirconium oxide.

Science.gov (United States)

Zamparini, Fausto; Siboni, Francesco; Prati, Carlo; Taddei, Paola; Gandolfi, Maria Giovanna

2018-05-08

The aim of the study was to evaluate chemical-physical properties and apatite-forming ability of three premixed calcium silicate materials containing monobasic calcium phosphate (CaH 4 P 2 O 8 ) bioceramic, tantalum pentoxide and zirconium oxide, recently marketed for endodontics (TotalFill BC-Sealer, BC-RRM-Paste, BC-RRM-Putty). Microchemical and micromorphological analyses, radiopacity, initial and final setting times, calcium release and alkalising activity were tested. The nucleation of calcium phosphates (CaPs) and/or apatite after 28 days ageing was evaluated by ESEM-EDX and micro-Raman spectroscopy. BC-Sealer and BC-RRM-Paste showed similar initial (23 h), prolonged final (52 h) setting times and good radiopacity (> 7 mm Al); BC-RRM-Putty showed fast initial (2 h) and final setting times (27 h) and excellent radiopacity (> 9 mm Al). All materials induced a marked alkalisation (pH 11-12) up to 28 days and showed the release of calcium ions throughout the entire test period (cumulative calcium release 641-806 ppm). After 28 days ageing, a well-distributed mineral layer was present on all samples surface; EDX demonstrated relevant calcium and phosphorous peaks. B-type carbonated apatite and calcite deposits were identified by micro-Raman spectroscopy on all the 28-day-aged samples; the deposit thickness was higher on BC-RRM-Paste and BC-RRM-Putty, in agreement with calcium release data. These materials met the required chemical and physical standards and released biologically relevant ions. The CaSi-CaH 4 P 2 O 8 system present in the materials provided Ca and OH ions release with marked abilities to nucleate a layer of B-type carbonated apatite favoured/accelerated by the bioceramic presence. The ability to nucleate apatite may lead many clinical advantages: In orthograde endodontics, it may improve the sealing ability by the deposition of CaPs at the material-root dentine interface, and in endodontic surgery, it could promote bone and

University of Washington/ Northwest National Marine Renewable Energy Center Tidal Current Technology Test Protocol, Instrumentation, Design Code, and Oceanographic Modeling Collaboration: Cooperative Research and Development Final Report, CRADA Number CRD-11-452

Energy Technology Data Exchange (ETDEWEB)

Driscoll, Frederick R. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2016-11-01

The University of Washington (UW) - Northwest National Marine Renewable Energy Center (UW-NNMREC) and the National Renewable Energy Laboratory (NREL) will collaborate to advance research and development (R&D) of Marine Hydrokinetic (MHK) renewable energy technology, specifically renewable energy captured from ocean tidal currents. UW-NNMREC is endeavoring to establish infrastructure, capabilities and tools to support in-water testing of marine energy technology. NREL is leveraging its experience and capabilities in field testing of wind systems to develop protocols and instrumentation to advance field testing of MHK systems. Under this work, UW-NNMREC and NREL will work together to develop a common instrumentation system and testing methodologies, standards and protocols. UW-NNMREC is also establishing simulation capabilities for MHK turbine and turbine arrays. NREL has extensive experience in wind turbine array modeling and is developing several computer based numerical simulation capabilities for MHK systems. Under this CRADA, UW-NNMREC and NREL will work together to augment single device and array modeling codes. As part of this effort UW NNMREC will also work with NREL to run simulations on NREL's high performance computer system.

Development of high power radio frequency components for fusion plasma heating. Final report, Revision 3

International Nuclear Information System (INIS)

1997-01-01

The purpose of this CRADA was to develop advanced microwave heating systems for both ion cyclotron heating and electron cyclotron heating for magnetic fusion reactors. This involved low-frequency (UHF), high-power (millimeter-wave) microwave components, such as antennas, windows, and matching elements. This CRADA also involved developing conceptual designs for new microwave sources. General Atomics built and tested the distributed cooled window and provided LLNL with transmission and reflection test data in order to then benchmark the EM computer codes. The combline antenna built and analyzed by LLNL was based on a GA design. GA provided LLNL with a number of niobium plates for hot pressing and provided the necessary guidance to allow successful bonding. GA representatives were on site at LLNL on numerous occasions to consult and give guidance on the ferroelectric tuner, combline antenna and distributed window analysis

Membranes for corrosive oxidations. Final CRADA report.

Energy Technology Data Exchange (ETDEWEB)

Snyder, S. W.; Energy Systems

2010-02-01

The objective of this project is to develop porous hydrophilic membranes that are highly resistant to oxidative and corrosive conditions and to deploy them for recovery and purification of high tonnage chemicals such as hydrogen peroxide and other oxychemicals. The research team patented a process for membrane-based separation of hydrogen peroxide (US Patent No. 5,662,878). The process is based on using a hydrophilic membrane to separate hydrogen peroxide from the organic working solution. To enable this process, a new method for producing hydrophilic membrane materials (Patent No.6,464,880) was reported. We investigated methods of producing these hydrophilic materials and evaluated separations performance in comparison to membrane stability. It was determined that at the required membrane flux, membrane stability was not sufficient to design a commercial process. This work was published (Hestekin et al., J. Membrane Science 2006). To meet the performance needs of the process, we developed a membrane contactor method to extract the hydrogen peroxide, then we surveyed several commercial and pre-commercial membrane materials. We identified pre-commercial hydrophilic membranes with the required selectivity, flux, and stability to meet the needs of the process. In addition, we invented a novel reaction/separations format that greatly increases the performance of the process. To test the performance of the membranes and the new formats we procured and integrated reactor/membrane separations unit that enables controlled mixing, flow, temperature control, pressure control, and sampling. The results were used to file a US non-provisional patent application (ANL-INV 03-12). Hydrogen peroxide is widely used in pulp and paper applications, environmental treatment, and other industries. Virtually all hydrogen peroxide production is now based on a process featuring catalytic hydrogenation followed by auto-oxidation of suitable organic carrier molecules. This process has several drawbacks, particularly in the extraction phase. One general disadvantage of this technology is that hydrogen peroxide must be produced at large centralized plants where it is concentrated to 70% by distillation and transported to the users plant sites where it is diluted before use. Advanced membranes have the potential to enable more efficient, economic, and safe manufacture of hydrogen peroxide. Advanced membrane technology would allow filtration-based separation to replace the difficult liquid-liquid extraction based separation step of the hydrogen peroxide process. This would make it possible for hydrogen peroxide to be produced on-site in mini-plants at 30% concentration and used at the same plant location without distillation and transportation. As a result, production could become more cost-effective, safe and energy efficient.

Solutions for Digital Video Transmission Technology Final Report CRADA No. TC02068.0

Energy Technology Data Exchange (ETDEWEB)

Smith, A. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rivers, W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-07

This Project aimed at development of software for seismic data processing based on the Geotool code developed by the American company Multimax., Inc. The Geotool code was written in early 90-es for the UNIX platform. Under Project# 2821, functions of the old Geotool code were transferred into a commercial version for the Microsoft XP and Vista platform with addition of new capabilities on visualization and data processing. The developed new version of the Geotool+ was implemented using the up-to-date tool Microsoft Visual Studio 2005 and uses capabilities of the .NET platform. C++ was selected as the main programming language for the Geotool+. The two-year Project was extended by six months and funding levels increased from 600,000 to $670,000. All tasks were successfully completed and all deliverables were met for the project even though both the industrial partner and LLNL principal investigator left the project before its final report.

CRADA Final Report for CRADA Number NFE-08-01671 Materials for Advanced Turbocharger Designs

Energy Technology Data Exchange (ETDEWEB)

Maziasz, P. J. [ORNL; Wilson, M. [Honeywell

2014-11-28

Results were obtained on residual stresses in the weld of the steel shaft to the Ni-based superalloy turbine wheel for turbochargers. Neutron diffraction studies at the HFIR Residual Stress Facility showed asymmetric tensile stresses after electron-beam welding of the wheel and shaft. A post-weld heat-treatment was found to relieve and reduce the residual stresses. Results were also obtained on cast CF8C-Plus steel as an upgrade alternative to cast irons (SiMo, Ni-resist) for higher temperature capability and performance for the turbocharger housing. CF8C-Plus steel has demonstrated creep-rupture resistance at 600-950oC, and is more creep-resistant than HK30Nb, but lacks oxidation-resistance at 800oC and above in 10% water vapor. New modified CF8C-Plus Cu/W steels with Cr and Ni additions show better oxidation resistance at 800oC in 10% water vapor, and have capability to higher temperatures. For automotive gasoline engine turbocharger applications, higher temperatures are required, so at the end of this project, testing began at 1000oC and above.

Transactive Campus Energy Systems: Final Report

Energy Technology Data Exchange (ETDEWEB)

Katipamula, Srinivas [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Corbin, Charles D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Haack, Jereme N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hao, He [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Kim, Woohyun [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hostick, Donna J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Akyol, Bora A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Allwardt, Craig H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Carpenter, Brandon J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Huang, Sen [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Liu, Guopeng [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lutes, Robert G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Makhmalbaf, Atefe [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Mendon, Vrushali V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Ngo, Hung [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Somasundaram, Sriram [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Underhill, Ronald M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zhao, Mingjie [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2017-09-26

Transactive energy refers to the combination of economic and control techniques to improve grid reliability and efficiency. The fundamental purpose of transactive energy management is to seamlessly coordinate the operation of large numbers of new intelligent assets—such as distributed solar, energy storage and responsive building loads—to provide the flexibility needed to operate the power grid reliably and at minimum cost, particularly one filled with intermittent renewable generation such as the Pacific Northwest. It addresses the key challenge of providing smooth, stable, and predictable “control” of these assets, despite the fact that most are neither owned nor directly controlled by the power grid. The Clean Energy and Transactive Campus (CETC) work described in this report was done as part of a Cooperative Research and Development Agreement (CRADA) between the U.S. Department of Energy’s Pacific Northwest National Laboratory (PNNL) and the Washington State Department of Commerce (Commerce) through the Clean Energy Fund (CEF). The project team consisted of PNNL, the University of Washington (UW) and Washington State University (WSU), to connect the PNNL, UW, and WSU campuses to form a multi-campus testbed for transaction-based energy management—transactive—solutions. Building on the foundational transactive system established by the Pacific Northwest Smart Grid Demonstration (PNWSGD), the purpose of the project was to construct the testbed as both a regional flexibility resource and as a platform for research and development (R&D) on buildings/grid integration and information-based energy efficiency. This report provides a summary of the various tasks performed under the CRADA.

Ion Beam Drift Compression Technology for NDCX. CRADA Final Report. CRADA No. LB05-001820

International Nuclear Information System (INIS)

Waldron, William L.

2009-01-01

Summary of the specific research and project accomplishments: Through this collaboration, LBNL and FPSI determined the specific energy manipulations that apply to the Neutralized Drift Compression Experiment (NDCX) ion beam and developed the preliminary design of a Fast Induction Energy Corrector (FIEC). This effort was successfully completed, firmly establishing the technical feasibility of the proposed approach for regulating the longitudinal energy distribution of the NDCX ion beam. This is a critical step in achieving the NDCX goal of axial compression of the beam by a factor of 100 during neutralized drift.

Novel CO{sub 2} capture. Final CRADA Report.

Energy Technology Data Exchange (ETDEWEB)

Snyder, S. W.; Energy Systems

2009-11-30

The goal of this work was to use electrochemically driven pH control to develop a second generation, enzyme-based contained liquid membrane (CLM) permeator to extract CO{sub 2} from a variety of coal-based flue gas streams more efficiently than does the CLM current design, while achieving performance coincident with DOE targets of less than 45% Cost of electricity (COE) in 2007 and less than 20% COE in 2012. Central to this goal the CLM would be alkaline (>pH 8) at the feed gas side and acid (

CRADA Final Report, 2011S003, Faraday Technologies

International Nuclear Information System (INIS)

Faraday Technologies

2012-01-01

This Phase I SBIR program addressed the need for an improved manufacturing process for electropolishing niobium RF superconducting cavities for the International Linear Collider (ILC). The ILC is a proposed particle accelerator that will be used to gain a deeper understanding of the forces of energy and matter by colliding beams of electrons and positrons at nearly the speed of light. The energy required for this to happen will be achieved through the use of advanced superconducting technology, specifically ∼16,000 RF superconducting cavities operating at near absolute zero. The RF superconductor cavities will be fabricated from highly pure Nb, which has an extremely low surface resistance at 2 Kelvin when compared to other materials. To take full advantage of the superconducting properties of the Nb cavities, the inner surface must be a) polished to a microscale roughness < 0.1 µm with removal of at least 100 µm of material, and b) cleaned to be free of impurities that would degrade performance of the ILC. State-of-the-art polishing uses either chemical polishing or electropolishing, both of which require hydrofluoric acid to achieve breakdown of the strong passive film on the surface. In this Phase I program, Faraday worked with its collaborators at the Thomas Jefferson National Accelerator Facility (JLab) to demonstrate the feasibility of an electropolishing process for pure niobium, utilizing an environmentally benign alternative to chemical or electrochemical polishing electrolytes containing hydrofluoric acid. Faraday utilized a 31 wt% aqueous sulfuric acid solution (devoid of hydrofluoric acid) in conjunction with the FARADAYICSM Process, which uses pulse/pulse reverse fields for electropolishing, to demonstrate the ability to electropolish niobium to the desired surface finish. The anticipated benefits of the FARADAYICSM Electropolishing process will be a simpler, safer, and less expensive method capable of surface finishing high purity niobium cavities. Another potential benefit would be for the medical industry that uses hydrofluoric acid to electropolish niobium-alloy materials. The FARADAYICSM Electropolishing process will eliminate the environmental hazards posed by the use of hydrofluoric acid employed by chemical polishing and conventional electropolishing. Further, improved performance benefits may be possible. The overall objective of the Phase I program was to demonstrate that FARADAYIC Electropolishing of niobium cavities in electrolytes free of hydrofluoric acid can meet the RF superconducting performance criteria of those cavities. The FARADAYIC Electropolishing Process developed in the Phase I program was used to polish 50 mm Nb disks to a surface roughness (RA) of < 1 nm over a small area through process and post-processing optimization. An excellent level of surface cleanliness was achieved. While the desired 2K RF performance has not yet been achieved, Faraday believes that surface oxide state can be controlled through manipulation of the process parameters, to meet the 2K RF standard. Faraday is establishing apparatus and facilities infrastructure for single-cell SRF cavity electropolishing, through a synergistic effort with the Fermi National Accelerator Facility (Fermilab) to scale-up electropolishing of superconducting RF cavities. Faraday proposes to commercialize the subject technology via an IP based strategic relationship with a partner with established market channels within two primary commercialization avenues: 1) the superconducting particle accelerator community, 2) the medical device and implant market. Faraday will initially maintain Low Rate Initial Production capabilities for an application, but latterly seek a strategic partner who is solely dedicated to high rate production

E2F1 promote the aggressiveness of human colorectal cancer by activating the ribonucleotide reductase small subunit M2

Energy Technology Data Exchange (ETDEWEB)

Fang, Zejun [Sanmen People' s Hospital of Zhejiang, Sanmen, Zhejiang, 317100 (China); Gong, Chaoju [Department of Pathology and Pathophysiology, Zhejiang University School of Medicine, Hangzhou, Zhejiang, 310058 (China); Liu, Hong [Zhejiang Normal University – Jinhua People' s Hospital Joint Center for Biomedical Research, Jinhua, Zhejiang, 321004 (China); Zhang, Xiaomin; Mei, Lingming [Sanmen People' s Hospital of Zhejiang, Sanmen, Zhejiang, 317100 (China); Song, Mintao [Department of Pathophysiology, Institute of Basic Medical Sciences, Chinese Academy of Medical Sciences (CAMS), School of Basic Medicine, Peking Union Medical College (PUMC), Beijing, 100005 (China); Qiu, Lanlan; Luo, Shuchai; Zhu, Zhihua; Zhang, Ronghui; Gu, Hongqian [Sanmen People' s Hospital of Zhejiang, Sanmen, Zhejiang, 317100 (China); Chen, Xiang, E-mail: sychenxiang@126.com [Sanmen People' s Hospital of Zhejiang, Sanmen, Zhejiang, 317100 (China)

2015-08-21

As the ribonucleotide reductase small subunit, the high expression of ribonucleotide reductase small subunit M2 (RRM2) induces cancer and contributes to tumor growth and invasion. In several colorectal cancer (CRC) cell lines, we found that the expression levels of RRM2 were closely related to the transcription factor E2F1. Mechanistic studies were conducted to determine the molecular basis. Ectopic overexpression of E2F1 promoted RRM2 transactivation while knockdown of E2F1 reduced the levels of RRM2 mRNA and protein. To further investigate the roles of RRM2 which was activated by E2F1 in CRC, CCK-8 assay and EdU incorporation assay were performed. Overexpression of E2F1 promoted cell proliferation in CRC cells, which was blocked by RRM2 knockdown attenuation. In the migration and invasion tests, overexpression of E2F1 enhanced the migration and invasion of CRC cells which was abrogated by silencing RRM2. Besides, overexpression of RRM2 reversed the effects of E2F1 knockdown partially in CRC cells. Examination of clinical CRC specimens demonstrated that both RRM2 and E2F1 were elevated in most cancer tissues compared to the paired normal tissues. Further analysis showed that the protein expression levels of E2F1 and RRM2 were parallel with each other and positively correlated with lymph node metastasis (LNM), TNM stage and distant metastasis. Consistently, the patients with low E2F1 and RRM2 levels have a better prognosis than those with high levels. Therefore, we suggest that E2F1 can promote CRC proliferation, migration, invasion and metastasis by regulating RRM2 transactivation. Understanding the role of E2F1 in activating RRM2 transcription will help to explain the relationship between E2F1 and RRM2 in CRC and provide a novel predictive marker for diagnosis and prognosis of the disease. - Highlights: • E2F1 promotes RRM2 transactivation in CRC cells. • E2F1 promotes the proliferation of CRC cells by activating RRM2. • E2F1 promotes the migration and

Random regret-based discrete-choice modelling: an application to healthcare.

Science.gov (United States)

de Bekker-Grob, Esther W; Chorus, Caspar G

2013-07-01

A new modelling approach for analysing data from discrete-choice experiments (DCEs) has been recently developed in transport economics based on the notion of regret minimization-driven choice behaviour. This so-called Random Regret Minimization (RRM) approach forms an alternative to the dominant Random Utility Maximization (RUM) approach. The RRM approach is able to model semi-compensatory choice behaviour and compromise effects, while being as parsimonious and formally tractable as the RUM approach. Our objectives were to introduce the RRM modelling approach to healthcare-related decisions, and to investigate its usefulness in this domain. Using data from DCEs aimed at determining valuations of attributes of osteoporosis drug treatments and human papillomavirus (HPV) vaccinations, we empirically compared RRM models, RUM models and Hybrid RUM-RRM models in terms of goodness of fit, parameter ratios and predicted choice probabilities. In terms of model fit, the RRM model did not outperform the RUM model significantly in the case of the osteoporosis DCE data (p = 0.21), whereas in the case of the HPV DCE data, the Hybrid RUM-RRM model outperformed the RUM model (p implied by the two models can vary substantially. Differences in model fit between RUM, RRM and Hybrid RUM-RRM were found to be small. Although our study did not show significant differences in parameter ratios, the RRM and Hybrid RUM-RRM models did feature considerable differences in terms of the trade-offs implied by these ratios. In combination, our results suggest that RRM and Hybrid RUM-RRM modelling approach hold the potential of offering new and policy-relevant insights for health researchers and policy makers.

Fiber Optic Hydrogen Sensor Development: Cooperative Research and Development Final Report, CRADA number CRD-05-00158

International Nuclear Information System (INIS)

Ringer, M.

2010-01-01

NREL and Nuclear Filter Technology collaborated to develop a prototype product for a hydrogen threshold sensor that was used to monitor hydrogen production in the transport of nuclear waste transport containers. This application is a core business area for Nuclear Filter Technology and will provide a basis for creating sensor products that are used in other licensed fields of use. Activities included design and construction of prototype product, product testing and debugging, and finalizing a prototype for initial field tests.

cDNA Library Screening Identifies Protein Interactors Potentially Involved in Non-telomeric Roles of Arabidopsis Telomerase

Directory of Open Access Journals (Sweden)

Ladislav eDokládal

2015-11-01

Full Text Available Telomerase-reverse transcriptase (TERT plays an essential catalytic role in maintaining telomeres. However, in animal systems telomerase plays additional non-telomeric functional roles. We previously screened an Arabidopsis cDNA library for proteins that interact with the C-terminal extension (CTE TERT domain and identified a nuclear-localized protein that contains a RNA recognition motif (RRM. This RRM-protein forms homodimers in both plants and yeast. Mutation of the gene encoding the RRM-protein had no detectable effect on plant growth and development, nor did it affect telomerase activity or telomere length in vivo, suggesting a non-telomeric role for TERT/RRM-protein complexes. The gene encoding the RRM-protein is highly expressed in leaf and reproductive tissues. We further screened an Arabidopsis cDNA library for proteins that interact with the RRM-protein and identified five interactors. These proteins are involved in numerous non-telomere-associated cellular activities. In plants, the RRM-protein, both alone and in a complex with its interactors, localizes to nuclear speckles. Transcriptional analyses in wild-type and rrm mutant plants, as well as transcriptional co-analyses, suggest that TERT, the RRM-protein, and the RRM-protein interactors may play important roles in non-telomeric cellular functions.

Final report on reliability and lifetime prediction.

Energy Technology Data Exchange (ETDEWEB)

Gillen, Kenneth T; Wise, Jonathan; Jones, Gary D.; Causa, Al G.; Terrill, Edward R.; Borowczak, Marc

2012-12-01

This document highlights the important results obtained from the subtask of the Goodyear CRADA devoted to better understanding reliability of tires and to developing better lifetime prediction methods. The overall objective was to establish the chemical and physical basis for the degradation of tires using standard as well as unique models and experimental techniques. Of particular interest was the potential application of our unique modulus profiling apparatus for assessing tire properties and for following tire degradation. During the course of this complex investigation, extensive relevant information was generated, including experimental results, data analyses and development of models and instruments. Detailed descriptions of the findings are included in this report.

Final Report of a CRADA Between Pacific Northwest National Laboratory and Cummins, Incorporated (CRADA No.PNNL/283): “Enhanced High and Low Temperature Performance of NO_x Reduction Catalyst Materials”

Energy Technology Data Exchange (ETDEWEB)

Gao, Feng [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Szanyi, Janos [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Wang, Yilin [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Wang, Yong [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Peden, Charles HF [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Howden, Ken [US Dept. of Energy, Washington, DC (United States); Currier, Neal [Cummins Inc., Columbus, IN (United States); Kamasamudram, Krishna [Cummins Inc., Columbus, IN (United States); Kumar, Ashok [Cummins Inc., Columbus, IN (United States); Li, J. [Cummins Inc., Columbus, IN (United States); Stafford, R. J. [Cummins Inc., Columbus, IN (United States); Yezerets, Aleksey [Cummins Inc., Columbus, IN (United States); Luo, J. [Cummins Inc., Columbus, IN (United States); Chen, H. Y. [Johnson Matthey Company, Royston (United Kingdom)

2016-09-01

of the most daunting challenges in R&D on new catalyst materials and processes that can effectively eliminate emissions at these quite low exhaust temperatures. This project has two clear focuses: (1) development of potassium-based high-temperature NSR materials, and studying their key causes of deactivation and methods of regeneration. By comparing results obtained on ‘Simple Model’ Pt-K/Al₂O₃ with ‘Enhanced Model’ Pt-K/ MgAlO_x and Pt-K/TiO₂ materials, we have developed an understanding of the role of various additives on the deactivation and regeneration processes. Studies have also been performed on the real commercial samples being used in a Dodge Ram truck with a Cummins diesel emission control system. However, the results about these ‘commercial samples’ will not be covered in this report. Following a brief description of our experimental approach, we will present a few highlights from some of the work performed in this CRADA with more details about these results provided in publications/reports/presentations lists presented at the end of the report. (2) for the Cu and Fe/Chabazite SCR catalysts, since these are so newly developed and references from open literature and industry are nearly absent, our work started from zeolite synthesis and catalyst synthesis methodology development, before research on their low- and high-temperature performance, deactivation, regeneration, etc. was conducted. Again, most work reported here is based on our “model” catalysts synthesized in-house. Work done on the ‘commercial samples’ will not be covered in this report.

Structural Insights into RNA Recognition by the Alternate-Splicing Regulator CUG-Binding Protein 1

Energy Technology Data Exchange (ETDEWEB)

M Teplova; J Song; H Gaw; A Teplov; D Patel

2011-12-31

CUG-binding protein 1 (CUGBP1) regulates multiple aspects of nuclear and cytoplasmic mRNA processing, with implications for onset of myotonic dystrophy. CUGBP1 harbors three RRM domains and preferentially targets UGU-rich mRNA elements. We describe crystal structures of CUGBP1 RRM1 and tandem RRM1/2 domains bound to RNAs containing tandem UGU(U/G) elements. Both RRM1 in RRM1-RNA and RRM2 in RRM1/2-RNA complexes use similar principles to target UGU(U/G) elements, with recognition mediated by face-to-edge stacking and water-mediated hydrogen-bonding networks. The UG step adopts a left-handed Z-RNA conformation, with the syn guanine recognized through Hoogsteen edge-protein backbone hydrogen-bonding interactions. NMR studies on the RRM1/2-RNA complex establish that both RRM domains target tandem UGUU motifs in solution, whereas filter-binding assays identify a preference for recognition of GU over AU or GC steps. We discuss the implications of CUGBP1-mediated targeting and sequestration of UGU(U/G) elements on pre-mRNA alternative-splicing regulation, translational regulation, and mRNA decay.

A Generalized Random Regret Minimization Model

NARCIS (Netherlands)

Chorus, C.G.

2013-01-01

This paper presents, discusses and tests a generalized Random Regret Minimization (G-RRM) model. The G-RRM model is created by replacing a fixed constant in the attribute-specific regret functions of the RRM model, by a regret-weight variable. Depending on the value of the regret-weights, the G-RRM

Inclusive, prompt and non-prompt J/$\\psi$ production at mid-rapidity in Pb-Pb collisions at $\\sqrt{s_{\\rm NN}}$ = 2.76 TeV

CERN Document Server

Adam, Jaroslav; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahn, Sang Un; Aimo, Ilaria; Aiola, Salvatore; Ajaz, Muhammad; Akindinov, Alexander; Alam, Sk Noor; Aleksandrov, Dmitry; Alessandro, Bruno; Alexandre, Didier; Alfaro Molina, Jose Ruben; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altinpinar, Sedat; Altsybeev, Igor; Alves Garcia Prado, Caio; Andrei, Cristian; Andronic, Anton; Anguelov, Venelin; Anielski, Jonas; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Armesto Perez, Nestor; Arnaldi, Roberta; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Bach, Matthias Jakob; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Baltasar Dos Santos Pedrosa, Fernando; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartke, Jerzy Gustaw; Bartsch, Esther; Basile, Maurizio; Bastid, Nicole; Basu, Sumit; Bathen, Bastian; Batigne, Guillaume; Batista Camejo, Arianna; Batyunya, Boris; Batzing, Paul Christoph; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Belmont Iii, Ronald John; Belmont Moreno, Ernesto; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Berceanu, Ionela; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhasin, Anju; Bhat, Inayat Rasool; Bhati, Ashok Kumar; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Livio; Bianchi, Nicola; Bianchin, Chiara; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biswas, Rathijit; Biswas, Saikat; Bjelogrlic, Sandro; Blanco, Fernando; Blau, Dmitry; Blume, Christoph; Bock, Friederike; Bogdanov, Alexey; Boggild, Hans; Boldizsar, Laszlo; Bombara, Marek; Book, Julian Heinz; Borel, Herve; Borissov, Alexander; Borri, Marcello; Bossu, Francesco; Botje, Michiel; Botta, Elena; Boettger, Stefan; Braun-Munzinger, Peter; Bregant, Marco; Breitner, Timo Gunther; Broker, Theo Alexander; Browning, Tyler Allen; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Buxton, Jesse Thomas; Caffarri, Davide; Cai, Xu; Caines, Helen Louise; Calero Diaz, Liliet; Caliva, Alberto; Calvo Villar, Ernesto; Camerini, Paolo; Carena, Francesco; Carena, Wisla; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Cavicchioli, Costanza; Ceballos Sanchez, Cesar; Cepila, Jan; Cerello, Piergiorgio; Cerkala, Jakub; Chang, Beomsu; Chapeland, Sylvain; Chartier, Marielle; Charvet, Jean-Luc Fernand; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chelnokov, Volodymyr; Cherney, Michael Gerard; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Chochula, Peter; Choi, Kyungeon; Chojnacki, Marek; Choudhury, Subikash; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-Urk; Zhang, Chunhui; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Connors, Megan Elizabeth; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortes Maldonado, Ismael; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Crochet, Philippe; Cruz Albino, Rigoberto; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Deisting, Alexander; Deloff, Andrzej; Denes, Ervin Sandor; D'Erasmo, Ginevra; Di Bari, Domenico; Di Mauro, Antonio; Di Nezza, Pasquale; Diaz Corchero, Miguel Angel; Dietel, Thomas; Dillenseger, Pascal; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Dobrowolski, Tadeusz Antoni; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Engel, Heiko; Erazmus, Barbara Ewa; Erdemir, Irem; Erhardt, Filip; Eschweiler, Dominic; Espagnon, Bruno; Estienne, Magali Danielle; Esumi, Shinichi; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Eyyubova, Gyulnara; Fabbietti, Laura; Fabris, Daniela; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Felea, Daniel; Feliciello, Alessandro; Feofilov, Grigorii; Ferencei, Jozef; Fernandez Tellez, Arturo; Gonzalez Ferreiro, Elena; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiore, Enrichetta Maria; Fleck, Martin Gabriel; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Frankenfeld, Ulrich Michael; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gallio, Mauro; Gangadharan, Dhevan Raja; Ganoti, Paraskevi; Gao, Chaosong; Garabatos Cuadrado, Jose; Garcia-Solis, Edmundo Javier; Gargiulo, Corrado; Gasik, Piotr Jan; Germain, Marie; Gheata, Andrei George; Gheata, Mihaela; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Gladysz-Dziadus, Ewa; Glassel, Peter; Gomez Ramirez, Andres; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Grelli, Alessandro; Grigoras, Alina Gabriela; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Grynyov, Borys; Grion, Nevio; Grosse-Oetringhaus, Jan Fiete; Grossiord, Jean-Yves; Grosso, Raffaele; Guber, Fedor; Guernane, Rachid; Guerzoni, Barbara; Gulbrandsen, Kristjan Herlache; Gulkanyan, Hrant; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Haake, Rudiger; Haaland, Oystein Senneset; Hadjidakis, Cynthia Marie; Haiduc, Maria; Hamagaki, Hideki; Hamar, Gergoe; Hansen, Alexander; Harris, John William; Hartmann, Helvi; Harton, Austin Vincent; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Heide, Markus Ansgar; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Herrera Corral, Gerardo Antonio; Hess, Benjamin Andreas; Hetland, Kristin Fanebust; Hilden, Timo Eero; Hillemanns, Hartmut; Hippolyte, Boris; Hosokawa, Ritsuya; Hristov, Peter Zahariev; Huang, Meidana; Humanic, Thomas; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Ilkaev, Radiy; Ilkiv, Iryna; Inaba, Motoi; Ionita, Costin; Ippolitov, Mikhail; Irfan, Muhammad; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacobs, Peter Martin; Jadlovska, Slavka; Jahnke, Cristiane; Jang, Haeng Jin; Janik, Malgorzata Anna; Pahula Hewage, Sandun; Jena, Chitrasen; Jena, Satyajit; Jimenez Bustamante, Raul Tonatiuh; Jones, Peter Graham; Jung, Hyungtaik; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kamin, Jason Adrian; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Khan, Kamal; Khan, Mohammed Mohisin; Khan, Palash; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Kileng, Bjarte; Kim, Beomkyu; Kim, Do Won; Kim, Dong Jo; Kim, Hyeonjoong; Kim, Jinsook; Kim, Mimae; Kim, Minwoo; Kim, Se Yong; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Kiss, Gabor; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-Boesing, Christian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobayashi, Taiyo; Kobdaj, Chinorat; Kofarago, Monika; Kollegger, Thorsten; Kolozhvari, Anatoly; Kondratev, Valerii; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Kopcik, Michal; Kour, Mandeep; Kouzinopoulos, Charalampos; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Kox, Serge; Koyithatta Meethaleveedu, Greeshma; Kral, Jiri; Kralik, Ivan; Kravcakova, Adela; Krelina, Michal; Kretz, Matthias; Krivda, Marian; Krizek, Filip; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kugathasan, Thanushan; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kulakov, Igor; Kumar, Ajay; Kumar, Jitendra; Lokesh, Kumar; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lagana Fernandes, Caio; Lakomov, Igor; Langoy, Rune; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Lattuca, Alessandra; Laudi, Elisa; Lea, Ramona; Leardini, Lucia; Lee, Graham Richard; Lee, Seongjoo; Legrand, Iosif; Lemmon, Roy Crawford; Lenti, Vito; Leogrande, Emilia; Leon Monzon, Ildefonso; Leoncino, Marco; Levai, Peter; Li, Shuang; Li, Xiaomei; Lien, Jorgen Andre; Lietava, Roman; Lindal, Svein; Lindenstruth, Volker; Lippmann, Christian; Lisa, Michael Annan; Ljunggren, Hans Martin; Lodato, Davide Francesco; Lonne, Per-Ivar; Loggins, Vera Renee; Loginov, Vitaly; Loizides, Constantinos; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Lunardon, Marcello; Luparello, Grazia; Ferreira Natal Da Luz, Pedro Hugo; Maevskaya, Alla; Mager, Magnus; Mahajan, Sanjay; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Maldonado Cervantes, Ivonne Alicia; Malinina, Liudmila; Mal'Kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manceau, Loic Henri Antoine; Manko, Vladislav; Manso, Franck; Manzari, Vito; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martin Blanco, Javier; Martinengo, Paolo; Martinez Hernandez, Mario Ivan; Martinez-Garcia, Gines; Martinez Pedreira, Miguel; Martynov, Yevgen; Mas, Alexis Jean-Michel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Mastroserio, Annalisa; Masui, Hiroshi; Matyja, Adam Tomasz; Mayer, Christoph; Mazer, Joel Anthony; Mazzoni, Alessandra Maria; Mcdonald, Daniel; Meddi, Franco; Menchaca-Rocha, Arturo Alejandro; Meninno, Elisa; Mercado-Perez, Jorge; Meres, Michal; Miake, Yasuo; Mieskolainen, Matti Mikael; Mikhaylov, Konstantin; Milano, Leonardo; Milosevic, Jovan; Minervini, Lazzaro Manlio; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Bedangadas; Molnar, Levente; Montano Zetina, Luis Manuel; Montes Prado, Esther; Morando, Maurizio; Moreira De Godoy, Denise Aparecida; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Murray, Sean; Musa, Luciano; Musinsky, Jan; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Naru, Muhammad Umair; Nattrass, Christine; Nayak, Kishora; Nayak, Tapan Kumar; Nazarenko, Sergey; Nedosekin, Alexander; Nellen, Lukas; Ng, Fabian; Nicassio, Maria; Niculescu, Mihai; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Saehanseul; Oh, Sun Kun; Ohlson, Alice Elisabeth; Okatan, Ali; Okubo, Tsubasa; Olah, Laszlo; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Ozdemir, Mahmut; Pachmayer, Yvonne Chiara; Pagano, Paola; Paic, Guy; Pajares Vales, Carlos; Pal, Susanta Kumar; Pan, Jinjin; Pandey, Ashutosh Kumar; Pant, Divyash; Papcun, Peter; Papikyan, Vardanush; Pappalardo, Giuseppe; Pareek, Pooja; Park, Woojin; Parmar, Sonia; Passfeld, Annika; Paticchio, Vincenzo; Patra, Rajendra Nath; Paul, Biswarup; Peitzmann, Thomas; Pereira Da Costa, Hugo Denis Antonio; Pereira De Oliveira Filho, Elienos; Peresunko, Dmitry Yurevich; Perez Lara, Carlos Eugenio; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrov, Viacheslav; Petrovici, Mihai; Petta, Catia; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Pinazza, Ombretta; Pinsky, Lawrence; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Porteboeuf, Sarah Julie; Porter, R Jefferson; Pospisil, Jan; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Puddu, Giovanna; Pujahari, Prabhat Ranjan; Punin, Valery; Putschke, Jorn Henning; Qvigstad, Henrik; Rachevski, Alexandre; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Read, Kenneth Francis; Real, Jean-Sebastien; Redlich, Krzysztof; Reed, Rosi Jan; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reolon, Anna Rita; Reshetin, Andrey; Rettig, Felix Vincenz; Revol, Jean-Pierre; Reygers, Klaus Johannes; Riabov, Viktor; Ricci, Renato Angelo; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-Lucian; Rivetti, Angelo; Rocco, Elena; Rodriguez Cahuantzi, Mario; Rodriguez Manso, Alis; Roeed, Ketil; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Romita, Rosa; Ronchetti, Federico; Ronflette, Lucile; Rosnet, Philippe; Rossi, Andrea; Roukoutakis, Filimon; Roy, Ankhi; Roy, Christelle Sophie; Roy, Pradip Kumar; Rubio Montero, Antonio Juan; Rui, Rinaldo; Russo, Riccardo; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Sadovskiy, Sergey; Safarik, Karel; Sahlmuller, Baldo; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Salgado Lopez, Carlos Alberto; Salzwedel, Jai Samuel Nielsen; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sanchez Castro, Xitzel; Sandor, Ladislav; Sandoval, Andres; Sano, Masato; Santagati, Gianluca; Sarkar, Debojit; Scapparone, Eugenio; Scarlassara, Fernando; Scharenberg, Rolf Paul; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schuchmann, Simone; Schukraft, Jurgen; Schulc, Martin; Schuster, Tim Robin; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Scott, Rebecca Michelle; Seeder, Karin Soraya; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Seo, Jeewon; Serradilla Rodriguez, Eulogio; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shadura, Oksana; Shahoyan, Ruben; Shangaraev, Artem; Sharma, Ankita; Sharma, Monika; Sharma, Natasha; Shigaki, Kenta; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Silvestre, Catherine Micaela; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singha, Subhash; Singhal, Vikas; Sinha, Bikash; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Soegaard, Carsten; Soltz, Ron Ariel; Song, Jihye; Song, Myunggeun; Song, Zixuan; Soramel, Francesca; Sorensen, Soren Pontoppidan; Spacek, Michal; Spiriti, Eleuterio; Sputowska, Iwona Anna; Spyropoulou-Stassinaki, Martha; Srivastava, Brijesh Kumar; Stachel, Johanna; Stan, Ionel; Stefanek, Grzegorz; Steinpreis, Matthew Donald; Stenlund, Evert Anders; Steyn, Gideon Francois; Stiller, Johannes Hendrik; Stocco, Diego; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Sultanov, Rishat; Sumbera, Michal; Symons, Timothy; Szabo, Alexander; Szanto De Toledo, Alejandro; Szarka, Imrich; Szczepankiewicz, Adam; Szymanski, Maciej Pawel; Takahashi, Jun; Tanaka, Naoto; Tangaro, Marco-Antonio; Tapia Takaki, Daniel Jesus; Tarantola Peloni, Attilio; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-Gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terasaki, Kohei; Terrevoli, Cristina; Teyssier, Boris; Thaeder, Jochen Mathias; Thomas, Deepa; Tieulent, Raphael Noel; Timmins, Anthony Robert; Toia, Alberica; Trogolo, Stefano; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vajzer, Michal; Vala, Martin; Valencia Palomo, Lizardo; Vallero, Sara; Van Der Maarel, Jasper; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vanat, Tomas; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vechernin, Vladimir; Veen, Annelies Marianne; Veldhoen, Misha; Velure, Arild; Venaruzzo, Massimo; Vercellin, Ermanno; Vergara Limon, Sergio; Vernet, Renaud; Verweij, Marta; Vickovic, Linda; Viesti, Giuseppe; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Vinogradov, Alexander; Vinogradov, Leonid; Vinogradov, Yury; Virgili, Tiziano; Vislavicius, Vytautas; Viyogi, Yogendra; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Vranic, Danilo; Vrlakova, Janka; Vulpescu, Bogdan; Vyushin, Alexey; Wagner, Boris; Wagner, Jan; Wang, Hongkai; Wang, Mengliang; Wang, Yifei; Watanabe, Daisuke; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Wessels, Johannes Peter; Westerhoff, Uwe; Wiechula, Jens; Wikne, Jon; Wilde, Martin Rudolf; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Williams, Crispin; Windelband, Bernd Stefan; Winn, Michael Andreas; Yaldo, Chris G; Yang, Hongyan; Yang, Ping; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-Kwon; Yurchenko, Volodymyr; Yushmanov, Igor; Zaborowska, Anna; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correia Zanoli, Henrique Jose; Zaporozhets, Sergey; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zgura, Sorin Ion; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhang, Yonghong; Zhao, Chengxin; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zhu, Xiangrong; Zichichi, Antonino; Zimmermann, Alice; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zyzak, Maksym

2015-07-10

The transverse momentum ($p_{\\rm T}$) dependence of the nuclear modification factor $R_{\\rm AA}$ and the centrality dependence of the average transverse momentum $\\langle p_{\\rm T}\\rangle$ for inclusive J/$\\psi$ have been measured with ALICE for Pb-Pb collisions at $\\sqrt{s_{\\rm NN}}$ = 2.76 TeV in the e$^+$e$^-$ decay channel at mid-rapidity ($|y|<0.8$). The $\\langle p_{\\rm T}\\rangle$ is significantly smaller than the one observed for pp collisions at the same centre-of-mass energy. Consistently, an increase of $R_{\\rm AA}$ is observed towards low $p_{\\rm T}$. These observations might be indicative of a sizable contribution of charm quark coalescence to the J/$\\psi$ production. Additionally, the fraction of non-prompt J/$\\psi$ from beauty hadron decays, $f_{\\rm B}$, has been determined in the region $1.5 < p_{\\rm T} < 10$ GeV/c in three centrality intervals. No significant centrality dependence of $f_{\\rm B}$ is observed. Finally, the $R_{\\rm AA}$ of non-prompt J/$\\psi$ is discussed and compared wit...

Crystal Structure of the N-Terminal RNA Recognition Motif of mRNA Decay Regulator AUF1

Directory of Open Access Journals (Sweden)

Young Jun Choi

2016-01-01

Full Text Available AU-rich element binding/degradation factor 1 (AUF1 plays a role in destabilizing mRNAs by forming complexes with AU-rich elements (ARE in the 3′-untranslated regions. Multiple AUF1-ARE complexes regulate the translation of encoded products related to the cell cycle, apoptosis, and inflammation. AUF1 contains two tandem RNA recognition motifs (RRM and a Gln- (Q- rich domain in their C-terminal region. To observe how the two RRMs are involved in recognizing ARE, we obtained the AUF1-p37 protein covering the two RRMs. However, only N-terminal RRM (RRM1 was crystallized and its structure was determined at 1.7 Å resolution. It appears that the RRM1 and RRM2 separated before crystallization. To demonstrate which factors affect the separate RRM1-2, we performed limited proteolysis using trypsin. The results indicated that the intact proteins were cleaved by unknown proteases that were associated with them prior to crystallization. In comparison with each of the monomers, the conformations of the β2-β3 loops were highly variable. Furthermore, a comparison with the RRM1-2 structures of HuR and hnRNP A1 revealed that a dimer of RRM1 could be one of the possible conformations of RRM1-2. Our data may provide a guidance for further structural investigations of AUF1 tandem RRM repeat and its mode of ARE binding.

Progesterone and DNA Damage Encourage Uterine Cell Proliferation and Decidualization through Up-regulating Ribonucleotide Reductase 2 Expression during Early Pregnancy in Mice*

Science.gov (United States)

Lei, Wei; Feng, Xu-Hui; Deng, Wen-Bo; Ni, Hua; Zhang, Zhi-Rong; Jia, Bo; Yang, Xin-Ling; Wang, Tong-Song; Liu, Ji-Long; Su, Ren-Wei; Liang, Xiao-Huan; Qi, Qian-Rong; Yang, Zeng-Ming

2012-01-01

Embryo implantation into the maternal uterus is a crucial step for the successful establishment of mammalian pregnancy. Following the attachment of embryo to the uterine luminal epithelium, uterine stromal cells undergo steroid hormone-dependent decidualization, which is characterized by stromal cell proliferation and differentiation. The mechanisms underlying steroid hormone-induced stromal cell proliferation and differentiation during decidualization are still poorly understood. Ribonucleotide reductase, consisting of two subunits (RRM1 and RRM2), is a rate-limiting enzyme in deoxynucleotide production for DNA synthesis and plays an important role in cell proliferation and tumorgenicity. Based on our microarray analysis, Rrm2 expression was significantly higher at implantation sites compared with interimplantation sites in mouse uterus. However, the expression, regulation, and function of RRM2 in mouse uterus during embryo implantation and decidualization are still unknown. Here we show that although both RRM1 and RRM2 expression are markedly induced in mouse uterine stromal cells undergoing decidualization, only RRM2 is regulated by progesterone, a key regulator of decidualization. Further studies showed that the induction of progesterone on RRM2 expression in stromal cells is mediated by the AKT/c-MYC pathway. RRM2 can also be induced by replication stress and DNA damage during decidualization through the ATR/ATM-CHK1-E2F1 pathway. The weight of implantation sites and deciduoma was effectively reduced by specific inhibitors for RRM2. The expression of decidual/trophoblast prolactin-related protein (Dtprp), a reliable marker for decidualization in mice, was significantly reduced in deciduoma and steroid-induced decidual cells after HU treatment. Therefore, RRM2 may be an important effector of progesterone signaling to induce cell proliferation and decidualization in mouse uterus. PMID:22403396

Qualitative analysis of how patients decide that they want risk-reducing mastectomy, and the implications for surgeons in responding to emotionally-motivated patient requests.

Science.gov (United States)

Brown, Stephen L; Whiting, Demian; Fielden, Hannah G; Saini, Pooja; Beesley, Helen; Holcombe, Christopher; Holcombe, Susan; Greenhalgh, Lyn; Fairburn, Louise; Salmon, Peter

2017-01-01

Contemporary approaches to medical decision-making advise that clinicians should respect patients' decisions. However, patients' decisions are often shaped by heuristics, such as being guided by emotion, rather than by objective risk and benefit. Risk-reducing mastectomy (RRM) decisions focus this dilemma sharply. RRM reduces breast cancer (BC) risk, but is invasive and can have iatrogenic consequences. Previous evidence suggests that emotion guides patients' decision-making about RRM. We interviewed patients to better understand how they made decisions about RRM, using findings to consider how clinicians could ethically respond to their decisions. Qualitative face-to-face interviews with 34 patients listed for RRM surgery and two who had decided against RRM. Patients generally did not use objective risk estimates or, indeed, consider risks and benefits of RRM. Instead emotions guided their decisions: they chose RRM because they feared BC and wanted to do 'all they could' to prevent it. Most therefore perceived RRM to be the 'obvious' option and made the decision easily. However, many recounted extensive post-decisional deliberation, generally directed towards justifying the original decision. A few patients deliberated before the decision because fears of surgery counterbalanced those of BC. Patients seeking RRM were motivated by fear of BC, and the need to avoid potential regret for not doing all they could to prevent it. We suggest that choices such as that for RRM, which are made emotionally, can be respected as autonomous decisions, provided patients have considered risks and benefits. Drawing on psychological theory about how people do make decisions, as well as normative views of how they should, we propose that practitioners can guide consideration of risks and benefits even, where necessary, after patients have opted for surgery. This model of practice could be extended to other medical decisions that are influenced by patients' emotions.

Qualitative analysis of how patients decide that they want risk-reducing mastectomy, and the implications for surgeons in responding to emotionally-motivated patient requests.

Directory of Open Access Journals (Sweden)

Stephen L Brown

Full Text Available Contemporary approaches to medical decision-making advise that clinicians should respect patients' decisions. However, patients' decisions are often shaped by heuristics, such as being guided by emotion, rather than by objective risk and benefit. Risk-reducing mastectomy (RRM decisions focus this dilemma sharply. RRM reduces breast cancer (BC risk, but is invasive and can have iatrogenic consequences. Previous evidence suggests that emotion guides patients' decision-making about RRM. We interviewed patients to better understand how they made decisions about RRM, using findings to consider how clinicians could ethically respond to their decisions.Qualitative face-to-face interviews with 34 patients listed for RRM surgery and two who had decided against RRM.Patients generally did not use objective risk estimates or, indeed, consider risks and benefits of RRM. Instead emotions guided their decisions: they chose RRM because they feared BC and wanted to do 'all they could' to prevent it. Most therefore perceived RRM to be the 'obvious' option and made the decision easily. However, many recounted extensive post-decisional deliberation, generally directed towards justifying the original decision. A few patients deliberated before the decision because fears of surgery counterbalanced those of BC.Patients seeking RRM were motivated by fear of BC, and the need to avoid potential regret for not doing all they could to prevent it. We suggest that choices such as that for RRM, which are made emotionally, can be respected as autonomous decisions, provided patients have considered risks and benefits. Drawing on psychological theory about how people do make decisions, as well as normative views of how they should, we propose that practitioners can guide consideration of risks and benefits even, where necessary, after patients have opted for surgery. This model of practice could be extended to other medical decisions that are influenced by patients' emotions.

RNA Binding of T-cell Intracellular Antigen-1 (TIA-1) C-terminal RNA Recognition Motif Is Modified by pH Conditions*

Science.gov (United States)

Cruz-Gallardo, Isabel; Aroca, Ángeles; Persson, Cecilia; Karlsson, B. Göran; Díaz-Moreno, Irene

2013-01-01

T-cell intracellular antigen-1 (TIA-1) is a DNA/RNA-binding protein that regulates critical events in cell physiology by the regulation of pre-mRNA splicing and mRNA translation. TIA-1 is composed of three RNA recognition motifs (RRMs) and a glutamine-rich domain and binds to uridine-rich RNA sequences through its C-terminal RRM2 and RRM3 domains. Here, we show that RNA binding mediated by either isolated RRM3 or the RRM23 construct is controlled by slight environmental pH changes due to the protonation/deprotonation of TIA-1 RRM3 histidine residues. The auxiliary role of the C-terminal RRM3 domain in TIA-1 RNA recognition is poorly understood, and this work provides insight into its binding mechanisms. PMID:23902765

Structure, dynamics and RNA binding of the multi-domain splicing factor TIA-1

Science.gov (United States)

Wang, Iren; Hennig, Janosch; Jagtap, Pravin Kumar Ankush; Sonntag, Miriam; Valcárcel, Juan; Sattler, Michael

2014-01-01

Alternative pre-messenger ribonucleic acid (pre-mRNA) splicing is an essential process in eukaryotic gene regulation. The T-cell intracellular antigen-1 (TIA-1) is an apoptosis-promoting factor that modulates alternative splicing of transcripts, including the pre-mRNA encoding the membrane receptor Fas. TIA-1 is a multi-domain ribonucleic acid (RNA) binding protein that recognizes poly-uridine tract RNA sequences to facilitate 5′ splice site recognition by the U1 small nuclear ribonucleoprotein (snRNP). Here, we characterize the RNA interaction and conformational dynamics of TIA-1 by nuclear magnetic resonance (NMR), isothermal titration calorimetry (ITC) and small angle X-ray scattering (SAXS). Our NMR-derived solution structure of TIA-1 RRM2–RRM3 (RRM2,3) reveals that RRM2 adopts a canonical RNA recognition motif (RRM) fold, while RRM3 is preceded by an non-canonical helix α0. NMR and SAXS data show that all three RRMs are largely independent structural modules in the absence of RNA, while RNA binding induces a compact arrangement. RRM2,3 binds to pyrimidine-rich FAS pre-mRNA or poly-uridine (U9) RNA with nanomolar affinities. RRM1 has little intrinsic RNA binding affinity and does not strongly contribute to RNA binding in the context of RRM1,2,3. Our data unravel the role of binding avidity and the contributions of the TIA-1 RRMs for recognition of pyrimidine-rich RNAs. PMID:24682828

Modulation of the ribonucleotide reductase M1-gemcitabine interaction in vivo by N-ethylmaleimide

Energy Technology Data Exchange (ETDEWEB)

Chen, Zhengming; Zhou, Jun; Zhang, Yingtao [Developmental Therapeutics Program, Karmanos Cancer Institute, Detroit, MI (United States); Bepler, Gerold, E-mail: beplerg@karmanos.org [Developmental Therapeutics Program, Karmanos Cancer Institute, Detroit, MI (United States)

2011-09-23

Highlights: {yields} Gemcitabine induces a RRM1 conformational change in tumor cell lines and xenografts. {yields} The 110 kDa RRM1 is unique to gemcitabine interaction among 12 cytotoxic agents. {yields} The 110 kDa RRM1 can be stabilized by the thiol alkylator N-ethylmaleimide. {yields} C218A, C429A, and E431A mutations in RRM1 abolished the conformational change. {yields} The 110 kDa RRM1 may be a specific biomarker of gemcitabine's therapeutic efficacy. -- Abstract: Ribonucleotide reductase M1 (RRM1) is the regulatory subunit of the holoenzyme that catalyzes the conversion of ribonucleotides to 2'-deoxyribonucleotides. Its function is indispensible in cell proliferation and DNA repair. It also serves as a biomarker of therapeutic efficacy of the antimetabolite drug gemcitabine (2',2'-difluoro-2'-deoxycytidine) in various malignancies. However, a mechanistic explanation remains to be determined. This study investigated how the alkylating agent N-ethylmaleimide (NEM) interacts with the inhibitory activity of gemcitabine on its target protein RRM1 in vivo. We found, when cells were treated with gemcitabine in the presence of NEM, a novel 110 kDa band, along with the 90 kDa native RRM1 band, appeared in immunoblots. This 110 kDa band was identified as RRM1 by mass spectrometry (LC-MS/MS) and represented a conformational change resulting from covalent labeling by gemcitabine. It is specific to gemcitabine/NEM, among 11 other chemotherapy drugs tested. It was also detectable in human tumor xenografts in mice treated with gemcitabine. Among mutations of seven residues essential for RRM1 function, C218A, C429A, and E431A abolished the conformational change, while N427A, C787A, and C790A diminished it. C444A was unique since it was able to alter the conformation even in absence of gemcitabine treatment. We conclude that the thiol alkylator NEM can stabilize the gemcitabine-induced conformational change of RRM1, and this stabilized RRM1

Modulation of the ribonucleotide reductase M1-gemcitabine interaction in vivo by N-ethylmaleimide

International Nuclear Information System (INIS)

Chen, Zhengming; Zhou, Jun; Zhang, Yingtao; Bepler, Gerold

2011-01-01

Highlights: → Gemcitabine induces a RRM1 conformational change in tumor cell lines and xenografts. → The 110 kDa RRM1 is unique to gemcitabine interaction among 12 cytotoxic agents. → The 110 kDa RRM1 can be stabilized by the thiol alkylator N-ethylmaleimide. → C218A, C429A, and E431A mutations in RRM1 abolished the conformational change. → The 110 kDa RRM1 may be a specific biomarker of gemcitabine's therapeutic efficacy. -- Abstract: Ribonucleotide reductase M1 (RRM1) is the regulatory subunit of the holoenzyme that catalyzes the conversion of ribonucleotides to 2'-deoxyribonucleotides. Its function is indispensible in cell proliferation and DNA repair. It also serves as a biomarker of therapeutic efficacy of the antimetabolite drug gemcitabine (2',2'-difluoro-2'-deoxycytidine) in various malignancies. However, a mechanistic explanation remains to be determined. This study investigated how the alkylating agent N-ethylmaleimide (NEM) interacts with the inhibitory activity of gemcitabine on its target protein RRM1 in vivo. We found, when cells were treated with gemcitabine in the presence of NEM, a novel 110 kDa band, along with the 90 kDa native RRM1 band, appeared in immunoblots. This 110 kDa band was identified as RRM1 by mass spectrometry (LC-MS/MS) and represented a conformational change resulting from covalent labeling by gemcitabine. It is specific to gemcitabine/NEM, among 11 other chemotherapy drugs tested. It was also detectable in human tumor xenografts in mice treated with gemcitabine. Among mutations of seven residues essential for RRM1 function, C218A, C429A, and E431A abolished the conformational change, while N427A, C787A, and C790A diminished it. C444A was unique since it was able to alter the conformation even in absence of gemcitabine treatment. We conclude that the thiol alkylator NEM can stabilize the gemcitabine-induced conformational change of RRM1, and this stabilized RRM1 conformation has the potential to serve as a specific

Biological effects of a de novo designed myxoma virus peptide analogue: evaluation of cytotoxicity on tumor cells.

Directory of Open Access Journals (Sweden)

Taghrid S Istivan

Full Text Available BACKGROUND: The Resonant Recognition Model (RRM is a physico-mathematical model that interprets protein sequence linear information using digital signal processing methods. In this study the RRM concept was employed for structure-function analysis of myxoma virus (MV proteins and the design of a short bioactive therapeutic peptide with MV-like antitumor/cytotoxic activity. METHODOLOGY/PRINCIPAL FINDINGS: The analogue RRM-MV was designed by RRM as a linear 18 aa 2.3 kDa peptide. The biological activity of this computationally designed peptide analogue against cancer and normal cell lines was investigated. The cellular cytotoxicity effects were confirmed by confocal immunofluorescence microscopy, by measuring the levels of cytoplasmic lactate dehydrogenase (LDH and by Prestoblue cell viability assay for up to 72 hours in peptide treated and non-treated cell cultures. Our results revealed that RRM-MV induced a significant dose and time-dependent cytotoxic effect on murine and human cancer cell lines. Yet, when normal murine cell lines were similarly treated with RRM-MV, no cytotoxic effects were observed. Furthermore, the non-bioactive RRM designed peptide RRM-C produced negligible cytotoxic effects on these cancer and normal cell lines when used at similar concentrations. The presence/absence of phosphorylated Akt activity in B16F0 mouse melanoma cells was assessed to indicate the possible apoptosis signalling pathway that could be affected by the peptide treatment. So far, Akt activity did not seem to be significantly affected by RRM-MV as is the case for the original viral protein. CONCLUSIONS/SIGNIFICANCE: Our findings indicate the successful application of the RRM concept to design a bioactive peptide analogue (RRM-MV with cytotoxic effects on tumor cells only. This 2.345 kDa peptide analogue to a 49 kDa viral protein may be suitable to be developed as a potential cancer therapeutic. These results also open a new direction to the rational

77 FR 38770 - Notice of Consortium on “nSoft Consortium”

Science.gov (United States)

2012-06-29

... Development Agreement (``CRADA'') with NIST. Membership is limited to 40 for-profit institutions and 15 not... by Member to NIST at the time of CRADA execution and annually in August thereafter. For-profit... Thousand ($10,000), payable at the time of CRADA execution. Subsequent membership payments of Twenty...

77 FR 25488 - Cooperative Research and Development Agreement: Federally Integrated Communications System

Science.gov (United States)

2012-04-30

... Cooperative Research and Development Agreement (CRADA) with General Dynamics C4 Systems, Inc. to lab.... The Coast Guard invites public comment on the proposed CRADA, and also invites other potential non... material on the proposed CRADA must either be submitted to our online docket via http://www.regulations.gov...

77 FR 71211 - Request for Information: Establish a Public-Private Collaboration, “Drug Development Initiative...

Science.gov (United States)

2012-11-29

... Agreement (CRADA) under the authority of the Federal Technology Transfer Act of 1986 (FTTA), Public Law 99-502, codified as amended in scattered sections of title 15, United States Code (U.S.C.). The CRADA... DDI focused on new pharmacological treatments for PTSD. Collaborations will be delineated via a CRADA...

Cooperative Research and Development Agreement Final Report for Cooperative Research and Development Agreement Number ORNL93-0237 Adhesive Bonding Technologies for Automotive Structural Composites; TOPICAL

International Nuclear Information System (INIS)

Boeman, R.G.

2001-01-01

In 1993, the Oak Ridge National Laboratory (ORNL) entered into a Cooperative Research and Development Agreement (CRADA) with the Automotive Composites Consortium (ACC) to conduct research and development that would overcome technological hurdles to the adhesive bonding of current and future automotive materials. This effort is part of a larger Department of Energy (DOE) program to promote the use of lighter weight materials in automotive structures for the purpose of increasing fuel efficiency and reducing environmental pollutant emissions. In accomplishing this mission, the bonding of similar and dissimilar materials was identified as being of primary importance to the automotive industry since this enabling technology would give designers the freedom to choose from an expanded menu of low mass materials for component weight reduction. The research undertaken under this CRADA addresses the following areas of importance: bulk material characterization, structural fracture mechanics, modeling/characterization, process control and nondestructive evaluation (PC/NDE), manufacturing demonstration, and advanced processing. For the bulk material characterization task, the individual material properties of the adherends and adhesives were characterized. This included generating a database of mechanical and physical properties, after identifying and developing standard test methods to obtain properties. The structural fracture mechanics task concentrated on test development to characterize the fracture toughness of adhesively bonded joints subjected to Mode I, Mode II and mixed-mode conditions. Standard test procedures for quantifying an adhesive/adherend system's resistance to crack growth were developed for use by industry. In the modeling/characterization task, fracture mechanics-based design guidelines and predictive methodologies have been developed which will facilitate iteration on design concepts for bonded joints while alleviating the need for extensive testing

Structure of the central RNA recognition motif of human TIA-1 at 1.95 A resolution

International Nuclear Information System (INIS)

Kumar, Amit O.; Swenson, Matthew C.; Benning, Matthew M.; Kielkopf, Clara L.

2008-01-01

T-cell-restricted intracellular antigen-1 (TIA-1) regulates alternative pre-mRNA splicing in the nucleus, and mRNA translation in the cytoplasm, by recognizing uridine-rich sequences of RNAs. As a step towards understanding RNA recognition by this regulatory factor, the X-ray structure of the central RNA recognition motif (RRM2) of human TIA-1 is presented at 1.95 A resolution. Comparison with structurally homologous RRM-RNA complexes identifies residues at the RNA interfaces that are conserved in TIA-1-RRM2. The versatile capability of RNP motifs to interact with either proteins or RNA is reinforced by symmetry-related protein-protein interactions mediated by the RNP motifs of TIA-1-RRM2. Importantly, the TIA-1-RRM2 structure reveals the locations of mutations responsible for inhibiting nuclear import. In contrast with previous assumptions, the mutated residues are buried within the hydrophobic interior of the domain, where they would be likely to destabilize the RRM fold rather than directly inhibit RNA binding

Dual Manifold System for Arraying Biomolecules; FINAL

International Nuclear Information System (INIS)

Doktycz, M.J.

2001-01-01

The objective of this CRADA is to establish a new approach to fluid transfer and array construction. This new approach will involve a high-speed, multiplexed fluid distribution valve and ink jet valves. It will enable the parallel handling of multiple reagents for a system that will have multiple applications in addition to the high-speed construction of microarrays. The primary tasks involve proof of principle experiments aimed at establishing key components of the technology and evaluating various optional configurations. The basic platform for evaluating the technology will be set-up by the Contractor at Oak Ridge National Laboratory (ORNL) and will employ custom valving prepared by Rheodyne. The test platform will consist of a motion controller, 3-axes of motion, software, and pneumatic control; and will be used to evaluate the hybrid valve

Electrically Heated Afterburner Final Report CRADA No. TC-0537-93

Energy Technology Data Exchange (ETDEWEB)

Vernazza, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gehrman, F. H. [Retech Services, Inc., Ukiah, CA (United States)

2018-01-24

This project was established as a three-year collaboration to develop and improve an innovative hazardous waste-processing system via the addition of an electrically heated afterburner. The fundamental objective of this project was comprehensive engineering of a plasma-fired afterburner with the goal of delivering a scaled demonstration model to process the gaseous effluent from a Plasma Arc Centrifugal Treatment (PACT) system. The first stage PACT technology has been already well developed by Retech Services, Inc. (Retech).

Improved Fiber Optics Final Report CRADA No. TSB-957-94

Energy Technology Data Exchange (ETDEWEB)

Fox, Glenn [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Univ. of California, Livermore, CA (United States); Wilford, Sandy [Lumenyte futemational Corporation (LIC), Irvine, CA (United States)

2018-01-22

The existing chemistry of Lumenyte® (an illumination fiber optic developed by LIC) was such that the component monomers inherently polymerized to a very hard mass if exposed to environmental IR, UV, or a combination of these frequencies. Lumenyte optic also would cure to a hard mass by exposure to the UV & IR generated by the illuminating lamps-although this could occur at a much slower rate, and the hardening could occur even when the adverse frequencies were filtered. The resultant product did not have the flexibility for the required applications. LIC's objective was to include other monomeric components in the formulation to impart permanent flexibility. LIC sought the expertise and the use of the facilities in the Polymeric Materials Section at LLNL to achieve this objective.

Laser Shot Peening Final Report CRADA No. TC-02059-03

Energy Technology Data Exchange (ETDEWEB)

Stuart, B. C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hackel, L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-27

This was a collaborative effort between The Regents of the University of California, Lawrence Livermore National Laboratory (LLNL) and Metal Improvement Company, Inc. (MIC), to further develop the laser shot peening technology. This project had an emphasis on laser development and government and military applications including DOE’s natural gas and oil technology program (NGOTP), Yucca Mountain Project (YMP), F-22 Fighter, etc.

Artificial Retina Project: Final Report for CRADA ORNL 01-0625

Energy Technology Data Exchange (ETDEWEB)

Greenbaum, E; Little, J [Second Sight Medical Products

2011-09-01

The U.S. Department of Energy’s Artificial Retina Project is a collaborative, multi-institutional effort to develop an implantable microelectronic retinal prosthesis that restores useful vision to people blinded by retinal diseases. The ultimate goal of the project is to restore reading ability, facial recognition, and unaided mobility in people with retinitis pigmentosa and age-related macular degeneration. The project taps into the unique research technologies and resources developed at DOE national laboratories to surmount the many technical challenges involved with developing a safe, effective, and durable product. The research team includes six DOE national laboratories, four universities, and private industry.

Electron Beam Curing of Polymer Matrix Composites - CRADA Final Report

Energy Technology Data Exchange (ETDEWEB)

Janke, C. J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Howell, Dave [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Norris, Robert E. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

1997-05-01

The major cost driver in manufacturing polymer matrix composite (PMC) parts and structures, and one of the elements having the greatest effect on their quality and performance, is the standard thermal cure process. Thermal curing of PMCs requires long cure times and high energy consumption, creates residual thermal stresses in the part, produces volatile toxic by-products, and requires expensive tooling that is tolerant of the high cure temperatures.

Infrared Imaging Camera Final Report CRADA No. TC02061.0

Energy Technology Data Exchange (ETDEWEB)

Roos, E. V. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Nebeker, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-08

This was a collaborative effort between the University of California, Lawrence Livermore National Laboratory (LLNL) and Cordin Company (Cordin) to enhance the U.S. ability to develop a commercial infrared camera capable of capturing high-resolution images in a l 00 nanoseconds (ns) time frame. The Department of Energy (DOE), under an Initiative for Proliferation Prevention (IPP) project, funded the Russian Federation Nuclear Center All-Russian Scientific Institute of Experimental Physics (RFNC-VNIIEF) in Sarov. VNIIEF was funded to develop a prototype commercial infrared (IR) framing camera and to deliver a prototype IR camera to LLNL. LLNL and Cordin were partners with VNIIEF on this project. A prototype IR camera was delivered by VNIIEF to LLNL in December 2006. In June of 2007, LLNL and Cordin evaluated the camera and the test results revealed that the camera exceeded presently available commercial IR cameras. Cordin believes that the camera can be sold on the international market. The camera is currently being used as a scientific tool within Russian nuclear centers. This project was originally designated as a two year project. The project was not started on time due to changes in the IPP project funding conditions; the project funding was re-directed through the International Science and Technology Center (ISTC), which delayed the project start by over one year. The project was not completed on schedule due to changes within the Russian government export regulations. These changes were directed by Export Control regulations on the export of high technology items that can be used to develop military weapons. The IR camera was on the list that export controls required. The ISTC and Russian government, after negotiations, allowed the delivery of the camera to LLNL. There were no significant technical or business changes to the original project.

Textile Resource Conservation Final Report CRADA No. TC-0699-93

Energy Technology Data Exchange (ETDEWEB)

Cooper, John [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McCreight, Dan J. [Institute of Textile Technology, Charlottesville, VA (United States)

2018-01-22

This project was undertaken to develop and demonstrate on a pilot scale the use of electro-osmotic transport to increase the efficiency of textiles wet processing operations. In particular, we sought to develop a means of rinsing textiles to remove material entrapped between the individual fibers that constitute a yarn. Material trapped within the yarn is slow to exchange with rinse water flowing primarily in the open weave are abetween the yarns. The application of an external field (strength, 5-50 kV /m) requires only a few volts for most fabric thicknesses. This field is sufficient to promote a rapid exchange of material to enhance rinsing and reduce the water required for rinsing from about 20 kg/kg-fabric to 3-6 kg/kg-fabric. We successfully developed technical and economic models of application of the process to the rinsing of many materials of industrial importance, including dyes, tints, chemicals, detergents and dye electrolytes. We demonstrated the process on a pilot plant scale using a translator designed in cooperation with Milliken and Company (Spartanburg, SC).

HCCI Combustion Engines Final Report CRADA No. TC02032.0

Energy Technology Data Exchange (ETDEWEB)

Aceves, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Lyford-Pike, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-08

This was a collaborative effort between Lawrence Livermore National Security, LLC (formerly The Regents of the University of California)/Lawrence Livermore National Laboratory (LLNL) and Cummins Engine Company (Cwnmins), to advance the state of the art on HomogeneousCharge Compression-Ignition (HCCI) engines, resulting in a clean, high-efficiency alternative to diesel engines.

An Assessment of Risk and Risk Management Information Disclosure of Companies Listed in Nasdaq OMX Baltic and Euronext Brussels

Directory of Open Access Journals (Sweden)

Dalia Kolmatsui

2016-09-01

Full Text Available The main goal of this paper is to discuss theoretically and to evaluate empirically the differences of risk and risk management information disclosure (RRMID among companies listed in Nasdaq OMX Baltic and Euronext Brussels and to determine factors influencing such differences. The authors use analysis and systemization of scientific literature, induction, content analysis and coding procedure for risk and risk management information disclosure assessment, as well as correlation and regression analyses. The results suggest that companies listed in Euronext Brussels disclose more risk and risk management (RRM information; RRM related disclosures are more qualitative, focused on past or present events and have a neutral meaning in both markets. Companies also disclose more information about risks themselves than about risk management. Finally, only companies’ size and presence of audit committee are significant factors influencing RRMID.

Oak Ridge National Laboratory Wireless Charging of Electric Vehicles - CRADA Report

Energy Technology Data Exchange (ETDEWEB)

Onar, Omer C [ORNL; Campbell, Steven L [ORNL; Seiber, Larry Eugene [ORNL; White, Cliff P [ORNL; Chinthavali, Madhu Sudhan [ORNL; Tang, Lixin [ORNL; Chambon, Paul H [ORNL; Ozpineci, Burak [ORNL; Smith, David E [ORNL

2016-06-20

Wireless power transfer (WPT) is a paradigm shift in electric-vehicle (EV) charging that offers the consumer an autonomous, safe, and convenient option to conductive charging and its attendant need for cables. With WPT, charging process can be fully automated due to the vehicle and grid side radio communication systems, and is non-contacting; therefore issues with leakage currents, ground faults, and touch potentials do not exist. It also eliminates the need for touching the heavy, bulky, dirty cables and plugs. It eliminates the fear of forgetting to plug-in and running out of charge the following day and eliminates the tripping hazards in public parking lots and in highly populated areas such as shopping malls, recreational areas, parking buildings, etc. Furthermore, the high-frequency magnetic fields employed in power transfer across a large air gap are focused and shielded, so that fringe fields (i.e., magnetic leakage/stray fields) attenuate rapidly over a transition region to levels well below limits set by international standards for the public zone (which starts at the perimeter of the vehicle and includes the passenger cabin). Oak Ridge National Laboratory s approach to WPT charging places strong emphasis on radio communications in the power regulation feedback channel augmented with software control algorithms. The over-arching goal for WPT is minimization of vehicle on-board complexity by keeping the secondary side content confined to coil tuning, rectification, filtering, and interfacing to the regenerative energy-storage system (RESS). This report summarizes the CRADA work between the Oak Ridge National Laboratory and the Toyota Research Institute of North America, Toyota Motor Engineering and Manufacturing North America (TEMA) on the wireless charging of electric vehicles which was funded by Department of Energy under DE-FOA-000667. In this project, ORNL is the lead agency and Toyota TEMA is one of the major partners. Over the course of the project

CRADA Final Report for CRADA Number ORNL98-0521 : Development of an Electric Bus Inverter Based on ORNL Auxiliary Resonant Tank (ART) Soft-Switching Technology; TOPICAL

International Nuclear Information System (INIS)

Ayers, C.W.

2001-01-01

The Power Electronics and Electric Machinery Research Center (PEEMRC) of Oak Ridge National Laboratory (ORNL) has for many years been developing technologies for power converters for motor drives and many other applications. Some of the research goals are to improve efficiency and reduce audible and electromagnetic interference noise generation for inverters and the driven loads. The converters are being required to produce more power with reduced weight and volume, which requires improvements in heat removal from the electronics, as well as improved circuit designs that have fewer electrical losses. PEEMRC has recently developed and patented a soft-switching inverter topology called an Auxiliary Resonant Tank (ART), and this design has been tested and proven at ORNL using a 10-kW laboratory prototype. The objective of this project was to develop, test, and install the ART inverter technology in an electric transit bus with the final goal of evaluating performance of the ORNL inverter under field conditions in a vehicle. A scaled-up inverter with the capacity to drive a 22-e bus was built based on the 10-kW ORNL laboratory prototype ART soft-switching inverter. Most (if not all) commercially available inverters for traction drive and other applications use hard-switching inverters. A Cooperative Research and Development Agreement was established with the Chattanooga Area Regional Transit Authority (CARTA), the Electric Transit Vehicle Institute (ETVI), and Advanced Vehicle Systems (AVS), all of Chattanooga, along with ORNL. CARTA, which maintains and operates the public transit system in Chattanooga, provided an area for testing the vehicle alongside other similar vehicles in the normal operating environment. ETVI offers capabilities in standardized testing and reporting and also provides exposure in the electric transit vehicle arena for ORNL's technologies. The third Chattanooga partner, (AVS) manufactures all-electric and hybrid electric transit buses using

A Deterministic and Probabilistic Cost Estimate for Nuclear Power Plants

International Nuclear Information System (INIS)

Ha, Gag Kyeon; Kwon, Jong Jooh

2005-01-01

There are many cost estimate methodologies for some future projects. Revenue Requirement Method (RRM), Cost/Benefit Ratio method, Return on Investment, Pay Back Period Method. etc. This paper uses the RRM method which is the amount of revenue that must be collected from customers to compensate a utility for all expenditures associated with implementing an alternative decision involving money. This RRM can be combined with a random sampling statistical simulation computer program to calculated the Probability Distribution Functions(PDF) of the cost elements for generating cost. EPRI developed this combined statistical techniques into RRM, named Statistical Revenue Requirement Method(SRRM). The statistical technique is a random sampling statistical simulation. The simulation tool is usually Monte Carlo sampling, Latin Latin Hypercube sampling, etc. SRRM is used to estimating for future power plants, apartments, hospital, marketing, etc. In this paper, RRM calculation and SRRM simulation have been practiced for PWR1400MWe nuclear power plants

A Lagrangian meshfree method applied to linear and nonlinear elasticity.

Science.gov (United States)

Walker, Wade A

2017-01-01

The repeated replacement method (RRM) is a Lagrangian meshfree method which we have previously applied to the Euler equations for compressible fluid flow. In this paper we present new enhancements to RRM, and we apply the enhanced method to both linear and nonlinear elasticity. We compare the results of ten test problems to those of analytic solvers, to demonstrate that RRM can successfully simulate these elastic systems without many of the requirements of traditional numerical methods such as numerical derivatives, equation system solvers, or Riemann solvers. We also show the relationship between error and computational effort for RRM on these systems, and compare RRM to other methods to highlight its strengths and weaknesses. And to further explain the two elastic equations used in the paper, we demonstrate the mathematical procedure used to create Riemann and Sedov-Taylor solvers for them, and detail the numerical techniques needed to embody those solvers in code.

Psychological factors associated with the intention to choose for risk-reducing mastectomy in family cancer clinic attendees.

Science.gov (United States)

van Driel, C M G; Oosterwijk, J C; Meijers-Heijboer, E J; van Asperen, C J; Zeijlmans van Emmichoven, I A; de Vries, J; Mourits, M J E; Henneman, L; Timmermans, D R M; de Bock, G H

2016-12-01

Women seeking counseling because of familial breast cancer occurrence face difficult decisions, such as whether and when to opt for risk-reducing mastectomy (RRM) in case of BRCA1/2 mutation. Only limited research has been done to identify the psychological factors associated with the decision for RRM. This study investigated which psychological factors are related to the intention to choose for RRM. A cohort of 486 cancer-unaffected women with a family history of breast cancer completed the following questionnaires prior to genetic counseling: the Cancer Worry Scale, Positive And Negative Affect Scale, Perceived Personal Control Scale, Hospital Anxiety and Depression Scale and State Anxiety Scale and questions regarding socio-demographic characteristics, family history, risk perception and RRM intention. Multivariate logistic regression was used to analyze the relation between psychological factors and women's intention to choose for RRM. Factors associated with RRM intention were high positive affect (OR = 1.86, 95%CI = 1.12-3.08), high negative affect (OR = 2.52, 95%CI = 1.44-4.43), high cancer worry (OR = 1.65, 95%CI = 1.00-2.72), high perceived personal control (OR = 3.58, 95%CI = 2.18-5.89), high risk-perception (OR = 1.85, 95%CI = 1.15-2.95) and having children (OR = 2.06, 95%CI = 1.21-3.50). Negative and positive affects play an important role in the intention for RRM. Furthermore, perceived personal control over the situation is associated with an intention for RRM. In addition to focusing on accurate risk communication, counseling should pay attention to the influence of perceived control and emotions to facilitate decision-making. Copyright © 2016 Elsevier Ltd. All rights reserved.

Chemical shift assignments of the first and second RRMs of Nrd1, a fission yeast MAPK-target RNA binding protein.

Science.gov (United States)

Kobayashi, Ayaho; Kanaba, Teppei; Satoh, Ryosuke; Ito, Yutaka; Sugiura, Reiko; Mishima, Masaki

2017-10-01

Negative regulator differentiation 1 (Nrd1), a fission yeast RNA binding protein, modulates cytokinesis and sexual development and contributes to stress granule formation in response to environmental stresses. Nrd1 comprises four RRM domains and binds and stabilizes Cdc4 mRNA that encodes the myosin II light chain. Nrd1 binds the Cpc2 fission-yeast RACK1 homolog, and the interaction promotes Nrd1 localization to stress granules. Interestingly, Pmk1 mitogen-activated protein kinase phosphorylates Thr40 in the unstructured N-terminal region and Thr126 in the first RRM domain of Nrd1. Phosphorylation significantly reduces RNA-binding activity and likely modulates Nrd1 function. To reveal the relationship between the structure and function of Nrd1 and how phosphorylation affects structure, we used heteronuclear NMR techniques to investigate the three-dimensional structure of Nrd1. Here we report the 1 H, 13 C, and 15 N resonance assignments of RRM1-RRM2 (residues 108-284) comprising the first and second RRMs obtained using heteronuclear NMR techniques. Secondary structures derived from the chemical shifts are reported. These data should contribute to the understanding of the three-dimensional structure of the RRM1-RRM2 region of Nrd1 and the perturbation caused by phosphorylation.

Remedial Action Plan and Site design for stabilization of the inactive Uranium Mill Tailings sites at Slick Rock, Colorado: Revision 1. Remedial action selection report, Attachment 2, geology report, Attachment 3, ground water hydrology report, Attachment 4, water resources protection strategy. Final

Energy Technology Data Exchange (ETDEWEB)

NONE

1995-09-01

The Slick Rock uranium mill tailings sites are located near the small community of Slick Rock, in San Miguel County, Colorado. There are two designated Uranium Mill Tailings Remedial Action (UMTRA) Project sites at Slick Rock: the Union Carbide site and the North Continent site. Both sites are adjacent to the Dolores River. The sites contain former mill building concrete foundations, tailings piles, demolition debris, and areas contaminated by windblown and waterborne radioactive materials. The total estimated volume of contaminated materials is approximately 621,000 cubic yards (475,000 cubic meters). In addition to the contamination at the two processing site areas, 13 vicinity properties were contaminated. Contamination associated with the UC and NC sites has leached into ground water. Pursuant to the requirements of the Uranium Mill Tailings Radiation Control Act (UMTRCA) (42 USC {section}7901 et seq.), the proposed remedial action plan (RAP) will satisfy the final US Environmental Protection Agency (EPA) standards in 40 CFR Part 192 (60 FR 2854) for cleanup, stabilization, and control of the residual radioactive material (RRM) (tailings and other contaminated materials) at the disposal site at Burro Canyon. The requirements for control of the RRM (Subpart A) will be satisfied by the construction of an engineered disposal cell. The proposed remedial action will consist of relocating the uranium mill tailings, contaminated vicinity property materials, demolition debris, and windblown/weaterborne materials to a permanent repository at the Burro Canyon disposal site. The site is approximately 5 road mi (8 km) northeast of the mill sites on land recently transferred to the DOE by the Bureau of Land Management.

Remedial Action Plan and Site design for stabilization of the inactive Uranium Mill Tailings sites at Slick Rock, Colorado: Revision 1. Remedial action selection report, Attachment 2, geology report, Attachment 3, ground water hydrology report, Attachment 4, water resources protection strategy. Final

International Nuclear Information System (INIS)

1995-09-01

The Slick Rock uranium mill tailings sites are located near the small community of Slick Rock, in San Miguel County, Colorado. There are two designated Uranium Mill Tailings Remedial Action (UMTRA) Project sites at Slick Rock: the Union Carbide site and the North Continent site. Both sites are adjacent to the Dolores River. The sites contain former mill building concrete foundations, tailings piles, demolition debris, and areas contaminated by windblown and waterborne radioactive materials. The total estimated volume of contaminated materials is approximately 621,000 cubic yards (475,000 cubic meters). In addition to the contamination at the two processing site areas, 13 vicinity properties were contaminated. Contamination associated with the UC and NC sites has leached into ground water. Pursuant to the requirements of the Uranium Mill Tailings Radiation Control Act (UMTRCA) (42 USC section 7901 et seq.), the proposed remedial action plan (RAP) will satisfy the final US Environmental Protection Agency (EPA) standards in 40 CFR Part 192 (60 FR 2854) for cleanup, stabilization, and control of the residual radioactive material (RRM) (tailings and other contaminated materials) at the disposal site at Burro Canyon. The requirements for control of the RRM (Subpart A) will be satisfied by the construction of an engineered disposal cell. The proposed remedial action will consist of relocating the uranium mill tailings, contaminated vicinity property materials, demolition debris, and windblown/weaterborne materials to a permanent repository at the Burro Canyon disposal site. The site is approximately 5 road mi (8 km) northeast of the mill sites on land recently transferred to the DOE by the Bureau of Land Management

How You Can Partner with NIH | NCI Technology Transfer Center | TTC

Science.gov (United States)

NCI Technology Transfer Center (TTC) provides an array of agreements to support the National Cancer Institute's partnering. Deciding which type of agreement to use can be a challenge: CRADA, MTA, collaboration, agreement, CTA, Materials-CRADA

The crystal structure of the Split End protein SHARP adds a new layer of complexity to proteins containing RNA recognition motifs.

Science.gov (United States)

Arieti, Fabiana; Gabus, Caroline; Tambalo, Margherita; Huet, Tiphaine; Round, Adam; Thore, Stéphane

2014-06-01

The Split Ends (SPEN) protein was originally discovered in Drosophila in the late 1990s. Since then, homologous proteins have been identified in eukaryotic species ranging from plants to humans. Every family member contains three predicted RNA recognition motifs (RRMs) in the N-terminal region of the protein. We have determined the crystal structure of the region of the human SPEN homolog that contains these RRMs-the SMRT/HDAC1 Associated Repressor Protein (SHARP), at 2.0 Å resolution. SHARP is a co-regulator of the nuclear receptors. We demonstrate that two of the three RRMs, namely RRM3 and RRM4, interact via a highly conserved interface. Furthermore, we show that the RRM3-RRM4 block is the main platform mediating the stable association with the H12-H13 substructure found in the steroid receptor RNA activator (SRA), a long, non-coding RNA previously shown to play a crucial role in nuclear receptor transcriptional regulation. We determine that SHARP association with SRA relies on both single- and double-stranded RNA sequences. The crystal structure of the SHARP-RRM fragment, together with the associated RNA-binding studies, extend the repertoire of nucleic acid binding properties of RRM domains suggesting a new hypothesis for a better understanding of SPEN protein functions. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.

Clinical Trials Reference Materials and Related Links | Division of Cancer Prevention

Science.gov (United States)

Agreements Clinical Trials Agreement Confidential Disclosure Agreements Cooperative Research and Development Agreement (CRADA) - Research Plan Financial and Staffing Contribution of the Parties Exception or Modifications to the CRADA Human Subject Protection/Informed Consent Tutorials (or Education) |

Adaptive radar resource management

CERN Document Server

Moo, Peter

2015-01-01

Radar Resource Management (RRM) is vital for optimizing the performance of modern phased array radars, which are the primary sensor for aircraft, ships, and land platforms. Adaptive Radar Resource Management gives an introduction to radar resource management (RRM), presenting a clear overview of different approaches and techniques, making it very suitable for radar practitioners and researchers in industry and universities. Coverage includes: RRM's role in optimizing the performance of modern phased array radars The advantages of adaptivity in implementing RRMThe role that modelling and

Mosaic Transparent Armor System Final Report CRADA No. TC02162.0

Energy Technology Data Exchange (ETDEWEB)

Kuntz, J. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Breslin, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-29

This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and The Protective Group, Inc. (TPG) to improve the performance of the mosaic transparent armor system (MTAS) for transparent armor applications, military and civilian. LLNL was to provide the unique MTAS technology and designs to TPG for innovative construction and ballistic testing of improvements needed for current and near future application of the armor windows on vehicles and aircraft. The goal of the project was to advance the technology of MTAS to the point that these mosaic transparent windows would be introduced and commercially manufactured for military vehicles and aircraft.

Optimization of electron-cyclotron-resonance charge-breeder ions : Final CRADA Report

International Nuclear Information System (INIS)

Pardo, R.

2009-01-01

Measurements of 1+ beam properties and associated performance of ECR Charge Breeder source determined by total efficiency measurement and charge state distributions from the ECR Charge Breeder. These results were communicated to Far-Tech personnel who used them to benchmark the newly developed programs that model ion capture and charge breeding in the ECR Charge Breeder Source. Providing the basic data described above and in the discussion below to Far-Tech allowed them to improve and refine their calculational tools for ECR ion sources. These new tools will be offered for sale to industry and will also provide important guidance to other research labs developing Charge Breeding ion sources for radioactive beam physics research.

Carbon-carbon composites for orthopedic prosthesis and implants. CRADA final report

Energy Technology Data Exchange (ETDEWEB)

Burchell, T D; Klett, J W; Strizak, J P [Oak Ridge National Lab., TN (United States); Baker, C [FMI, Biddeford, ME (United States)

1998-01-21

The prosthetic implant market is extensive. For example, because of arthritic degeneration of hip and knee cartilage and osteoporotic fractures of the hip, over 200,000 total joint replacements (TJRs) are performed in the United States each year. Current TJR devices are typically metallic (stainless steel, cobalt, or titanium alloy) and are fixed in the bone with polymethylacrylate (PMMA) cement. Carbon-carbon composite materials offer several distinct advantages over metals for TJR prosthesis. Their mechanical properties can be tailored to match more closely the mechanical properties of human bone, and the composite may have up to 25% porosity, the size and distribution of which may be controlled through processing. The porous nature of carbon-carbon composites will allow for the ingrowth of bone, achieving biological fixation, and eliminating the need for PMMA cement fixation.

Breast Cancer Diagnostic System Final Report CRADA No. TC02098.0

Energy Technology Data Exchange (ETDEWEB)

Rubenchik, A. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); DaSilva, L. B. [BioTelligent, Inc., Livermore, CA (United States)

2017-09-06

This was a collaborative effort between Lawrence Livermore National Security, LLC (formerly The Regents of the University of California)/Lawrence Liver more National Laboratory (LLNL) and BioTelligent, Inc. together with a Russian Institution (BioFil, Ltd.), to develop a new system ( diagnostic device, operating procedures, algorithms and software) to accurately distinguish between benign and malignant breast tissue (Breast Cancer Diagnostic System, BCDS).

Rapidly Deployable Security System Final Report CRADA No. TC-2030-01

Energy Technology Data Exchange (ETDEWEB)

Kohlhepp, V. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Whiteman, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McKibben, M. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-28

The ultimate objective of the LEADER and LLNL strategic partnership was to develop and commercialize_a security-based system product and platform for the use in protecting the substantial physical and economic assets of the government and commerce of the United States. The primary goal of this project was to integrate video surveillance hardware developed by LLNL with a security software backbone developed by LEADER. Upon completion of the project, a prototype hardware/software security system that is highly scalable was to be demonstrated.

Letter to Eduard Smetanin, dated March 2, 2007: Final CRADA report

International Nuclear Information System (INIS)

Ehst, D.A.

2007-01-01

The IPP/DOE program office has finished its evaluation of the alpha-emitting isotope work with Kurchatov Institute and IPPE, and they have made an important decision about the future of this work. IPP/DOE has directed us to re-program the work and add more funds, so the emphasis will be on production of Th228. By making this re-direction of the isotope work, IPPE will see several important benefits: (a) the payments will be made faster to IPPE by using the ISTC Agreement; (b) a larger amount of money will be paid to IPPE; and (c) a profitable future business opportunity for IPPE is more probable.

ALPHA SMP SYSTEM(S) Final Report CRADA No. TC-1404-97

Energy Technology Data Exchange (ETDEWEB)

Seager, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Beaudet, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-16

Within the scope of this subcontract, Digital Equipment Corporation (DIGITAL) and the University, through the Lawrence Livermore National Laboratory (LLNL), engaged in joint research and development activities of mutual interest and benefit. The primary objectives of these activities were, for LLNL to improve its capability to perform its mission, and for DIGITAL to develop technical capability complimentary to this mission. The collaborative activities had direct manpower investments by DIGITAL and LLNL. The project was divided into four areas of concern, which were handled concurrently. These areas included Gang Scheduling, Numerical Methods, Applications Development and Code Development Tools.

Development of Rotational Accelerometers Final Report CRADA No. TSB-2008-99

Energy Technology Data Exchange (ETDEWEB)

Hunter, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Crosson, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-16

One of the difficulties in fabricating an inexpensive angular rate or rotation sensor is producing a device that is insensitive to acceleration, including the constant acceleration of gravity. The majority of rate sensors are either tuning fork type devices sensing a relatively weak force (i.e., Coriolis effect) and thus not very sensitive, or gyroscopes (either rotating or fiber optic based) that are large, consume lots of power and are expensive. This project was a collaborative effort between LLNL and The Fredericks Company to develop a rotational sensor as a standardized, commercial product. The Fredericks Company possessed expertise and capabilities in the technical aspects of manufacturing this type of sensor, and they were interested in collaborating with LLNL to manufacture the rotational rate sensors as a commercial product.

Automotive Airbag Safety Enhancement Final Report CRADA No. TSB-1165-95

Energy Technology Data Exchange (ETDEWEB)

Cutting, Jack [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Durrell, Robert [Quantic Industries, Inc., San Carlos, CA (United States)

2017-11-09

The Vehicle Safety systems (VSS) Division of Quantic Industries, Inc. (QII) manufactured automotive airbag components. When both the driver and the passenger side airbags inflated in a tightly sealed passenger compartment, the compression of the surrounding air could and, in some instances, would cause damage to the eardrums of the occupants. The Aerospace and Division (ADD) of QII had partially developed the technology to fracture the canopy of a jet aircraft at the time of pilot ejection. The technical problem was how to adapt the canopy fracturing technology to the rear window of a motor vehicle in a safe and cost effective manner. The existing approach was to replace the embedded rear window defroster with a series-parallel network of exploding bridge wires (EBWs). This would still provide the defrost function at low voltage/ current, but would cause fracturing of the window when a high current/voltage pulse was applied without pyrotechnics or explosives. The elements of this system were the embedded EBW network and a trunk-mounted fireset. The fireset would store the required energy to fire the network upon the receipt of a trigger signal from the existing air bag crash sensor.

Laser Drilling Development Trial Final Report CRADA No. TSB-1538-98

Energy Technology Data Exchange (ETDEWEB)

Hermann, M. R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hebbar, R. R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-11-01

This project performed various laser drilling tests to demonstrate femtosecond laser drilling of fuel injector nozzles with minimal recast, minimal heat affected zone and no collateral damage. LLNL had extensive experience in ultra short-pulse laser systems and developed specialized hardware for these applications.

Bipolar plate materials in molten carbonate fuel cells. Final CRADA report.

Energy Technology Data Exchange (ETDEWEB)

Krumpelt, M.

2004-06-01

Advantages of implementation of power plants based on electrochemical reactions are successfully demonstrated in the USA and Japan. One of the msot promising types of fuel cells (FC) is a type of high temperature fuel cells. At present, thanks to the efforts of the leading countries that develop fuel cell technologies power plants on the basis of molten carbonate fuel cells (MCFC) and solid oxide fuel cells (SOFC) are really close to commercialization. One of the problems that are to be solved for practical implementation of MCFC and SOFC is a problem of corrosion of metal components of stacks that are assembled of a number of fuel cells. One of the major components of MCFC and SOFC stacks is a bipolar separator plate (BSP) that performs several functions - it is separation of reactant gas flows sealing of the joints between fuel cells, and current collection from the surface of electrodes. The goal of Task 1 of the project is to develop new cost-effective nickel coatings for the Russian 20X23H18 steel for an MCFC bipolar separator plate using technological processes usually implemented to apply corrosion stable coatings onto the metal parts for products in the defense. There was planned the research on production of nickel coatings using different methods, first of all the galvanic one and the explosion cladding one. As a result of the works, 0.4 x 712 x 1296 mm plates coated with nickel on one side were to be made and passed to ANL. A line of 4 galvanic baths 600 liters was to be built for the galvanic coating applications. The goal of Task 2 of the project is the development of a new material of an MCFC bipolar separator plate with an upgraded corrosion stability, and development of a technology to produce cold roll sheets of this material the sizes of which will be 0.8 x 712x 1296 mm. As a result of these works, a pilot batch of the rolled material in sheets 0.8 x 712 x 1296 mm in size is to be made (in accordance with the norms and standards of the Russian metallurgical industry) and supplied to the partner for tests in a stack of fuel cells. A feasibility study on the cost of the Russian material for a BSP is to be done on Tasks 1, 2 in case the annual order makes up 400,000 sheets. The goal of Task 3 of the project is to research on possible implementation of cermet compositions on the basis of LiAlO{sub 2}, TiN, B{sub 4}C, ceramics with Ni and Ni-Mo binders. BaCeO{sub 3} conductive ceramics with metal binders of Ni, Ni-Cr etc. were also planned to be studied. As a result of these works, a pilot batch of samples is to be made and passed to FCE for tests. The goal of Task 4 of the Project is development of a new alloy or alloys with a ceramic coating that will have upgraded corrosion stability in operation within a SOFC. A new alloy was to be worked out by the way of modification of compositions of industrial alloys. Ceramic coatings are to be applied onto ferrite steel produced serially by iron and steel industry of Russia as sheet iron.

New Aqueous Binders for Lithium-ion Batteries

Energy Technology Data Exchange (ETDEWEB)

Jansen, Andrew N. [Argonne National Lab. (ANL), Argonne, IL (United States). Chemical Sciences and Engineering Division; Krumdick, Gregory K. [Argonne National Lab. (ANL), Argonne, IL (United States). Energy Systems Division; Trask, Stephen E. [Argonne National Lab. (ANL), Argonne, IL (United States). Chemical Sciences and Engineering Division; Polzin, Bryant J. [Argonne National Lab. (ANL), Argonne, IL (United States). Chemical Sciences and Engineering Division; Lu, Wenquan [Argonne National Lab. (ANL), Argonne, IL (United States). Chemical Sciences and Engineering Division; Kahvecioglu Feridun, Ozge [Argonne National Lab. (ANL), Argonne, IL (United States). Energy Systems Division; Hellring, Stuart D. [PPG Industries, Inc., Allison Park, PA (United States); Stewart, Matthew [PPG Industries, Inc., Allison Park, PA (United States); Kornish, Brian [PPG Industries, Inc., Allison Park, PA (United States)

2016-12-22

This final report summarizes the research effort of the CRADA between PPG Industries and Argonne National Laboratory (CRADA # C1400501 and Amendment 1 - ACK 85C11, Rev. 1), and completes the requirements of Task #5 in the CRADA. The results from Argonne represent a combined effort between the MERF and CAMP Facility (Materials Engineering Research Facility and the Cell Analysis, Modeling and Prototyping Facility). The key points of this report can be briefly summarized as: The multicomponent aqueous binder for NCM cathodes developed by PPG shows promising results when used on the CAMP Facility’s pilot-scale coater; NCM523 cathode electrodes exposed to water exhibit a voltage anomaly in the first two formation cycles that appears to have little effect on the material capacity, but needs to be explored further; the experimental LFP electrode produced by PPG does cycle electrochemically, but with reduced capacity and an uncharacteristic voltage profile; there is no obvious correlation between the pH and zeta-potential of materials that are commonly used in the lithium-ion battery; lithium ions are more readily dissolved out of NCM523 by water than the transition metals (by two orders of magnitude), and suggests that the plating bath may need to be spiked with a lithium salt; the approach of creating sub-micron size NCM523 particles via ball milling results in a cathode material with poor electrochemical performance.

Evaluation of Novel Semiconductor Materials Potentially Useful in Solar Cells: Cooperative Research and Development Final Report, CRADA number CRD-06-00172

Energy Technology Data Exchange (ETDEWEB)

Geisz, J.

2010-07-01

Evaluation of novel semiconductor materials potentially useful in solar cells. NREL will fabricate, test and analyze solar cells from EpiWorks' wafers produced in 2-3 separate growth campaigns. NREL will also characterize material from 2-3 separate EpiWorks material development campaigns. Finally, NREL will visit EpiWorks and help establish any necessary process, such as spectral CV measurements and III-V on Si metalization processes and help validate solar cell designs and performance.

Three RNA recognition motifs participate in RNA recognition and structural organization by the pro-apoptotic factor TIA-1

Science.gov (United States)

Bauer, William J.; Heath, Jason; Jenkins, Jermaine L.; Kielkopf, Clara L.

2012-01-01

T-cell intracellular antigen-1 (TIA-1) regulates developmental and stress-responsive pathways through distinct activities at the levels of alternative pre-mRNA splicing and mRNA translation. The TIA-1 polypeptide contains three RNA recognition motifs (RRMs). The central RRM2 and C-terminal RRM3 associate with cellular mRNAs. The N-terminal RRM1 enhances interactions of a C-terminal Q-rich domain of TIA-1 with the U1-C splicing factor, despite linear separation of the domains in the TIA-1 sequence. Given the expanded functional repertoire of the RRM family, it was unknown whether TIA-1 RRM1 contributes to RNA binding as well as documented protein interactions. To address this question, we used isothermal titration calorimetry and small-angle X-ray scattering (SAXS) to dissect the roles of the TIA-1 RRMs in RNA recognition. Notably, the fas RNA exhibited two binding sites with indistinguishable affinities for TIA-1. Analyses of TIA-1 variants established that RRM1 was dispensable for binding AU-rich fas sites, yet all three RRMs were required to bind a polyU RNA with high affinity. SAXS analyses demonstrated a `V' shape for a TIA-1 construct comprising the three RRMs, and revealed that its dimensions became more compact in the RNA-bound state. The sequence-selective involvement of TIA-1 RRM1 in RNA recognition suggests a possible role for RNA sequences in regulating the distinct functions of TIA-1. Further implications for U1-C recruitment by the adjacent TIA-1 binding sites of the fas pre-mRNA and the bent TIA-1 shape, which organizes the N- and C-termini on the same side of the protein, are discussed. PMID:22154808

A rapid genetic counselling and testing in newly diagnosed breast cancer is associated with high rate of risk-reducing mastectomy in BRCA1/2-positive Italian women.

Science.gov (United States)

Cortesi, L; Razzaboni, E; Toss, A; De Matteis, E; Marchi, I; Medici, V; Tazzioli, G; Andreotti, A; De Santis, G; Pignatti, M; Federico, M

2014-01-01

Risk-reducing mastectomy (RRM) decreases breast cancer (BC) risk in BRCA1/2 mutation carriers by up to 95%, but the Italian attitude towards this procedure is reluctant. This is an observational study with retrospective design, using quantitative and qualitative research methods, aimed at evaluating the attitude towards RRM by rapid genetic counselling and testing (RGCT), at the time of BC diagnosis, compared with traditional genetic counselling and testing (TGCT), after previous BC surgery. Secondary aims were to investigate patient satisfaction after RRM and the rate of occult tumour in healthy breasts. A total of 1168 patients were evaluated: 1058 received TGCT, whereas 110 underwent RGCT. In TGCT, among 1058 patients, 209 (19.7%) mutation carriers were identified, with the rate of RRM being 4.7% (10 of 209). Conversely in RGCT, among 110 patients, 36 resulted positive, of which, 15 (41.7%) underwent bilateral mastectomy at the BC surgery time, showing an overall good satisfaction, measured by interpretative phenomenological analysis 12 months after the intervention. Our study shows that RGCT in patients with a hereditary profile is associated with a high rate of RRM at the BC surgery time, this being the pathway offered within a multidisciplinary organization.

High Efficiency Water Heating Technology Development Final Report. Part I, Lab/Field Performance Evaluation and Accelerated Life Testing of a Hybrid Electric Heat Pump Water Heater (HPWH)

Energy Technology Data Exchange (ETDEWEB)

Baxter, Van D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Murphy, Richard W. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Rice, C. Keith [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Linkous, Randall Lee [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

2016-04-01

DOE has supported efforts for many years with the objective of getting a water heater that uses heat pump technology (aka a heat pump water heater or HPWH) successfully on the residential equipment market. The most recent previous effort (1999-2002) produced a product that performed very well in ORNL-led accelerated durability and field tests. The commercial partner for this effort, Enviromaster International (EMI), introduced the product to the market under the trade name Watter$aver in 2002 but ceased production in 2005 due to low sales. A combination of high sales price and lack of any significant infrastructure for service after the sale were the principal reasons for the failure of this effort. What was needed for market success was a commercial partner with the manufacturing and market distribution capability necessary to allow economies of scale to lead to a viable unit price together with a strong customer service infrastructure. General Electric certainly meets these requirements, and knowing of ORNL s expertise in this area, approached ORNL with the proposal to partner in a CRADA to produce a high efficiency electric water heater. A CRADA with GE was initiated early in Fiscal Year, 2008. GE initially named its product the Hybrid Electric Water Heater (HEWH).

NCBI nr-aa BLAST: CBRC-RMAC-16-0045 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-16-0045 ref|ZP_01184807.1| RNA-binding protein, RRM domain [Bacillus weihenstep...hanensis KBAB4] gb|EAR75831.1| RNA-binding protein, RRM domain [Bacillus weihenstephanensis KBAB4] ZP_01184807.1 2e-04 32% ...

78 FR 12832 - Request for Information: Public-Private Collaborations in Pain Research

Science.gov (United States)

2013-02-25

..., your name and title, and contact information (including mailing address, email address, and phone... the collaborating party a license or an assignment to inventions made under the CRADA. VA will select... those products embodying inventions made under the CRADA will be manufactured substantially in the...

Requirements and Algorithms for Cooperation of Heterogeneous Radio Access Networks

DEFF Research Database (Denmark)

Mihovska, Albena D.; Tragos, Elias; Mino, Emilio

2009-01-01

systems.The RRM mechanisms are evaluated for the scenario of intra-RAN and inter-RAN user mobility. The RRM framework incorporates as novelty improved triggering mechanisms, a network-controlledmobility management scheme with policy enforcement on different levels in the RANarchitecture, and a distributed...

76 FR 25362 - Cooperative Research and Development Agreement: Butanol Fuel Blend Usage With Marine Outboard...

Science.gov (United States)

2011-05-04

... participants would identify and investigate the advantages, disadvantages, required technology enhancements... Development Agreements (CRADAs), are authorized by the Federal Technology Transfer Act of 1986 (Pub. L. 99- 502, codified at 15 U.S.C. 3710(a)). A CRADA promotes the transfer of technology to the private sector...

Random regret minimization : Exploration of a new choice model for environmental and resource economics

NARCIS (Netherlands)

Thiene, M.; Boeri, M.; Chorus, C.G.

2011-01-01

This paper introduces the discrete choice model-paradigm of Random Regret Minimization (RRM) to the field of environmental and resource economics. The RRM-approach has been very recently developed in the context of travel demand modelling and presents a tractable, regret-based alternative to the

Breast cancer after bilateral risk-reducing mastectomy

DEFF Research Database (Denmark)

Skytte, A-B; Crüger, Dorthe Gylling; Gerster, M

2011-01-01

This study aims to evaluate the incidence of breast cancer after risk-reducing mastectomy (RRM) in healthy BRCA mutation carriers. This study is a long-term follow-up of 307 BRCA mutation carriers of whom 96 chose RRM. None of the study participants had a previous history of breast or ovarian...... cancer nor had they undergone RRM or risk-reducing bilateral salpingo-oophorectomy (BSO) prior to the time of BRCA testing. The annual incidence of post-mastectomy breast cancer was 0.8% compared with 1.7% in the non-operated group. Implications of these findings in relation to genetic counseling...

Environmental Light and Its Relationship with Electromagnetic Resonances of Biomolecular Interactions, as Predicted by the Resonant Recognition Model

Directory of Open Access Journals (Sweden)

Irena Cosic

2016-06-01

Full Text Available The meaning and influence of light to biomolecular interactions, and consequently to health, has been analyzed using the Resonant Recognition Model (RRM. The RRM proposes that biological processes/interactions are based on electromagnetic resonances between interacting biomolecules at specific electromagnetic frequencies within the infra-red, visible and ultra-violet frequency ranges, where each interaction can be identified by the certain frequency critical for resonant activation of specific biological activities of proteins and DNA. We found that: (1 the various biological interactions could be grouped according to their resonant frequency into super families of these functions, enabling simpler analyses of these interactions and consequently analyses of influence of electromagnetic frequencies to health; (2 the RRM spectrum of all analyzed biological functions/interactions is the same as the spectrum of the sun light on the Earth, which is in accordance with fact that life is sustained by the sun light; (3 the water is transparent to RRM frequencies, enabling proteins and DNA to interact without loss of energy; (4 the spectrum of some artificial sources of light, as opposed to the sun light, do not cover the whole RRM spectrum, causing concerns for disturbance to some biological functions and consequently we speculate that it can influence health.

Measurement of electrons from beauty-hadron decays in p-Pb collisions at $\\sqrt{s_{\\rm NN}}=5.02$ TeV and Pb-Pb collisions at $\\sqrt{s_{\\rm NN}}=2.76$ TeV

CERN Document Server

Adam, Jaroslav; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahmad, Shakeel; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Alam, Sk Noor; Silva De Albuquerque, Danilo; Aleksandrov, Dmitry; Alessandro, Bruno; Alexandre, Didier; Alfaro Molina, Jose Ruben; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altinpinar, Sedat; Altsybeev, Igor; Alves Garcia Prado, Caio; An, Mangmang; Andrei, Cristian; Andrews, Harry Arthur; Andronic, Anton; Anguelov, Venelin; Anson, Christopher Daniel; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Balasubramanian, Supraja; Baldisseri, Alberto; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartke, Jerzy Gustaw; Bartsch, Esther; Basile, Maurizio; Bastid, Nicole; Basu, Sumit; Bathen, Bastian; Batigne, Guillaume; Batista Camejo, Arianna; Batyunya, Boris; Batzing, Paul Christoph; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Belmont Moreno, Ernesto; Espinoza Beltran, Lucina Gabriela; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Berceanu, Ionela; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhasin, Anju; Bhat, Inayat Rasool; Bhati, Ashok Kumar; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Livio; Bianchi, Nicola; Bianchin, Chiara; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biro, Gabor; Biswas, Rathijit; Biswas, Saikat; Bjelogrlic, Sandro; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Bock, Friederike; Bogdanov, Alexey; Boggild, Hans; Boldizsar, Laszlo; Bombara, Marek; Bonora, Matthias; Book, Julian Heinz; Borel, Herve; Borissov, Alexander; Borri, Marcello; Bossu, Francesco; Botta, Elena; Bourjau, Christian; Braun-munzinger, Peter; Bregant, Marco; Broker, Theo Alexander; Browning, Tyler Allen; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buhler, Paul; Iga Buitron, Sergio Arturo; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Cabala, Jan; Caffarri, Davide; Cai, Xu; Caines, Helen Louise; Caliva, Alberto; Calvo Villar, Ernesto; Camerini, Paolo; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Cepila, Jan; Cerello, Piergiorgio; Cerkala, Jakub; Chang, Beomsu; Chapeland, Sylvain; Chartier, Marielle; Charvet, Jean-luc Fernand; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chauvin, Alex; Chelnokov, Volodymyr; Cherney, Michael Gerard; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Choi, Kyungeon; Chojnacki, Marek; Choudhury, Subikash; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Connors, Megan Elizabeth; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortes Maldonado, Ismael; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Crkovska, Jana; Crochet, Philippe; Cruz Albino, Rigoberto; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Danisch, Meike Charlotte; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Derradi De Souza, Rafael; Deisting, Alexander; Deloff, Andrzej; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Nezza, Pasquale; Di Ruzza, Benedetto; Diaz Corchero, Miguel Angel; Dietel, Thomas; Dillenseger, Pascal; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Drozhzhova, Tatiana; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Duggal, Ashpreet Kaur; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Endress, Eric; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erhardt, Filip; Espagnon, Bruno; Estienne, Magali Danielle; Esumi, Shinichi; Eulisse, Giulio; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Eyyubova, Gyulnara; Fabbietti, Laura; Fabris, Daniela; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Ferencei, Jozef; Fernandez Tellez, Arturo; Gonzalez Ferreiro, Elena; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiore, Enrichetta Maria; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Francisco, Audrey; Frankenfeld, Ulrich Michael; Fronze, Gabriele Gaetano; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gajdosova, Katarina; Gallio, Mauro; Duarte Galvan, Carlos; Gangadharan, Dhevan Raja; Ganoti, Paraskevi; Gao, Chaosong; Garabatos Cuadrado, Jose; Garcia-solis, Edmundo Javier; Garg, Kunal; Garg, Prakhar; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; Germain, Marie; Gheata, Mihaela; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Gladysz-dziadus, Ewa; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Sanchez Gonzalez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Grachov, Oleg Anatolievich; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Grelli, Alessandro; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Grynyov, Borys; Grion, Nevio; Gronefeld, Julius Maximilian; Grosse-oetringhaus, Jan Fiete; Grosso, Raffaele; Gruber, Lukas; Guber, Fedor; Guernane, Rachid; Guerzoni, Barbara; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Bautista Guzman, Irais; Haake, Rudiger; Hadjidakis, Cynthia Marie; Haiduc, Maria; Hamagaki, Hideki; Hamar, Gergoe; Hamon, Julien Charles; Harris, John William; Harton, Austin Vincent; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Hellbar, Ernst; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Herrera Corral, Gerardo Antonio; Herrmann, Florian; Hess, Benjamin Andreas; Hetland, Kristin Fanebust; Hillemanns, Hartmut; Hippolyte, Boris; Horak, David; Hosokawa, Ritsuya; Hristov, Peter Zahariev; Hughes, Charles; Humanic, Thomas; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Ilkaev, Radiy; Inaba, Motoi; Incani, Elisa; Ippolitov, Mikhail; Irfan, Muhammad; Isakov, Vladimir; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacak, Barbara; Jacazio, Nicolo; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jahnke, Cristiane; Jakubowska, Monika Joanna; Janik, Malgorzata Anna; Pahula Hewage, Sandun; Jena, Chitrasen; Jena, Satyajit; Jimenez Bustamante, Raul Tonatiuh; Jones, Peter Graham; Jung, Hyungtaik; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karayan, Lilit; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Khan, Mohammed Mohisin; Khan, Palash; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Khatun, Anisa; Khuntia, Arvind; Kileng, Bjarte; Kim, Do Won; Kim, Dong Jo; Kim, Daehyeok; Kim, Hyeonjoong; Kim, Jinsook; Kim, Jiyoung; Kim, Minjung; Kim, Minwoo; Kim, Se Yong; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Kiss, Gabor; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobdaj, Chinorat; Kofarago, Monika; Kollegger, Thorsten; Kolozhvari, Anatoly; Kondratev, Valerii; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Kopcik, Michal; Kour, Mandeep; Kouzinopoulos, Charalampos; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Koyithatta Meethaleveedu, Greeshma; Kralik, Ivan; Kravcakova, Adela; Krivda, Marian; Krizek, Filip; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Ajay; Kumar, Jitendra; Kumar, Lokesh; Kumar, Shyam; Kundu, Sourav; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lagana Fernandes, Caio; Lakomov, Igor; Langoy, Rune; Lapidus, Kirill; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Lattuca, Alessandra; Laudi, Elisa; Lazaridis, Lazaros; Lea, Ramona; Leardini, Lucia; Lee, Seongjoo; Lehas, Fatiha; Lehner, Sebastian; Lehrbach, Johannes; Lemmon, Roy Crawford; Lenti, Vito; Leogrande, Emilia; Leon Monzon, Ildefonso; Leon Vargas, Hermes; Leoncino, Marco; Levai, Peter; Li, Shuang; Li, Xiaomei; Lien, Jorgen Andre; Lietava, Roman; Lindal, Svein; Lindenstruth, Volker; Lippmann, Christian; Lisa, Michael Annan; Ljunggren, Hans Martin; Lodato, Davide Francesco; Lonne, Per-ivar; Loginov, Vitaly; Loizides, Constantinos; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Lunardon, Marcello; Luparello, Grazia; Lupi, Matteo; Lutz, Tyler Harrison; Maevskaya, Alla; Mager, Magnus; Mahajan, Sanjay; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Maldonado Cervantes, Ivonne Alicia; Malinina, Liudmila; Mal'kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Mao, Yaxian; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martinengo, Paolo; Martinez Hernandez, Mario Ivan; Martinez-garcia, Gines; Martinez Pedreira, Miguel; Mas, Alexis Jean-michel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Mastroserio, Annalisa; Matyja, Adam Tomasz; Mayer, Christoph; Mazer, Joel Anthony; Mazzilli, Marianna; Mazzoni, Alessandra Maria; Meddi, Franco; Melikyan, Yuri; Menchaca-rocha, Arturo Alejandro; Meninno, Elisa; Mercado-perez, Jorge; Meres, Michal; Mhlanga, Sibaliso; Miake, Yasuo; Mieskolainen, Matti Mikael; Mikhaylov, Konstantin; Milosevic, Jovan; Mischke, Andre; Mishra, Aditya Nath; Mishra, Tribeni; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Bedangadas; Molnar, Levente; Montes Prado, Esther; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munning, Konstantin; Munzer, Robert Helmut; Murakami, Hikari; Murray, Sean; Musa, Luciano; Musinsky, Jan; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Naru, Muhammad Umair; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Rosado Navarro, Sebastian; Nayak, Kishora; Nayak, Ranjit; Nayak, Tapan Kumar; Nazarenko, Sergey; Nedosekin, Alexander; Negrao De Oliveira, Renato Aparecido; Nellen, Lukas; Ng, Fabian; Nicassio, Maria; Niculescu, Mihai; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Saehanseul; Oh, Sun Kun; Ohlson, Alice Elisabeth; Okatan, Ali; Okubo, Tsubasa; Olah, Laszlo; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Oravec, Matej; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Ozdemir, Mahmut; Pachmayer, Yvonne Chiara; Pagano, Davide; Pagano, Paola; Paic, Guy; Pal, Susanta Kumar; Palni, Prabhakar; Pan, Jinjin; Pandey, Ashutosh Kumar; Papikyan, Vardanush; Pappalardo, Giuseppe; Pareek, Pooja; Park, Jonghan; Park, Woojin; Parmar, Sonia; Passfeld, Annika; Paticchio, Vincenzo; Patra, Rajendra Nath; Paul, Biswarup; Pei, Hua; Peitzmann, Thomas; Peng, Xinye; Pereira Da Costa, Hugo Denis Antonio; Peresunko, Dmitry Yurevich; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrov, Viacheslav; Petrovici, Mihai; Petta, Catia; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Ozelin De Lima Pimentel, Lais; Pinazza, Ombretta; Pinsky, Lawrence; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Poppenborg, Hendrik; Porteboeuf, Sarah Julie; Porter, R Jefferson; Pospisil, Jan; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Puddu, Giovanna; Pujahari, Prabhat Ranjan; Punin, Valery; Putschke, Jorn Henning; Qvigstad, Henrik; Rachevski, Alexandre; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Ratza, Viktor; Ravasenga, Ivan; Read, Kenneth Francis; Redlich, Krzysztof; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reolon, Anna Rita; Reshetin, Andrey; Reygers, Klaus Johannes; Riabov, Viktor; Ricci, Renato Angelo; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-lucian; Rodriguez Cahuantzi, Mario; Roeed, Ketil; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Ronchetti, Federico; Ronflette, Lucile; Rosnet, Philippe; Rossi, Andrea; Roukoutakis, Filimon; Roy, Ankhi; Roy, Christelle Sophie; Roy, Pradip Kumar; Rubio Montero, Antonio Juan; Rui, Rinaldo; Russo, Riccardo; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Saarinen, Sampo; Sadhu, Samrangy; Sadovskiy, Sergey; Safarik, Karel; Sahlmuller, Baldo; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Salzwedel, Jai Samuel Nielsen; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandor, Ladislav; Sandoval, Andres; Sano, Masato; Sarkar, Debojit; Sarkar, Nachiketa; Sarma, Pranjal; Scapparone, Eugenio; Scarlassara, Fernando; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schmidt, Martin; Schukraft, Jurgen; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Scott, Rebecca Michelle; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shadura, Oksana; Shahoyan, Ruben; Shangaraev, Artem; Sharma, Ankita; Sharma, Anjali; Sharma, Mona; Sharma, Monika; Sharma, Natasha; Sheikh, Ashik Ikbal; Shigaki, Kenta; Shou, Qiye; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Silvestre, Catherine Micaela; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singhal, Vikas; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Song, Jihye; Song, Myunggeun; Song, Zixuan; Soramel, Francesca; Sorensen, Soren Pontoppidan; Sozzi, Federica; Spiriti, Eleuterio; Sputowska, Iwona Anna; Spyropoulou-stassinaki, Martha; Stachel, Johanna; Stan, Ionel; Stankus, Paul; Stenlund, Evert Anders; Steyn, Gideon Francois; Stiller, Johannes Hendrik; Stocco, Diego; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Sumowidagdo, Suharyo; Suzuki, Ken; Swain, Sagarika; Szabo, Alexander; Szarka, Imrich; Szczepankiewicz, Adam; Szymanski, Maciej Pawel; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terasaki, Kohei; Terrevoli, Cristina; Teyssier, Boris; Thaeder, Jochen Mathias; Thakur, Dhananjaya; Thomas, Deepa; Tieulent, Raphael Noel; Tikhonov, Anatoly; Timmins, Anthony Robert; Toia, Alberica; Tripathy, Sushanta; Trogolo, Stefano; Trombetta, Giuseppe; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vala, Martin; Van Der Maarel, Jasper; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vanat, Tomas; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vazquez Doce, Oton; Vechernin, Vladimir; Veen, Annelies Marianne; Velure, Arild; Vercellin, Ermanno; Vergara Limon, Sergio; Vernet, Renaud; Vertesi, Robert; Vickovic, Linda; Vigolo, Sonia; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Vinogradov, Leonid; Virgili, Tiziano; Vislavicius, Vytautas; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Voscek, Dominik; Vranic, Danilo; Vrlakova, Janka; Vulpescu, Bogdan; Wagner, Boris; Wagner, Jan; Wang, Hongkai; Wang, Mengliang; Watanabe, Daisuke; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Weiser, Dennis Franz; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Willems, Guido Alexander; Williams, Crispin; Windelband, Bernd Stefan; Winn, Michael Andreas; Yalcin, Serpil; Yang, Ping; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correia Zanoli, Henrique Jose; Zaporozhets, Sergey; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zgura, Sorin Ion; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhang, Yonghong; Chunhui, Zhang; Zhang, Zuman; Zhao, Chengxin; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zichichi, Antonino; Zimmermann, Alice; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zmeskal, Johann

2017-07-11

The production of beauty hadrons was measured via semi-leptonic decays at mid-rapidity with the ALICE detector at the LHC in the transverse momentum interval $1R_{\\rm pA}$ and $R_{\\rm AA}$, were obtained by a pQCD-driven scaling of the cross section of electrons from beauty-hadron decays measured at $\\sqrt{s}=7$ TeV. The $R_{\\rm AA}$ is about 0.7 with an uncertainty of about 30% in the interval $3R_{\\rm AA}$ values increase with decreasing transverse momentum with systematic uncertainties of 30-45%. The $R_{\\rm pA}$ is consistent with unity w...

Exploring clinicians' attitudes about using aspirin for risk reduction in people with Lynch Syndrome with no personal diagnosis of colorectal cancer.

Science.gov (United States)

Chen, Yanni; Peate, Michelle; Kaur, Rajneesh; Meiser, Bettina; Wong, Tim; Kirk, Judy; Ward, Robyn L; Goodwin, Annabel; Macrae, Finlay; Hiller, Janet; Trainer, Alison H; Mitchell, Gillian

2017-01-01

Recent research has shown that aspirin reduces the risk of cancers associated with Lynch Syndrome. However, uncertainty exists around the optimal dosage, treatment duration and whether the benefits of aspirin as a risk-reducing medication (RRM) outweigh adverse medication related side-effects. Little is known about clinicians' attitudes, current practice, and perceived barriers to recommending aspirin as a RRM. To explore the attitudes of clinicians who discuss risk management options with patients with Lynch Syndrome towards using aspirin as a RRM. Clinicians were invited through professional organisations to complete an online survey. Topics included their clinical experience with Lynch Syndrome, views and practice of recommending aspirin as a RRM, and knowledge about clinical risk management guidelines for Lynch Syndrome. Comparison of attitudes was made between three professional groups. 181 respondents were included in the analysis: 59 genetics professionals (genetic counsellors and clinical geneticists, medical oncologists with specialist training in familial cancer), 49 gastroenterologists and 73 colorectal surgeons. Most clinicians (76 %) considered aspirin to be an effective RRM and most (72 %) were confident about discussing it. In all professional categories, those who were confident about discussing aspirin with patients perceived it to be an effective RRM (OR = 2.8 [95 % CI = 1.8-4.2], p Lynch Syndrome patients compared to 69 % of gastroenterologists and 68 % of colorectal surgeons. Those who considered aspirin as an effective RRM or who felt confident in their knowledge of the aspirin literature were more likely (OR = 10 [95 % CI = 1.5-65], p = 0.010, OR = 6 [95 % CI = 2.2-16], p Lynch Syndrome per year were more likely to be confident in their knowledge of the aspirin literature and discussing it with patients (OR = 4.1 [95 % CI = 1.6-10.2], p = 0.003). Explicit recommendations to take aspirin, was reported by 65

Borated stainless steel joining technology. Final report

International Nuclear Information System (INIS)

Smith, R.J.

1994-12-01

EPRI had continued investigating the application of borated stainless steel products within the US commercial nuclear power industry through participation in a wide range of activities. This effort provides the documentation of the data obtained in the development of the ASTM-A887 Specification preparation effort conducted by Applied Science and Technology and the most recent efforts for the development of joining technologies conducted under a joint effort by EPRI, Carpenter Technologies and Sandia National Laboratory under a US DOE CRADA program. The data presented in this report provides the basis for the ASTM specification which has been previously unpublished by EPRI and the data generated in support of the Joining Technology research effort conducted at Sandia. The results of the Sandia research, although terminated prior to the completion, confirms earlier data that the degradation of material properties in fusion welded borated stainless steels occurs in the heat affected zone of the weld area and not in the base material. The data obtained also supports the conclusion that the degradation of material properties can be overcome by post weld heat treatment which can result in material properties near the original unwelded metal

Development of DNA Pillar Chip Final Report CRADA No. TSB-2035-01

Energy Technology Data Exchange (ETDEWEB)

Ness, K. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Long, G. W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-16

This was a collaborative effort between The Regents of the University of California, Lawrence Livermore National Laboratory (LLNL) and Tetracore, to demonstrate a proof of principal device for the capture and controlled release of DNA moving within a flow stream.

Solidification Technologies for Radioactive and Chemical Liquid Waste Treatment - Final CRADA Report

International Nuclear Information System (INIS)

Castiglioni, Andrew J.; Gelis, Artem V.

2016-01-01

This project, organized under DOE/NNSA's Global Initiatives for Proliferation Prevention program, joined Russian and DOE scientists in developing more effective solidification and storage technologies for liquid radioactive waste. Several patent applications were filed by the Russian scientists (Russia only) and in 2012, the technology developed was approved by Russia's Federal State Unitary Enterprise RADON for application throughout Russia in cleaning up and disposing of radioactive waste.

Development of Physics Package Sensors Final Report CRADA No. TC02094.0

Energy Technology Data Exchange (ETDEWEB)

Karpenko, V. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Salmon, J. [Lockheed Martin Space Systems Company, Sunnyvale, CA (United States)

2017-09-06

The goal of this project was to work together through the project phases to conceive, demonstrate, and produce concepts for detecting, locating, tracking, imaging, and assessing emissions passively or actively. The initial Sensor Concept Exploration Phase was postulated and assessed concepts at a first-order level to ascertain whether the parties’ concepts (either separately developed or jointly developed) had merit for missile defense and homeland security applications

Electromagnetic Simulations for Aerospace Application Final Report CRADA No. TC-0376-92

Energy Technology Data Exchange (ETDEWEB)

Madsen, N. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Meredith, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2018-01-24

Electromagnetic (EM) simulation tools play an important role in the design cycle, allowing optimization of a design before it is fabricated for testing. The purpose of this cooperative project was to provide Lockheed with state-of-the-art electromagnetic (EM) simulation software that will enable the optimal design of the next generation of low-observable (LO) military aircraft through the VHF regime. More particularly, the project was principally code development and validation, its goal to produce a 3-D, conforming grid,time-domain (TD) EM simulation tool, consisting of a mesh generator, a DS13D-based simulation kernel, and an RCS postprocessor, which was useful in the optimization of LO aircraft, both for full-aircraft simulations run on a massively parallel computer and for small scale problems run on a UNIX workstation.

Rapid tooling for functional prototyping of metal mold processes. CRADA final report

Energy Technology Data Exchange (ETDEWEB)

Zacharia, T.; Ludtka, G.M.; Bjerke, M.A.; Gray, W.H.

1997-12-01

The overall scope of this endeavor was to develop an integrated computer system, running on a network of heterogeneous computers, that would allow the rapid development of tool designs, and then use process models to determine whether the initial tooling would have characteristics which produce the prototype parts. The major thrust of this program for ORNL was the definition of the requirements for the development of the integrated die design system with the functional purpose to link part design, tool design, and component fabrication through a seamless software environment. The principal product would be a system control program that would coordinate the various application programs and implement the data transfer so that any networked workstation would be useable. The overall system control architecture was to be required to easily facilitate any changes, upgrades, or replacements of the model from either the manufacturing end or the design criteria standpoint. The initial design of such a program is described in the section labeled ``Control Program Design``. A critical aspect of this research was the design of the system flow chart showing the exact system components and the data to be transferred. All of the major system components would have been configured to ensure data file compatibility and transferability across the Internet. The intent was to use commercially available packages to model the various manufacturing processes for creating the die and die inserts in addition to modeling the processes for which these parts were to be used. In order to meet all of these requirements, investigative research was conducted to determine the system flow features and software components within the various organizations contributing to this project. This research is summarized.

Plastic Substrate Active Matrix Displays Final Report CRADA No. TC-2011-00

Energy Technology Data Exchange (ETDEWEB)

Bernhardt, A. F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Smith, P. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-28

This project was a collaborative effort between the University of California, Lawrence Livermore National Laboratory (LLNL) and FlexICs, Inc. to develop thin film transistor (TFT) electronics for active matrix displays.

Technology Assessment for Powertrain Components Final Report CRADA No. TC-1124-95

Energy Technology Data Exchange (ETDEWEB)

Tokarz, F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gough, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-19

LLNL utilized its defense technology assessment methodologies in combination with its capabilities in the energy; manufacturing, and transportation technologies to demonstrate a methodology that synthesized available but incomplete information on advanced automotive technologies into a comprehensive framework.

LST CGM Generator and Viewer Final Report CRADA No. TSB-1558-98

Energy Technology Data Exchange (ETDEWEB)

Vickers, Don [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Larson, Don [Larson Software Technology, Houston, TX (United States)

2017-11-09

The purpose of this project was to jointly develop and test a software plug-in that would convert native Pro /ENGINEER digital engineering drawings to Computer Graphics Metafile (CGM) format. If it was not feasible to convert the Pro/ENGINEER files, we planned to develop and test a similar conversion of native AutoCAD engineering drawings to CGM. CGM viewer plug-ins were developed as needed. There were four main tasks in this project: 1. Requirements for CGM Plug-in 2. Product Evaluation 3. Product Development Feasibility Study 4. Developing a "Plug-In" Application.

Low Temperature Metal Coating Method Final Report CRADA No. TSB-1155-95

Energy Technology Data Exchange (ETDEWEB)

Kang, Sang-Wook [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gabel, Howard [Innovative Technology, Inc., Santa Barbara, CA (United States)

2018-01-19

A new metal coating method, cidled KEM (kinetic energy metal.lization), demonstrated in the laboratory by lnovati, utilized fast-moving solid particIes entrained in a gas that are caused to fiow through a nozzIe to effect particle deposition on metal surfaces at room temperature conditions. This method (US Patent 5,795,626) was an attractive and viabIe alternative to the currentIy available high-temperature coating methods avaiIabIe. Since it differs significantly from existing metal coating technologies, a brief description of the method is incIuded here. The proposed method, KEM, achieves cohesive and adhesive metallurgical bonding through the high-speed coUision of powder with a substrate and the subsequent discharge of electrical charge at the substrate. Such coating is effected by entraining metal powder in a gas and accelerating this mixture through a supersonic nozzle. The gas/powder is directed towards the substrate to be coated. Collisions occur, initiaIly between the powder and the substrate, and, as the first Iayer of the coating forms, between the powder and the coating. During these collisions the powder is rapidly deformed, causing the exposure of fresh (oxide free) active metal surface. When these’active surfaces contact one another, they agglomerate and form true metaIIurgicaI bonds. The resultant coating has Iow porosity and high adhesive and cohesive strength. The formation of metaIIurgicaI bonds is potentiated by the discharge of electrical energy. This electrical energy is the result of triboeIectric charging of the particIes during acceleration and transit to the nozzIe. An advantage of the method is that it does not raise the temperature of the powder being appLiedor that of the substrate. Consequently, materials sensitive to high temperature may be applied without changing Me properties of the materkd or substrate.

High Performance Parallel Processing Project: Industrial computing initiative. Progress reports for fiscal year 1995

Energy Technology Data Exchange (ETDEWEB)

Koniges, A.

1996-02-09

This project is a package of 11 individual CRADA`s plus hardware. This innovative project established a three-year multi-party collaboration that is significantly accelerating the availability of commercial massively parallel processing computing software technology to U.S. government, academic, and industrial end-users. This report contains individual presentations from nine principal investigators along with overall program information.

RESEARCH OF DYNAMIC PARAMETERS OF THE ELECTRIC DRIVE ON THE BASIS OF ROLLING ROTOR MOTOR

Directory of Open Access Journals (Sweden)

G. V. Kulinchenko

2016-12-01

Full Text Available Purpose. Development and investigation of a dynamic model of electric drive on the base of the rolling rotor motor (RRM which reflects the positioning of the actuator of the locking and regulating equipment in time. Methodology. Analytical description of electromagnetic and mechanical processes in the electric drive during the RRM shaft movement by using a system of differential equations. Numerical imitation modeling with the processes visualization in the Matlab environment of the RRM rotor displacement with mechanical load in time. Results. It is shown that the degree of influence of the value of the load inertia on the dynamics of the object obtained by the waveform changes the rotation angle of the rotor and motor speed in time. The degree of influence of the value of the electromagnetic time constant of the dynamics of the positioning of the actuator, and the nature of transients during acceleration and fixing position of the rotor with a predetermined moment of inertia for different values of inductance. The effect of the ratio of electromechanical and electromagnetic time constants of the nature of the transition processes accompanying jog mode angular displacement of the drive shaft on the base of RRM. Originality. The lack of technical means to ensure acceptable accuracy time measurement of angular displacement shaft of the actuator in jog mode offset by using a laser meter which gives the opportunity to assess the adequacy of the dynamic model of the RRM. Practical value. The results of investigations allow to create a tool for optimization of structural, technical and hardware and software solutions for the improvement and modernization of the projected electric locking and regulating equipment. The direction for improving the dynamics of the drive on the basis of RRM is indicated providing for an increase in its torque characteristics of the motor by reducing the influence of the parameters of transients.

Linearity optimizations of analog ring resonator modulators through bias voltage adjustments

Science.gov (United States)

Hosseinzadeh, Arash; Middlebrook, Christopher T.

2018-03-01

The linearity of ring resonator modulator (RRM) in microwave photonic links is studied in terms of instantaneous bandwidth, fabrication tolerances, and operational bandwidth. A proposed bias voltage adjustment method is shown to maximize spur-free dynamic range (SFDR) at instantaneous bandwidths required by microwave photonic link (MPL) applications while also mitigating RRM fabrication tolerances effects. The proposed bias voltage adjustment method shows RRM SFDR improvement of ∼5.8 dB versus common Mach-Zehnder modulators at 500 MHz instantaneous bandwidth. Analyzing operational bandwidth effects on SFDR shows RRMs can be promising electro-optic modulators for MPL applications which require high operational frequencies while in a limited bandwidth such as radio-over-fiber 60 GHz wireless network access.

A study of Multistage/Multifunction Column for Fine Coal Cleaning CRADA PC93-005, Final Report; FINAL

International Nuclear Information System (INIS)

Ralph Lai; Shiao-Hung Chiang; Daxin He; Yuru Feng

1998-01-01

The overall objective of the this research project is to explore the potential applicability of a multistage column for fine coal cleaning and other applications in fluid particle separation. The research work identifies the design parameters and their effects on the performance of the separation device. The results of this study provide an engineering data basis for further development of this technology in coal cleaning and in general areas of fluid and particle separations

Researching Complex Heat, Air and Moisture Interactions for a Wide-Range of Building Envelope Systems and Environmental Loads

Energy Technology Data Exchange (ETDEWEB)

Karagiozis, A.N.

2007-05-15

This document serves as the final report documenting work completed by Oak Ridge National Laboratory (ORNL) and the Fraunhofer Institute in Building Physics (Holzkirchen, Germany) under an international CRADA No. 0575 with Fraunhofer Institute of Bauphysics of the Federal Republic of Germany for Researching Complex Heat, Air and Moisture Interactions for a Wide Range of Building Envelope Systems and Environmental Loads. This CRADA required a multi-faceted approach to building envelope research that included a moisture engineering approach by blending extensive material property analysis, laboratory system and sub-system thermal and moisture testing, and advanced moisture analysis prediction performance. The Participant's Institute for Building physics (IBP) and the Contractor's Buildings Technology Center (BTC) identified potential research projects and activities capable of accelerating and advancing the development of innovative, low energy and durable building envelope systems in diverse climates. This allowed a major leverage of the limited resources available to ORNL to execute the required Department of Energy (DOE) directives in the area of moisture engineering. A joint working group (ORNL and Fraunhofer IBP) was assembled and a research plan was executed from May 2000 to May 2005. A number of key deliverables were produced such as adoption of North American loading into the WUFI-software. in addition the ORNL Weather File Analyzer was created and this has been used to address environmental loading for a variety of US climates. At least 4 papers have been co-written with the CRADA partners, and a chapter in the ASTM Manual 40 on Moisture Analysis and Condensation Control. All deliverables and goals were met and exceeded making this collaboration a success to all parties involves.

Final Report for completed IPP Project:"Development of Plasma Ablation for Soft Tissue and Bone Surgery"

Energy Technology Data Exchange (ETDEWEB)

Brown, Ian

2009-09-01

ArthroCare is a medical device company that develops, manufactures, and markets an advanced surgical tool, a plasma electro-surgical system for cutting and removing tissue. The hand-held electrical discharge device produces plasma in a biocompatible conductive fluid and tissue to which it is applied during surgery. Its products allow surgeons to operate with increased precision and accuracy, limiting damage to surrounding tissue thereby reducing pain and speeding recovery for the patient. In the past, the design of ArthfoCare's plasma wands has been an empirical undertaking. One goal of this R&D program was to put the phenomena involved on a sound scientific footing, allowing optimization of existing plasma based electro-surgery system technology, and the design and manufacture of new and improved kinds of scalpels, in particular for the surgical cutting of bone. Another important related goal of the program was to develop, through an experimental approach, new plasma wand approaches to the cutting ('shaving') of hard bone tissue. The goals of the CRADA were accomplished - computer models were used to predict important parameters of the plasma discharge and the bone environment, and several different approaches to bone-shaving were developed and demonstrated. The primary goal of the project was to develop and demonstrate an atmospheric-pressure plasma tool that is suitable for surgical use for shaving bone in humans. This goal was accomplished, in fact with several different alternative plasma approaches. High bone ablation speeds were measured. The use of probes ('plasma wand' - the surgical tool) with moving active electrodes was also explored, and there are advantages to this method. Another important feature is that the newly-exposed bone surface have only a very thin necrosis layer; this feature was demonstrated. This CRADA has greatly advanced our understanding of bone removal by atmospheric pressure plasmas in liquid, and puts Arthro

Final Report for completed IPP Project: Development of Plasma Ablation for Soft Tissue and Bone Surgery

International Nuclear Information System (INIS)

Brown, Ian

2009-01-01

ArthroCare is a medical device company that develops, manufactures, and markets an advanced surgical tool, a plasma electro-surgical system for cutting and removing tissue. The hand-held electrical discharge device produces plasma in a biocompatible conductive fluid and tissue to which it is applied during surgery. Its products allow surgeons to operate with increased precision and accuracy, limiting damage to surrounding tissue thereby reducing pain and speeding recovery for the patient. In the past, the design of ArthfoCare's plasma wands has been an empirical undertaking. One goal of this R and D program was to put the phenomena involved on a sound scientific footing, allowing optimization of existing plasma based electro-surgery system technology, and the design and manufacture of new and improved kinds of scalpels, in particular for the surgical cutting of bone. Another important related goal of the program was to develop, through an experimental approach, new plasma wand approaches to the cutting ('shaving') of hard bone tissue. The goals of the CRADA were accomplished - computer models were used to predict important parameters of the plasma discharge and the bone environment, and several different approaches to bone-shaving were developed and demonstrated. The primary goal of the project was to develop and demonstrate an atmospheric-pressure plasma tool that is suitable for surgical use for shaving bone in humans. This goal was accomplished, in fact with several different alternative plasma approaches. High bone ablation speeds were measured. The use of probes ('plasma wand' - the surgical tool) with moving active electrodes was also explored, and there are advantages to this method. Another important feature is that the newly-exposed bone surface have only a very thin necrosis layer; this feature was demonstrated. This CRADA has greatly advanced our understanding of bone removal by atmospheric pressure plasmas in liquid, and puts ArthroCare in a good

Design and synthesis of fused polycycles via Diels–Alder reaction and ring-rearrangement metathesis as key steps

Directory of Open Access Journals (Sweden)

Sambasivarao Kotha

2015-07-01

Full Text Available Atom efficient processes such as the Diels–Alder reaction (DA and the ring-rearrangement metathesis (RRM have been used to design new polycycles. In this regard, ruthenium alkylidene catalysts are effective in realizing the RRM of bis-norbornene derivatives prepared by DA reaction and Grignard addition. Here, fused polycycles are assembled which are difficult to produce by conventional synthetic routes.

Design and synthesis of fused polycycles via Diels-Alder reaction and ring-rearrangement metathesis as key steps.

Science.gov (United States)

Kotha, Sambasivarao; Ravikumar, Ongolu

2015-01-01

Atom efficient processes such as the Diels-Alder reaction (DA) and the ring-rearrangement metathesis (RRM) have been used to design new polycycles. In this regard, ruthenium alkylidene catalysts are effective in realizing the RRM of bis-norbornene derivatives prepared by DA reaction and Grignard addition. Here, fused polycycles are assembled which are difficult to produce by conventional synthetic routes.

Frictional behavior of automotive brake materials under wet and dry conditions

Energy Technology Data Exchange (ETDEWEB)

Blau, P.J.; Martin, R.L. [Oak Ridge National Lab., TN (United States); Weintraub, M.H.; Jang, Ho; Donlon, W. [Ford Motor Co., Dearborn, MI (United States)

1996-12-15

The purpose of this effort was to develop an improved understanding of the relationship between the structure and frictional behavior of materials in the disc brake/rotor interface with a view toward improving the performance of automotive disc brakes. The three tasks involved in this Cooperative Research and Development Agreement (CRADA) were as follows: Task 1. Investigation of Brake Pads and Rotors. Characterize surface features of worn brake pads and rotors, with special attention to the transfer film which forms on them during operation. Ford to supply specimens for examination and other supporting information. Task 2. Effects of Atmosphere and Repeated Applications on Brake Material Friction. Conduct pin-on-disk friction tests at ORNL under controlled moisture levels to determine effects of relative humidity on frictional behavior of brake pad and rotor materials. Conduct limited tests on the characteristics of friction under application of repeated contacts. Task 3. Comparison of Dynamometer Tests with Laboratory Friction Tests. Compare ORNL friction data with Ford dynamometer test data to establish the degree to which the simple bench tests can be useful in helping to understand frictional behavior in full-scale brake component tests. This final report summarizes work performed under this CRADA.

Matrin 3 binds and stabilizes mRNA.

Directory of Open Access Journals (Sweden)

Maayan Salton

Full Text Available Matrin 3 (MATR3 is a highly conserved, inner nuclear matrix protein with two zinc finger domains and two RNA recognition motifs (RRM, whose function is largely unknown. Recently we found MATR3 to be phosphorylated by the protein kinase ATM, which activates the cellular response to double strand breaks in the DNA. Here, we show that MATR3 interacts in an RNA-dependent manner with several proteins with established roles in RNA processing, and maintains its interaction with RNA via its RRM2 domain. Deep sequencing of the bound RNA (RIP-seq identified several small noncoding RNA species. Using microarray analysis to explore MATR3's role in transcription, we identified 77 transcripts whose amounts depended on the presence of MATR3. We validated this finding with nine transcripts which were also bound to the MATR3 complex. Finally, we demonstrated the importance of MATR3 for maintaining the stability of several of these mRNA species and conclude that it has a role in mRNA stabilization. The data suggest that the cellular level of MATR3, known to be highly regulated, modulates the stability of a group of gene transcripts.

Technology Transfer Opportunities: On-Demand Printing in Support of National Geospatial Data

Science.gov (United States)

,

1997-01-01

The U.S. Geological Survey (USGS) and the 3M Company of St. Paul, Minnesota, have entered into a cooperative research and development agreement (CRADA) to investigate maps-on-demand technology to support the production of USGS mapping products. The CRADA will potentially help the USGS to develop on-demand alternatives to lithographic maps and help 3M to develop a series of commercial instant map-printing systems.

Image Matrix Processor for Volumetric Computations Final Report CRADA No. TSB-1148-95

Energy Technology Data Exchange (ETDEWEB)

Roberson, G. Patrick [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Browne, Jolyon [Advanced Research & Applications Corporation, Sunnyvale, CA (United States)

2018-01-22

The development of an Image Matrix Processor (IMP) was proposed that would provide an economical means to perform rapid ray-tracing processes on volume "Giga Voxel" data sets. This was a multi-phased project. The objective of the first phase of the IMP project was to evaluate the practicality of implementing a workstation-based Image Matrix Processor for use in volumetric reconstruction and rendering using hardware simulation techniques. Additionally, ARACOR and LLNL worked together to identify and pursue further funding sources to complete a second phase of this project.

Investigation of the fundamentals of low-energy nanosecond pulse ignition: Final CRADA Report

Energy Technology Data Exchange (ETDEWEB)

Wallner, Thomas [Argonne National Lab. (ANL), Argonne, IL (United States); Scarcelli, Riccardo [Argonne National Lab. (ANL), Argonne, IL (United States); Zhang, Anqi [Argonne National Lab. (ANL), Argonne, IL (United States); Sevik, James [Argonne National Lab. (ANL), Argonne, IL (United States); Biruduganti, Munidhar [Argonne National Lab. (ANL), Argonne, IL (United States); Bihari, Bipin [Argonne National Lab. (ANL), Argonne, IL (United States); Matusik, Katarzyna E. [Argonne National Lab. (ANL), Argonne, IL (United States); Duke, Daniel J. [Argonne National Lab. (ANL), Argonne, IL (United States); Powell, Christopher F. [Argonne National Lab. (ANL), Argonne, IL (United States); Kastengren, Alan L. [Argonne National Lab. (ANL), Argonne, IL (United States)

2017-01-01

A detailed investigation of the fundamentals of low-energy nanosecond pulse ignition was performed with the objective to overcome the barrier presented by limited knowledge and characterization of nonequilibrium plasma ignition for realistic internal combustion engine applications (be it in the automotive or power generation field) and shed light on the mechanisms which improve the performance of the advanced TPS ignition system compared to conventional state-of-the-art hardware. Three main tasks of the research included experimental evaluation on a single-cylinder automotive gasoline engine, experimental evaluation on a single-cylinder stationary natural gas engine and energy quantification using x-ray diagnostics.

Laser Texturing of Magnetic Recording Media Final Report CRADA No. TSV-1298-96

Energy Technology Data Exchange (ETDEWEB)

Hackel, L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Marshall, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-16

The Commercial Laser Systems Group at LLNL developed a concept for patterning of computer magnetic recording discs. Magnetic recording media require texturing over areas designated for contact in order to minimize friction with data transducing heads. In fabricating a hard disk, an aluminum nickel-phosphorous substrate was polished to a specular finish then a mechanical means was used to roughen an annular area intended to be the head contact band. In a previous patent (US Patent 5,062,021) it was proposed that the focused output of a low power laser with short pulse length could be used to generate the textured pattern. However, the patterned area typically required 75,000 textured spots that needed to be rapidly (less than 10 seconds) printed with good uniformity. A means to achieve the accurate placement and uniform profile, as well as a meaningfully rapid process time, was not discussed in the referenced patent. The LLNL team devised a system that could rapidly and inexpensively accomplish the texturing.

Evaluation of Aerogel Clad Optical Fibers Final Report CRADA No. TSB-1448-97

Energy Technology Data Exchange (ETDEWEB)

Maitland, Duncan [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Droege, M. W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2018-01-22

Fiber-optic based sensors will be needed for in situ monitoring of degradation products in various components of nuclear weapons. These sensors typically consist of a transducer located at the measurement site whose optical properties are modulated by interaction with the targeted degradation product. The interrogating light source and the detector for determining sensor response are located remotely. These two subsystems are connected by fiber optic cables. LLNL has developed a new technology, aerogel clad optical fibers, that have the advantage of accepting incident rays over a much wider angular range than normal glass clad fibers. These fibers are also capable of transmitting light more efficiently. These advantages can lead to a factor of 2-4 improvement in sensitivity and detection limit.

The treatment of crigler-najjar syndrome by blue light as explained by resonant recognition model

Directory of Open Access Journals (Sweden)

Cosic Irena

2016-12-01

However, the blue light treatment is less effective with ageing, due to decrease of the blue lightpenetration through skin. Thus, there is a need for alternative treatments. Here, we propose to design de-novopeptide, using this specific RRM frequency. Such peptide, according to RRM, is proposed to have the samebiological function as UDP glucuronosyltransferase 1-A1 and thus can be used for alternative treatment of Crigler-Najjar syndrome.

A systematic review of women's satisfaction and regret following risk-reducing mastectomy.

Science.gov (United States)

Braude, Lucy; Kirsten, Laura; Gilchrist, Jemma; Juraskova, Ilona

2017-12-01

A systematic review of quantitative and qualitative studies, to describe patient satisfaction and regret associated with risk-reducing mastectomies (RRM), and the patient-reported factors associated with these among women at high risk of developing breast cancer. Studies were identified using Medline, CINAHL, Embase and PsycInfo databases (1995-2016). Data were extracted and crosschecked for accuracy. Article quality was assessed using standardised criteria. Of the 1657 unique articles identified, 30 studies met the inclusion criteria (n=23 quantitative studies, n=3 qualitative studies, n=4 mixed-method studies). Studies included were cross-sectional (n=23) or retrospective (n=7). General satisfaction with RRM, decision satisfaction and aesthetic satisfaction were generally high, although some women expressed regret around their decision and dissatisfaction with their appearance. Factors associated with both patient satisfaction and regret included: post-operative complications, body image changes, psychological distress and perceived inadequacy of information. While satisfaction with RRM was generally high, some women had regrets and expressed dissatisfaction. Future research is needed to further explore RRM, and to investigate current satisfaction trends given the ongoing improvements to surgical and clinical practice. Offering pre-operative preparation, decisional support and continuous psychological input may help to facilitate satisfaction with this complex procedure. Copyright © 2017 Elsevier B.V. All rights reserved.

Design and synthesis of polycyclic sulfones via Diels-Alder reaction and ring-rearrangement metathesis as key steps.

Science.gov (United States)

Kotha, Sambasivarao; Gunta, Rama

2015-01-01

Here, we describe a new and simple synthetic strategy to various polycyclic sulfones via Diels-Alder reaction and ring-rearrangement metathesis (RRM) as the key steps. This approach delivers tri- and tetracyclic sulfones with six (n = 1), seven (n = 2) or eight-membered (n = 3) fused-ring systems containing trans-ring junctions unlike the conventional all cis-ring junctions generally obtained during the RRM sequence. Interestingly the starting materials used are simple and commercially available.

Variance-based Sensitivity Analysis of Large-scale Hydrological Model to Prepare an Ensemble-based SWOT-like Data Assimilation Experiments

Science.gov (United States)

Emery, C. M.; Biancamaria, S.; Boone, A. A.; Ricci, S. M.; Garambois, P. A.; Decharme, B.; Rochoux, M. C.

2015-12-01

Land Surface Models (LSM) coupled with River Routing schemes (RRM), are used in Global Climate Models (GCM) to simulate the continental part of the water cycle. They are key component of GCM as they provide boundary conditions to atmospheric and oceanic models. However, at global scale, errors arise mainly from simplified physics, atmospheric forcing, and input parameters. More particularly, those used in RRM, such as river width, depth and friction coefficients, are difficult to calibrate and are mostly derived from geomorphologic relationships, which may not always be realistic. In situ measurements are then used to calibrate these relationships and validate the model, but global in situ data are very sparse. Additionally, due to the lack of existing global river geomorphology database and accurate forcing, models are run at coarse resolution. This is typically the case of the ISBA-TRIP model used in this study.A complementary alternative to in-situ data are satellite observations. In this regard, the Surface Water and Ocean Topography (SWOT) satellite mission, jointly developed by NASA/CNES/CSA/UKSA and scheduled for launch around 2020, should be very valuable to calibrate RRM parameters. It will provide maps of water surface elevation for rivers wider than 100 meters over continental surfaces in between 78°S and 78°N and also direct observation of river geomorphological parameters such as width ans slope.Yet, before assimilating such kind of data, it is needed to analyze RRM temporal sensitivity to time-constant parameters. This study presents such analysis over large river basins for the TRIP RRM. Model output uncertainty, represented by unconditional variance, is decomposed into ordered contribution from each parameter. Doing a time-dependent analysis allows then to identify to which parameters modeled water level and discharge are the most sensitive along a hydrological year. The results show that local parameters directly impact water levels, while

Recent applications of ring-rearrangement metathesis in organic synthesis

Directory of Open Access Journals (Sweden)

Sambasivarao Kotha

2015-10-01

Full Text Available Ring-rearrangement metathesis (RRM involves multiple metathesis processes such as ring-opening metathesis (ROM/ring-closing metathesis (RCM in a one-pot operation to generate complex targets. RRM delivers complex frameworks that are difficult to assemble by conventional methods. The noteworthy point about this type of protocol is multi-bond formation and it is an atom economic process. In this review, we have covered literature that appeared during the last seven years (2008–2014.

Measurement of the charged particle nuclear modification factor in PbPb collisions at $\\sqrt{s_{\\rm NN}}=5.02~\\mathrm{TeV}$

CERN Document Server

CMS Collaboration

2016-01-01

The nuclear modification factor, $R_{\\rm AA}$, of charged particles produced in the $|\\eta|<1$ pseudorapidity region is measured at $\\sqrt{s_{\\rm NN}}=5.02~\\mathrm{TeV}$ using $404~\\mu\\mathrm{b}^{-1}$ of PbPb and $25.8~\\mathrm{pb}^{-1}$ of pp data collected by the CMS experiment at the end of 2015. The $R_{\\rm AA}$ is presented in several bins of collision centrality, over the transverse momentum range of $0.7-400~\\mathrm{GeV}$. The measured $R_{\\rm AA}$ in the $0-5\\%$ most central collision class shows a maximum suppression by a factor of approximately $7.5$ in the $6-9~\\mathrm{GeV}$ $p_\\mathrm{T}$ region, followed by a rising trend up to the highest transverse momenta measured in the analysis. The measurement is compared to earlier results at lower collision energies, and to theory predictions.

Centrality dependence of high-$p_{\\rm T}$ D meson suppression in Pb-Pb collisions at $\\sqrt{s_{\\rm NN}}$ = 2.76 TeV

CERN Document Server

Adam, Jaroslav; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahn, Sang Un; Aimo, Ilaria; Aiola, Salvatore; Ajaz, Muhammad; Akindinov, Alexander; Alam, Sk Noor; Aleksandrov, Dmitry; Alessandro, Bruno; Alexandre, Didier; Alfaro Molina, Jose Ruben; Alici, Andrea; Alkin, Anton; Millan Almaraz, Jesus Roberto; Alme, Johan; Alt, Torsten; Altinpinar, Sedat; Altsybeev, Igor; Alves Garcia Prado, Caio; Andrei, Cristian; Andronic, Anton; Anguelov, Venelin; Anielski, Jonas; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Armesto Perez, Nestor; Arnaldi, Roberta; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Bach, Matthias Jakob; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Baltasar Dos Santos Pedrosa, Fernando; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartke, Jerzy Gustaw; Bartsch, Esther; Basile, Maurizio; Bastid, Nicole; Basu, Sumit; Bathen, Bastian; Batigne, Guillaume; Batista Camejo, Arianna; Batyunya, Boris; Batzing, Paul Christoph; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Belmont Iii, Ronald John; Belmont Moreno, Ernesto; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Berceanu, Ionela; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhasin, Anju; Bhat, Inayat Rasool; Bhati, Ashok Kumar; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Livio; Bianchi, Nicola; Bianchin, Chiara; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biswas, Rathijit; Biswas, Saikat; Bjelogrlic, Sandro; Blanco, Fernando; Blau, Dmitry; Blume, Christoph; Bock, Friederike; Bogdanov, Alexey; Boggild, Hans; Boldizsar, Laszlo; Bombara, Marek; Book, Julian Heinz; Borel, Herve; Borissov, Alexander; Borri, Marcello; Bossu, Francesco; Botta, Elena; Boettger, Stefan; Braun-Munzinger, Peter; Bregant, Marco; Breitner, Timo Gunther; Broker, Theo Alexander; Browning, Tyler Allen; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Caffarri, Davide; Cai, Xu; Caines, Helen Louise; Calero Diaz, Liliet; Caliva, Alberto; Calvo Villar, Ernesto; Camerini, Paolo; Carena, Francesco; Carena, Wisla; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Cavicchioli, Costanza; Ceballos Sanchez, Cesar; Cepila, Jan; Cerello, Piergiorgio; Cerkala, Jakub; Chang, Beomsu; Chapeland, Sylvain; Chartier, Marielle; Charvet, Jean-Luc Fernand; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chelnokov, Volodymyr; Cherney, Michael Gerard; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Chochula, Peter; Choi, Kyungeon; Chojnacki, Marek; Choudhury, Subikash; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-Urk; Zhang, Chunhui; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Connors, Megan Elizabeth; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortes Maldonado, Ismael; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Crochet, Philippe; Cruz Albino, Rigoberto; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Deisting, Alexander; Deloff, Andrzej; Denes, Ervin Sandor; D'Erasmo, Ginevra; Di Bari, Domenico; Di Mauro, Antonio; Di Nezza, Pasquale; Diaz Corchero, Miguel Angel; Dietel, Thomas; Dillenseger, Pascal; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Dobrowolski, Tadeusz Antoni; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Engel, Heiko; Erazmus, Barbara Ewa; Erdemir, Irem; Erhardt, Filip; Eschweiler, Dominic; Espagnon, Bruno; Estienne, Magali Danielle; Esumi, Shinichi; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Eyyubova, Gyulnara; Fabbietti, Laura; Fabris, Daniela; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Felea, Daniel; Feliciello, Alessandro; Feofilov, Grigorii; Ferencei, Jozef; Fernandez Tellez, Arturo; Gonzalez Ferreiro, Elena; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fiore, Enrichetta Maria; Fleck, Martin Gabriel; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Frankenfeld, Ulrich Michael; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gallio, Mauro; Gangadharan, Dhevan Raja; Ganoti, Paraskevi; Gao, Chaosong; Garabatos Cuadrado, Jose; Garcia-Solis, Edmundo Javier; Gargiulo, Corrado; Gasik, Piotr Jan; Germain, Marie; Gheata, Andrei George; Gheata, Mihaela; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Gladysz-Dziadus, Ewa; Glassel, Peter; Gomez Ramirez, Andres; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Grelli, Alessandro; Grigoras, Alina Gabriela; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Grynyov, Borys; Grion, Nevio; Grosse-Oetringhaus, Jan Fiete; Grossiord, Jean-Yves; Grosso, Raffaele; Guber, Fedor; Guernane, Rachid; Guerzoni, Barbara; Gulbrandsen, Kristjan Herlache; Gulkanyan, Hrant; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Haake, Rudiger; Haaland, Oystein Senneset; Hadjidakis, Cynthia Marie; Haiduc, Maria; Hamagaki, Hideki; Hamar, Gergoe; Hansen, Alexander; Harris, John William; Hartmann, Helvi; Harton, Austin Vincent; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Heide, Markus Ansgar; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Herrera Corral, Gerardo Antonio; Hess, Benjamin Andreas; Hetland, Kristin Fanebust; Hilden, Timo Eero; Hillemanns, Hartmut; Hippolyte, Boris; Hosokawa, Ritsuya; Hristov, Peter Zahariev; Huang, Meidana; Humanic, Thomas; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Ilkaev, Radiy; Ilkiv, Iryna; Inaba, Motoi; Ippolitov, Mikhail; Irfan, Muhammad; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacobs, Peter Martin; Jadlovska, Slavka; Jahnke, Cristiane; Jang, Haeng Jin; Janik, Malgorzata Anna; Pahula Hewage, Sandun; Jena, Chitrasen; Jena, Satyajit; Jimenez Bustamante, Raul Tonatiuh; Jones, Peter Graham; Jung, Hyungtaik; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kamin, Jason Adrian; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karayan, Lilit; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Khan, Kamal; Khan, Mohammed Mohisin; Khan, Palash; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Kileng, Bjarte; Kim, Beomkyu; Kim, Do Won; Kim, Dong Jo; Kim, Hyeonjoong; Kim, Jinsook; Kim, Mimae; Kim, Minwoo; Kim, Se Yong; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Kiss, Gabor; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-Boesing, Christian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobayashi, Taiyo; Kobdaj, Chinorat; Kofarago, Monika; Kollegger, Thorsten; Kolozhvari, Anatoly; Kondratev, Valerii; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Kopcik, Michal; Kour, Mandeep; Kouzinopoulos, Charalampos; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Koyithatta Meethaleveedu, Greeshma; Kral, Jiri; Kralik, Ivan; Kravcakova, Adela; Krelina, Michal; Kretz, Matthias; Krivda, Marian; Krizek, Filip; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kugathasan, Thanushan; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kulakov, Igor; Kumar, Ajay; Kumar, Jitendra; Lokesh, Kumar; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lagana Fernandes, Caio; Lakomov, Igor; Langoy, Rune; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Lattuca, Alessandra; Laudi, Elisa; Lea, Ramona; Leardini, Lucia; Lee, Graham Richard; Lee, Seongjoo; Legrand, Iosif; Lehas, Fatiha; Lemmon, Roy Crawford; Lenti, Vito; Leogrande, Emilia; Leon Monzon, Ildefonso; Leoncino, Marco; Levai, Peter; Li, Shuang; Li, Xiaomei; Lien, Jorgen Andre; Lietava, Roman; Lindal, Svein; Lindenstruth, Volker; Lippmann, Christian; Lisa, Michael Annan; Ljunggren, Hans Martin; Lodato, Davide Francesco; Lonne, Per-Ivar; Loginov, Vitaly; Loizides, Constantinos; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Lunardon, Marcello; Luparello, Grazia; Ferreira Natal Da Luz, Pedro Hugo; Maevskaya, Alla; Mager, Magnus; Mahajan, Sanjay; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Maldonado Cervantes, Ivonne Alicia; Malinina, Liudmila; Mal'Kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martin Blanco, Javier; Martinengo, Paolo; Martinez Hernandez, Mario Ivan; Martinez-Garcia, Gines; Martinez Pedreira, Miguel; Martynov, Yevgen; Mas, Alexis Jean-Michel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Mastroserio, Annalisa; Masui, Hiroshi; Matyja, Adam Tomasz; Mayer, Christoph; Mazer, Joel Anthony; Mazzoni, Alessandra Maria; Mcdonald, Daniel; Meddi, Franco; Melikyan, Yuri; Menchaca-Rocha, Arturo Alejandro; Meninno, Elisa; Mercado-Perez, Jorge; Meres, Michal; Miake, Yasuo; Mieskolainen, Matti Mikael; Mikhaylov, Konstantin; Milano, Leonardo; Milosevic, Jovan; Minervini, Lazzaro Manlio; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Bedangadas; Molnar, Levente; Montano Zetina, Luis Manuel; Montes Prado, Esther; Morando, Maurizio; Moreira De Godoy, Denise Aparecida; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Murray, Sean; Musa, Luciano; Musinsky, Jan; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Naru, Muhammad Umair; Nattrass, Christine; Nayak, Kishora; Nayak, Tapan Kumar; Nazarenko, Sergey; Nedosekin, Alexander; Nellen, Lukas; Ng, Fabian; Nicassio, Maria; Niculescu, Mihai; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Saehanseul; Oh, Sun Kun; Ohlson, Alice Elisabeth; Okatan, Ali; Okubo, Tsubasa; Olah, Laszlo; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Ozdemir, Mahmut; Pachmayer, Yvonne Chiara; Pagano, Paola; Paic, Guy; Pajares Vales, Carlos; Pal, Susanta Kumar; Pan, Jinjin; Pandey, Ashutosh Kumar; Pant, Divyash; Papcun, Peter; Papikyan, Vardanush; Pappalardo, Giuseppe; Pareek, Pooja; Park, Woojin; Parmar, Sonia; Passfeld, Annika; Paticchio, Vincenzo; Patra, Rajendra Nath; Paul, Biswarup; Peitzmann, Thomas; Pereira Da Costa, Hugo Denis Antonio; Pereira De Oliveira Filho, Elienos; Peresunko, Dmitry Yurevich; Perez Lara, Carlos Eugenio; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrov, Viacheslav; Petrovici, Mihai; Petta, Catia; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Pinazza, Ombretta; Pinsky, Lawrence; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Porteboeuf, Sarah Julie; Porter, R Jefferson; Pospisil, Jan; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Puddu, Giovanna; Pujahari, Prabhat Ranjan; Punin, Valery; Putschke, Jorn Henning; Qvigstad, Henrik; Rachevski, Alexandre; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Read, Kenneth Francis; Real, Jean-Sebastien; Redlich, Krzysztof; Reed, Rosi Jan; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reolon, Anna Rita; Reshetin, Andrey; Rettig, Felix Vincenz; Revol, Jean-Pierre; Reygers, Klaus Johannes; Riabov, Viktor; Ricci, Renato Angelo; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-Lucian; Rivetti, Angelo; Rocco, Elena; Rodriguez Cahuantzi, Mario; Rodriguez Manso, Alis; Roeed, Ketil; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Romita, Rosa; Ronchetti, Federico; Ronflette, Lucile; Rosnet, Philippe; Rossi, Andrea; Roukoutakis, Filimon; Roy, Ankhi; Roy, Christelle Sophie; Roy, Pradip Kumar; Rubio Montero, Antonio Juan; Rui, Rinaldo; Russo, Riccardo; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Sadovskiy, Sergey; Safarik, Karel; Sahlmuller, Baldo; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Salgado Lopez, Carlos Alberto; Salzwedel, Jai Samuel Nielsen; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sanchez Castro, Xitzel; Sandor, Ladislav; Sandoval, Andres; Sano, Masato; Sarkar, Debojit; Scapparone, Eugenio; Scarlassara, Fernando; Scharenberg, Rolf Paul; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schuchmann, Simone; Schukraft, Jurgen; Schulc, Martin; Schuster, Tim Robin; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Scott, Rebecca Michelle; Seeder, Karin Soraya; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Seo, Jeewon; Serradilla Rodriguez, Eulogio; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shadura, Oksana; Shahoyan, Ruben; Shangaraev, Artem; Sharma, Ankita; Sharma, Mona; Sharma, Monika; Sharma, Natasha; Shigaki, Kenta; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Silvestre, Catherine Micaela; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singha, Subhash; Singhal, Vikas; Sinha, Bikash; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Soegaard, Carsten; Soltz, Ron Ariel; Song, Jihye; Song, Myunggeun; Song, Zixuan; Soramel, Francesca; Sorensen, Soren Pontoppidan; Spacek, Michal; Spiriti, Eleuterio; Sputowska, Iwona Anna; Spyropoulou-Stassinaki, Martha; Srivastava, Brijesh Kumar; Stachel, Johanna; Stan, Ionel; Stefanek, Grzegorz; Steinpreis, Matthew Donald; Stenlund, Evert Anders; Steyn, Gideon Francois; Stiller, Johannes Hendrik; Stocco, Diego; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Sultanov, Rishat; Sumbera, Michal; Symons, Timothy; Szabo, Alexander; Szanto De Toledo, Alejandro; Szarka, Imrich; Szczepankiewicz, Adam; Szymanski, Maciej Pawel; Takahashi, Jun; Tanaka, Naoto; Tangaro, Marco-Antonio; Tapia Takaki, Daniel Jesus; Tarantola Peloni, Attilio; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-Gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terasaki, Kohei; Terrevoli, Cristina; Teyssier, Boris; Thaeder, Jochen Mathias; Thomas, Deepa; Tieulent, Raphael Noel; Timmins, Anthony Robert; Toia, Alberica; Trogolo, Stefano; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vajzer, Michal; Vala, Martin; Valencia Palomo, Lizardo; Vallero, Sara; Van Der Maarel, Jasper; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vanat, Tomas; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vechernin, Vladimir; Veen, Annelies Marianne; Veldhoen, Misha; Velure, Arild; Venaruzzo, Massimo; Vercellin, Ermanno; Vergara Limon, Sergio; Vernet, Renaud; Verweij, Marta; Vickovic, Linda; Viesti, Giuseppe; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Vinogradov, Alexander; Vinogradov, Leonid; Vinogradov, Yury; Virgili, Tiziano; Vislavicius, Vytautas; Viyogi, Yogendra; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Vranic, Danilo; Vrlakova, Janka; Vulpescu, Bogdan; Vyushin, Alexey; Wagner, Boris; Wagner, Jan; Wang, Hongkai; Wang, Mengliang; Wang, Yifei; Watanabe, Daisuke; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Wessels, Johannes Peter; Westerhoff, Uwe; Wiechula, Jens; Wikne, Jon; Wilde, Martin Rudolf; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Williams, Crispin; Windelband, Bernd Stefan; Winn, Michael Andreas; Yaldo, Chris G; Yang, Hongyan; Yang, Ping; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-Kwon; Yurchenko, Volodymyr; Yushmanov, Igor; Zaborowska, Anna; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correia Zanoli, Henrique Jose; Zaporozhets, Sergey; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zgura, Sorin Ion; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhang, Yonghong; Zhao, Chengxin; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zhu, Xiangrong; Zichichi, Antonino; Zimmermann, Alice; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zyzak, Maksym

2015-11-30

The nuclear modification factor, $R_{\\rm AA}$, of the prompt charmed mesons ${\\rm D^0}$, ${\\rm D^+}$ and ${\\rm D^{*+}}$, and their antiparticles, was measured with the ALICE detector in Pb-Pb collisions at a centre-of-mass energy $\\sqrt{s_{\\rm NN}} = 2.76$ TeV in two transverse momentum intervals, $5R_{\\rm AA}$ shows a maximum suppression of a factor of 5-6 in the 10% most central collisions. The suppression and its centrality dependence are compatible within uncertainties with those of charged pions. A comparison with the $R_{\\rm AA}$ of non-prompt ${\\rm J}/\\psi$ from B meson decays, measured by the CMS Collaboration, hints at a larger suppression of D mesons in the most central collisions.

Discovery of a Splicing Regulator Required for Cell Cycle Progression

Energy Technology Data Exchange (ETDEWEB)

Suvorova, Elena S.; Croken, Matthew; Kratzer, Stella; Ting, Li-Min; Conde de Felipe, Magnolia; Balu, Bharath; Markillie, Lye Meng; Weiss, Louis M.; Kim, Kami; White, Michael W.

2013-02-01

In the G1 phase of the cell division cycle, eukaryotic cells prepare many of the resources necessary for a new round of growth including renewal of the transcriptional and protein synthetic capacities and building the machinery for chromosome replication. The function of G1 has an early evolutionary origin and is preserved in single and multicellular organisms, although the regulatory mechanisms conducting G1 specific functions are only understood in a few model eukaryotes. Here we describe a new G1 mutant from an ancient family of apicomplexan protozoans. Toxoplasma gondii temperature-sensitive mutant 12-109C6 conditionally arrests in the G1 phase due to a single point mutation in a novel protein containing a single RNA-recognition-motif (TgRRM1). The resulting tyrosine to asparagine amino acid change in TgRRM1 causes severe temperature instability that generates an effective null phenotype for this protein when the mutant is shifted to the restrictive temperature. Orthologs of TgRRM1 are widely conserved in diverse eukaryote lineages, and the human counterpart (RBM42) can functionally replace the missing Toxoplasma factor. Transcriptome studies demonstrate that gene expression is downregulated in the mutant at the restrictive temperature due to a severe defect in splicing that affects both cell cycle and constitutively expressed mRNAs. The interaction of TgRRM1 with factors of the tri-SNP complex (U4/U6 & U5 snRNPs) indicate this factor may be required to assemble an active spliceosome. Thus, the TgRRM1 family of proteins is an unrecognized and evolutionarily conserved class of splicing regulators. This study demonstrates investigations into diverse unicellular eukaryotes, like the Apicomplexa, have the potential to yield new insights into important mechanisms conserved across modern eukaryotic kingdoms.

Direct and maternal genetic effects for preweaning growth in Retinta cattle estimated by a longitudinal approach throughout the calving trajectory of the cow.

Science.gov (United States)

Morales, R; Menéndez-Buxadera, A; Avilés, C; Molina, A

2013-12-01

The direct and maternal genetic effects were estimated for the preweaning growth of Retinta calves with a multitrait model across parities, using a longitudinal approach with random regression models (RRM). The 120 (P120) and 180 days (P180) weights (5972 calves) were considered as different traits in each calving. The heritability of direct effect across parities was on average 0.37 for P120 and 0.58 for P180, slightly higher than the estimates by univariate (0.30 and 0.56) and bivariate models (0.30 and 0.51, respectively). The heritability for maternal effects was 0.16 for P120 and 0.26 for P180 and very similar by uni- (0.16 and 0.23) and multivariate model (0.16 and 0.22, respectively). The correlation between direct and maternal effects by RRM showed a pronounced antagonism -0.64 for P120 and -0.78 for P180), likewise uni- (-0.62 and -0.72) and multivariate case (-0.64 and -0.74, respectively). The preweaning weights should be considered as different traits across parities, because the genetic correlations were different from unity. The RRM also allowed us to estimate all the parameters throughout the calving trajectory of the cow. The use of multiple traits RRM across parities can provide very useful information for the breeding programmes. © 2013 Blackwell Verlag GmbH.

Pre-expansion before risk reducing mastectomy combined with lipomodelling to enhance results from implant based reconstruction.

Science.gov (United States)

Katerinaki, E; Sircar, T; Fatah, F

2012-02-01

Implant based breast reconstruction after risk reducing mastectomy (RRM) is challenging as implants are inadequately covered in their lower pole. Also complication rates with one stage procedures are significant. We describe a novel method of pre-expansion by inserting subpectoral anatomical expandable implants to prepare the breast mound before RRM is carried out. Lipomodelling is later used to enhance the overall result of the reconstruction. Six patients who were BRCA 1 mutation carriers requested bilateral RRM. Median age was 31. All were non-smokers. Anatomical expandable implants were inserted via an inframammary incision and were expanded in the next two months. RRM was carried out 6-13 months later and was followed by lipomodelling seven months afterwards. Four patients had a nipple sparing mastectomy. In three cases access was via the previous inframammary scar. In all cases complete implant cover had been achieved. There were no early postoperative complications but one patient has developed grade III capsular contracture on the side of previous wide local tumour excision and radiotherapy. Five patients have so far undergone post-mastectomy lipomodelling to improve breast contour. In conclusion, we believe that our technique provides better aesthetic results with reduced complication rates for these patients. Copyright © 2011 British Association of Plastic, Reconstructive and Aesthetic Surgeons. Published by Elsevier Ltd. All rights reserved.

Development of CVD Diamond for Industrial Applications Final Report CRADA No. TC-2047-02

Energy Technology Data Exchange (ETDEWEB)

Caplan, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Olstad, R. [General Atomics, San Diego, CA (United States); Jory, H. [Communications and Power Industries, Palo Alto, CA (United States); Vikharov, A. L. [Russian Academy of Sciences (RAS), Moscow (Russian Federation)

2017-09-08

This project was a collaborative effort to develop and demonstrate a new millimeter microwave assisted chemical vapor deposition(CVD) process for manufacturing large diamond disks with greatly reduced processing times and costs from those now available. In the CVD process, carbon based gases (methane) and hydrogen are dissociated into plasma using microwave discharge and then deposited layer by layer as polycrystalline diamond onto a substrate. The available low frequency (2.45GHz) microwave sources used elsewhere (De Beers) result in low density plasmas and low deposition rates: 4 inch diamond disks take 6-8 weeks to process. The new system developed in this project uses a high frequency 30GHz Gyrotron as the microwave source and a quasi-optical CVD chamber resulting in a much higher density plasma which greatly reduced the diamond processing times (1-2 weeks)

Numerical Simulations of 3D Seismic Data Final Report CRADA No. TC02095.0

Energy Technology Data Exchange (ETDEWEB)

Friedmann, S. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kostov, C. [Schlumberger Cambridge Research (United Kingdom)

2017-09-06

This was a collaborative effort between Lawrence Livermore National Security, LLC (formerly The Regents of the University of Califomia)/Lawrence-Livermore National Laboratory (LLNL) and Schlumberger Cambridge Research (SCR), to develop synthetic seismic data sets and supporting codes.

Interventional Application of Shape Memory Polymer Foam Final Report CRADA No. TC-02067-03

Energy Technology Data Exchange (ETDEWEB)

Maitland, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Metzger, M. F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-27

This was a collaborative effort between The Regents of the University of California, Lawrence Livermore National Laboratory (LLNL) and Sierra Interventions, LLC, to develop shape memory polymer foam devices for treating hemorrhagic stroke.

Monolithic circuits for barium fluoride detectors used in nuclear physics experiments. CRADA final report

International Nuclear Information System (INIS)

Varner, R.L.; Blankenship, J.L.; Beene, J.R.; Todd, R.A.

1998-02-01

Custom monolithic electronic circuits have been developed recently for large detector applications in high energy physics where subsystems require tens of thousands of channels of signal processing and data acquisition. In the design and construction of these enormous detectors, it has been found that monolithic circuits offer significant advantages over discrete implementations through increased performance, flexible packaging, lower power and reduced cost per channel. Much of the integrated circuit design for the high energy physics community is directly applicable to intermediate energy heavy-ion and electron physics. This STTR project conducted in collaboration with researchers at the Holifield Radioactive Ion Beam Facility (HRIBF) at Oak Ridge National Laboratory, sought to develop a new integrated circuit chip set for barium fluoride (BaF 2 ) detector arrays based upon existing CMOS monolithic circuit designs created for the high energy physics experiments. The work under the STTR Phase 1 demonstrated through the design, simulation, and testing of several prototype chips the feasibility of using custom CMOS integrated circuits for processing signals from BaF 2 detectors. Function blocks including charge-sensitive amplifiers, comparators, one shots, time-to-amplitude converters, analog memory circuits and buffer amplifiers were implemented during Phase 1 effort. Experimental results from bench testing and laboratory testing with sources were documented

CRADA Final Report: Identification of New Therapies with Potential for Treatment of Breast Cancer

Energy Technology Data Exchange (ETDEWEB)

Bissell, Mina J.

2002-10-21

This project represents a collaboration between two research groups at Lawrence Berkeley National Laboratory (LBNL) and the research facility at the Chiron corporation, in which each group supplied unique and essential contributions. Mina Bissell, at LBNL, provided the resources and expertise of her research group in a physiologically relevant culture system with particular utility for investigating the development of breast cancer. Chiron Corporation, of Emeryville, California, generated high-quality cDNA microarrays, hybridized cDNA prepared from cultures and cell lines developed in the Bissell laboratory, and performed preliminary analysis of the resultant dataset. Saira Mian, at LBNL, used sophisticated statistical and Bayesian techniques for analysis of the enormously complex dataset to reveal key genes involved in signaling pathways responsible for development of breast cancer. These results have indicated separate and distinct groups of genes associated only with the nonmalignant cells, with the malignant cells, and the reverted cells. Currently, the project team is involved in data verification, to be followed by testing selected genes for utility as potential tumor suppressors. However, the results already obtained were so striking that a disclosure has been filed on 367 of the selected genes for potential use in therapy.

Algorithms and Architectures for Elastic-Wave Inversion Final Report CRADA No. TC02144.0

Energy Technology Data Exchange (ETDEWEB)

Larsen, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Lindtjorn, O. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-15

This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and Schlumberger Technology Corporation (STC), to perform a computational feasibility study that investigates hardware platforms and software algorithms applicable to STC for Reverse Time Migration (RTM) / Reverse Time Inversion (RTI) of 3-D seismic data.

Ozone/UV treatment to enhance biodegradation of surfactants in industrial wastewater. CRADA final report

Energy Technology Data Exchange (ETDEWEB)

Cline, J.E. [Lockheed Martin Energy Systems, Inc., Oak Ridge, TN (United States); Sullivan, P.F. [Specialty Industrial Products, Inc., Spartanburg, SC (United States); Lovejoy, M.A.; Collier, J. [Sun River Innovations, Ltd., Lexington, KY (United States); Adams, C.D. [Univ. of Missouri, Rolla, MO (United States)

1996-10-01

The new owners of a surfactant manufacturing plant wanted to triple production but were limited by the plant`s wastewater treatment capacity. Mass balance calculations indicated that little aerobic biodegradation was occurring in the plant`s wastewater treatment system. Literature reviews and laboratory tests confirmed that as much as 60% of the plant`s products might resist aerobic biodegradation. Overall chemical losses, both solid and aqueous, were estimated at 3.8% of theoretical. Organic loadings to the wastewater treatment system were 170 kg/d of which 50 kg/d reached the biological treatment system. Pollution prevention measures have allowed a > 20% increase in production levels with a > 30% decrease in effluent volume and no increase in discharge of chemical oxygen demand (COD). A new dissolved air flotation (DAF) system removes 70% of the organic loading. Sludge volumes are lower by an order of magnitude than with the clarifier/drum-filter process it replaced.

Rapid Assessment of Individual Soldier Operational Readiness Final Report CRADA No. TC02104.0

Energy Technology Data Exchange (ETDEWEB)

Turteltaub, K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Mapes, J. [Rules Based Medicine, Inc., Austin, TX (United States)

2017-09-08

This was a collaborative effort between Lawrence Livermore National Security (LLNS) (formerly The Regents of the University of California), Lawrence Livermore National Laboratory (LLNL) and Rules Based Medicine, Inc. {RBM), to identify markers in blood that would be candidates for determining the combat readiness of troops.

Miniature CCD X-Ray Imaging Camera Technology Final Report CRADA No. TC-773-94

Energy Technology Data Exchange (ETDEWEB)

Conder, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Mummolo, F. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-19

The goal of the project was to develop a compact, large active area, high spatial resolution, high dynamic range, charge-coupled device (CCD) camera to replace film for digital imaging of visible light, ultraviolet radiation, and soft to penetrating X-rays. The camera head and controller needed to be capable of operation within a vacuum environment and small enough to be fielded within the small vacuum target chambers at LLNL.

Field Emission Cathode Based X-Ray Source Final Report CRADA No. TSV-1456-97

Energy Technology Data Exchange (ETDEWEB)

Morse, J. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Turner, D. C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-11-01

To characterize the aging mechanisms of the nuclear stockpile, sensors and diagnostics were required for identifying the precursors to degradation of the materials and components. Existing approaches utilized an invasive sampling of the vacuum system surrounding the components to identify the presence of any chemicals that could outgas from the components by techniques such as ion mass spectrometry. This resulted in the inactivation of the system for a period of time, and possibly the destruction of the system as well. Furthermore, this approach did not allow for real time monitoring in order to determine rates of degradation. Instead, it provided an integration of the amount of degradation over the sample period.

Advanced Manufacturing - National Information Infrastructure (AM-NII) Final Report CRADA No. TO-4013-01

Energy Technology Data Exchange (ETDEWEB)

Vickers, Don [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2001-03-23

Advanced Manufacturing - National Information Infrastructure (AM-NII) was a multiyear DOE/DP program, involving multiple DOE laboratories and production facilities, focused on improving the manufacturing capabilities of the Nuclear Weapons Complex (NWC) through the application of modem information technologies. AM-NII's published mission states: "In partnership with the manufacturing business sector, AMNII will leverage DOE capabilities to develop, demonstrate, and pilot industrial information infrastructure and applications that enhance national security." LLNL's AM-NII project targeted two opportunities for improving NWC manufacturing capabilities. First was the link between the NWC and its outside suppliers of manufactured parts - web-based supply-chain integration. Second was the cross-site enterprise integration (EI) within the Complex itself. The general approach to supply-chain integration was to leverage the National Information Infrastructure (including Internet) to demonstrate the procurement of fabricated electrical and mechanical parts using a completely paperless procurement process. The general approach to NWC enterprise integration was to utilize SecureNet, a network that provides a secure, high-speed data link among the various NWC sites. If one looks at SecureNet as "the track," our goal was to get the trains running. Cross-site enterprise integration presupposes there is some level of local integration, so we worked both local and cross-site is sues simultaneously. Our EI work was in support of the LLNL Stockpile Life Extension Programs (SLEPs), the Submarine Launch Ballistic Missile Warhead Protection Program (SWPP), and the Laser Cutter Workstation installed at Y-12.

Ceramicrete stabilization of radioactive-salt-containing liquid waste and sludge water. Final CRADA report.

Energy Technology Data Exchange (ETDEWEB)

Ehst, D.; Nuclear Engineering Division

2010-08-04

It was found that the Ceramicrete Specimens incorporated the Streams 1 and 2 sludges with the adjusted loading about 41.6 and 31.6%, respectively, have a high solidity. The visible cracks in the matrix materials and around the anionite AV-17 granules included could not obtain. The granules mentioned above fixed by Ceramicrete matrix very strongly. Consequently, we can conclude that irradiation of Ceramecrete matrix, goes from the high radioactive elements, not result the structural degradation. Based on the chemical analysis of specimens No.462 and No.461 used it was shown that these matrix included the formation elements (P, K, Mg, O), but in the different samples their correlations are different. These ratios of the content of elements included are about {+-} 10%. This information shows a great homogeneity of matrix prepared. In the list of the elements founded, expect the matrix formation elements, we detected also Ca and Si (from the wollastonite - the necessary for Ceramicrete compound); Na, Al, S, O, Cl, Fe, Ni also have been detected in the Specimen No.642 from the waste forms: NaCl, Al(OH){sub 3}, Na{sub 2}SO{sub 4}. Fe(OH){sub 3}, nickel ferrocyanide and Ni(NO{sub 3})2. The unintelligible results also were found from analysis of an AV-17 granules, in which we obtain the great amount of K. The X-ray radiographs of the Ceramicrete specimens with loading 41.4 % of Stream 1 and 31.6% of Stream 2, respectively showed that the realization of the advance technology, created at GEOHKI, leads to formation of excellent ceramic matrix with high amount of radioactive streams up to 40% and more. Really, during the interaction with start compounds MgO and KH{sub 2}PO{sub 4} with the present of H{sub 3}BO{sub 3} and Wollastonite this process run with high speed under the controlled regimes. That fact that the Ceramicrete matrix with 30-40% of Streams 1 and 2 have a crystalline form, not amorphous matter, allows to permit that these matrix should be very stable, reliable for incorporation of a radionuclides.

Water Treatment Using Advanced Ultraviolet Light Sources Final Report CRADA No. TC02089.0

Energy Technology Data Exchange (ETDEWEB)

Hoppes, W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Oster, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-15

This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and Teknichal Services, LLC (TkS), to develop water treatment systems using advanced ultraviolet light sources. The Russian institutes involved with this project were The High Current Electronics Institute (HCEI) and Russian Institute of Technical Physics-Institute of Experimental Physics (VNIIEF). HCEI and VNIIEF developed and demonstrated the potential commercial viability of short-wavelength ultraviolet excimer lamps under a Thrust 1 Initiatives for Proliferation Prevention (IPP) Program. The goals of this collaboration were to demonstrate both the commercial viability of excilampbased water disinfection and achieve further substantial operational improvement in the lamps themselves; particularly in the area of energy efficiency.

Optical Encoding Technology for Viral Screening Panels Final Report CRADA No TC02132.0

Energy Technology Data Exchange (ETDEWEB)

Lenhoff, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Haushalter, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-15

This was a collaborative effort between Lawrence Livermore National Security, LLC, Lawrence Livermore National Laboratory (LLNL) and Parallel Synthesis Technologies, Inc. (PSTI), to develop Optical Encoding Technology for Viral Screening Panels. The goal for this effort was to prepare a portable bead reader system that would enable the development of viral and bacterial screening panels which could be used for the detection of any desired set of bacteria or viruses in any location. The main objective was to determine if the combination of a bead-based, PCR suspension array technology, formulated from Parallume encoded beads and PSTI’s multiplex assay reader system (MARS), could provide advantages in terms of the number of simultaneously measured samples, portability, ruggedness, ease of use, accuracy, precision or cost as compared to the Luminexbased system developed at LLNL. The project underwent several no cost extensions however the overall goal of demonstrating the utility of this new system was achieved. As a result of the project a significant change to the type of bead PSTI used for the suspension system was implemented allowing better performance than the commercial Luminex system.

Ceramic High Efficiency Particulate Air (HEPA) Filter Final Report CRADA No. TC02160.0

Energy Technology Data Exchange (ETDEWEB)

Mitchell, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bergman, W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-25

The technical objective of this project was to develop a ceramic HEPA filter technology, by initially producing and testing coupon ceramics, small scale prototypes, and full scale prototype HEPA filters, and to address relevant manufacturing and commercialization technical issues.

Production of Ra225 precursor for Ac225/Bi213 generators. Final CRADA Report

International Nuclear Information System (INIS)

Ehst, D.A.

2009-01-01

Russian subcontractors shipped two small deliveries of Ra225 to PNNL for evaluation. The activity was close to the requisite amount in the subcontract. The first labeled properly; the second did not. This showed that the Russians could supply Ra225 to the US; however they proved unable to meet future demands for larger amounts of activity. The US DOE attempts to get Ra225 from Russian should be terminated; the Russians, under Rosatom, are not interested in this business.

Development and Demonstration of Carbon Fuel Cell Final Report CRADA No. TC02091.0

Energy Technology Data Exchange (ETDEWEB)

Cooper, J. F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Berner, J. K. [Contained Energy, Inc., Shaker Heights, OH (United States)

2017-09-08

This was a collaborative effort between The Regents of the University of California, Lawrence Livermore National Laboratory (LLNL) and Contained Energy, Inc. (CEI), to conduct necessary research and to develop, fabricate and test a multi-cell carbon fuel cell.

Ceramic High Efficiency Particulate Air (HEPA) Filter Final Report CRADA No. TC02102.0

Energy Technology Data Exchange (ETDEWEB)

Mitchell, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Morse, T. [Flanders Corp., Washington, DC (United States)

2017-09-06

This was a collaborative effort between Lawrence Livermore National Security, LLC (formerly The Regents of the University of California)/Lawrence Livermor e National Laboratory (LLNL) and Flanders-Precisionaire (Flanders), to develop ceramic HEP A filters under a Thrust II Initiative for Proliferation Prevention (IPP) project. The research was conducted via the IPP Program at Commonwe alth of Independent States (CIS) Institutes, which are handled under a separate agreement. The institutes (collectively referred to as "CIS Institutes") involved with this project were: Bochvar: Federal State Unitarian Enterprise All-Russia Scientific and Research Institute of Inorganic Materials (FSUE VNIINM); Radium Khlopin: Federal State Unitarian Enterprise NPO Radium Institute named (FSUE NPO Radium Institute); and Bakor: Science and Technology Center Bakor (STC Bakor).

Multiplicity dependence of charged pion, kaon, and (anti)proton production at large transverse momentum in p-Pb collisions at $\\sqrt{s_{\\rm NN}}$= 5.02 TeV

CERN Document Server

Adam, Jaroslav; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahmad, Shakeel; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Alam, Sk Noor; Aleksandrov, Dmitry; Alessandro, Bruno; Alexandre, Didier; Alfaro Molina, Jose Ruben; Alici, Andrea; Alkin, Anton; Millan Almaraz, Jesus Roberto; Alme, Johan; Alt, Torsten; Altinpinar, Sedat; Altsybeev, Igor; Alves Garcia Prado, Caio; Andrei, Cristian; Andronic, Anton; Anguelov, Venelin; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Balasubramanian, Supraja; Baldisseri, Alberto; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartke, Jerzy Gustaw; Bartsch, Esther; Basile, Maurizio; Bastid, Nicole; Basu, Sumit; Bathen, Bastian; Batigne, Guillaume; Batista Camejo, Arianna; Batyunya, Boris; Batzing, Paul Christoph; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Belmont Iii, Ronald John; Belmont Moreno, Ernesto; Belyaev, Vladimir; Benacek, Pavel; Bencedi, Gyula; Beole, Stefania; Berceanu, Ionela; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhasin, Anju; Bhat, Inayat Rasool; Bhati, Ashok Kumar; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Livio; Bianchi, Nicola; Bianchin, Chiara; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biro, Gabor; Biswas, Rathijit; Biswas, Saikat; Bjelogrlic, Sandro; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Bock, Friederike; Bogdanov, Alexey; Boggild, Hans; Boldizsar, Laszlo; Bombara, Marek; Book, Julian Heinz; Borel, Herve; Borissov, Alexander; Borri, Marcello; Bossu, Francesco; Botta, Elena; Bourjau, Christian; Braun-Munzinger, Peter; Bregant, Marco; Breitner, Timo Gunther; Broker, Theo Alexander; Browning, Tyler Allen; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Caffarri, Davide; Cai, Xu; Caines, Helen Louise; Calero Diaz, Liliet; Caliva, Alberto; Calvo Villar, Ernesto; Camerini, Paolo; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Cerello, Piergiorgio; Cerkala, Jakub; Chang, Beomsu; Chapeland, Sylvain; Chartier, Marielle; Charvet, Jean-Luc Fernand; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chauvin, Alex; Chelnokov, Volodymyr; Cherney, Michael Gerard; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Choi, Kyungeon; Chojnacki, Marek; Choudhury, Subikash; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-Urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Connors, Megan Elizabeth; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortes Maldonado, Ismael; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Crochet, Philippe; Cruz Albino, Rigoberto; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Danisch, Meike Charlotte; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Deisting, Alexander; Deloff, Andrzej; Denes, Ervin Sandor; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Nezza, Pasquale; Diaz Corchero, Miguel Angel; Dietel, Thomas; Dillenseger, Pascal; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Drozhzhova, Tatiana; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Endress, Eric; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erdemir, Irem; Erhardt, Filip; Espagnon, Bruno; Estienne, Magali Danielle; Esumi, Shinichi; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Eyyubova, Gyulnara; Fabbietti, Laura; Fabris, Daniela; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Ferencei, Jozef; Fernandez Tellez, Arturo; Gonzalez Ferreiro, Elena; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiore, Enrichetta Maria; Fleck, Martin Gabriel; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Frankenfeld, Ulrich Michael; Fronze, Gabriele Gaetano; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gallio, Mauro; Gangadharan, Dhevan Raja; Ganoti, Paraskevi; Gao, Chaosong; Garabatos Cuadrado, Jose; Garcia-Solis, Edmundo Javier; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; Germain, Marie; Gheata, Andrei George; Gheata, Mihaela; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Gladysz-Dziadus, Ewa; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Grachov, Oleg Anatolievich; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Grelli, Alessandro; Grigoras, Alina Gabriela; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Grynyov, Borys; Grion, Nevio; Gronefeld, Julius Maximilian; Grosse-Oetringhaus, Jan Fiete; Grossiord, Jean-Yves; Grosso, Raffaele; Guber, Fedor; Guernane, Rachid; Guerzoni, Barbara; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Haake, Rudiger; Haaland, Oystein Senneset; Hadjidakis, Cynthia Marie; Haiduc, Maria; Hamagaki, Hideki; Hamar, Gergoe; Hamon, Julien Charles; Harris, John William; Harton, Austin Vincent; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Herrera Corral, Gerardo Antonio; Hess, Benjamin Andreas; Hetland, Kristin Fanebust; Hillemanns, Hartmut; Hippolyte, Boris; Horak, David; Hosokawa, Ritsuya; Hristov, Peter Zahariev; Huang, Meidana; Humanic, Thomas; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Ilkaev, Radiy; Inaba, Motoi; Incani, Elisa; Ippolitov, Mikhail; Irfan, Muhammad; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacazio, Nicolo; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jahnke, Cristiane; Jakubowska, Monika Joanna; Jang, Haeng Jin; Janik, Malgorzata Anna; Pahula Hewage, Sandun; Jena, Chitrasen; Jena, Satyajit; Jimenez Bustamante, Raul Tonatiuh; Jones, Peter Graham; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kamin, Jason Adrian; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karayan, Lilit; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Khan, Mohammed Mohisin; Khan, Palash; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Kileng, Bjarte; Kim, Do Won; Kim, Dong Jo; Kim, Daehyeok; Kim, Hyeonjoong; Kim, Jinsook; Kim, Minwoo; Kim, Se Yong; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Kiss, Gabor; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-Boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobdaj, Chinorat; Kofarago, Monika; Kollegger, Thorsten; Kolozhvari, Anatoly; Kondratev, Valerii; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Kopcik, Michal; Kostarakis, Panagiotis; Kour, Mandeep; Kouzinopoulos, Charalampos; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Koyithatta Meethaleveedu, Greeshma; Kralik, Ivan; Kravcakova, Adela; Kretz, Matthias; Krivda, Marian; Krizek, Filip; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Ajay; Kumar, Jitendra; Lokesh, Kumar; Kumar, Shyam; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Ladron De Guevara, Pedro; Lagana Fernandes, Caio; Lakomov, Igor; Langoy, Rune; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Lattuca, Alessandra; Laudi, Elisa; Lea, Ramona; Leardini, Lucia; Lee, Graham Richard; Lee, Seongjoo; Lehas, Fatiha; Lemmon, Roy Crawford; Lenti, Vito; Leogrande, Emilia; Leon Monzon, Ildefonso; Leon Vargas, Hermes; Leoncino, Marco; Levai, Peter; Li, Shuang; Li, Xiaomei; Lien, Jorgen Andre; Lietava, Roman; Lindal, Svein; Lindenstruth, Volker; Lippmann, Christian; Lisa, Michael Annan; Ljunggren, Hans Martin; Lodato, Davide Francesco; Lonne, Per-Ivar; Loginov, Vitaly; Loizides, Constantinos; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Lunardon, Marcello; Luparello, Grazia; Lutz, Tyler Harrison; Maevskaya, Alla; Mager, Magnus; Mahajan, Sanjay; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Maldonado Cervantes, Ivonne Alicia; Malinina, Liudmila; Mal'Kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martin Blanco, Javier; Martinengo, Paolo; Martinez Hernandez, Mario Ivan; Martinez-Garcia, Gines; Martinez Pedreira, Miguel; Mas, Alexis Jean-Michel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Mastroserio, Annalisa; Matyja, Adam Tomasz; Mayer, Christoph; Mazer, Joel Anthony; Mazzoni, Alessandra Maria; Mcdonald, Daniel; Meddi, Franco; Melikyan, Yuri; Menchaca-Rocha, Arturo Alejandro; Meninno, Elisa; Mercado-Perez, Jorge; Meres, Michal; Miake, Yasuo; Mieskolainen, Matti Mikael; Mikhaylov, Konstantin; Milano, Leonardo; Milosevic, Jovan; Minervini, Lazzaro Manlio; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Bedangadas; Molnar, Levente; Montano Zetina, Luis Manuel; Montes Prado, Esther; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munzer, Robert Helmut; Murakami, Hikari; Murray, Sean; Musa, Luciano; Musinsky, Jan; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Naru, Muhammad Umair; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Rosado Navarro, Sebastian; Nayak, Kishora; Nayak, Ranjit; Nayak, Tapan Kumar; Nazarenko, Sergey; Nedosekin, Alexander; Nellen, Lukas; Ng, Fabian; Nicassio, Maria; Niculescu, Mihai; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Saehanseul; Oh, Sun Kun; Ohlson, Alice Elisabeth; Okatan, Ali; Okubo, Tsubasa; Olah, Laszlo; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Ozdemir, Mahmut; Pachmayer, Yvonne Chiara; Pagano, Paola; Paic, Guy; Pal, Susanta Kumar; Pan, Jinjin; Pandey, Ashutosh Kumar; Papikyan, Vardanush; Pappalardo, Giuseppe; Pareek, Pooja; Park, Woojin; Parmar, Sonia; Passfeld, Annika; Paticchio, Vincenzo; Patra, Rajendra Nath; Paul, Biswarup; Pei, Hua; Peitzmann, Thomas; Pereira Da Costa, Hugo Denis Antonio; Peresunko, Dmitry Yurevich; Perez Lara, Carlos Eugenio; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrov, Viacheslav; Petrovici, Mihai; Petta, Catia; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Ozelin De Lima Pimentel, Lais; Pinazza, Ombretta; Pinsky, Lawrence; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Porteboeuf, Sarah Julie; Porter, R Jefferson; Pospisil, Jan; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Puddu, Giovanna; Pujahari, Prabhat Ranjan; Punin, Valery; Putschke, Jorn Henning; Qvigstad, Henrik; Rachevski, Alexandre; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Read, Kenneth Francis; Redlich, Krzysztof; Reed, Rosi Jan; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reolon, Anna Rita; Reshetin, Andrey; Revol, Jean-Pierre; Reygers, Klaus Johannes; Riabov, Viktor; Ricci, Renato Angelo; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-Lucian; Rocco, Elena; Rodriguez Cahuantzi, Mario; Rodriguez Manso, Alis; Roeed, Ketil; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Romita, Rosa; Ronchetti, Federico; Ronflette, Lucile; Rosnet, Philippe; Rossi, Andrea; Roukoutakis, Filimon; Roy, Ankhi; Roy, Christelle Sophie; Roy, Pradip Kumar; Rubio Montero, Antonio Juan; Rui, Rinaldo; Russo, Riccardo; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Sadovskiy, Sergey; Safarik, Karel; Sahlmuller, Baldo; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Salzwedel, Jai Samuel Nielsen; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandor, Ladislav; Sandoval, Andres; Sano, Masato; Sarkar, Debojit; Sarma, Pranjal; Scapparone, Eugenio; Scarlassara, Fernando; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schuchmann, Simone; Schukraft, Jurgen; Schulc, Martin; Schuster, Tim Robin; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Scott, Rebecca Michelle; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shadura, Oksana; Shahoyan, Ruben; Shahzad, Muhammed Ikram; Shangaraev, Artem; Sharma, Ankita; Sharma, Mona; Sharma, Monika; Sharma, Natasha; Shigaki, Kenta; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Silvestre, Catherine Micaela; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singha, Subhash; Singhal, Vikas; Sinha, Bikash; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Soegaard, Carsten; Song, Jihye; Song, Myunggeun; Song, Zixuan; Soramel, Francesca; Sorensen, Soren Pontoppidan; Derradi De Souza, Rafael; Sozzi, Federica; Spacek, Michal; Spiriti, Eleuterio; Sputowska, Iwona Anna; Spyropoulou-Stassinaki, Martha; Stachel, Johanna; Stan, Ionel; Stankus, Paul; Stefanek, Grzegorz; Stenlund, Evert Anders; Steyn, Gideon Francois; Stiller, Johannes Hendrik; Stocco, Diego; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Szabo, Alexander; Szanto De Toledo, Alejandro; Szarka, Imrich; Szczepankiewicz, Adam; Szymanski, Maciej Pawel; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tangaro, Marco-Antonio; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-Gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terasaki, Kohei; Terrevoli, Cristina; Teyssier, Boris; Thaeder, Jochen Mathias; Thomas, Deepa; Tieulent, Raphael Noel; Timmins, Anthony Robert; Toia, Alberica; Trogolo, Stefano; Trombetta, Giuseppe; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vajzer, Michal; Vala, Martin; Valencia Palomo, Lizardo; Vallero, Sara; Van Der Maarel, Jasper; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vanat, Tomas; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vechernin, Vladimir; Veen, Annelies Marianne; Veldhoen, Misha; Velure, Arild; Venaruzzo, Massimo; Vercellin, Ermanno; Vergara Limon, Sergio; Vernet, Renaud; Verweij, Marta; Vickovic, Linda; Viesti, Giuseppe; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Vinogradov, Leonid; Vinogradov, Yury; Virgili, Tiziano; Vislavicius, Vytautas; Viyogi, Yogendra; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Vranic, Danilo; Vrlakova, Janka; Vulpescu, Bogdan; Wagner, Boris; Wagner, Jan; Wang, Hongkai; Wang, Mengliang; Watanabe, Daisuke; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Weiser, Dennis Franz; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Williams, Crispin; Windelband, Bernd Stefan; Winn, Michael Andreas; Yang, Hongyan; Yang, Ping; Yano, Satoshi; Yasin, Zafar; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-Kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Yushmanov, Igor; Zaborowska, Anna; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correia Zanoli, Henrique Jose; Zaporozhets, Sergey; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zgura, Sorin Ion; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhang, Yonghong; Chunhui, Zhang; Zhang, Zuman; Zhao, Chengxin; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zichichi, Antonino; Zimmermann, Alice; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zyzak, Maksym

2016-09-10

The production of charged pions, kaons and (anti)protons has been measured at mid-rapidity ($-0.5 10$ GeV/$c$), the particle ratios are consistent with those reported for pp and Pb-Pb collisions at the LHC energies. At intermediate $p_{\\rm T}$ the (anti)proton $R_{\\rm pPb}$ shows a Cronin-like enhancement, while pions and kaons show little or no nuclear modification. At high $p_{\\rm T}$ the charged pion, kaon and (anti)proton $R_{\\rm pPb}$ are consistent with unity within statistical and systematic uncertainties.

Wireless Sensor for Measuring Pump Efficiency: Small Business Voucher Project with KCF Technologies

Energy Technology Data Exchange (ETDEWEB)

Gehl, Anthony C [ORNL; Liu, Xiaobing [ORNL; Koopman, Gary [KCF Technologies; Fugate, David L [ORNL

2017-01-23

This document is to fulfill the final report requirements for the Small Business Voucher (SBV) CRADA project with ORNL and KCF Technologies (CRADA/NFE-16-06133). Pumping systems account for nearly 20% of the world’s electrical energy demand and range from 25-50% of the energy usage in many industrial and building power plants. The energy cost is the largest element in the total cost of owning a pump (~40%). In response to a recent DOE mandate for improved pump efficiency pump manufacturers are preparing for the changes that the impending regulations will bring, including design improvements. This mandate also establishes a need for new low cost pump efficiency measurement systems. The standard industry definition of pump efficiency is the mechanical water horsepower delivered divided by the electrical horsepower input to the motor. KCF Technologies has developed a new sensor measurement technique to estimate fluid pump efficiency using a thermodynamic approach. KCF Technologies applied for a SBV grant with ORNL as the research partner. KCF needed a research partner with the proper facilities to demonstrate the efficacy of its wireless sensor unit for measuring pump efficiency. The ORNL Building Technologies Research and Integration Center (BTRIC) test resources were used to test and demonstrate the successful measurement of pump efficiency with the KCF sensor technology. KCF is now working on next steps to commercialize this sensing technology.

Electron beam curing of polymer matrix composites

International Nuclear Information System (INIS)

Janke, C.J.; Wheeler, D.; Saunders, C.

1998-01-01

The purpose of the CRADA was to conduct research and development activities to better understand and utilize the electron beam PMC curing technology. This technology will be used to replace or supplement existing PMC thermal curing processes in Department of Energy (DOE) Defense Programs (DP) projects and American aircraft and aerospace industries. This effort involved Lockheed Martin Energy Systems, Inc./Lockheed Martin Energy Research Corp. (Contractor), Sandia National Laboratories, and ten industrial Participants including four major aircraft and aerospace companies, three advanced materials companies, and three electron beam processing organizations. The technical objective of the CRADA was to synthesize and/or modify high performance, electron beam curable materials that meet specific end-use application requirements. There were six tasks in this CRADA including: Electron beam materials development; Electron beam database development; Economic analysis; Low-cost Electron Beam tooling development; Electron beam curing systems integration; and Demonstration articles/prototype structures development. The contractor managed, participated and integrated all the tasks, and optimized the project efforts through the coordination, exchange, and dissemination of information to the project participants. Members of the Contractor team were also the principal inventors on several electron beam related patents and a 1997 R and D 100 Award winner on Electron-Beam-Curable Cationic Epoxy Resins. The CRADA achieved a major breakthrough for the composites industry by having successfully developed high-performance electron beam curable cationic epoxy resins for use in composites, adhesives, tooling compounds, potting compounds, syntactic foams, etc. UCB Chemicals, the world's largest supplier of radiation-curable polymers, has acquired a license to produce and sell these resins worldwide

RNA-binding domain of the A protein component of the U1 small nuclear ribonucleoprotein analyzed by NMR spectroscopy is structurally similar to ribosomal proteins

International Nuclear Information System (INIS)

Hoffman, D.W.; Query, C.C.; Golden, B.L.; White, S.W.; Keene, J.D.

1991-01-01

An RNA recognition motif (RRM) of ∼80 amino acids constitutes the core of RNA-binding domains found in a large family of proteins involved in RNA processing. The U1 RNA-binding domain of the A protein component of the human U1 small nuclear ribonucleoprotein (RNP), which encompasses the RRM sequence, was analyzed by using NMR spectroscopy. The domain of the A protein is a highly stable monomer in solution consisting of four antiparallel β-strands and two α-helices. The highly conserved RNP1 and RNP2 consensus sequences, containing residues previously suggested to be involved in nucleic acid binding, are juxtaposed in adjacent β-strands. Conserved aromatic side chains that are critical for RNA binding are clustered on the surface to the molecule adjacent to a variable loop that influences recognition of specific RNA sequences. The secondary structure and topology of the RRM are similar to those of ribosomal proteins L12 and L30, suggesting a distant evolutionary relationship between these two types of RNA-associated proteins

Choppers to optimise the repetition rate multiplication technique on a direct geometry neutron chopper spectrometer

International Nuclear Information System (INIS)

Vickery, A.; Deen, P. P.

2014-01-01

In recent years the use of repetition rate multiplication (RRM) on direct geometry neutron spectrometers has been established and is the common mode of operation on a growing number of instruments. However, the chopper configurations are not ideally optimised for RRM with a resultant 100 fold flux difference across a broad wavelength band. This paper presents chopper configurations that will produce a relative constant (RC) energy resolution and a relative variable (RV) energy resolution for optimised use of RRM. The RC configuration provides an almost uniform ΔE/E for all incident wavelengths and enables an efficient use of time as the entire dynamic range is probed with equivalent statistics, ideal for single shot measurements of transient phenomena. The RV energy configuration provides an almost uniform opening time at the sample for all incident wavelengths with three orders of magnitude in time resolution probed for a single European Spallation Source (ESS) period, which is ideal to probe complex relaxational behaviour. These two chopper configurations have been simulated for the Versatile Optimal Resolution direct geometry spectrometer, VOR, that will be built at ESS

Analysis of the apparent nuclear modification in peripheral Pb-Pb collisions at 5.02 TeV arXiv

CERN Document Server

Acharya, Shreyasi; Adamova, Dagmar; Adolfsson, Jonatan; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Al-turany, Mohammad; Alam, Sk Noor; Silva De Albuquerque, Danilo; Aleksandrov, Dmitry; Alessandro, Bruno; Alfaro Molina, Jose Ruben; Ali, Yasir; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altenkamper, Lucas; Altsybeev, Igor; Anaam, Mustafa Naji; Andrei, Cristian; Andreou, Dimitra; Andrews, Harry Arthur; Andronic, Anton; Angeletti, Massimo; Anguelov, Venelin; Anson, Christopher Daniel; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Anwar, Rafay; Apadula, Nicole; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Ball, Markus; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barioglio, Luca; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartsch, Esther; Bastid, Nicole; Basu, Sumit; Batigne, Guillaume; Batyunya, Boris; Batzing, Paul Christoph; Bazo Alba, Jose Luis; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Espinoza Beltran, Lucina Gabriela; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhaduri, Partha Pratim; Bhasin, Anju; Bhat, Inayat Rasool; Bhatt, Himani; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Antonio; Bianchi, Livio; Bianchi, Nicola; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biro, Gabor; Biswas, Rathijit; Biswas, Saikat; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Boca, Gianluigi; Bock, Friederike; Bogdanov, Alexey; Boldizsar, Laszlo; Bombara, Marek; Bonomi, Germano; Bonora, Matthias; Borel, Herve; Borissov, Alexander; Borri, Marcello; Botta, Elena; Bourjau, Christian; Bratrud, Lars; Braun-munzinger, Peter; Bregant, Marco; Broker, Theo Alexander; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buhler, Paul; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Cabala, Jan; Caffarri, Davide; Caines, Helen Louise; Caliva, Alberto; Calvo Villar, Ernesto; Soto Camacho, Rabi; Camerini, Paolo; Capon, Aaron Allan; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Chandra, Sinjini; Chang, Beomsu; Chang, Wan; Chapeland, Sylvain; Chartier, Marielle; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chauvin, Alex; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Chowdhury, Tasnuva; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Concas, Matteo; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Costanza, Susanna; Crkovska, Jana; Crochet, Philippe; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Dani, Sanskruti; Danisch, Meike Charlotte; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Derradi De Souza, Rafael; Franz Degenhardt, Hermann; Deisting, Alexander; Deloff, Andrzej; Delsanto, Silvia; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Ruzza, Benedetto; Arteche Diaz, Raul; Dietel, Thomas; Dillenseger, Pascal; Ding, Yanchun; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Van Doremalen, Lennart Vincent; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dudi, Sandeep; Duggal, Ashpreet Kaur; Dukhishyam, Mallick; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Endress, Eric; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erhardt, Filip; Ersdal, Magnus Rentsch; Espagnon, Bruno; Eulisse, Giulio; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Fabbietti, Laura; Faggin, Mattia; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Fernandez Tellez, Arturo; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiorenza, Gabriele; Flor, Fernando; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Francisco, Audrey; Frankenfeld, Ulrich Michael; Fronze, Gabriele Gaetano; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gajdosova, Katarina; Gallio, Mauro; Duarte Galvan, Carlos; Ganoti, Paraskevi; Garabatos Cuadrado, Jose; Garcia-solis, Edmundo Javier; Garg, Kunal; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; De Leone Gay, Maria Beatriz; Germain, Marie; Ghosh, Jhuma; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Greiner, Leo Clifford; Grelli, Alessandro; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Gronefeld, Julius Maximilian; Grosa, Fabrizio; Grosse-oetringhaus, Jan Fiete; Grosso, Raffaele; Guernane, Rachid; Guerzoni, Barbara; Guittiere, Manuel; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Bautista Guzman, Irais; Haake, Rudiger; Habib, Michael Karim; Hadjidakis, Cynthia Marie; Hamagaki, Hideki; Hamar, Gergoe; Hamid, Mohammed; Hamon, Julien Charles; Hannigan, Ryan; Haque, Md Rihan; Harlenderova, Alena; Harris, John William; Harton, Austin Vincent; Hassan, Hadi; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Hellbar, Ernst; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Gonzalez Hernandez, Emma; Herrera Corral, Gerardo Antonio; Herrmann, Florian; Hetland, Kristin Fanebust; Hilden, Timo Eero; Hillemanns, Hartmut; Hills, Christopher; Hippolyte, Boris; Hohlweger, Bernhard; Horak, David; Hornung, Sebastian; Hosokawa, Ritsuya; Hota, Jyotishree; Hristov, Peter Zahariev; Huang, Chun-lu; Hughes, Charles; Huhn, Patrick; Humanic, Thomas; Hushnud, Hushnud; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Iddon, James Philip; Iga Buitron, Sergio Arturo; Ilkaev, Radiy; Inaba, Motoi; Ippolitov, Mikhail; Islam, Md Samsul; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacak, Barbara; Jacazio, Nicolo; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jaelani, Syaefudin; Jahnke, Cristiane; Jakubowska, Monika Joanna; Janik, Malgorzata Anna; Jena, Chitrasen; Jercic, Marko; Jevons, Oliver; Jimenez Bustamante, Raul Tonatiuh; Jin, Muqing; Jones, Peter Graham; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karczmarczyk, Przemyslaw; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Ketzer, Bernhard Franz; Khabanova, Zhanna; Khan, Ahsan Mehmood; Khan, Shaista; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Khatun, Anisa; Khuntia, Arvind; Kielbowicz, Miroslaw Marek; Kileng, Bjarte; Kim, Byungchul; Kim, Daehyeok; Kim, Dong Jo; Kim, Eun Joo; Kim, Hyeonjoong; Kim, Jinsook; Kim, Jiyoung; Kim, Minjung; Kim, Se Yong; Kim, Taejun; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobdaj, Chinorat; Varga-kofarago, Monika; Kohler, Markus Konrad; Kollegger, Thorsten; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Konopka, Piotr Jan; Konyushikhin, Maxim; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Kralik, Ivan; Kravcakova, Adela; Kreis, Lukas; Krivda, Marian; Krizek, Filip; Kruger, Mario; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Jitendra; Kumar, Lokesh; Kumar, Shyam; Kundu, Sourav; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kvapil, Jakub; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lai, Yue Shi; Lakomov, Igor; Langoy, Rune; Lapidus, Kirill; Lardeux, Antoine Xavier; Larionov, Pavel; Laudi, Elisa; Lavicka, Roman; Lea, Ramona; Leardini, Lucia; Lee, Seongjoo; Lehas, Fatiha; Lehner, Sebastian; Lehrbach, Johannes; Lemmon, Roy Crawford; Leon Monzon, Ildefonso; Levai, Peter; Li, Xiaomei; Li, Xing Long; Lien, Jorgen Andre; Lietava, Roman; Lim, Bong-hwi; Lindal, Svein; Lindenstruth, Volker; Lindsay, Scott William; Lippmann, Christian; Lisa, Michael Annan; Litichevskyi, Vladyslav; Liu, Alwina; Ljunggren, Hans Martin; Llope, William; Lodato, Davide Francesco; Loginov, Vitaly; Loizides, Constantinos; Loncar, Petra; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Luhder, Jens Robert; Lunardon, Marcello; Luparello, Grazia; Lupi, Matteo; Maevskaya, Alla; Mager, Magnus; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Malik, Qasim Waheed; Malinina, Liudmila; Mal'kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Mao, Yaxian; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martinengo, Paolo; Martinez, Jacobb Lee; Martinez Hernandez, Mario Ivan; Martinez-garcia, Gines; Martinez Pedreira, Miguel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Masson, Erwann; Mastroserio, Annalisa; Mathis, Andreas Michael; Toledo Matuoka, Paula Fernanda; Matyja, Adam Tomasz; Mayer, Christoph; Mazzilli, Marianna; Mazzoni, Alessandra Maria; Meddi, Franco; Melikyan, Yuri; Menchaca-rocha, Arturo Alejandro; Meninno, Elisa; Mercado-perez, Jorge; Meres, Michal; Soncco Meza, Carlos; Mhlanga, Sibaliso; Miake, Yasuo; Micheletti, Luca; Mieskolainen, Matti Mikael; Mihaylov, Dimitar Lubomirov; Mikhaylov, Konstantin; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Auro Prasad; Mohanty, Bedangadas; Khan, Mohammed Mohisin; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Mrnjavac, Teo; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munning, Konstantin; Arratia Munoz, Miguel Ignacio; Munzer, Robert Helmut; Murakami, Hikari; Murray, Sean; Musa, Luciano; Musinsky, Jan; Myers, Corey James; Myrcha, Julian Wojciech; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Narayan, Amrendra; Naru, Muhammad Umair; Nassirpour, Adrian Fereydon; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Rosado Navarro, Sebastian; Nayak, Kishora; Nayak, Ranjit; Nayak, Tapan Kumar; Nazarenko, Sergey; Negrao De Oliveira, Renato Aparecido; Nellen, Lukas; Nesbo, Simon Voigt; Neskovic, Gvozden; Ng, Fabian; Nicassio, Maria; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oh, Hoonjung; Ohlson, Alice Elisabeth; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Oravec, Matej; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Pachmayer, Yvonne Chiara; Pacik, Vojtech; Pagano, Davide; Paic, Guy; Palni, Prabhakar; Pan, Jinjin; Pandey, Ashutosh Kumar; Panebianco, Stefano; Papikyan, Vardanush; Pareek, Pooja; Park, Jonghan; Parkkila, Jasper Elias; Parmar, Sonia; Passfeld, Annika; Pathak, Surya Prakash; Patra, Rajendra Nath; Paul, Biswarup; Pei, Hua; Peitzmann, Thomas; Peng, Xinye; Pereira, Luis Gustavo; Pereira Da Costa, Hugo Denis Antonio; Peresunko, Dmitry Yurevich; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrovici, Mihai; Petta, Catia; Peretti Pezzi, Rafael; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Ozelin De Lima Pimentel, Lais; Pinazza, Ombretta; Pinsky, Lawrence; Pisano, Silvia; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pliquett, Fabian; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Poppenborg, Hendrik; Porteboeuf, Sarah Julie; Pozdniakov, Valeriy; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Punin, Valery; Putschke, Jorn Henning; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Ratza, Viktor; Ravasenga, Ivan; Read, Kenneth Francis; Redlich, Krzysztof; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reshetin, Andrey; Revol, Jean-pierre; Reygers, Klaus Johannes; Riabov, Viktor; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-lucian; Rode, Sudhir Pandurang; Rodriguez Cahuantzi, Mario; Roeed, Ketil; Rogalev, Roman; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Rokita, Przemyslaw Stefan; Ronchetti, Federico; Dominguez Rosas, Edgar; Roslon, Krystian; Rosnet, Philippe; Rossi, Andrea; Rotondi, Alberto; Roukoutakis, Filimon; Roy, Christelle Sophie; Roy, Pradip Kumar; Vazquez Rueda, Omar; Rui, Rinaldo; Rumyantsev, Boris; Rustamov, Anar; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Saarinen, Sampo; Sadhu, Samrangy; Sadovskiy, Sergey; Safarik, Karel; Saha, Sumit Kumar; Sahoo, Baidyanath; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandoval, Andres; Sarkar, Amal; Sarkar, Debojit; Sarkar, Nachiketa; Sarma, Pranjal; Sas, Mike Henry Petrus; Scapparone, Eugenio; Scarlassara, Fernando; Schaefer, Brennan; Scheid, Horst Sebastian; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schmidt, Marten Ole; Schmidt, Martin; Schmidt, Nicolas Vincent; Schukraft, Jurgen; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sett, Priyanka; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shahoyan, Ruben; Shaikh, Wadut; Shangaraev, Artem; Sharma, Anjali; Sharma, Ankita; Sharma, Meenakshi; Sharma, Natasha; Sheikh, Ashik Ikbal; Shigaki, Kenta; Shimomura, Maya; Shirinkin, Sergey; Shou, Qiye; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singh, Randhir; Singhal, Vikas; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Song, Jihye; Soramel, Francesca; Sorensen, Soren Pontoppidan; Sozzi, Federica; Sputowska, Iwona Anna; Stachel, Johanna; Stan, Ionel; Stankus, Paul; Stenlund, Evert Anders; Stocco, Diego; Storetvedt, Maksim Melnik; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Sumowidagdo, Suharyo; Suzuki, Ken; Swain, Sagarika; Szabo, Alexander; Szarka, Imrich; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terrevoli, Cristina; Teyssier, Boris; Thakur, Dhananjaya; Thakur, Sanchari; Thomas, Deepa; Thoresen, Freja; Tieulent, Raphael Noel; Tikhonov, Anatoly; Timmins, Anthony Robert; Toia, Alberica; Topilskaya, Nataliya; Toppi, Marco; Rojas Torres, Solangel; Tripathy, Sushanta; Trogolo, Stefano; Trombetta, Giuseppe; Tropp, Lukas; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Trzcinski, Tomasz Piotr; Trzeciak, Barbara Antonina; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Umaka, Ejiro Naomi; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vala, Martin; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vazquez Doce, Oton; Vechernin, Vladimir; Veen, Annelies Marianne; Vercellin, Ermanno; Vergara Limon, Sergio; Vermunt, Luuk; Vernet, Renaud; Vertesi, Robert; Vickovic, Linda; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Virgili, Tiziano; Vislavicius, Vytautas; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Voscek, Dominik; Vranic, Danilo; Vrlakova, Janka; Wagner, Boris; Wang, Hongkai; Wang, Mengliang; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Wegrzynek, Adam; Weiser, Dennis Franz; Wenzel, Sandro Christian; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Willems, Guido Alexander; Williams, Crispin; Willsher, Emily; Windelband, Bernd Stefan; Witt, William Edward; Xu, Ran; Yalcin, Serpil; Yamakawa, Kosei; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correa Zanoli, Henrique Jose; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zhalov, Mikhail; Zhang, Xiaoming; Zhang, Yonghong; Zhang, Zuman; Zhao, Chengxin; Zherebchevskii, Vladimir; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zhu, Ya; Zichichi, Antonino; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zmeskal, Johann; Zou, Shuguang

Charged-particle spectra at midrapidity are measured in Pb-Pb collisions at the centre-of-mass energy per nucleon-nucleon pair $\\sqrt{s_{\\rm NN}}$ = 5.02 TeV and presented in centrality classes ranging from most central (0-5%) to most peripheral (95-100%) collisions. Possible medium effects are quantified using the nuclear modification factor ($R_{\\rm AA}$) by comparing the measured spectra with those from proton-proton collisions, scaled by the number of independent nucleon-nucleon collisions obtained from a Glauber model. At large transverse momenta ($8R_{\\rm AA}$ is found to increase from about $0.15$ in 0-5% central to a maximum value of about $0.8$ in 75-85% peripheral collisions, beyond which it falls off strongly to below $0.2$ for the most peripheral collisions. Furthermore, $R_{\\rm AA}$ initially exhibits a positive slope as a function of $p_{\\rm T}$ in the $8$-$20$ GeV/$c$ interval, while for collisions beyond the 80% class the slope is negative. To reduce...

Smart Bandwidth Assignation in an Underlay Cellular Network for Internet of Vehicles.

Science.gov (United States)

de la Iglesia, Idoia; Hernandez-Jayo, Unai; Osaba, Eneko; Carballedo, Roberto

2017-09-27

The evolution of the IoT (Internet of Things) paradigm applied to new scenarios as VANETs (Vehicular Ad Hoc Networks) has gained momentum in recent years. Both academia and industry have triggered advanced studies in the IoV (Internet of Vehicles), which is understood as an ecosystem where different types of users (vehicles, elements of the infrastructure, pedestrians) are connected. How to efficiently share the available radio resources among the different types of eligible users is one of the important issues to be addressed. This paper briefly analyzes various concepts presented hitherto in the literature and it proposes an enhanced algorithm for ensuring a robust co-existence of the aforementioned system users. Therefore, this paper introduces an underlay RRM (Radio Resource Management) methodology which is capable of (1) improving cellular spectral efficiency while making a minimal impact on cellular communications and (2) ensuring the different QoS (Quality of Service) requirements of ITS (Intelligent Transportation Systems) applications. Simulation results, where we compare the proposed algorithm to the other two RRM, show the promising spectral efficiency performance of the proposed RRM methodology.

Reflex reticular myoclonus: relationship to some brainstem pathophysiological mechanisms.

Science.gov (United States)

Rektor, I; Kadanka, Z; Bednarik, J

1991-04-01

Two patients with reflex reticular myoclonus [RRM] were tested electrophysiologically and pharmacologically. In one of the cases the underlying disease was chronic Lyme borreliosis. In the other, the RRM attacks may have been associated with procarbazine therapy applied for Hodgkin's disease. No cortical lesion could be demonstrated either clinically or electrophysiologically [EEG, averaged EEg preceeding the jerks, SSEP]. An EMG analysis of the jerks revealed the shortest latency in the muscles innervated by the accessory nerve. The latencies became longer in a more rostral muscle [masseter], as well as in a more caudal one, the muscles innervated by the facial nerve were spared. it is presumed that the complete movement pattern of the myoclonus residues in the jerk generating structure. RRM in the described cases differs from the startle by sparing the facial nerve and from the Papio papio baboon non-epileptic myoclonus by the activating effect of physostigmine. A partial therapeutic effect was achieved with a serotonine precursor, but a GABAergic therapy proved to be the most effective.

Development and Testing of a High Capacity Plasma Chemical Reactor in the Ukraine

Energy Technology Data Exchange (ETDEWEB)

Reilly, Raymond W.

2012-07-30

This project, Development and Testing of a High Capacity Plasma Chemical Reactor in the Ukraine was established at the Kharkiv Institute of Physics and Technology (KIPT). The associated CRADA was established with Campbell Applied Physics (CAP) located in El Dorado Hills, California. This project extends an earlier project involving both CAP and KIPT conducted under a separate CRADA. The initial project developed the basic Plasma Chemical Reactor (PCR) for generation of ozone gas. This project built upon the technology developed in the first project, greatly enhancing the output of the PCR while also improving reliability and system control.

Feasability Study and Protocol Development for Manufacturing of a Veterinarian Drug Using Local Plant Sources as Raw Materials

Energy Technology Data Exchange (ETDEWEB)

Davison, B. H.; Kuritz, T.

2006-08-28

This CRADA was a collaborative effort between the Oak Ridge National Laboratory (ORNL) and Sass & Sass, Inc. It also had involvement with the University of Tennessee Knoxville (UTK) The CRADA focused on the development and commercialization in the U.S. of the substance developed in Russia with potential veterinary applications. The project addressed validation and further characterization of the lead substance necessary for its commercialization in the U.S. market as a veterinarian biologic and at the commercialization of the product for the Russian market, by the Russian group establishing of sustainability of the Russian research groups.

Dicty_cDB: Contig-U13057-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available nqlnmvnykrfqly*rrm lksfqclmmirelhfmkplqmanwiqciy*liif*ri*kkikfqkl*inkmimvghhfmm l...e B: wptglkkvqnkmy*iekvvhhyiwhvvnhhqqtislivvvilvyqwliyyyyqvhp*lvv hmvdifymklhqkvivitlivs*k*iqilqiqqthsdvhhyl

Fuel Testing for Sylvatex: Cooperative Research and Development Final Report, CRADA Number CRD-16-636

Energy Technology Data Exchange (ETDEWEB)

Burton, Jonathan L. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2018-02-07

Sylvatex is a green nano-chemistry company that has developed a platform technology utilizing renewable, non-toxic inputs to create a stable nanoparticle that can be used in multiple applications. Their mission is to increase the use of renewables globally, to empower a cleaner and healthier future. The main application is a fuel technology product - MicroX - that utilizes proprietary knowledge to scale low-cost, cleaner-burning renewable diesel fuel and additives by using a co-location commercial model. The aspects of this project will include testing of two Sylvatex MicroX fuels on an engine dynamometer platform. Industry standard ultra-low sulfur diesel (ULSD) B3 fuel and a ULSD B20 will both be used for comparison of the Sylvatex fuels (U.S. standard diesel fuel at the pump contains an average of approximately 3% biodiesel; this is why B3 would be used as a baseline comparison). Sylvatex is currently using a prototype formulation (MicroX 1) that applies a high cost surfactant. An experimental formulation (MicroX 2) that uses lower cost materials is under development. The MicroX 1 will be blended at a 10% level into the B3 ULSD fuel and the MicroX 2 will be blended at a 10% level into both the B3 and the B20 ULSD fuels for study on the engine dynamometer test platform. All fuel blends will be tested over the FTP transient engine test cycle and a steady state ramped modal engine test cycle. Each test cycle will be performed a minimum of 3 times for each fuel. Tailpipe and/or engine out gaseous exhaust emissions (CO2, CO, NOx, THC, O2,), engine out PM emissions, and brake-specific fuel consumption rates will be evaluated for all test cycles.

Development and demonstration of biosorbents for clean-up of uranium in water. CRADA final report

International Nuclear Information System (INIS)

Faison, B.D.; Hu, M.Z.C.; Norman, J.M.; Reeves, M.E.; Williams, L.; Schmidt-Kuster, W.; Darnell, K.

1997-08-01

Pseudomonas aeruginosa strain CSU, a nongenetically engineered bacterial strain known to bind dissolved hexavalent uranium, shows particular promise as the basis of an immobilized-cell process for removal of dissolved uranium from contaminated wastewaters. It was characterized with respect to its sorptive active. Living, heat-killed, permeabilized, and unreconstituted lyophilized cells were all capable of binding uranium. The uranium biosorption equilibrium could be described by the Langmuir isotherm. The rate of uranium adsorption increased following permeabilization of the outer and/or cytoplasmic membrane by organic solvents such as acetone. P. aeruginosa CSU biomass was significantly more sorptive toward uranium than certain novel, patented biosorbents derived from algal or fungal biomass sources. P. aeruginosa CSU biomass was also competitive with commercial cation-exchange resins, particularly in the presence of dissolved transition metals. Uranium binding by P. aeruginosa was clearly pH dependent. Uranium loading capacity increased with increasing pH under acidic conditions, presumably as a function of uranium speciation and due to the H + competition at some binding sites. Nevertheless, preliminary evidence suggests that this microorganism is also capable of binding anionic hexavalent uranium complexes. Ferric iron was a strong inhibitor of uranium binding to P. aeruginosa CSU biomass, and the presence of uranium also decreased the Fe 3+ loading when the biomass was not saturated with Fe 3+ , suggesting that Fe 3+ and uranium may share the same binding sites on biomass

Development and demonstration of biosorbents for clean-up of uranium in water. CRADA final report

Energy Technology Data Exchange (ETDEWEB)

Faison, B.D.; Hu, M.Z.C.; Norman, J.M.; Reeves, M.E.; Williams, L.; Schmidt-Kuster, W.; Darnell, K. [Oak Ridge National Lab., TN (United States)]|[Ogden Environmental Service, Oak Ridge, TN (United States)

1997-08-01

Pseudomonas aeruginosa strain CSU, a nongenetically engineered bacterial strain known to bind dissolved hexavalent uranium, shows particular promise as the basis of an immobilized-cell process for removal of dissolved uranium from contaminated wastewaters. It was characterized with respect to its sorptive active. Living, heat-killed, permeabilized, and unreconstituted lyophilized cells were all capable of binding uranium. The uranium biosorption equilibrium could be described by the Langmuir isotherm. The rate of uranium adsorption increased following permeabilization of the outer and/or cytoplasmic membrane by organic solvents such as acetone. P. aeruginosa CSU biomass was significantly more sorptive toward uranium than certain novel, patented biosorbents derived from algal or fungal biomass sources. P. aeruginosa CSU biomass was also competitive with commercial cation-exchange resins, particularly in the presence of dissolved transition metals. Uranium binding by P. aeruginosa was clearly pH dependent. Uranium loading capacity increased with increasing pH under acidic conditions, presumably as a function of uranium speciation and due to the H{sup +} competition at some binding sites. Nevertheless, preliminary evidence suggests that this microorganism is also capable of binding anionic hexavalent uranium complexes. Ferric iron was a strong inhibitor of uranium binding to P. aeruginosa CSU biomass, and the presence of uranium also decreased the Fe{sup 3+} loading when the biomass was not saturated with Fe{sup 3+}, suggesting that Fe{sup 3+} and uranium may share the same binding sites on biomass.

Modification of Color Centers by Electron Bombardment: Final Report CRADA No. TC-0460-93-A

Energy Technology Data Exchange (ETDEWEB)

Van Bibber, Karl [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Alger, Don M. [Quali-Tech, Inc., Columbia, MO (United States)

2000-11-30

The purpose of the project was to: Identify those electron beam irradiation parameters most relevant to process quality and efficiency, to producing and modifying color centers in topaz. Develop and test improved radiation processing techniques, and evaluate their potential applicability to other types of semi-precious gems. Develop an optimized data base for the process and procedures for identifying and characterizing material from new and diverse sources. Transfer new processing technology to the private sector, and, until they are implemented industrially, to perform radiation dosing to partially satisfy existing excess demand. We planned to define the interaction between sample purity level, the physics of irradiation to achieve color cent-er modification on a reproducible basis and demonstration of the resulting process on a commercially viable basis. The primary deliverable was the increased knowledge base in terms of expanded understanding of the systematics of color center modification in materials, and an extensive database of electron beam parameters which would optimize the efficiency and quality of radiation processing of topaz from diverse sources. The radiation processing of these stones constitutes a deliverable to Quali-Tech by LLNL.

Development of Weldable Superplastic Forming Aluminum Alloy Sheet Final Report CRADA No. TC-1086-95

Energy Technology Data Exchange (ETDEWEB)

Lesuer, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Sun, T. C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-11-01

Numerous applications could exist for superplastic formable, weldable aluminum alloys in the automotive, aerospace, architectural, and construction industries. In this project, LLNL and Kaiser worked with the Institute for Metals Superplasticity Problems to develop and evaluate weldable superplastic alloys.

Development of Advanced Materials for Electro-Ceramic Application Final Report CRADA No. TC-1331-96

Energy Technology Data Exchange (ETDEWEB)

Caplan, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Olstad, R. [General Atomics, San Diego, CA (United States); McMillan, L. [Symetrix International, Inc., Colorado Springs, CO (United States); Tulupov, A. [Soliton-NTT, Moscow (Russia)

2017-10-19

The goal of this project was to further develop and characterize the electrochemical methods originating in Russia for producing ultra high purity organometallic compounds utilized as precursors in the production of high quality electro-ceramic materials. Symetrix planned to use electro-ceramic materials with high dielectric constant for microelectronic memory circuit applications. General Atomics planned to use the barium titanate type ceramics with low loss tangent for producing a high power ferroelectric tuner used to match radio frequency power into their Dill-D fusion machine. Phase I of the project was scheduled to have a large number of organometallic (alkoxides) chemical samples produced using various methods. These would be analyzed by LLNL, Soliton and Symetrix independently to determine the level of chemical impurities thus verifying each other's analysis. The goal was to demonstrate a cost-effective production method, which could be implemented in a large commercial facility to produce high purity organometallic compounds. In addition, various compositions of barium-strontium-titanate ceramics were to be produced and analyzed in order to develop an electroceramic capacitor material having the desired characteristics with respect to dielectric constant, loss tangent, temperature characteristics and non-linear behavior under applied voltage. Upon optimizing the barium titanate material, 50 capacitor preforms would be produced from this material demonstrating the ability to produce, in quantity, the pills ultimately required for the ferroelectric tuner (approx 2000-3000 ceramic pills).

Public Key-Based Need-to-Know Authorization Engine Final Report CRADA No. TSB-1553-98

Energy Technology Data Exchange (ETDEWEB)

Mark, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Williams, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-11-01

The goals of this project were to develop a public key-based authentication service plug-in based on LLNL's requirements, integrate the public key-based authentication with the Intra Verse authorization service adn the LLNL NTK server by developing a full-featured version of the prototyped Intra Verse need-to-know plug in; and to test the authorization and need-to-know plug-in in a secured extranet prototype among selected national Labs.

Tracking of Polycarbonate Films using Low-energy Ions Final Report CRADA No. TC-774-94

Energy Technology Data Exchange (ETDEWEB)

Musket, R. G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2018-01-24

Ion tracking is performed almost exclusively using ions with energies near or above the maximum in electronic stopping. For the present study, we have examined the results of etching ion tracks created by ions bombarding polycarbonate films with energies corresponding to stopping well below the maximum and just above the anticipated threshold for creating etchable latent tracks. Low-energy neon and argon ions with 18-60 keV /amu and fluences of about 10⁸/cm² were used to examine the limits for producing etchable tracks in polycarbonate films. By concentrating on the early stages of etching (i.e., -20 nm < SEM hole diameter < -100 nm), we can directly relate the energy deposition calculated for the incident ion to the creation of etchable tracks. The experimental results will be discussed with regard to the energy losses of the ions in the polycarbonate films and to the formation of continuous latent tracks through the entire thickness the films. These results have significant implications with respect to the threshold for formation of etchable tracks and to the use of low-energy ions for lithographic applications.

Feasibility of correlating V-Cr-Ti alloy weld strength with weld chemistry. CRADA final report

International Nuclear Information System (INIS)

Grossbeck, M.L.; Odom, R.W.

1998-06-01

The mechanical properties of refractory metals such as vanadium are determined to a large extent by the interstitial impurities in the alloy. In the case of welding, interstitial impurities are introduced in the welding process from the atmosphere and by dissolution of existing precipitates in the alloy itself. Because of the necessity of having an ultra-pure atmosphere, a vacuum chamber or a glove box is necessary. In the V-Cr-Ti system, the titanium serves as a getter to control the concentration of oxygen and nitrogen in solid solution in the alloy. In this project the secondary ion mass spectrometry (SIMS) technique was used to detect, measure, and map the spacial distribution of impurity elements in welds in the alloy V-4Cr-4Ti. An attempt was then made to correlate the concentrations and distributions of the impurities with mechanical properties of the welds. Mechanical integrity of the welds was determined by Charpy V-notch testing. Welds were prepared by the gas-tungsten-arc (GTA) method. Charpy testing established a correlation between weld impurity concentration and the ductile to brittle transition temperature (DBTT). Higher concentrations of oxygen resulted in a higher DBTT. An exception was noted in the case of a low-oxygen weld which had a high hydrogen concentration resulting in a brittle weld. The concentrations and distributions of the impurities determined by SIMS could not be correlated with the mechanical properties of the welds. This research supports efforts to develop fusion reactor first wall and blanket structural materials

Microwave Sintering of Ceramic Materials for Industrial Application Final Report CRADA No. TC-1116-95

Energy Technology Data Exchange (ETDEWEB)

Caplan, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Tandon, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Callis, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-19

The goal of this project was to develop the commercial capability in the US to sinter alumina oxide ceramic parts for the semiconductor manufacturing equipment industry. We planned to use the millimeter microwave (30 GHz) sintering system first developed by IAP in Russia.

LiverTox: Advanced QSAR and Toxicogeomic Software for Hepatotoxicity Prediction

Energy Technology Data Exchange (ETDEWEB)

Lu, P-Y.; Yuracko, K. (YAHSGS, LLC)

2011-02-25

YAHSGS LLC and Oak Ridge National Laboratory (ORNL) established a CRADA in an attempt to develop a predictive system using a pre-existing ORNL computational neural network and wavelets format. This was in the interest of addressing national needs for toxicity prediction system to help overcome the significant drain of resources (money and time) being directed toward developing chemical agents for commerce. The research project has been supported through an STTR mechanism and funded by the National Institute of Environmental Health Sciences beginning Phase I in 2004 (CRADA No. ORNL-04-0688) and extending Phase II through 2007 (ORNL NFE-06-00020). To attempt the research objectives and aims outlined under this CRADA, state-of-the-art computational neural network and wavelet methods were used in an effort to design a predictive toxicity system that used two independent areas on which to base the system’s predictions. These two areas were quantitative structure-activity relationships and gene-expression data obtained from microarrays. A third area, using the new Massively Parallel Signature Sequencing (MPSS) technology to assess gene expression, also was attempted but had to be dropped because the company holding the rights to this promising MPSS technology went out of business. A research-scale predictive toxicity database system called Multi-Intelligent System for Toxicogenomic Applications (MISTA) was developed and its feasibility for use as a predictor of toxicological activity was tested. The fundamental focus of the CRADA was an attempt and effort to operate the MISTA database using the ORNL neural network. This effort indicated the potential that such a fully developed system might be used to assist in predicting such biological endpoints as hepatotoxcity and neurotoxicity. The MISTA/LiverTox approach if eventually fully developed might also be useful for automatic processing of microarray data to predict modes of action. A technical paper describing the

Conservation and variability in the structure and function of the Cas5d endoribonuclease in the CRISPR-mediated microbial immune system.

Science.gov (United States)

Koo, Yoon; Ka, Donghyun; Kim, Eun-Jin; Suh, Nayoung; Bae, Euiyoung

2013-10-23

Clustered regularly interspaced short palindromic repeats (CRISPRs) and CRISPR-associated (Cas) proteins form an RNA-mediated microbial immune system against invading foreign genetic elements. Cas5 proteins constitute one of the most prevalent Cas protein families in CRISPR-Cas systems and are predicted to have RNA recognition motif (RRM) domains. Cas5d is a subtype I-C-specific Cas5 protein that can be divided into two distinct subgroups, one of which has extra C-terminal residues while the other contains a longer insertion in the middle of its N-terminal RRM domain. Here, we report crystal structures of Cas5d from Streptococcus pyogenes and Xanthomonas oryzae, which respectively represent the two Cas5d subgroups. Despite a common domain architecture consisting of an N-terminal RRM domain and a C-terminal β-sheet domain, the structural differences between the two Cas5d proteins are highlighted by the presence of a unique extended helical region protruding from the N-terminal RRM domain of X. oryzae Cas5d. We also demonstrate that Cas5d proteins possess not only specific endoribonuclease activity for CRISPR RNAs but also nonspecific double-stranded DNA binding affinity. These findings suggest that Cas5d may play multiple roles in CRISPR-mediated immunity. Furthermore, the specific RNA processing was also observed between S. pyogenes Cas5d protein and X. oryzae CRISPR RNA and vice versa. This cross-species activity of Cas5d provides a special opportunity for elucidating conserved features of the CRISPR RNA processing event. Copyright © 2013 Elsevier Ltd. All rights reserved.

J/$\\psi$ suppression at forward rapidity in Pb–Pb collisions at $\\sqrt{s_{\\rm NN}} = 5.02$ TeV

CERN Document Server

Adam, Jaroslav; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahmad, Shakeel; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Alam, Sk Noor; Silva De Albuquerque, Danilo; Aleksandrov, Dmitry; Alessandro, Bruno; Alexandre, Didier; Alfaro Molina, Jose Ruben; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altinpinar, Sedat; Altsybeev, Igor; Alves Garcia Prado, Caio; An, Mangmang; Andrei, Cristian; Andrews, Harry Arthur; Andronic, Anton; Anguelov, Venelin; Anson, Christopher Daniel; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Balasubramanian, Supraja; Baldisseri, Alberto; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartke, Jerzy Gustaw; Bartsch, Esther; Basile, Maurizio; Bastid, Nicole; Basu, Sumit; Bathen, Bastian; Batigne, Guillaume; Batista Camejo, Arianna; Batyunya, Boris; Batzing, Paul Christoph; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Belmont Iii, Ronald John; Belmont Moreno, Ernesto; Espinoza Beltran, Lucina Gabriela; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Berceanu, Ionela; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhasin, Anju; Bhat, Inayat Rasool; Bhati, Ashok Kumar; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Livio; Bianchi, Nicola; Bianchin, Chiara; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biro, Gabor; Biswas, Rathijit; Biswas, Saikat; Bjelogrlic, Sandro; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Bock, Friederike; Bogdanov, Alexey; Boggild, Hans; Boldizsar, Laszlo; Bombara, Marek; Bonora, Matthias; Book, Julian Heinz; Borel, Herve; Borissov, Alexander; Borri, Marcello; Bossu, Francesco; Botta, Elena; Bourjau, Christian; Braun-Munzinger, Peter; Bregant, Marco; Breitner, Timo Gunther; Broker, Theo Alexander; Browning, Tyler Allen; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Cabala, Jan; Caffarri, Davide; Cai, Xu; Caines, Helen Louise; Calero Diaz, Liliet; Caliva, Alberto; Calvo Villar, Ernesto; Camerini, Paolo; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Cepila, Jan; Cerello, Piergiorgio; Cerkala, Jakub; Chang, Beomsu; Chapeland, Sylvain; Chartier, Marielle; Charvet, Jean-Luc Fernand; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chauvin, Alex; Chelnokov, Volodymyr; Cherney, Michael Gerard; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Choi, Kyungeon; Chojnacki, Marek; Choudhury, Subikash; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-Urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Connors, Megan Elizabeth; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortes Maldonado, Ismael; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Crkovska, Jana; Crochet, Philippe; Cruz Albino, Rigoberto; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Danisch, Meike Charlotte; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Derradi De Souza, Rafael; Deisting, Alexander; Deloff, Andrzej; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Nezza, Pasquale; Di Ruzza, Benedetto; Diaz Corchero, Miguel Angel; Dietel, Thomas; Dillenseger, Pascal; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Drozhzhova, Tatiana; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Endress, Eric; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erdemir, Irem; Erhardt, Filip; Espagnon, Bruno; Estienne, Magali Danielle; Esumi, Shinichi; Eulisse, Giulio; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Eyyubova, Gyulnara; Fabbietti, Laura; Fabris, Daniela; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Ferencei, Jozef; Fernandez Tellez, Arturo; Gonzalez Ferreiro, Elena; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiore, Enrichetta Maria; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Francisco, Audrey; Frankenfeld, Ulrich Michael; Fronze, Gabriele Gaetano; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gajdosova, Katarina; Gallio, Mauro; Duarte Galvan, Carlos; Gangadharan, Dhevan Raja; Ganoti, Paraskevi; Gao, Chaosong; Garabatos Cuadrado, Jose; Garcia-Solis, Edmundo Javier; Garg, Kunal; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; Germain, Marie; Gheata, Mihaela; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Gladysz-Dziadus, Ewa; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Sanchez Gonzalez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Grachov, Oleg Anatolievich; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Grelli, Alessandro; Grigoras, Alina Gabriela; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Grynyov, Borys; Grion, Nevio; Gronefeld, Julius Maximilian; Grosse-Oetringhaus, Jan Fiete; Grosso, Raffaele; Gruber, Lukas; Guber, Fedor; Guernane, Rachid; Guerzoni, Barbara; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Bautista Guzman, Irais; Haake, Rudiger; Hadjidakis, Cynthia Marie; Haiduc, Maria; Hamagaki, Hideki; Hamar, Gergoe; Hamon, Julien Charles; Harris, John William; Harton, Austin Vincent; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Hellbar, Ernst; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Herrera Corral, Gerardo Antonio; Herrmann, Florian; Hess, Benjamin Andreas; Hetland, Kristin Fanebust; Hillemanns, Hartmut; Hippolyte, Boris; Horak, David; Hosokawa, Ritsuya; Hristov, Peter Zahariev; Hughes, Charles; Humanic, Thomas; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Ilkaev, Radiy; Inaba, Motoi; Incani, Elisa; Ippolitov, Mikhail; Irfan, Muhammad; Isakov, Vladimir; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacak, Barbara; Jacazio, Nicolo; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jahnke, Cristiane; Jakubowska, Monika Joanna; Janik, Malgorzata Anna; Pahula Hewage, Sandun; Jena, Chitrasen; Jena, Satyajit; Jimenez Bustamante, Raul Tonatiuh; Jones, Peter Graham; Jung, Hyungtaik; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karayan, Lilit; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Khan, Mohammed Mohisin; Khan, Palash; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Khatun, Anisa; Kileng, Bjarte; Kim, Do Won; Kim, Dong Jo; Kim, Daehyeok; Kim, Hyeonjoong; Kim, Jinsook; Kim, Jiyoung; Kim, Minjung; Kim, Minwoo; Kim, Se Yong; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Kiss, Gabor; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-Boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobdaj, Chinorat; Kofarago, Monika; Kollegger, Thorsten; Kolozhvari, Anatoly; Kondratev, Valerii; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Kopcik, Michal; Kour, Mandeep; Kouzinopoulos, Charalampos; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Koyithatta Meethaleveedu, Greeshma; Kralik, Ivan; Kravcakova, Adela; Krivda, Marian; Krizek, Filip; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Ajay; Kumar, Jitendra; Kumar, Lokesh; Kumar, Shyam; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Ladron De Guevara, Pedro; Lagana Fernandes, Caio; Lakomov, Igor; Langoy, Rune; Lapidus, Kirill; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Lattuca, Alessandra; Laudi, Elisa; Lea, Ramona; Leardini, Lucia; Lee, Seongjoo; Lehas, Fatiha; Lehner, Sebastian; Lemmon, Roy Crawford; Lenti, Vito; Leogrande, Emilia; Leon Monzon, Ildefonso; Leon Vargas, Hermes; Leoncino, Marco; Levai, Peter; Li, Shuang; Li, Xiaomei; Lien, Jorgen Andre; Lietava, Roman; Lindal, Svein; Lindenstruth, Volker; Lippmann, Christian; Lisa, Michael Annan; Ljunggren, Hans Martin; Lodato, Davide Francesco; Lonne, Per-Ivar; Loginov, Vitaly; Loizides, Constantinos; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Lunardon, Marcello; Luparello, Grazia; Lupi, Matteo; Lutz, Tyler Harrison; Maevskaya, Alla; Mager, Magnus; Mahajan, Sanjay; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Maldonado Cervantes, Ivonne Alicia; Malinina, Liudmila; Mal'Kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Mao, Yaxian; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martinengo, Paolo; Martinez Hernandez, Mario Ivan; Martinez-Garcia, Gines; Martinez Pedreira, Miguel; Mas, Alexis Jean-Michel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Mastroserio, Annalisa; Matyja, Adam Tomasz; Mayer, Christoph; Mazer, Joel Anthony; Mazzilli, Marianna; Mazzoni, Alessandra Maria; Meddi, Franco; Melikyan, Yuri; Menchaca-Rocha, Arturo Alejandro; Meninno, Elisa; Mercado-Perez, Jorge; Meres, Michal; Mhlanga, Sibaliso; Miake, Yasuo; Mieskolainen, Matti Mikael; Mikhaylov, Konstantin; Milano, Leonardo; Milosevic, Jovan; Mischke, Andre; Mishra, Aditya Nath; Mishra, Tribeni; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Bedangadas; Molnar, Levente; Montano Zetina, Luis Manuel; Montes Prado, Esther; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munning, Konstantin; Munzer, Robert Helmut; Murakami, Hikari; Murray, Sean; Musa, Luciano; Musinsky, Jan; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Naru, Muhammad Umair; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Rosado Navarro, Sebastian; Nayak, Kishora; Nayak, Ranjit; Nayak, Tapan Kumar; Nazarenko, Sergey; Nedosekin, Alexander; Negrao De Oliveira, Renato Aparecido; Nellen, Lukas; Ng, Fabian; Nicassio, Maria; Niculescu, Mihai; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Saehanseul; Oh, Sun Kun; Ohlson, Alice Elisabeth; Okatan, Ali; Okubo, Tsubasa; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Oravec, Matej; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Ozdemir, Mahmut; Pachmayer, Yvonne Chiara; Pagano, Davide; Pagano, Paola; Paic, Guy; Pal, Susanta Kumar; Palni, Prabhakar; Pan, Jinjin; Pandey, Ashutosh Kumar; Papikyan, Vardanush; Pappalardo, Giuseppe; Pareek, Pooja; Park, Jonghan; Park, Woojin; Parmar, Sonia; Passfeld, Annika; Paticchio, Vincenzo; Patra, Rajendra Nath; Paul, Biswarup; Pei, Hua; Peitzmann, Thomas; Peng, Xinye; Pereira Da Costa, Hugo Denis Antonio; Peresunko, Dmitry Yurevich; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrov, Viacheslav; Petrovici, Mihai; Petta, Catia; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Ozelin De Lima Pimentel, Lais; Pinazza, Ombretta; Pinsky, Lawrence; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Poppenborg, Hendrik; Porteboeuf, Sarah Julie; Porter, R Jefferson; Pospisil, Jan; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Puddu, Giovanna; Pujahari, Prabhat Ranjan; Punin, Valery; Putschke, Jorn Henning; Qvigstad, Henrik; Rachevski, Alexandre; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Ratza, Viktor; Ravasenga, Ivan; Read, Kenneth Francis; Redlich, Krzysztof; Reed, Rosi Jan; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reolon, Anna Rita; Reshetin, Andrey; Reygers, Klaus Johannes; Riabov, Viktor; Ricci, Renato Angelo; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-Lucian; Rodriguez Cahuantzi, Mario; Rodriguez Manso, Alis; Roeed, Ketil; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Ronchetti, Federico; Ronflette, Lucile; Rosnet, Philippe; Rossi, Andrea; Roukoutakis, Filimon; Roy, Ankhi; Roy, Christelle Sophie; Roy, Pradip Kumar; Rubio Montero, Antonio Juan; Rui, Rinaldo; Russo, Riccardo; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Saarinen, Sampo; Sadhu, Samrangy; Sadovskiy, Sergey; Safarik, Karel; Sahlmuller, Baldo; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Salzwedel, Jai Samuel Nielsen; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandor, Ladislav; Sandoval, Andres; Sano, Masato; Sarkar, Debojit; Sarkar, Nachiketa; Sarma, Pranjal; Scapparone, Eugenio; Scarlassara, Fernando; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schmidt, Martin; Schuchmann, Simone; Schukraft, Jurgen; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Scott, Rebecca Michelle; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shadura, Oksana; Shahoyan, Ruben; Shangaraev, Artem; Sharma, Ankita; Sharma, Mona; Sharma, Monika; Sharma, Natasha; Sheikh, Ashik Ikbal; Shigaki, Kenta; Shou, Qiye; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Silvestre, Catherine Micaela; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singhal, Vikas; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Song, Jihye; Song, Myunggeun; Song, Zixuan; Soramel, Francesca; Sorensen, Soren Pontoppidan; Sozzi, Federica; Spiriti, Eleuterio; Sputowska, Iwona Anna; Spyropoulou-Stassinaki, Martha; Stachel, Johanna; Stan, Ionel; Stankus, Paul; Stenlund, Evert Anders; Steyn, Gideon Francois; Stiller, Johannes Hendrik; Stocco, Diego; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Sumowidagdo, Suharyo; Swain, Sagarika; Szabo, Alexander; Szarka, Imrich; Szczepankiewicz, Adam; Szymanski, Maciej Pawel; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-Gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terasaki, Kohei; Terrevoli, Cristina; Teyssier, Boris; Thaeder, Jochen Mathias; Thakur, Dhananjaya; Thomas, Deepa; Tieulent, Raphael Noel; Tikhonov, Anatoly; Timmins, Anthony Robert; Toia, Alberica; Trogolo, Stefano; Trombetta, Giuseppe; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vala, Martin; Valencia Palomo, Lizardo; Van Der Maarel, Jasper; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vanat, Tomas; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vazquez Doce, Oton; Vechernin, Vladimir; Veen, Annelies Marianne; Velure, Arild; Vercellin, Ermanno; Vergara Limon, Sergio; Vernet, Renaud; Vickovic, Linda; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Vinogradov, Leonid; Virgili, Tiziano; Vislavicius, Vytautas; Viyogi, Yogendra; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Vranic, Danilo; Vrlakova, Janka; Vulpescu, Bogdan; Wagner, Boris; Wagner, Jan; Wang, Hongkai; Wang, Mengliang; Watanabe, Daisuke; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Weiser, Dennis Franz; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Willems, Guido Alexander; Williams, Crispin; Windelband, Bernd Stefan; Winn, Michael Andreas; Yalcin, Serpil; Yang, Ping; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-Kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correia Zanoli, Henrique Jose; Zaporozhets, Sergey; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zgura, Sorin Ion; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhang, Yonghong; Chunhui, Zhang; Zhang, Zuman; Zhao, Chengxin; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zichichi, Antonino; Zimmermann, Alice; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zyzak, Maksym

2017-03-10

The inclusive J/$\\psi$ production has been studied in Pb-Pb and pp interactions at the centre-of-mass energy per nucleon-nucleon collision $\\sqrt{s_{\\rm NN}} = 5.02$ TeV, using the ALICE detector at the CERN LHC. The J/$\\psi$ meson is detected, in the centre-of-mass rapidity interval $2.5R_{\\rm AA}$. The latter is presented as a function of the centrality of the collision and, for central collisions, as a function of the transverse momentum $p_{\\rm T}$ of the J/$\\psi$. The measured $R_{\\rm AA}$ values are compared to previous results obtained by ALICE in Pb-Pb collisions at $\\sqrt{s_{\\rm NN}} = 2.76$ TeV. The ratio of the $R_{\\rm AA}$ values at the two energies is also computed and compared to calculations of statistical and dyn...

$\\Upsilon$ suppression at forward rapidity in Pb-Pb collisions at $\\sqrt{s_{\\rm NN}}= 5.02$ TeV

CERN Document Server

Acharya, Shreyasi; The ALICE collaboration; Adamova, Dagmar; Adolfsson, Jonatan; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Al-turany, Mohammad; Alam, Sk Noor; Silva De Albuquerque, Danilo; Aleksandrov, Dmitry; Alessandro, Bruno; Alfaro Molina, Jose Ruben; Ali, Yasir; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altenkamper, Lucas; Altsybeev, Igor; Anaam, Mustafa Naji; Andrei, Cristian; Andreou, Dimitra; Andrews, Harry Arthur; Andronic, Anton; Angeletti, Massimo; Anguelov, Venelin; Anson, Christopher Daniel; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Anwar, Rafay; Apadula, Nicole; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Ball, Markus; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barioglio, Luca; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartsch, Esther; Bastid, Nicole; Basu, Sumit; Batigne, Guillaume; Batyunya, Boris; Batzing, Paul Christoph; Bazo Alba, Jose Luis; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Espinoza Beltran, Lucina Gabriela; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhaduri, Partha Pratim; Bhasin, Anju; Bhat, Inayat Rasool; Bhatt, Himani; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Antonio; Bianchi, Livio; Bianchi, Nicola; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biro, Gabor; Biswas, Rathijit; Biswas, Saikat; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Boca, Gianluigi; Bock, Friederike; Bogdanov, Alexey; Boldizsar, Laszlo; Bombara, Marek; Bonomi, Germano; Bonora, Matthias; Borel, Herve; Borissov, Alexander; Borri, Marcello; Botta, Elena; Bourjau, Christian; Bratrud, Lars; Braun-munzinger, Peter; Bregant, Marco; Broker, Theo Alexander; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buhler, Paul; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Cabala, Jan; Caffarri, Davide; Caines, Helen Louise; Caliva, Alberto; Calvo Villar, Ernesto; Soto Camacho, Rabi; Camerini, Paolo; Capon, Aaron Allan; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Chandra, Sinjini; Chang, Beomsu; Chang, Wan; Chapeland, Sylvain; Chartier, Marielle; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chauvin, Alex; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Chowdhury, Tasnuva; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Concas, Matteo; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Costanza, Susanna; Crkovska, Jana; Crochet, Philippe; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Dani, Sanskruti; Danisch, Meike Charlotte; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Derradi De Souza, Rafael; Franz Degenhardt, Hermann; Deisting, Alexander; Deloff, Andrzej; Delsanto, Silvia; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Ruzza, Benedetto; Arteche Diaz, Raul; Dietel, Thomas; Dillenseger, Pascal; Ding, Yanchun; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Van Doremalen, Lennart Vincent; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dudi, Sandeep; Duggal, Ashpreet Kaur; Dukhishyam, Mallick; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Endress, Eric; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erhardt, Filip; Ersdal, Magnus Rentsch; Espagnon, Bruno; Eulisse, Giulio; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Fabbietti, Laura; Faggin, Mattia; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Fernandez Tellez, Arturo; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiorenza, Gabriele; Flor, Fernando; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Francisco, Audrey; Frankenfeld, Ulrich Michael; Fronze, Gabriele Gaetano; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gajdosova, Katarina; Gallio, Mauro; Duarte Galvan, Carlos; Ganoti, Paraskevi; Garabatos Cuadrado, Jose; Garcia-solis, Edmundo Javier; Garg, Kunal; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; De Leone Gay, Maria Beatriz; Germain, Marie; Ghosh, Jhuma; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Greiner, Leo Clifford; Grelli, Alessandro; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Gronefeld, Julius Maximilian; Grosa, Fabrizio; Grosse-oetringhaus, Jan Fiete; Grosso, Raffaele; Guernane, Rachid; Guerzoni, Barbara; Guittiere, Manuel; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Bautista Guzman, Irais; Haake, Rudiger; Habib, Michael Karim; Hadjidakis, Cynthia Marie; Hamagaki, Hideki; Hamar, Gergoe; Hamid, Mohammed; Hamon, Julien Charles; Hannigan, Ryan; Haque, Md Rihan; Harris, John William; Harton, Austin Vincent; Hassan, Hadi; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Hellbar, Ernst; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Gonzalez Hernandez, Emma; Herrera Corral, Gerardo Antonio; Herrmann, Florian; Hetland, Kristin Fanebust; Hilden, Timo Eero; Hillemanns, Hartmut; Hills, Christopher; Hippolyte, Boris; Hohlweger, Bernhard; Horak, David; Hornung, Sebastian; Hosokawa, Ritsuya; Hota, Jyotishree; Hristov, Peter Zahariev; Huang, Chun-lu; Hughes, Charles; Huhn, Patrick; Humanic, Thomas; Hushnud, Hushnud; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Iddon, James Philip; Iga Buitron, Sergio Arturo; Ilkaev, Radiy; Inaba, Motoi; Ippolitov, Mikhail; Islam, Md Samsul; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacak, Barbara; Jacazio, Nicolo; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jaelani, Syaefudin; Jahnke, Cristiane; Jakubowska, Monika Joanna; Janik, Malgorzata Anna; Jena, Chitrasen; Jercic, Marko; Jevons, Oliver; Jimenez Bustamante, Raul Tonatiuh; Jin, Muqing; Jones, Peter Graham; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karczmarczyk, Przemyslaw; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Ketzer, Bernhard Franz; Khabanova, Zhanna; Khan, Ahsan Mehmood; Khan, Shaista; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Khatun, Anisa; Khuntia, Arvind; Kielbowicz, Miroslaw Marek; Kileng, Bjarte; Kim, Byungchul; Kim, Daehyeok; Kim, Dong Jo; Kim, Eun Joo; Kim, Hyeonjoong; Kim, Jinsook; Kim, Jiyoung; Kim, Minjung; Kim, Se Yong; Kim, Taejun; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobdaj, Chinorat; Varga-kofarago, Monika; Kohler, Markus Konrad; Kollegger, Thorsten; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Konyushikhin, Maxim; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Kralik, Ivan; Kravcakova, Adela; Kreis, Lukas; Krivda, Marian; Krizek, Filip; Kruger, Mario; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Jitendra; Kumar, Lokesh; Kumar, Shyam; Kundu, Sourav; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kvapil, Jakub; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lai, Yue Shi; Lakomov, Igor; Langoy, Rune; Lapidus, Kirill; Lardeux, Antoine Xavier; Larionov, Pavel; Laudi, Elisa; Lavicka, Roman; Lea, Ramona; Leardini, Lucia; Lee, Seongjoo; Lehas, Fatiha; Lehner, Sebastian; Lehrbach, Johannes; Lemmon, Roy Crawford; Leon Monzon, Ildefonso; Levai, Peter; Li, Xiaomei; Li, Xing Long; Lien, Jorgen Andre; Lietava, Roman; Lim, Bong-hwi; Lindal, Svein; Lindenstruth, Volker; Lindsay, Scott William; Lippmann, Christian; Lisa, Michael Annan; Litichevskyi, Vladyslav; Liu, Alwina; Ljunggren, Hans Martin; Llope, William; Lodato, Davide Francesco; Loginov, Vitaly; Loizides, Constantinos; Loncar, Petra; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Luhder, Jens Robert; Lunardon, Marcello; Luparello, Grazia; Lupi, Matteo; Maevskaya, Alla; Mager, Magnus; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Malik, Qasim Waheed; Malinina, Liudmila; Mal'kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Mao, Yaxian; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martinengo, Paolo; Martinez, Jacobb Lee; Martinez Hernandez, Mario Ivan; Martinez-garcia, Gines; Martinez Pedreira, Miguel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Masson, Erwann; Mastroserio, Annalisa; Mathis, Andreas Michael; Toledo Matuoka, Paula Fernanda; Matyja, Adam Tomasz; Mayer, Christoph; Mazzilli, Marianna; Mazzoni, Alessandra Maria; Meddi, Franco; Melikyan, Yuri; Menchaca-rocha, Arturo Alejandro; Meninno, Elisa; Mercado-perez, Jorge; Meres, Michal; Soncco Meza, Carlos; Mhlanga, Sibaliso; Miake, Yasuo; Micheletti, Luca; Mieskolainen, Matti Mikael; Mihaylov, Dimitar Lubomirov; Mikhaylov, Konstantin; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Auro Prasad; Mohanty, Bedangadas; Khan, Mohammed Mohisin; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munning, Konstantin; Arratia Munoz, Miguel Ignacio; Munzer, Robert Helmut; Murakami, Hikari; Murray, Sean; Musa, Luciano; Musinsky, Jan; Myers, Corey James; Myrcha, Julian Wojciech; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Narayan, Amrendra; Naru, Muhammad Umair; Nassirpour, Adrian Fereydon; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Rosado Navarro, Sebastian; Nayak, Kishora; Nayak, Ranjit; Nayak, Tapan Kumar; Nazarenko, Sergey; Negrao De Oliveira, Renato Aparecido; Nellen, Lukas; Nesbo, Simon Voigt; Neskovic, Gvozden; Ng, Fabian; Nicassio, Maria; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oh, Hoonjung; Ohlson, Alice Elisabeth; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Oravec, Matej; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Pachmayer, Yvonne Chiara; Pacik, Vojtech; Pagano, Davide; Paic, Guy; Palni, Prabhakar; Pan, Jinjin; Pandey, Ashutosh Kumar; Panebianco, Stefano; Papikyan, Vardanush; Pareek, Pooja; Park, Jonghan; Parkkila, Jasper Elias; Parmar, Sonia; Passfeld, Annika; Pathak, Surya Prakash; Patra, Rajendra Nath; Paul, Biswarup; Pei, Hua; Peitzmann, Thomas; Peng, Xinye; Pereira, Luis Gustavo; Pereira Da Costa, Hugo Denis Antonio; Peresunko, Dmitry Yurevich; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrovici, Mihai; Petta, Catia; Peretti Pezzi, Rafael; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Ozelin De Lima Pimentel, Lais; Pinazza, Ombretta; Pinsky, Lawrence; Pisano, Silvia; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pliquett, Fabian; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Poppenborg, Hendrik; Porteboeuf, Sarah Julie; Pozdniakov, Valeriy; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Punin, Valery; Putschke, Jorn Henning; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Ratza, Viktor; Ravasenga, Ivan; Read, Kenneth Francis; Redlich, Krzysztof; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reshetin, Andrey; Revol, Jean-pierre; Reygers, Klaus Johannes; Riabov, Viktor; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-lucian; Rode, Sudhir Pandurang; Rodriguez Cahuantzi, Mario; Roeed, Ketil; Rogalev, Roman; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Rokita, Przemyslaw Stefan; Ronchetti, Federico; Dominguez Rosas, Edgar; Roslon, Krystian; Rosnet, Philippe; Rossi, Andrea; Rotondi, Alberto; Roukoutakis, Filimon; Roy, Christelle Sophie; Roy, Pradip Kumar; Vazquez Rueda, Omar; Rui, Rinaldo; Rumyantsev, Boris; Rustamov, Anar; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Saarinen, Sampo; Sadhu, Samrangy; Sadovskiy, Sergey; Safarik, Karel; Saha, Sumit Kumar; Sahoo, Baidyanath; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandoval, Andres; Sarkar, Amal; Sarkar, Debojit; Sarkar, Nachiketa; Sarma, Pranjal; Sas, Mike Henry Petrus; Scapparone, Eugenio; Scarlassara, Fernando; Schaefer, Brennan; Scheid, Horst Sebastian; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schmidt, Marten Ole; Schmidt, Martin; Schmidt, Nicolas Vincent; Schukraft, Jurgen; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sett, Priyanka; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shahoyan, Ruben; Shaikh, Wadut; Shangaraev, Artem; Sharma, Anjali; Sharma, Ankita; Sharma, Meenakshi; Sharma, Natasha; Sheikh, Ashik Ikbal; Shigaki, Kenta; Shimomura, Maya; Shirinkin, Sergey; Shou, Qiye; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singh, Randhir; Singhal, Vikas; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Song, Jihye; Soramel, Francesca; Sorensen, Soren Pontoppidan; Sozzi, Federica; Sputowska, Iwona Anna; Stachel, Johanna; Stan, Ionel; Stankus, Paul; Stenlund, Evert Anders; Stocco, Diego; Storetvedt, Maksim Melnik; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Sumowidagdo, Suharyo; Suzuki, Ken; Swain, Sagarika; Szabo, Alexander; Szarka, Imrich; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terrevoli, Cristina; Teyssier, Boris; Thakur, Dhananjaya; Thakur, Sanchari; Thomas, Deepa; Thoresen, Freja; Tieulent, Raphael Noel; Tikhonov, Anatoly; Timmins, Anthony Robert; Toia, Alberica; Topilskaya, Nataliya; Toppi, Marco; Rojas Torres, Solangel; Tripathy, Sushanta; Trogolo, Stefano; Trombetta, Giuseppe; Tropp, Lukas; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Trzcinski, Tomasz Piotr; Trzeciak, Barbara Antonina; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Umaka, Ejiro Naomi; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vala, Martin; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vazquez Doce, Oton; Vechernin, Vladimir; Veen, Annelies Marianne; Vercellin, Ermanno; Vergara Limon, Sergio; Vermunt, Luuk; Vernet, Renaud; Vertesi, Robert; Vickovic, Linda; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Virgili, Tiziano; Vislavicius, Vytautas; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Voscek, Dominik; Vranic, Danilo; Vrlakova, Janka; Wagner, Boris; Wang, Hongkai; Wang, Mengliang; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Wegrzynek, Adam; Weiser, Dennis Franz; Wenzel, Sandro Christian; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Willems, Guido Alexander; Williams, Crispin; Willsher, Emily; Windelband, Bernd Stefan; Witt, William Edward; Xu, Ran; Yalcin, Serpil; Yamakawa, Kosei; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correa Zanoli, Henrique Jose; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zhalov, Mikhail; Zhang, Xiaoming; Zhang, Yonghong; Zhang, Zuman; Zhao, Chengxin; Zherebchevskii, Vladimir; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zhu, Ya; Zichichi, Antonino; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zmeskal, Johann; Zou, Shuguang

2018-01-01

Inclusive $\\Upsilon(1S)$ and $\\Upsilon(2S)$ production have been measured in Pb-Pb collisions at the centre-of-mass energy per nucleon-nucleon pair $\\sqrt{s_{\\rm NN}}= 5.02$ TeV, using the ALICE detector at the CERN LHC. The $\\Upsilon$ mesons are reconstructed in the centre-of-mass rapidity interval $2.5 < y < 4$ and in the transverse1 momentum range $p_{\\rm T} <15$ GeV/$c$, via their decays to muon pairs. In this Letter, we present results on the inclusive $\\Upsilon(1S)$ nuclear modification factor $R_{\\rm AA}$ as a function of collision centrality, transverse momentum and rapidity. The $\\Upsilon(1S)$ and $\\Upsilon(2S)$ $R_{\\rm AA}$, integrated over the centrality range 0-90%, are $0.37\\pm 0.02 {\\rm (stat)}\\pm 0.03 {\\rm (syst)}$ and $0.10 \\pm 0.04 {\\rm (stat)} \\pm 0.02{\\rm (syst)}$, respectively, leading to a ratio $R_{\\rm AA}^{\\Upsilon(2S)}/R_{\\rm AA}^{\\Upsilon(1S)}$ of $0.28 \\pm 0.12{\\rm (stat)} \\pm 0.06{\\rm (syst)}$. The observed $\\Upsilon(1S)$ suppression increases with the centrality of the col...

Enhanced cognitive Radio Resource Management for LTE systems

KAUST Repository

Alqerm, Ismail

2013-10-01

The explosive growth in mobile Internet and related services has increased the need for more bandwidth in cellular networks. The Long-Term Evolution (LTE) technology is an attractive solution for operators and subscribers to meet such need since it provides high data rates and scalable bandwidth. Radio Resource Management (RRM) is essential for LTE to provide better communication quality and meet the application QoS requirements. Cognitive resource management is a promising solution for LTE RRM as it improves network efficiency by exploiting radio environment information, intelligent optimization algorithms to configure transmission parameters, and mitigate interference. In this paper, we propose a cognitive resource management scheme to adapt LTE network parameters to the environment conditions. The scheme optimizes resource blocks assignment, modulation selection and bandwidth selection to maximize throughput and minimize interference. The scheme uses constrained optimization for throughput maximization and interference control. It is also enhanced by learning mechanism to reduce the optimization complexity and improve the decision-making quality. Our evaluation results show that our scheme achieved significant improvements in throughput and LTE system capacity. Results also show the improvement in the user satisfaction over other techniques in LTE RRM.

Smart Bandwidth Assignation in an Underlay Cellular Network for Internet of Vehicles

Directory of Open Access Journals (Sweden)

Idoia de la Iglesia

2017-09-01

Full Text Available The evolution of the IoT (Internet of Things paradigm applied to new scenarios as VANETs (Vehicular Ad Hoc Networks has gained momentum in recent years. Both academia and industry have triggered advanced studies in the IoV (Internet of Vehicles, which is understood as an ecosystem where different types of users (vehicles, elements of the infrastructure, pedestrians are connected. How to efficiently share the available radio resources among the different types of eligible users is one of the important issues to be addressed. This paper briefly analyzes various concepts presented hitherto in the literature and it proposes an enhanced algorithm for ensuring a robust co-existence of the aforementioned system users. Therefore, this paper introduces an underlay RRM (Radio Resource Management methodology which is capable of (1 improving cellular spectral efficiency while making a minimal impact on cellular communications and (2 ensuring the different QoS (Quality of Service requirements of ITS (Intelligent Transportation Systems applications. Simulation results, where we compare the proposed algorithm to the other two RRM, show the promising spectral efficiency performance of the proposed RRM methodology.

Structural Basis for Recognition and Sequestration of UUUOH 3 ' Temini of Nascent RNA Polymerase III Transcripts by La, a Rheumatic Disease Autoantigen

Energy Technology Data Exchange (ETDEWEB)

Teplova,M.; Yuan, Y.; Phan, A.; Malinina, L.; Ilin, S.; Teplov, A.; Patel, D.

2006-01-01

The nuclear phosphoprotein La was identified as an autoantigen in patients with systemic lupus erythematosus and Sjogren's syndrome. La binds to and protects the UUUOH 3' terminii of nascent RNA polymerase III transcripts from exonuclease digestion. We report the 1.85 Angstroms crystal structure of the N-terminal domain of human La, consisting of La and RRM1 motifs, bound to r(U1-G2-C3-U4-G5-U6-U7-U8-U9OH). The U7-U8-U9OH 3' end, in a splayed-apart orientation, is sequestered within a basic and aromatic amino acid-lined cleft between the La and RRM1 motifs. The specificity-determining U8 residue bridges both motifs, in part through unprecedented targeting of the {beta} sheet edge, rather than the anticipated face, of the RRM1 motif. Our structural observations, supported by mutation studies of both La and RNA components, illustrate the principles behind RNA sequestration by a rheumatic disease autoantigen, whereby the UUUOH 3' ends of nascent RNA transcripts are protected during downstream processing and maturation events.

Long-term surveillance plan for the Green River, Utah disposal site. Revision 2

International Nuclear Information System (INIS)

1998-07-01

The long-term surveillance plan (LTSP) for the Green River, Utah, Uranium Mill Tailings Remedial Action (UMTRA) Project disposal site describes the surveillance activities for the Green River disposal cell. The US Department of Energy (DOE) will carry out these activities to ensure that the disposal cell continues to function as designed. This final LTSP was prepared as a requirement for acceptance under the US Nuclear Regulatory Commission (NRC) general license for custody and long-term care of residual radioactive materials (RRM). This LTSP documents whether the land and interests are owned by the United States or an Indian tribe and details how the long-term care of the disposal site will be carried out

UMTRA Surface Project management action process document. Final report: Revision 1

International Nuclear Information System (INIS)

1996-04-01

A critical mission of the US Department of Energy (DOE) is the planning, implementation, and completion of environmental restoration (ER) programs at facilities that were operated by or in support of the former Atomic Energy Commission (AEC) from the late 1940s into the 1970s. Among these facilities are the 24 former uranium mill sites designed in the Uranium Mill Tailings Radiation Control Act (UMTRCA) of 1978 (42 USC section 7901 et seq.) Title 1 of the UMTRCA authorized the DOE to undertake remedial actions at these designated sites and associated vicinity properties (VP), which contain uranium mill tailings and other residual radioactive materials (RRM) derived from the processing sites. Title 2 of the UMTRCA addresses uranium mill sites that were licensed at the time the UMTRCA was enacted. Cleanup of these Title 2 sites is the responsibility of the licensees. The cleanup of the Title 1 sites has been split into two separate projects: the Surface Project, which deals with the mill buildings, tailings, and contaminated soils at the sites and VPs; and the Ground Water Project, which is limited to the contaminated ground water at the sites. This management action process (MAP) document discusses the Uranium Mill Tailings Remedial Action (UMTRA) Surface Project only; a separate MAP document has been prepared for the UMTRA Ground Water Project

Results of combustion and emissions testing when co-firing blends of binder-enhanced densified refuse-derived fuel (b-dRDF) pellets and coal in a 440 MW{sub e} cyclone fired combustor. Volume 3: Appendices

Energy Technology Data Exchange (ETDEWEB)

Ohlsson, O.

1994-07-01

This report contains the data resulting from the co-firing of b-dRDF pellets and coal in a 440-MW{sub e} cyclone-fired combustor. These tests were conducted under a Collaborative Research and Development Agreement (CRADA). The CRADA partners included the U.S. Department of Energy (DOE), National Renewable Energy Laboratory (NREL), Argonne National Laboratory (ANL), Otter Tail Power Company, Green Isle Environmental, Inc., XL Recycling Corporation, and Marblehead Lime Company. The report is made up of three volumes. This volume contains other supporting information, along with quality assurance documentation and safety and test plans. With this multi-volume approach, readers can find information at the desired level of detail, depending on individual interest or need.

Trichloroethylene and Cancer: Systematic and Quantitative Review of Epidemiologic Evidence for Identifying Hazards

Directory of Open Access Journals (Sweden)

Cheryl Siegel Scott

2011-11-01

Full Text Available We conducted a meta-analysis focusing on studies with high potential for trichloroethylene (TCE exposure to provide quantitative evaluations of the evidence for associations between TCE exposure and kidney, liver, and non-Hodgkin lymphoma (NHL cancers. A systematic review documenting essential design features, exposure assessment approaches, statistical analyses, and potential sources of confounding and bias identified twenty-four cohort and case-control studies on TCE and the three cancers of interest with high potential for exposure, including five recently published case-control studies of kidney cancer or NHL. Fixed- and random-effects models were fitted to the data on overall exposure and on the highest exposure group. Sensitivity analyses examined the influence of individual studies and of alternative risk estimate selections. For overall TCE exposure and kidney cancer, the summary relative risk (RRm estimate from the random effects model was 1.27 (95% CI: 1.13, 1.43, with a higher RRm for the highest exposure groups (1.58, 95% CI: 1.28, 1.96. The RRm estimates were not overly sensitive to alternative risk estimate selections or to removal of an individual study. There was no apparent heterogeneity or publication bias. For NHL, RRm estimates for overall exposure and for the highest exposure group, respectively, were 1.23 (95% CI: 1.07, 1.42 and 1.43 (95% CI: 1.13, 1.82 and, for liver cancer, 1.29 (95% CI: 1.07, 1.56 and 1.28 (95% CI: 0.93, 1.77. Our findings provide strong support for a causal association between TCE exposure and kidney cancer. The support is strong but less robust for NHL, where issues of study heterogeneity, potential publication bias, and weaker exposure-response results contribute uncertainty, and more limited for liver cancer, where only cohort studies with small numbers of cases were available.

Trichloroethylene and Cancer: Systematic and Quantitative Review of Epidemiologic Evidence for Identifying Hazards

Science.gov (United States)

Scott, Cheryl Siegel; Jinot, Jennifer

2011-01-01

We conducted a meta-analysis focusing on studies with high potential for trichloroethylene (TCE) exposure to provide quantitative evaluations of the evidence for associations between TCE exposure and kidney, liver, and non-Hodgkin lymphoma (NHL) cancers. A systematic review documenting essential design features, exposure assessment approaches, statistical analyses, and potential sources of confounding and bias identified twenty-four cohort and case-control studies on TCE and the three cancers of interest with high potential for exposure, including five recently published case-control studies of kidney cancer or NHL. Fixed- and random-effects models were fitted to the data on overall exposure and on the highest exposure group. Sensitivity analyses examined the influence of individual studies and of alternative risk estimate selections. For overall TCE exposure and kidney cancer, the summary relative risk (RRm) estimate from the random effects model was 1.27 (95% CI: 1.13, 1.43), with a higher RRm for the highest exposure groups (1.58, 95% CI: 1.28, 1.96). The RRm estimates were not overly sensitive to alternative risk estimate selections or to removal of an individual study. There was no apparent heterogeneity or publication bias. For NHL, RRm estimates for overall exposure and for the highest exposure group, respectively, were 1.23 (95% CI: 1.07, 1.42) and 1.43 (95% CI: 1.13, 1.82) and, for liver cancer, 1.29 (95% CI: 1.07, 1.56) and 1.28 (95% CI: 0.93, 1.77). Our findings provide strong support for a causal association between TCE exposure and kidney cancer. The support is strong but less robust for NHL, where issues of study heterogeneity, potential publication bias, and weaker exposure-response results contribute uncertainty, and more limited for liver cancer, where only cohort studies with small numbers of cases were available. PMID:22163205

The function of the RNA-binding protein TEL1 in moss reveals ancient regulatory mechanisms of shoot development.

Science.gov (United States)

Vivancos, Julien; Spinner, Lara; Mazubert, Christelle; Charlot, Florence; Paquet, Nicolas; Thareau, Vincent; Dron, Michel; Nogué, Fabien; Charon, Céline

2012-03-01

The shoot represents the basic body plan in land plants. It consists of a repeated structure composed of stems and leaves. Whereas vascular plants generate a shoot in their diploid phase, non-vascular plants such as mosses form a shoot (called the gametophore) in their haploid generation. The evolution of regulatory mechanisms or genetic networks used in the development of these two kinds of shoots is unclear. TERMINAL EAR1-like genes have been involved in diploid shoot development in vascular plants. Here, we show that disruption of PpTEL1 from the moss Physcomitrella patens, causes reduced protonema growth and gametophore initiation, as well as defects in gametophore development. Leafy shoots formed on ΔTEL1 mutants exhibit shorter stems with more leaves per shoot, suggesting an accelerated leaf initiation (shortened plastochron), a phenotype shared with the Poaceae vascular plants TE1 and PLA2/LHD2 mutants. Moreover, the positive correlation between plastochron length and leaf size observed in ΔTEL1 mutants suggests a conserved compensatory mechanism correlating leaf growth and leaf initiation rate that would minimize overall changes in plant biomass. The RNA-binding protein encoded by PpTEL1 contains two N-terminus RNA-recognition motifs, and a third C-terminus non-canonical RRM, specific to TEL proteins. Removal of the PpTEL1 C-terminus (including this third RRM) or only 16-18 amino acids within it seriously impairs PpTEL1 function, suggesting a critical role for this third RRM. These results show a conserved function of the RNA-binding PpTEL1 protein in the regulation of shoot development, from early ancestors to vascular plants, that depends on the third TEL-specific RRM.

Thermoset polymers chemo-rheology dedicated to reactive rotational moulding (RRM) understanding and control

International Nuclear Information System (INIS)

Viale, J.

2009-12-01

This study comes within the scope of New Technology for Energy, particularly for high pressure hydrogen storage. Reactive Rotational Moulding has been identified as an adapted process for hydrogen-tight liners manufacturing. Thus the Reactive Rotational Moulding process has been studied in order to find theoretical tools dedicated to the understanding of such a reactive forming process. Chemical kinetics of four polyurethanes and poly-epoxides reactive systems have been determined on classical isothermal conditions and original aniso-thermal conditions i.e. on temperature ramps. Aniso-thermal conditions have been selected because they corresponds better to real process conditions. Rheological behaviour have also been characterized on two different approaches, an isothermal one and on temperature ramps. In particular, viscosity have been described as a function of heating rate. These physical and chemical results have been compiled in an original state diagram in order to show material properties evolution in a time-temperature space. The whole ex situ characterizations are then managed to described the behavior of the different formulations during the rotational moulding. Moreover they allow to form specific materials and so to widen the range of material to thermoset polymers. Finally, in order to correlate theoretical deduction to real reactive systems evolution, the elaboration of innovating monitoring tool based on ultrasonic analysis has been studied. To begin, polymerization monitoring criteria have been identified and then specific techniques have been set to monitor these criteria in real forming process. (author)

Report to Congress on the Activities of the DoD Office of Technology Transition

National Research Council Canada - National Science Library

2006-01-01

.... This 11th report discusses our major efforts and successes in transferring technology. Appendix B displays specific data elements showing the trends in Cooperative Research and Development Agreements (CRADAs...

Tunneling Conductance in Two-Dimensional Junctions between a Normal Metal and a Ferromagnetic Rashba Metal

Science.gov (United States)

Oshima, Daisuke; Taguchi, Katsuhisa; Tanaka, Yukio

2018-03-01

We have studied charge transport in a ferromagnetic Rashba metal (FRM), where both Rashba type spin-orbit coupling (RSOC) and exchange coupling coexist. It has nontrivial metallic states, i.e., a normal Rashba metal (NRM), anomalous Rashba metal (ARM), and Rashba ring metal (RRM), and they are manipulated by tuning the Fermi level with an applied gate voltage. We theoretically studied the tunneling conductance (G) in a normal metal/FRM junction by changing the Fermi level via an applied gate voltage (Vg) on the FRM. We found a wide variation in the Vg dependence of G, which depends on the metallic states. In an NRM, the Vg dependence of G is the same as that in a conventional two-dimensional system. However, in an ARM, the Vg dependence of G is similar to that in a conventional one- (two-)dimensional system for a large (small) RSOC. Furthermore, in an RRM, which is generated by a large RSOC, the Vg dependence of G is similar to that in the one-dimensional system. In addition, these anomalous properties stem from the density of states in the ARM and RRM caused by the large RSOC and exchange coupling rather than the spin-momentum locking of RSOC.

Hazardous and Medical Waste Destruction Using the AC Plasmatron Final Report CRADA No. TC-1560-98

Energy Technology Data Exchange (ETDEWEB)

Caplan, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bucher, K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Tulupov, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-28

The goal of this project was to develop a prototype medical waste destruction facility based on the AC plasma torch capable of processing 150 kg of waste per hour while satisfying US EPA emission standards. The project was to provide the first opportunity for a joint U.S.-Russian project using an AC Plasma Torch in a hazardous waste destruction system to be assembled and operated in the U.S. thus promoting the commercialization in the U.S. of this joint U.S.-Russian developed technology. This project was a collaboration between the Russian Institute Soliton- NTT, the U.S industrial partner Scientific Utilization Inc. (SUI) and Lawrence Livermore National Laboratory ( LLNL). The project was funded by DOE for a total of $1.2 million with $600K for allocated for Phase I and $600K for Phase II. The Russian team received about $800K over the two (2) year period while LLNL received $400K. SUI was to provide in kind matching funds totaling $1.2 million.

Biochemical basis of drought tolerance in hybrid Populus grown under field production conditions. CRADA final report

Energy Technology Data Exchange (ETDEWEB)

Tschaplinski, T.J.; Tuskan, G.A. [Oak Ridge National Lab., TN (United States); Wierman, C. [Boise Cascade Corp., Wallula, WA (United States)

1997-04-01

The purpose of this cooperative effort was to assess the use of osmotically active compounds as molecular selection criteria for drought tolerance in Populus in a large-scale field trial. It is known that some plant species, and individuals within a plant species, can tolerate increasing stress associated with reduced moisture availability by accumulating solutes. The biochemical matrix of such metabolites varies among species and among individuals. The ability of Populus clones to tolerate drought has equal value to other fiber producers, i.e., the wood products industry, where irrigation is used in combination with other cultural treatments to obtain high dry weight yields. The research initially involved an assessment of drought stress under field conditions and characterization of changes in osmotic constitution among the seven clones across the six moisture levels. The near-term goal was to provide a mechanistic basis for clonal differences in productivity under various irrigation treatments over time.

Rapid Tooling for Functional Prototype of Metal Mold Processes Final Report CRADA No. TC-1032-98

Energy Technology Data Exchange (ETDEWEB)

Heestand, G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jaskolski, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-16

Production inserts for die-casting were generally fabricated from materials with sufficient strength and· good wear properties at casting temperatures for long life. Frequently tool steels were used and machining was done with a combination of. conventional and Electric Discharge Machining (EDM) with some handwork, an expensive and time consuming process, partilly for prototype work. We proposed electron beam physical vapor deposition (EBPVD) as a process for rapid fabrication of dies. Metals, ranging from low melting point to refractory metals (Ta, Mo, etc.), would be evaporated and deposited at high rates (-2mm/hr.). Alloys could be easily evaporated and deposited if their constituent vapor pressures were similar and with more difficulty if they were not. Of course, layering of different materials was possible if required for a specific application. For example, a hard surface layer followed by a tough steel and backed by a high thermal conductivity (possibly cooled) copper layer could be fabricated. Electron-beam deposits exhibited 100% density and lull strength when deposited at a substrate (mandrel) temperature that was a substantial fraction of the deposited material's melting point. There were several materials that could have the required high temperature properties and ease of fabrication required for such a mandrel. We had successfully used graphite, machined from free formed objects with a replicator, to produce aluminum-bronze test molds. There were several parting layer materials of interest, but the ideal material depended upon the specific application.

Heavy-duty diesel engine NO{sub x} reduction with nitrogen-enriched combustion air. Final CRADA report.

Energy Technology Data Exchange (ETDEWEB)

McConnell, S.; Energy Systems

2010-07-28

The concept of engine emissions control by modifying intake combustion gas composition from that of ambient air using gas separation membranes has been developed during several programs undertaken at Argonne. These have led to the current program which is targeted at heavy-duty diesel truck engines. The specific objective is reduction of NO{sub x} emissions by the target engine to meet anticipated 2007 standards while extracting a maximum of 5 percent power loss and allowing implementation within commercial constraints of size, weight, and cost. This report includes a brief review of related past programs, describes work completed to date during the current program, and presents interim conclusions. Following a work schedule adjustment in August 2002 to accommodate problems in module procurement and data analysis, activities are now on schedule and planned work is expected to be completed in September, 2004. Currently, we believe that the stated program requirements for the target engine can be met, based upon extrapolation of the work completed. Planned project work is designed to experimentally confirm these projections and result in a specification for a module package that will meet program objectives.

Compiling for Application Specific Computational Acceleration in Reconfigurable Architectures Final Report CRADA No. TSB-2033-01

Energy Technology Data Exchange (ETDEWEB)

De Supinski, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Caliga, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-28

The primary objective of this project was to develop memory optimization technology to efficiently deliver data to, and distribute data within, the SRC-6's Field Programmable Gate Array- ("FPGA") based Multi-Adaptive Processors (MAPs). The hardware/software approach was to explore efficient MAP configurations and generate the compiler technology to exploit those configurations. This memory accessing technology represents an important step towards making reconfigurable symmetric multi-processor (SMP) architectures that will be a costeffective solution for large-scale scientific computing.

Biodiesel Performance with Modern Engines. Cooperative Research and Development Final Report, CRADA Number CRD-05-153

Energy Technology Data Exchange (ETDEWEB)

McCormick, Robert [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2016-01-29

NREL and the National Biodiesel Board (NBB) will work cooperatively to assess the effects of biodiesel blends on the performance of modern diesel engines and emissions control systems meeting increasingly strict emissions standards. This work will include research to understand the impact of biodiesel blends on the operation and durability of particle filters and NOx control sorbents/catalysts, to quantify the effect on emission control systems performance, and to understand effects on engine component durability. Work to assess the impact of biodiesel blends on real world fleet operations will be performed. Also, research to develop appropriate ASTM standards for biodiesel quality and stability will be conducted. The cooperative project will involve engine testing and fleet evaluation studies at NREL using biodiesel from a variety of sources. In addition, NREL will work with NBB to set up an Industrial Steering Committee to design the scope for the various projects and to provide technical oversight to these projects. NREL and NBB will cooperatively communicate the study results to as broad an audience as possible.

Sorghum to Ethanol Research Initiative: Cooperative Research and Development Final Report, CRADA Number CRD-08-291

Energy Technology Data Exchange (ETDEWEB)

Wolfrum, E.

2011-10-01

The goal of this project was to investigate the feasibility of using sorghum to produce ethanol. The work performed included a detailed examination of the agronomics and composition of a large number of sorghum varieties, laboratory experiments to convert sorghum to ethanol, and economic and life-cycle analyses of the sorghum-to-ethanol process. This work showed that sorghum has a very wide range of composition, which depended on the specific sorghum cultivar as well as the growing conditions. The results of laboratory- and pilot-scale experiments indicated that a typical high-biomass sorghum variety performed very similarly to corn stover during the multi-step process required to convert biomass feedstocks to ethanol; yields of ethanol for sorghum were very similar to the corn stover used as a control in these experiments. Based on multi-year agronomic data and theoretical ethanol production, sorghum can achieve more than 1,300 gallons of ethanol per acre given the correct genetics and environment. In summary, sorghum may be a compelling dedicated bioenergy crop that could help provide a portion of the feedstocks required to produce renewable domestic transportation fuels.

A Portable Cell Maintenance System for Rapid Toxicity Monitoring Final Report CRADA No. TC-02081-04

Energy Technology Data Exchange (ETDEWEB)

Kane, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Zhou, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-27

The Phase I STTR research project was targeted at meeting the objectives and requirements stated in STTR solicitation A04-T028 for a Portable Cell Maintenance System for Rapid Toxicity Monitoring. In accordance with the requirements for STTR programs, collaboration was formed between a small business, Kionix, Inc., and The Regents of the University of California, Lawrence Livermore National Laboratory (LLNL). The collaboration included CytoDiscovery, Inc. (CDI) which, in collaboration with Kionix, provided access to membrane chip technology and provided program support and coordination. The objective of the overall program (excerpted from the original solicitation) was: “To develop a small, portable cell maintenance system for the transport, storage, and monitoring of viable vertebrate cells and tissues.” The goal of the Phase I project was to demonstrate the feasibility of achieving the program objectives utilizing a system comprised of a small-size, microfluidic chip-based cell maintenance cartridge (CMC) and a portable cell maintenance system (CMS) capable of housing a minimum of four CMCs. The system was designed to be capable of optimally maintaining multiple vertebrate cell types while supporting a wide variety of cellular assays.

Phase II, Compact AMS System for Biological Tracer Detection Final Report CRADA No. TSV-1533-96

Energy Technology Data Exchange (ETDEWEB)

Brown, T. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hamm, R. W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-11-01

The objective of this collaboration between LLNL and AccSys Technology, Inc. of Pleasanton, California was to build and demonstrate a low cost, compact tritium (3H) Accelerator Mass Spectrometer (AMS) system matched to the requirements of biomedical research.

Phase II: Automated System for Aneuploidy Detection in Sperm Final Report CRADA No. TC-1554-98

Energy Technology Data Exchange (ETDEWEB)

Wyrobek, W. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Dunlay, R. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-28

This was a collaborative effort between the University of California, Lawrence Livermore National Laboratory (LLNL) and Cellomics, Inc. (formerly BioDx and Biological Detection, Inc.) to develop an automated system for detecting human sperm aneuploidy. Aneuploidy (an abnormal number of chromosomes) is one of the major categories of chromosomally abnormal sperm, which results in chromosomally defective pregnancies and babies. An automated system would be used for testing the effects of toxic agents and for other research and clinical applications. This collaborated effort was funded by a National Institutes of Environmental Health Services, Phase II, Small Business Innovation Research Program (SBIR) grant to Cellornics (Contract No. N44-ES-82004).

Accelerator-Detector Complex for Photonuclear Detection of Hidden Explosives Final Report CRADA No. TC2065.0

Energy Technology Data Exchange (ETDEWEB)

Lowdermilk, W. H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Brothers, L. J. [Valley Forge Composite Technologies, Inc., Covington, KY (United States)

2017-09-06

This was a collaborative effort by Lawrence Livermore National Security (formerly the University of California)/Lawrence Livermore National Laboratory (LLNL), Valley Forge Composite Technologies, Inc., and the following Russian Institutes: P. N. Lebedev Physical Institute (LPI), Innovative Technologies Center.(AUO CIT), Central Design Bureau-Almas (CDB Almaz), Moscow Instrument Automation Research Institute, and Institute for High Energy Physics (IBEP) to develop equipment and procedures for detecting explosive materials concealed in airline checked baggage and cargo.

Process Parameter Evaluation and Optimization for Advanced Material Development Final Report CRADA No. TC-1234-96

Energy Technology Data Exchange (ETDEWEB)

Hrubesh, L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McGann, T. W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-19

This project was established as a three-year collaboration to produce and characterize · silica aerogels prepared by a Rapid Supercritical Extraction (RSCE) process to meet . BNA, Inc. application requirements. The objectives of this project were to study the parameters necessary to produce optimized aerogel parts with narrowly specified properties and establish the range and limits of the process for producing such aerogels. The project also included development of new aerogel materials useful for high temperature applications. The results of the project were expected to set the conditions necessary to produce quantities of aerogels having particular specifications such as size, shape, density, and mechanical strength. BNA, Inc. terminated the project on April 7, 1999, 10-months prior to the anticipated completion date, due to termination of corporate funding for the project. The technical accomplishments achieved are outlined in Paragraph C below.

Flow Visualization Studies in the Novacor Left Ventricular Assist System CRADA PC91-002, Final Report

Energy Technology Data Exchange (ETDEWEB)

Borovetz, H.S.; Shaffer, F.; Schaub, R.; Lund, L.; Woodard, J.

1999-01-01

This paper discusses a series of experiments to visualize and measure flow fields in the Novacor left ventricular assist system (LVAS). The experiments utilize a multiple exposure, optical imaging technique called fluorescent image tracking velocimetry (FITV) to hack the motion of small, neutrally-buoyant particles in a flowing fluid.

Manufacturing Steps for Commercial Production of Nano-Structure Capacitors Final Report CRADA No. TC02159.0

Energy Technology Data Exchange (ETDEWEB)

Barbee, T. W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Schena, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-29

This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and TroyCap LLC, to develop manufacturing steps for commercial production of nano-structure capacitors. The technical objective of this project was to demonstrate high deposition rates of selected dielectric materials which are 2 to 5 times larger than typical using current technology.

Computational fluid dynamics modeling of two-phase flow in a BWR fuel assembly. Final CRADA Report

International Nuclear Information System (INIS)

Tentner, A.

2009-01-01

A direct numerical simulation capability for two-phase flows with heat transfer in complex geometries can considerably reduce the hardware development cycle, facilitate the optimization and reduce the costs of testing of various industrial facilities, such as nuclear power plants, steam generators, steam condensers, liquid cooling systems, heat exchangers, distillers, and boilers. Specifically, the phenomena occurring in a two-phase coolant flow in a BWR (Boiling Water Reactor) fuel assembly include coolant phase changes and multiple flow regimes which directly influence the coolant interaction with fuel assembly and, ultimately, the reactor performance. Traditionally, the best analysis tools for this purpose of two-phase flow phenomena inside the BWR fuel assembly have been the sub-channel codes. However, the resolution of these codes is too coarse for analyzing the detailed intra-assembly flow patterns, such as flow around a spacer element. Advanced CFD (Computational Fluid Dynamics) codes provide a potential for detailed 3D simulations of coolant flow inside a fuel assembly, including flow around a spacer element using more fundamental physical models of flow regimes and phase interactions than sub-channel codes. Such models can extend the code applicability to a wider range of situations, which is highly important for increasing the efficiency and to prevent accidents.

CRADA Final Report For CRADA NO. CR-12-006 [Operation and Testing of an SO2-depolarized Electrolyzer (SDE) for the Purpose of Hydrogen and Sulfuric Acid Production

International Nuclear Information System (INIS)

Summers, W. A.; Colon-Mercado, H. R.; Steimke, J. L.; Zahn, Steffen

2014-01-01

Over the past several years, Savannah River National Laboratory (SRNL) has led a team of collaborators under the Department of Energy's (DOE) nuclear hydrogen production program to develop the Hybrid Sulfur (HyS) Process. HyS is a 2-step water-splitting process consisting of high temperature decomposition of sulfuric acid to generate SO 2 , followed by the electrolysis of aqueous SO 2 to generate hydrogen and sulfuric acid. The latter is fed back into the high temperature reactor. SRNL designed and built an SO 2 -depolarized electrolyzer (SDE) and a test facility. Over 40 SDE's were tested using different catalysts, membranes and other components. SRNL demonstrated that an SDE could be operated continuously for approximately 200 hours under certain conditions without buildup of sulfur at the SDE's cathode, thus solving a key technical problem with SDE technology. Air Products and Chemicals, Inc. (APCI) is a major supplier of hydrogen production systems, and they have proprietary technology that could benefit from the SDE developed by SRNS, or some improved version thereof. However, to demonstrate that SRNL's SDE is a truly viable approach to the electrolyzer design, continuous operation for far greater periods of time than 200 hours must be demonstrated, and the electrolyzer must be scaled up to greater hydrogen production capacities. SRNL and Air Products entered into a Cooperative Research and Development Agreement with the objective of demonstrating the effectiveness of the SDE for hydrogen and sulfuric acid production and to demonstrate long-term continuous operation so as to dramatically increase the confidence in the SDE design for commercial operation. SRNL prepared a detailed technical report documenting previous SDE development, including the current SDE design and operating conditions that led to the 200-hour sulfurfree testing. SRNL refurbished its single cell SDE test facility and qualified the equipment for continuous operation. A new membrane electrode assembly (MEA) was fabricated and installed in the single cell electrolyzer (60 cm 2 active cell area). Shakedown testing was conducted, and several modifications were made to the test facility equipment. Seven different MEAs were used during testing. Beginning on May 20, 2013, SRNL was able to test the SDE continuously for 1200 hours, including 1000 hours under power to generate hydrogen at an average rate of 10.8 liters per hour. The SDE was not removed or repaired during the 50-day test and was successfully restarted after each shutdown. The test was intentionally stopped after 1200 hours (1000 hours of hydrogen production) due to funding constraints. Post-test examination of the MEA using Scanning Electron Microscopy (SEM) and Energy Dispersive X-ray Microanalysis (EDAX) showed no elemental sulfur deposits or sulfur layer inside the cell, thus successfully achieving the test goals. The results demonstrated that the SDE could be operated for extended periods without major performance degradation or the buildup of sulfur inside the MEA. Air Products conducted an assessment of the economic viability of the SDE based on the ''as tested'' design. The results indicated that the SDE faces significant economic obstacles in its current state. Further development and scale-up are necessary before the SDE is ready for commercialization

Long-term surveillance plan for the Shiprock Disposal site, Shiprock, New Mexico

International Nuclear Information System (INIS)

1994-09-01

The long-term surveillance plan (LTSP) for the Shiprock, New Mexico, Uranium Mill Tailings Remedial Action (UMTRA) Project disposal site describes the surveillance activities for the Shiprock disposal cell. The U.S. Department of Energy (DOE) will carry out these activities to ensure that the disposal cell continues to function as designed. This final LTSP was prepared as a requirement for acceptance under the U.S. Nuclear Regulatory Commission (NRC) general license for custody and long-term care of residual radioactive materials (RRM). This LTSP documents the land ownership interests and details how the long-term care of the disposal site will be carried out. It is based on the DOE's Guidance for Implementing the UMTRA Project Long-term Surveillance Program (DOE, 1992a)

Hybrid RRM Architecture for Future Wireless Networks

DEFF Research Database (Denmark)

Tragos, Elias; Mihovska, Albena D.; Mino, Emilio

2007-01-01

The concept of ubiquitous and scalable system is applied in the IST WINNER II [1] project to deliver optimum performance for different deployment scenarios from local area to wide area wireless networks. The integration of cellular and local area networks in a unique radio system will provide a g...

Dual shell pressure balanced reactor vessel. Final project report

International Nuclear Information System (INIS)

Robertus, R.J.; Fassbender, A.G.

1994-10-01

The Department of Energy's Office of Energy Research (OER) has previously provided support for the development of several chemical processes, including supercritical water oxidation, liquefaction, and aqueous hazardous waste destruction, where chemical and phase transformations are conducted at high pressure and temperature. These and many other commercial processes require a pressure vessel capable of operating in a corrosive environment where safety and economy are important requirements. Pacific Northwest Laboratory (PNL) engineers have recently developed and patented (U.S. patent 5,167,930 December 1, 1992) a concept for a novel Dual Shell Pressure Balanced Vessel (DSPBV) which could solve a number of these problems. The technology could be immediately useful in continuing commercialization of an R ampersand D 100 award-winning technology, Sludge-to-oil Reactor System (STORS), originally developed through funding by OER. Innotek Corporation is a small business that would be one logical end-user of the DSPBV reactor technology. Innotek is working with several major U.S. engineering firms to evaluate the potential of this technology in the disposal of wastes from sewage treatment plants. PNL entered into a CRADA with Innotek to build a bench-scale demonstration reactor and test the system to advance the economic feasibility of a variety of high pressure chemical processes. Hydrothermal processing of corrosive substances on a large scale can now be made significantly safer and more economical through use of the DSPBV. Hydrothermal chemical reactions such as wet-air oxidation and supercritical water oxidation occur in a highly corrosive environment inside a pressure vessel. Average corrosion rates from 23 to 80 miles per year have been reported by Rice (1994) and Latanision (1993)

Cost Effective Bioethanol via Acid Pretreatment of Corn Stover, Saccharification, and Conversion via a Novel Fermentation Organism: Cooperative Research and Development Final Report, CRADA Number: CRD-12-485

Energy Technology Data Exchange (ETDEWEB)

Dowe, N.

2014-05-01

This research program will convert acid pretreated corn stover to sugars at the National Renewable Energy Laboratory (NREL) and then transfer these sugars to Honda R&D and its partner the Green Earth Institute (GEI) for conversion to ethanol via a novel fermentation organism. In phase one, NREL will adapt its pretreatment and saccharification process to the unique attributes of this organism, and Honda R&D/GEI will increase the sugar conversion rate as well as the yield and titer of the resulting ethanol. In later phases, NREL, Honda R&D, and GEI will work together at NREL to optimize and scale-up to pilot-scale the Honda R&D/GEI bioethanol production process. The final stage will be to undertake a pilot-scale test at NREL of the optimized bioethanol conversion process.

48 CFR 970.5227-3 - Technology transfer mission.

Science.gov (United States)

2010-10-01

... consistent with the missions of the Laboratory; except that such term does not include a procurement contract... substantial interest in the preparation, negotiation, or approval of the CRADA; (2) receives a gift or...

78 FR 8546 - National Center for Advancing Translational Sciences (NCATS) and National Human Genome Research...

Science.gov (United States)

2013-02-06

... March 8, 2013 for consideration. Guidelines for the preparation of a full CRADA proposal will be... recapitulates the pathologic hallmarks of Gaucher disease,'' Panicker LM, Miller D, Park TS, Patel B, Azevedo JL...

Technology Transfer Policy Applied to the U.S. Army Military History Institute Collection

National Research Council Canada - National Science Library

Bell, William

1998-01-01

.... This cooperative process is called technology transfer. The main point of the laws is to allow commercial vendors and the organizations of the federal government to enter into cooperative research and development agreements (CRADAs...

Remedial action plan and site design for stabilization of the inactive uranium mill tailings sites at Slick Rock, Colorado: Remedial Action Selection Report. Preliminary final

Energy Technology Data Exchange (ETDEWEB)

1994-03-01

This proposed remedial action plan incorporates the results of detailed investigation of geologic, geomorphic, and seismic conditions at the proposed disposal site. The proposed remedial action will consist of relocating the uranium mill tailings, contaminated vicinity property materials, demolition debris, and windblown/waterborne materials to a permanent repository at the proposed Burro Canyon disposal cell. The proposed disposal site will be geomorphically stable. Seismic design parameters were developed for the geotechnical analyses of the proposed cell. Cell stability was analyzed to ensure long-term performance of the disposal cell in meeting design standards, including slope stability, settlement, and liquefaction potential. The proposed cell cover and erosion protection features were also analyzed and designed to protect the RRM (residual radioactive materials) against surface water and wind erosion. The location of the proposed cell precludes the need for permanent drainage or interceptor ditches. Rock to be used on the cell top-, side-, and toeslopes was sized to withstand probable maximum precipitation events.

Mitigation action plan for remedial action at the Uranium Mill Tailing Sites and Disposal Site, Rifle, Colorado

International Nuclear Information System (INIS)

1992-07-01

The Estes Gulch disposal site is approximately 10 kilometers (6 miles) north of the town of Rifle, off State Highway 13 on Federal land administered by the Bureau of Land Management. The Department of Energy (DOE) will transport the residual radioactive materials (RRM) by truck to the Estes Gulch disposal site via State Highway 13 and place it in a partially below-grade disposal cell. The RRM will be covered by an earthen radon barrier, frost protection layers, and a rock erosion protection layer. A toe ditch and other features will also be constructed to control erosion at the disposal site. After removal of the RRM and disposal at the Estes Gulch site, the disturbed areas at all three sites will be backfilled with clean soils, contoured to facilitate surface drainage, and revegetated. Wetlands areas destroyed at the former Rifle processing sites will be compensated for by the incorporation of now wetlands into the revegetation plan at the New Rifle site. The UMTRA Project Office, supported by the Remedial Action Contractor (RAC) and the Technical Assistance Contractor (TAC), oversees the implementation of the MAP. The RAC executes mitigation measures in the field. The TAC provides monitoring of the mitigation actions in cases where mitigation measures are associated with design features. Site closeout and inspection compliance will be documented in the site completion report

Yeast eIF4B binds to the head of the 40S ribosomal subunit and promotes mRNA recruitment through its N-terminal and internal repeat domains.

Science.gov (United States)

Walker, Sarah E; Zhou, Fujun; Mitchell, Sarah F; Larson, Victoria S; Valasek, Leos; Hinnebusch, Alan G; Lorsch, Jon R

2013-02-01

Eukaryotic translation initiation factor (eIF)4B stimulates recruitment of mRNA to the 43S ribosomal pre-initiation complex (PIC). Yeast eIF4B (yeIF4B), shown previously to bind single-stranded (ss) RNA, consists of an N-terminal domain (NTD), predicted to be unstructured in solution; an RNA-recognition motif (RRM); an unusual domain comprised of seven imperfect repeats of 26 amino acids; and a C-terminal domain. Although the mechanism of yeIF4B action has remained obscure, most models have suggested central roles for its RRM and ssRNA-binding activity. We have dissected the functions of yeIF4B's domains and show that the RRM and its ssRNA-binding activity are dispensable in vitro and in vivo. Instead, our data indicate that the 7-repeats and NTD are the most critical domains, which mediate binding of yeIF4B to the head of the 40S ribosomal subunit via interaction with Rps20. This interaction induces structural changes in the ribosome's mRNA entry channel that could facilitate mRNA loading. We also show that yeIF4B strongly promotes productive interaction of eIF4A with the 43S•mRNA PIC in a manner required for efficient mRNA recruitment.

DES meets Gaia: discovery of strongly lensed quasars from a multiplet search

Energy Technology Data Exchange (ETDEWEB)

Agnello, A.; et al.

2017-11-10

We report the discovery, spectroscopic confirmation and first lens models of the first two, strongly lensed quasars from a combined search in WISE and Gaia over the DES footprint. The four-image lensWGD2038-4008 (r.a.=20:38:02.65, dec.=-40:08:14.64) has source- and lens-redshifts $z_{s}=0.777 \\pm 0.001$ and $z_l = 0.230 \\pm 0.002$ respectively. Its deflector has effective radius $R_{\\rm eff} \\approx 3.4^{\\prime\\prime}$, stellar mass $\\log(M_{\\star}/M_{\\odot}) = 11.64^{+0.20}_{-0.43}$, and shows extended isophotal shape variation. Simple lens models yield Einstein radii $R_{\\rm E}=(1.30\\pm0.04)^{\\prime\\prime},$ axis ratio $q=0.75\\pm0.1$ (compatible with that of the starlight) and considerable shear-ellipticity degeneracies. The two-image lensWGD2021-4115 (r.a.=20:21:39.45, dec.=--41:15:57.11) has $z_{s}=1.390\\pm0.001$ and $z_l = 0.335 \\pm 0.002$, and Einstein radius $R_{\\rm E} = (1.1\\pm0.1)^{\\prime\\prime},$ but higher-resolution imaging is needed to accurately separate the deflector and faint quasar image. We also show high-rank candidate doubles selected this way, some of which have been independently identified with different techniques, and discuss a DES+WISE quasar multiplet selection.

Estimation of Genetic Parameters for First Lactation Monthly Test-day Milk Yields using Random Regression Test Day Model in Karan Fries Cattle

Directory of Open Access Journals (Sweden)

Ajay Singh

2016-06-01

Full Text Available A single trait linear mixed random regression test-day model was applied for the first time for analyzing the first lactation monthly test-day milk yield records in Karan Fries cattle. The test-day milk yield data was modeled using a random regression model (RRM considering different order of Legendre polynomial for the additive genetic effect (4th order and the permanent environmental effect (5th order. Data pertaining to 1,583 lactation records spread over a period of 30 years were recorded and analyzed in the study. The variance component, heritability and genetic correlations among test-day milk yields were estimated using RRM. RRM heritability estimates of test-day milk yield varied from 0.11 to 0.22 in different test-day records. The estimates of genetic correlations between different test-day milk yields ranged 0.01 (test-day 1 [TD-1] and TD-11 to 0.99 (TD-4 and TD-5. The magnitudes of genetic correlations between test-day milk yields decreased as the interval between test-days increased and adjacent test-day had higher correlations. Additive genetic and permanent environment variances were higher for test-day milk yields at both ends of lactation. The residual variance was observed to be lower than the permanent environment variance for all the test-day milk yields.

Galfenol Energy Harvesting Device Proposal

Energy Technology Data Exchange (ETDEWEB)

Lograsso, Thomas [Ames Lab., Ames, IA (United States); Jones, Lawrence [Ames Lab., Ames, IA (United States); Xing, Qingfeng [Ames Lab., Ames, IA (United States)

2016-06-29

This CRADA involved an integrated approach of synthesizing Fe-Ga (Galfenol) powder using high-pressure gas atomization (HPGA) and 3D printing via laser engineered net shaping (LENS) processing to produce free standing magnetostricitve sensors.

The tip of the iceberg: RNA-binding proteins with prion-like domains in neurodegenerative disease

Science.gov (United States)

King, Oliver D.; Gitler, Aaron D.; Shorter, James

2012-01-01

Prions are self-templating protein conformers that are naturally transmitted between individuals and promote phenotypic change. In yeast, prion-encoded phenotypes can be beneficial, neutral or deleterious depending upon genetic background and environmental conditions. A distinctive and portable ‘prion domain’ enriched in asparagine, glutamine, tyrosine and glycine residues unifies the majority of yeast prion proteins. Deletion of this domain precludes prionogenesis and appending this domain to reporter proteins can confer prionogenicity. An algorithm designed to detect prion domains has successfully identified 19 domains that can confer prion behavior. Scouring the human genome with this algorithm enriches a select group of RNA-binding proteins harboring a canonical RNA recognition motif (RRM) and a putative prion domain. Indeed, of 210 human RRM-bearing proteins, 29 have a putative prion domain, and 12 of these are in the top 60 prion candidates in the entire genome. Startlingly, these RNA-binding prion candidates are inexorably emerging, one by one, in the pathology and genetics of devastating neurodegenerative disorders, including: amyotrophic lateral sclerosis (ALS), frontotemporal lobar degeneration with ubiquitin-positive inclusions (FTLD-U), Alzheimer’s disease and Huntington’s disease. For example, FUS and TDP-43, which rank 1st and 10th among RRM-bearing prion candidates, form cytoplasmic inclusions in the degenerating motor neurons of ALS patients and mutations in TDP-43 and FUS cause familial ALS. Recently, perturbed RNA-binding proteostasis of TAF15, which is the 2nd ranked RRM-bearing prion candidate, has been connected with ALS and FTLD-U. We strongly suspect that we have now merely reached the tip of the iceberg. We predict that additional RNA-binding prion candidates identified by our algorithm will soon surface as genetic modifiers or causes of diverse neurodegenerative conditions. Indeed, simple prion-like transfer mechanisms involving the

Biological assessment of remedial action at the abandoned uranium mill tailings site near Naturita, Colorado

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-03-01

Pursuant to the Uranium Mill Tailings Radiation Control Act (UMTRCA) of 1978, the U.S. Department of Energy (DOE) is proposing to conduct remedial action to clean up the residual radioactive materials (RRM) at the Naturita uranium processing site in Colorado. The Naturita site is in Montrose County, Colorado, and is approximately 2 miles (mi) (3 kilometer [km]) from the unincorporated town of Naturita. The proposed remedial action is to remove the RRM from the Naturita site to the Upper Burbank Quarry at the Uravan disposal site. To address the potential impacts of the remedial action on threatened and endangered species, the DOE prepared this biological assessment. Informal consultations with the U.S. Department of the Interior, Fish and Wildlife Service (FWS) were initiated in 1986, and the FWS provided a list of the threatened and endangered species that may occur in the Naturita study area. This list was updated by two FWS letters in 1988 and by verbal communication in 1990. A biological assessment was included in the environmental assessment (EA) of the proposed remedial action that was prepared in 1990. This EA addressed the impacts of moving the Naturita RRM to the Dry Flats disposal site. In 1993, the design for the Dry Flats disposal alternative was changed. The FWS was again consulted in 1993 and provided a new list of threatened and endangered species that may occur in the Naturita study area. The Naturita EA and the biological assessment were revised in response to these changes. In 1994, remedial action was delayed because an alternate disposal site was being considered. The DOE decided to move the FIRM at the Naturita site to the Upper Burbank Quarry at the Uravan site. Due to this delay, the FWS was consulted in 1995 and a list of threatened and endangered species was provided. This biological assessment is a revision of the assessment attached to the Naturita EA and addresses moving the Naturita RRM to the Upper Burbank Quarry disposal site.

Automated tools for cross-referencing large databases. Final report

Energy Technology Data Exchange (ETDEWEB)

Clapp, N E; Green, P L; Bell, D [and others

1997-05-01

A Cooperative Research and Development Agreement (CRADA) was funded with TRESP Associates, Inc., to develop a limited prototype software package operating on one platform (e.g., a personal computer, small workstation, or other selected device) to demonstrate the concepts of using an automated database application to improve the process of detecting fraud and abuse of the welfare system. An analysis was performed on Tennessee`s welfare administration system. This analysis was undertaken to determine if the incidence of welfare waste, fraud, and abuse could be reduced and if the administrative process could be improved to reduce benefits overpayment errors. The analysis revealed a general inability to obtain timely data to support the verification of a welfare recipient`s economic status and eligibility for benefits. It has been concluded that the provision of more modern computer-based tools and the establishment of electronic links to other state and federal data sources could increase staff efficiency, reduce the incidence of out-of-date information provided to welfare assistance staff, and make much of the new data required available in real time. Electronic data links have been proposed to allow near-real-time access to data residing in databases located in other states and at federal agency data repositories. The ability to provide these improvements to the local office staff would require the provision of additional computers, software, and electronic data links within each of the offices and the establishment of approved methods of accessing remote databases and transferring potentially sensitive data. In addition, investigations will be required to ascertain if existing laws would allow such data transfers, and if not, what changed or new laws would be required. The benefits, in both cost and efficiency, to the state of Tennessee of having electronically-enhanced welfare system administration and control are expected to result in a rapid return of investment.

GREEN REACTION CHEMISTRIES PERFORMED IN THE SST REACTOR

Science.gov (United States)

The U. S. Environmental Protection Agency (USEPA) and Kreido Laboratories have established a Cooperative Research and Development Agreement (CRADA) collaboration, to develop and commercialize green and sustainable chemistries in the area of industrial chemical synthesis. Uti...

GREEN REACTION CHEMISTRIES PERFORMED IN THE SPINNING TUBE-IN-TUBE (STT) REACTOR

Science.gov (United States)

The U. S. Environmental Protection Agency (USEPA) and Kreido Laboratories have established a Cooperative Research and Development Agreement (CRADA) collaboration, to develop and commercialize green and sustainable chemistries in the area of industrial chemical synthesis. Utilizi...

Ion Implantation Processing Technologies for Telecommunications Electronics

Energy Technology Data Exchange (ETDEWEB)

Haynes, T E

2000-05-01

The subject CRADA was a collaboration between Oak Ridge National Laboratory and Bell Laboratories, Lucent Technologies (formerly AT and T Bell Laboratories) to explore the development of ion implantation technologies for silicon integrated circuit (IC) manufacturing.

UMTRA Surface Project management action process document: Final. Revision 2

International Nuclear Information System (INIS)

1996-06-01

Title 1 of the UMTRCA authorized the DOE to undertake remedial actions at these designed sites and associated vicinity properties (VP), which contain uranium mill tailings and other residual radioactive materials (RRM) derived from the processing sites. Title 2 of the UMTRCA addresses uranium mill sites that were licensed at the time the UMTRCA was enacted. Cleanup of these Title 2 sites is the responsibility of the licensees. The cleanup of the Title 1 sites has been split into two separate projects: the Surface Project, which deals with the mill buildings, tailings, and contaminated soils at the sites and VPs; and the Ground Water Project, which is limited to the contaminated ground water at the sites. This management action process (MAP) document discusses the Uranium Mill Tailings Remedial Action (UMTRA) Surface Project. Since its inception through March 1996, the Surface Project (hereinafter called the Project) has cleaned up 16 of the 24 designated processing sites and approximately 5,000 VPs, reducing the risk to human health and the environment posed by the uranium mill tailings. Two of the 24 sites, Belfield and Bowman, North Dakota, will not be remediated at the request of the state, reducing the total number of sites to 22. By the start of FY1998, the remaining 6 processing sites and associated VPs will be cleaned up. The remedial action activities to be funded in FY1998 by the FY1998 budget request are remediation of the remaining Grand Junction, Colorado, VPs; closure of the Cheney disposal cell in Grand Junction, Colorado; and preparation of the completion reports for 4 completed sites

UMTRA Surface Project management action process document: Final. Revision 2

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-06-01

Title 1 of the UMTRCA authorized the DOE to undertake remedial actions at these designed sites and associated vicinity properties (VP), which contain uranium mill tailings and other residual radioactive materials (RRM) derived from the processing sites. Title 2 of the UMTRCA addresses uranium mill sites that were licensed at the time the UMTRCA was enacted. Cleanup of these Title 2 sites is the responsibility of the licensees. The cleanup of the Title 1 sites has been split into two separate projects: the Surface Project, which deals with the mill buildings, tailings, and contaminated soils at the sites and VPs; and the Ground Water Project, which is limited to the contaminated ground water at the sites. This management action process (MAP) document discusses the Uranium Mill Tailings Remedial Action (UMTRA) Surface Project. Since its inception through March 1996, the Surface Project (hereinafter called the Project) has cleaned up 16 of the 24 designated processing sites and approximately 5,000 VPs, reducing the risk to human health and the environment posed by the uranium mill tailings. Two of the 24 sites, Belfield and Bowman, North Dakota, will not be remediated at the request of the state, reducing the total number of sites to 22. By the start of FY1998, the remaining 6 processing sites and associated VPs will be cleaned up. The remedial action activities to be funded in FY1998 by the FY1998 budget request are remediation of the remaining Grand Junction, Colorado, VPs; closure of the Cheney disposal cell in Grand Junction, Colorado; and preparation of the completion reports for 4 completed sites.

Structural study of the Fox-1 RRM protein hydration reveals a role for key water molecules in RRM-RNA recognition

Czech Academy of Sciences Publication Activity Database

Krepl, Miroslav; Blatter, M.; Clery, A.; Damberger, F.F.; Allain, F.H.T.; Šponer, Jiří

2017-01-01

Roč. 45, č. 13 (2017), s. 8046-8063 ISSN 0305-1048 R&D Projects: GA ČR(CZ) GBP305/12/G034 Institutional support: RVO:68081707 Keywords : dynamics simulations * nucleic-acids * crystal-structures Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 10.162, year: 2016

Development of Electrodeposited CIGS Solar Cells: Cooperative Research and Development Final Report, CRADA Number CRD-09-357

Energy Technology Data Exchange (ETDEWEB)

Neale, Nathan [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2016-09-01

At present, most PV materials are fabricated by vacuum technologies. Some of the many disadvantages of vacuum technology are complicated instrumentation, material waste, high cost of deposition per surface area, and instability of some compounds at the deposition temperature. Solution-based approaches for thin-film deposition on large areas are particularly desirable because of the low capital cost of the deposition equipment, relative simplicity of the processes, ease of doping, uniform deposition on a variety of substrates (including interior and exterior of tubes and various nonplanar devices), and potential compatibility with high-throughput (e.g., roll-to-roll) processing. Of the nonsilicon solar photovoltaic device modules that have been deployed to date, those based on the n-CdS/p-CdTe is a leading candidate. Two features in the optical characteristics of CdTe absorber are particularly attractive for photovoltaic conversion of sunlight; (a) its energy bandgap of 1.5 eV, which provides an optimal match with the solar spectrum and thus facilitates its efficient utilization and (b) the direct mode of the main optical transition which results in a large absorption coefficient and turn permits the use of thin layer (1-2 um) of active material. Thin films of CdTe required for these devices have been fabricated by a variety of methods (e.g., vapor transport deposition, vacuum deposition, screen printing and close-spaced sublimation). Electrodeposition is another candidate deserves more attention. This project will focus on delivering low-cost, high efficiency electrodeposited CdTe-based device.

Automated System for Aneuploidy Detection in Sperm Final Report CRADA No. TC-1364-96: Phase I SBIR

Energy Technology Data Exchange (ETDEWEB)

Wyrobek, A. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Dunlay, R. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-19

This project was a relationship between Lawrence Livermore National Laboratory (LLNL) and Biological Detection, Inc. (now known as Cellomics, Inc.) It was funded as a Phase I SBIR from the National Institutes of Health (NIH) awarded to Cellomics, Inc. with a subcontract to LLNL.

Sperm Scoring Using Multi-Spectral Flow Imaging and FISH-IS Final Report CRADA No. TC02088.0

Energy Technology Data Exchange (ETDEWEB)

Marchetti, F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Morrissey, P. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-27

This was to be a collaborative effort between The Regents of the University of California, Lawrence Livermore National Laboratory (LLNL) and Amnis Corporation, to develop an automated system for scoring sperm interphase cells for the presence of chromosomal abnormalities using fluorescence in situ hybridization and the Amnis ImageStream technology platform.

Projecting Fatalities in Crashes Involving Older Drivers, 2000–2025, CRADA No. ORNL98-0500 Final Report

Energy Technology Data Exchange (ETDEWEB)

Hu, Patricia S. [ORNL; Jones, Donald W. [ORNL; Reuscher, Timothy [Oak Ridge Institute for Science and Education; Schmoyer, Richard S. [ORNL; Truett, Lorena F. [ORNL

2000-04-01

At the turn of the century – the 20th century that is – the median age in the United States was under 30 years; America was 60% rural in nature; and there were only 36 highway fatalities all year. As we leave the 20th century behind, the route into the 21st century is very different. “Intelligent” cars speed down multi-lane “smart” highways in a nation that is 75% urban. According to the Federal Highway Administration’s Highway Statistics, there are 28,000 times more vehicles on the road in 2000 than there were in 1900, and these vehicles travel about 2.6 trillion miles each year. Annual fatalities resulting from highway crashes have also increased – by over 1100%. We see other changes as well. The face of America is changing. It is growing older. In 2025, persons 65 and over will make up 18.5% of the total population. The number of persons aged 85 and over is increasing more rapidly than any other age group. More importantly, the elderly are taking more trips, driving further, and continuing to drive much later in life. These conditions lead to concerns about traffic safety. Although the elderly are healthier and drive safer cars than they did just two decades ago, their frailty makes them more susceptible to injury than younger persons involved in traffic crashes of the same severity. In addition, visual, physical, and cognitive skills, all of which contribute to driving abilities, decrease with advancing age. The familiar “U”-shaped curve depicting the rate of fatalities per vehicle miles traveled, shows that the elderly experience a higher highway fatality rate than any other age group except teenagers. While the overall number of highway fatalities has decreased regularly since 1972, the number of fatalities of elderly travelers has continued to increase steadily. This increase is cause for concern for both the elderly driver and for other persons on the roads who migh tbe placed in danger through crashes involving elderly drivers.

Graded Reflectivity Mirror for the Solid State Heat Capacity Laser Final Report CRADA No. TC-2085-04

Energy Technology Data Exchange (ETDEWEB)

Yamamoto, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Davis, J. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-27

This was a collaborative effort between The Regents of the University of California, Lawrence Livermore National Laboratory (LLNL) and the Boeing Company, to develop a Graded Reflectivity Mirror (GRM) to achieve improved near field fill and higher brightness in the far field output of LLNL’s Solid State Heat Capacity Laser (SSHCL).

Modeling Parasitic Energy Losses and the Impact of Advanced Tribological Concepts on Fuel Efficiency - Final CRADA Report

Energy Technology Data Exchange (ETDEWEB)

Fenske, George [Argonne National Lab. (ANL), Argonne, IL (United States)

2016-11-28

Our primary task for this project was to perform FMEP calculations for a broad range of parameters including engine type [spark ignition (SI) or compression ignition (CI)], engine size, engine mode (speed and load), lubricant viscosity, asperity friction, surface finish, oil type (mineral or synthetic), and additive (friction modifier), as discussed previously [1–3]. The actual analysis was limited to a large diesel engine and it included both load and speed dependencies as well as lubricant viscosity and speed.

Southern California Edison Grid Integration Evaluation: Cooperative Research and Development Final Report, CRADA Number CRD-10-376

Energy Technology Data Exchange (ETDEWEB)

Mather, Barry [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2015-07-09

The objective of this project is to use field verification to improve DOE’s ability to model and understand the impacts of, as well as develop solutions for, high penetration PV deployments in electrical utility distribution systems. The Participant will work with NREL to assess the existing distribution system at SCE facilities and assess adding additional PV systems into the electric power system.

Optimization of Diode Laser System to Treat Benign Prostate Hyperplasia Final Report CRADA No. TSB-1154-95

Energy Technology Data Exchange (ETDEWEB)

London, Richard A [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Byrne, Mark [Ethicon Endo-Surgery, Inc., Cincinnati, OH (United States)

2018-01-22

Benign prostate hyperplasia (BPH) is a pervasive condition of enlargement of the male prostate gland which leads to several urinary difficulties ranging from hesitancy to incontinence to kidney dysfunction in severe cases. Currently the most common therapy is transurethral resection of the prostate (TURP) utilizing an electrosurgical device. Although TURP is largely successful, new BPH therapy methods are desired to reduce the cost and recovery time, improve the success rate, and reduce side effects. Recently, lasers have been introduced for this purpose. Indigo Medical Inc. is currently engaged in the development, testing, and preparation for sales of a new diode laser based BPH therapy system. The development is based on laboratory experiments, animal studies, and a limited FDA-approved clinical trial in the US and in other countries. The addition of sophisticated numerical modeling, of the sort that has been highly developed at Lawrence Livermore National Laboratory, can greatly aid in the design of the system and treatment protocol. The benefits to DOE include the maintenance and advancement of numerical modeling expertise in radiation-matter interactions of the sort essential for the stockpile stewardship, inertial confinement fusion, and advanced manufacturing, and the push on advanced scientific computational methods, ultimately in areas such as 3-D transport.

Rarefaction Shock Wave Cutter for Offshore Oil-Gas Platform Removal Final Report CRADA No. TC02009.0

Energy Technology Data Exchange (ETDEWEB)

Glenn, L. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Barker, J. [Halliburton Energy Services, Alvarado, TX (United States)

2017-09-06

This was a collaborative effort between Lawrence Livermore National Security, LLC/Lawrence Livermore National Laboratory (LLNL) (formerly the University of California) and Jet Research Center, a wholly owned division of Halliburton Energy Services, Inc. to design and prototype an improved explosive cutter for cutting the support legs of offshore oil and gas platforms.

Medical Isotope Program: O-18, C-13, and Xe-129 Final Report CRADA No. TC-2043-02

Energy Technology Data Exchange (ETDEWEB)

Scheibner, K. F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Fought, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-27

This was a collaborative effort between the University of California, Lawrence Livermore National Laboratory (LLNL) and Spectra Gases, Inc., to develop new and cheaper sources of Oxgyen-18 (O-18), Carbon-13 (C-13), and Xenon-129 (Xe-129), and to develop new applications of these stable medical isotopes in medicine resulting in a substantial increase in stable isotopes that are important to human health sciences.

Ethical aspects of final disposal. Final report

International Nuclear Information System (INIS)

Baltes, B.; Leder, W.; Achenbach, G.B.; Spaemann, R.; Gerhardt, V.

2003-01-01

In fulfilment of this task the Federal Environmental Ministry has commissioned GRS to summarise the current national and international status of ethical aspects of the final disposal of radioactive wastes as part of the project titled ''Final disposal of radioactive wastes as seen from the viewpoint of ethical objectives''. The questions arising from the opinions, positions and publications presented in the report by GRS were to serve as a basis for an expert discussion or an interdisciplinary discussion forum for all concerned with the ethical aspects of an answerable approach to the final disposal of radioactive wastes. In April 2001 GRS held a one-day seminar at which leading ethicists and philosophers offered statements on the questions referred to above and joined in a discussion with experts on issues of final disposal. This report documents the questions that arose ahead of the workshop, the specialist lectures held there and a summary of the discussion results [de

Silent Discharge Plasma Technology for the Treatment of Air Toxics and Other Applications

Energy Technology Data Exchange (ETDEWEB)

Rosocha, Louis A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Chase, Peter J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Gross, Michael P. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

1998-09-21

Under this CRADA, the Los Alamos National Laboratory (LANL) and High Mesa Technologies, Inc. (HMT) carried out a joint project on the development of the silent discharge plasma (SDP) technology for the treatment of hazardous air pollutants and other hazardous or toxic chemicals. The project had two major components: a technology-demonstration part and a scale-up and commercialization part. In the first part, a small-scale, mobile SDP plasma processor, which was being developed under a CRADA with the Electric Power Research Institute (EPRI) was the mobile equipment was modified for higher capacity service and employed for an innovative remediation technologies demonstration on soil-vapor extraction off-gases at the McClellan Air Force Base near Sacramento, CA. The performance of the SDP system for the variety of volatile organic compounds (VOCs) encountered at the McClellan site was sufficiently promising to the project HMT and LANL worked together to formulate a scale-up strategy and commercialization/manufacturing plan, and to design a prototype scaled-up SDP unit. HMT and LANL are now in the final stages of completing a licensing agreement for the technology and HMT is in the process of raising funds to engineer and manufacture commercial prototype SDP equipment focused on stack-gas emissions control and environmental remediation. HMT, in collaboration with another Northern New Mexico business, Coyote Aerospace, has also been successful in receiving a Phase I Small Business Innovative Research (SBIR) award from the Army Research Office to develop, design, and construct a small non-thermal plasma reactor for laboratory studies ("Non-Thermal Plasma Reactor for Control of Fugitive Emissions of Toxic Gases")

Epileptic Seizure Forewarning by Nonlinear Techniques

International Nuclear Information System (INIS)

Hively, L.M.

2001-01-01

Nicolet Biomedical Inc. (NBI) is collaborating with Oak Ridge National Laboratory (ORNL) under a Cooperative Research and Development Agreement (CRADA) to convert ORNL's patented technology for forewarning of epileptic seizures to a clinical prototype. This technical report describes the highlights of the first year's effort. The software requirements for the clinical device were specified from which the hardware specifications were obtained. ORNL's research-class FORTRAN was converted to run under a graphical user interface (GUI) that was custom-built for this application by NBI. The resulting software package was cloned to desktop computers that are being tested in five different clinical sites. Two hundred electroencephalogram (EEG) datasets from those clinical sites were provided to ORNL for detailed analysis and improvement of the forewarning methodology. Effort under this CRADA is continuing into the second year as planned

Utility of Big Area Additive Manufacturing (BAAM) For The Rapid Manufacture of Customized Electric Vehicles

Energy Technology Data Exchange (ETDEWEB)

Love, Lonnie J [ORNL

2015-08-01

This Oak Ridge National Laboratory (ORNL) Manufacturing Development Facility (MDF) technical collaboration project was conducted in two phases as a CRADA with Local Motors Inc. Phase 1 was previously reported as Advanced Manufacturing of Complex Cyber Mechanical Devices through Community Engagement and Micro-manufacturing and demonstrated the integration of components onto a prototype body part for a vehicle. Phase 2 was reported as Utility of Big Area Additive Manufacturing (BAAM) for the Rapid Manufacture of Customized Electric Vehicles and demonstrated the high profile live printing of an all-electric vehicle using ONRL s Big Area Additive Manufacturing (BAAM) technology. This demonstration generated considerable national attention and successfully demonstrated the capabilities of the BAAM system as developed by ORNL and Cincinnati, Inc. and the feasibility of additive manufacturing of a full scale electric vehicle as envisioned by the CRADA partner Local Motors, Inc.

Electron beam curing of composites in North America

International Nuclear Information System (INIS)

Berejka, Anthony J.; Eberle, Cliff

2002-01-01

Electron beam curing of fiber-reinforced composites was explored over 30 years ago. Since then there have been developments in accelerator technology, in processes for handling materials presented to an accelerator, and in materials that can be used as matrix binders. In recent years in North America, Cooperative Research and Development Agreements (CRADAs) have been formed involving collaboration amongst materials suppliers, accelerator manufacturers and service providers, national laboratories, such as Oak Ridge National Laboratory, and interested potential users. The scope and status of these CRADAs are reviewed along with other recent developments in the electron beam curing of composites in North America. Innovative and proprietary materials technology has been developed and progress made toward implementing commercial practice. Significant market interest has developed in the military/aerospace industries that are finding the process and performance of electron beam cured composites to offer significant benefits

CRADA Final Report For CRADA NO. CR-12-006 [Operation and Testing of an SO₂-depolarized Electrolyzer (SDE) for the Purpose of Hydrogen and Sulfuric Acid Production

Energy Technology Data Exchange (ETDEWEB)

Summers, W. A. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Colon-Mercado, H. R. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Steimke, J. L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Zahn, Steffen [Air Products and Chemicals, Inc., Allentown, PA (United States)

2014-02-24

Over the past several years, Savannah River National Laboratory (SRNL) has led a team of collaborators under the Department of Energy’s (DOE) nuclear hydrogen production program to develop the Hybrid Sulfur (HyS) Process. HyS is a 2-step water-splitting process consisting of high temperature decomposition of sulfuric acid to generate SO₂, followed by the electrolysis of aqueous SO₂ to generate hydrogen and sulfuric acid. The latter is fed back into the high temperature reactor. SRNL designed and built an SO₂-depolarized electrolyzer (SDE) and a test facility. Over 40 SDE’s were tested using different catalysts, membranes and other components. SRNL demonstrated that an SDE could be operated continuously for approximately 200 hours under certain conditions without buildup of sulfur at the SDE’s cathode, thus solving a key technical problem with SDE technology. Air Products and Chemicals, Inc. (APCI) is a major supplier of hydrogen production systems, and they have proprietary technology that could benefit from the SDE developed by SRNS, or some improved version thereof. However, to demonstrate that SRNL’s SDE is a truly viable approach to the electrolyzer design, continuous operation for far greater periods of time than 200 hours must be demonstrated, and the electrolyzer must be scaled up to greater hydrogen production capacities. SRNL and Air Products entered into a Cooperative Research and Development Agreement with the objective of demonstrating the effectiveness of the SDE for hydrogen and sulfuric acid production and to demonstrate long-term continuous operation so as to dramatically increase the confidence in the SDE design for commercial operation. SRNL prepared a detailed technical report documenting previous SDE development, including the current SDE design and operating conditions that led to the 200-hour sulfurfree testing. SRNL refurbished its single cell SDE test facility and qualified the equipment for continuous operation. A new membrane electrode assembly (MEA) was fabricated and installed in the single cell electrolyzer (60 cm² active cell area). Shakedown testing was conducted, and several modifications were made to the test facility equipment. Seven different MEAs were used during testing. Beginning on May 20, 2013, SRNL was able to test the SDE continuously for 1200 hours, including 1000 hours under power to generate hydrogen at an average rate of 10.8 liters per hour. The SDE was not removed or repaired during the 50-day test and was successfully restarted after each shutdown. The test was intentionally stopped after 1200 hours (1000 hours of hydrogen production) due to funding constraints. Post-test examination of the MEA using Scanning Electron Microscopy (SEM) and Energy Dispersive X-ray Microanalysis (EDAX) showed no elemental sulfur deposits or sulfur layer inside the cell, thus successfully achieving the test goals. The results demonstrated that the SDE could be operated for extended periods without major performance degradation or the buildup of sulfur inside the MEA. Air Products conducted an assessment of the economic viability of the SDE based on the “as tested” design. The results indicated that the SDE faces significant economic obstacles in its current state. Further development and scale-up are necessary before the SDE is ready for commercialization.

Genotype by environment interaction for 450-day weight of Nelore cattle analyzed by reaction norm models

Directory of Open Access Journals (Sweden)

Newton T. Pégolo

2009-01-01

Full Text Available Genotype by environment interactions (GEI have attracted increasing attention in tropical breeding programs because of the variety of production systems involved. In this work, we assessed GEI in 450-day adjusted weight (W450 Nelore cattle from 366 Brazilian herds by comparing traditional univariate single-environment model analysis (UM and random regression first order reaction norm models for six environmental variables: standard deviations of herd-year (RRMw and herd-year-season-management (RRMw-m groups for mean W450, standard deviations of herd-year (RRMg and herd-year-season-management (RRMg-m groups adjusted for 365-450 days weight gain (G450 averages, and two iterative algorithms using herd-year-season-management group solution estimates from a first RRMw-m and RRMg-m analysis (RRMITw-m and RRMITg-m, respectively. The RRM results showed similar tendencies in the variance components and heritability estimates along environmental gradient. Some of the variation among RRM estimates may have been related to the precision of the predictor and to correlations between environmental variables and the likely components of the weight trait. GEI, which was assessed by estimating the genetic correlation surfaces, had values < 0.5 between extreme environments in all models. Regression analyses showed that the correlation between the expected progeny differences for UM and the corresponding differences estimated by RRM was higher in intermediate and favorable environments than in unfavorable environments (p < 0.0001.

A novel RNA-recognition-motif protein is required for premeiotic G1/S-phase transition in rice (Oryza sativa L..

Directory of Open Access Journals (Sweden)

Ken-Ichi Nonomura

2011-01-01

Full Text Available The molecular mechanism for meiotic entry remains largely elusive in flowering plants. Only Arabidopsis SWI1/DYAD and maize AM1, both of which are the coiled-coil protein, are known to be required for the initiation of plant meiosis. The mechanism underlying the synchrony of male meiosis, characteristic to flowering plants, has also been unclear in the plant kingdom. In other eukaryotes, RNA-recognition-motif (RRM proteins are known to play essential roles in germ-cell development and meiosis progression. Rice MEL2 protein discovered in this study shows partial similarity with human proline-rich RRM protein, deleted in Azoospermia-Associated Protein1 (DAZAP1, though MEL2 also possesses ankyrin repeats and a RING finger motif. Expression analyses of several cell-cycle markers revealed that, in mel2 mutant anthers, most germ cells failed to enter premeiotic S-phase and meiosis, and a part escaped from the defect and underwent meiosis with a significant delay or continued mitotic cycles. Immunofluorescent detection revealed that T7 peptide-tagged MEL2 localized at cytoplasmic perinuclear region of germ cells during premeiotic interphase in transgenic rice plants. This study is the first report of the plant RRM protein, which is required for regulating the premeiotic G1/S-phase transition of male and female germ cells and also establishing synchrony of male meiosis. This study will contribute to elucidation of similarities and diversities in reproduction system between plants and other species.

Singlet Oxygen-Mediated Oxidation during UVA Radiation Alters the Dynamic of Genomic DNA Replication.

Directory of Open Access Journals (Sweden)

Dany Graindorge

Full Text Available UVA radiation (320-400 nm is a major environmental agent that can exert its deleterious action on living organisms through absorption of the UVA photons by endogenous or exogenous photosensitizers. This leads to the production of reactive oxygen species (ROS, such as singlet oxygen (1O2 and hydrogen peroxide (H2O2, which in turn can modify reversibly or irreversibly biomolecules, such as lipids, proteins and nucleic acids. We have previously reported that UVA-induced ROS strongly inhibit DNA replication in a dose-dependent manner, but independently of the cell cycle checkpoints activation. Here, we report that the production of 1O2 by UVA radiation leads to a transient inhibition of replication fork velocity, a transient decrease in the dNTP pool, a quickly reversible GSH-dependent oxidation of the RRM1 subunit of ribonucleotide reductase and sustained inhibition of origin firing. The time of recovery post irradiation for each of these events can last from few minutes (reduction of oxidized RRM1 to several hours (replication fork velocity and origin firing. The quenching of 1O2 by sodium azide prevents the delay of DNA replication, the decrease in the dNTP pool and the oxidation of RRM1, while inhibition of Chk1 does not prevent the inhibition of origin firing. Although the molecular mechanism remains elusive, our data demonstrate that the dynamic of replication is altered by UVA photosensitization of vitamins via the production of singlet oxygen.

Singlet Oxygen-Mediated Oxidation during UVA Radiation Alters the Dynamic of Genomic DNA Replication

Science.gov (United States)

Graindorge, Dany; Martineau, Sylvain; Machon, Christelle; Arnoux, Philippe; Guitton, Jérôme; Francesconi, Stefania; Frochot, Céline; Sage, Evelyne; Girard, Pierre-Marie

2015-01-01

UVA radiation (320–400 nm) is a major environmental agent that can exert its deleterious action on living organisms through absorption of the UVA photons by endogenous or exogenous photosensitizers. This leads to the production of reactive oxygen species (ROS), such as singlet oxygen (1O2) and hydrogen peroxide (H2O2), which in turn can modify reversibly or irreversibly biomolecules, such as lipids, proteins and nucleic acids. We have previously reported that UVA-induced ROS strongly inhibit DNA replication in a dose-dependent manner, but independently of the cell cycle checkpoints activation. Here, we report that the production of 1O2 by UVA radiation leads to a transient inhibition of replication fork velocity, a transient decrease in the dNTP pool, a quickly reversible GSH-dependent oxidation of the RRM1 subunit of ribonucleotide reductase and sustained inhibition of origin firing. The time of recovery post irradiation for each of these events can last from few minutes (reduction of oxidized RRM1) to several hours (replication fork velocity and origin firing). The quenching of 1O2 by sodium azide prevents the delay of DNA replication, the decrease in the dNTP pool and the oxidation of RRM1, while inhibition of Chk1 does not prevent the inhibition of origin firing. Although the molecular mechanism remains elusive, our data demonstrate that the dynamic of replication is altered by UVA photosensitization of vitamins via the production of singlet oxygen. PMID:26485711

Glycobiology in yeast: production of bio-ative biopolymers and small molecules

Energy Technology Data Exchange (ETDEWEB)

Scheller, Henrik [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

2014-04-30

The accomplished goals of the CRADA were the establishment of a yeast strain capable of producing levels of vanillin suitable for commercial production and the identification of novel glycosyltransferases to construct the biosynthetic pathway of a gum Arabic-variant in yeast.

Improved External Base Resistance Extraction for Submicrometer InP/InGaAs DHBT Models

DEFF Research Database (Denmark)

Johansen, Tom Keinicke; Krozer, Viktor; Nodjiadjim, Virginie

2011-01-01

An improved direct parameter extraction method is proposed for III–V heterojunction bipolar transistor (HBT) external base resistance $R_{\\rm bx}$ extraction from forward active $S$-parameters. The method is formulated taking into account the current dependence of the intrinsic base–collector cap......An improved direct parameter extraction method is proposed for III–V heterojunction bipolar transistor (HBT) external base resistance $R_{\\rm bx}$ extraction from forward active $S$-parameters. The method is formulated taking into account the current dependence of the intrinsic base...... factor given as the ratio of the emitter to the collector area. The determination of the parameters $I_{p}$ and $X_{0}$ from experimental $S$-parameters is described. The method is applied to high-speed submicrometer InP/InGaAs DHBT devices and leads to small-signal equivalent circuit models, which...

The application of the random regret minimization model to drivers’ choice of crash avoidance maneuvers

DEFF Research Database (Denmark)

Kaplan, Sigal; Prato, Carlo Giacomo

This study explores the plausibility of regret minimization as behavioral paradigm underlying the choice of crash avoidance maneuvers. Alternatively to previous studies that considered utility maximization, this study applies the random regret minimization (RRM) model while assuming that drivers ...

The application of the random regret minimization model to drivers’ choice of crash avoidance maneuvers

DEFF Research Database (Denmark)

Kaplan, Sigal; Prato, Carlo Giacomo

2012-01-01

This study explores the plausibility of regret minimization as behavioral paradigm underlying the choice of crash avoidance maneuvers. Alternatively to previous studies that considered utility maximization, this study applies the random regret minimization (RRM) model while assuming that drivers ...

Chemiresistor microsensors for in-situ monitoring of volatile organic compounds : final LDRD report.

Energy Technology Data Exchange (ETDEWEB)

Thomas, Michael Loren; Hughes, Robert Clark; Kooser, Ara S.; McGrath, Lucas K.; Ho, Clifford Kuofei; Wright, Jerome L.; Davis, Chad Edward

2003-09-01

This report provides a summary of the three-year LDRD (Laboratory Directed Research and Development) project aimed at developing microchemical sensors for continuous, in-situ monitoring of volatile organic compounds. A chemiresistor sensor array was integrated with a unique, waterproof housing that allows the sensors to be operated in a variety of media including air, soil, and water. Numerous tests were performed to evaluate and improve the sensitivity, stability, and discriminatory capabilities of the chemiresistors. Field tests were conducted in California, Nevada, and New Mexico to further test and develop the sensors in actual environments within integrated monitoring systems. The field tests addressed issues regarding data acquisition, telemetry, power requirements, data processing, and other engineering requirements. Significant advances were made in the areas of polymer optimization, packaging, data analysis, discrimination, design, and information dissemination (e.g., real-time web posting of data; see www.sandia.gov/sensor). This project has stimulated significant interest among commercial and academic institutions. A CRADA (Cooperative Research and Development Agreement) was initiated in FY03 to investigate manufacturing methods, and a Work for Others contract was established between Sandia and Edwards Air Force Base for FY02-FY04. Funding was also obtained from DOE as part of their Advanced Monitoring Systems Initiative program from FY01 to FY03, and a DOE EMSP contract was awarded jointly to Sandia and INEEL for FY04-FY06. Contracts were also established for collaborative research with Brigham Young University to further evaluate, understand, and improve the performance of the chemiresistor sensors.

Protein: FBA7 [TP Atlas

Lifescience Database Archive (English)

Full Text Available FBA7 claudin-zona occluden Tjp1 Zo1 Tight junction protein ZO-1 Tight junction protein 1, Zona occludens pr...otein 1, Zonula occludens protein 1 10090 Mus musculus 21872 P39447 2RRM P39447 21431884 ...

A Pictorial History of the Code 717 Unmanned Systems Group: Air, Land, and Sea. Volume 1: 1970-1999

Science.gov (United States)

2016-04-28

application was never pursued, however, given the far more practical approach of dropping a small RF repeater brick , as further discussed in several later... Mortar CODEC Coder Decoder COEE Concept of Employment Exercise COTS Commercial Off The Shelf CRADA Cooperative Research and Development

The Use of Adjuvant Nutrition to Preserve and Increase Lean Body Mass in AIDS Patients with Muscle Wasting.

Energy Technology Data Exchange (ETDEWEB)

None

2000-01-03

The studies conducted under this CRADA were aimed at determining if nutritional supplementation with HMb, in combination with glutamine and arginine can ameliorate the AIDS-associated wasting syndrome and in turn improve the clinical course of the disease.

Long-term surveillance plan for the Green River, Utah, disposal site

International Nuclear Information System (INIS)

1997-06-01

The long-term surveillance plan (LTSP) for the Green River, Utah, Uranium Mill Tailings Remedial Action (UMTRA) Project disposal site describes the surveillance activities for the Green River disposal cell. The U.S. Department of Energy (DOE) will carry out these activities to ensure that the disposal cell continues to function as designed. This final LTSP was prepared as a requirement for acceptance under the U.S. Nuclear Regulatory Commission (NRC) general license for custody and long-term care of residual radioactive materials (RRM). This LTSP documents whether the land and interests are owned by the United States or an Indian tribe and details how the long-term care of the disposal site will be carried out. The Green River, Utah, LTSP is based on the DOE's Guidance for Implementing the UMTRA Project Long-term Surveillance Program (DOE, 1992a)

Long-term surveillance plan for the Green River, Utah disposal site. Revision 1

International Nuclear Information System (INIS)

1994-08-01

The long-term surveillance plan (LTSP) for the Green River, Utah, Uranium Mill Tailings Remedial Action (UMTRA) Project disposal site describes the surveillance activities for the Green River disposal cell. The US Department of Energy (DOE) will carry out these activities to ensure that the disposal cell continues to function as designed. This final LTSP was prepared as a requirement for acceptance under the US Nuclear Regulatory Commission (NRC) general license for custody and long-term care of residual radioactive materials (RRM). This LTSP documents whether the land and interests are owned by the United States or an Indian tribe and details how the long-term care of the disposal site will be carried out. The Green River, Utah, LTSP is based on the DOE's Guidance for Implementing the UMTRA Project Long-term Surveillance Program (DOE, 1992a)

Butanol / Honda CRADA Report

Science.gov (United States)

2015-02-01

Beam Overall (includes collar) 8’-6” Cruise Speed 35 knots @ 4500 RPM Operational Draft (DIW4 with engines vertical) 3’-3” Maximum Operating...system, it froze upon startup. To restart the system, the test engineer remotely walked the boat crewman through the required steps.  Interaction...install request, automatically installing a mouse driver on the port. The data flowing through the port caused this “virtual mouse ” to randomly

Survey report for fiscal 1999 on foundation of strategy formation for industrial technologies. Strategy of foundation and environment buildup (Further into support for technological innovation); 1999 nendo sangyo gijutsu senryaku sakutei kiban chosa hokokusho. Kiban kankyo senryaku gijutsu kakushin shien shisaku shinkutsu

Energy Technology Data Exchange (ETDEWEB)

NONE

2000-03-01

Surveyed are the roles of the government, important for environmental buildup for technological innovation. The U.S. research and development support programs are classed into contracts, grants, cooperative agreements, and CRADAs (Cooperative Research and Development Agreements). The government financially supports the first three, but not CRADA. It provides CRADA with manpower, facilities, and resources. The research and development (R-and-D) appropriation not for national defense in the U.S. fiscal 2000 budget is up 36% to $39.4 billion occupying 50.6% of the total R-and-D expense. The basic research appropriation is given the highest priority, enjoying an increase of 4.7% to $18.1 billion. In the U.S., taxation for R-and-D expenses is done in two ways. One is a research expense tax deduction system under which R-and-D expense is handled as a cost, a subject of deduction. The other is a research and experiment tax deduction system under which a certain percentage of R-and-D increment is free of taxation. NEDO's (New Energy and Industrial Technology Development Organization) system for national R-and-D projects is scheduled to change extensively upon reorganization of the government ministries and agencies in January, 2001. Under the circumstances, the current and future systems of the state supports for R-and-D are outlined, and the position of NEDO in them is clarified. The R-and-D systems of the entrusted businesses and the problems they contain are also described. (NEDO)

Evaluation of Subsurface Flow and Free-water Surface Wetlands Treating NPR-3 Produced Water - Year No. 1

International Nuclear Information System (INIS)

Myers, J. E.; Jackson, L. M.

2001-01-01

This paper is a summary of some of the activities conducted during the first year of a three-year cooperative research and development agreement (CRADA) between the Department of Energy (DOE) Rocky Mountain Oilfield Testing Center (RMOTC) and Texaco relating to the treatment of produced water by constructed wetlands. The first year of the CRADA is for design, construction and acclimation of the wetland pilot units. The second and third years of the CRADA are for tracking performance of pilot wetlands as the plant and microbial communities mature. A treatment wetland is a proven technology for the secondary and tertiary treatment of produced water, storm water and other wastewaters. Treatment wetlands are typically classified as either free-water surface (FWS) or subsurface flow (SSF). Both FWS and SSF wetlands work well when properly designed and operated. This paper presents a collection of kinetic data gathered from pilot units fed a slipstream of Wyoming (NPR-3) produced water. The pilot units are set up outdoors to test climatic influences on treatment. Monitoring parameters include evapotranspiration, plant growth, temperature, and NPDES discharge limits. The pilot wetlands (FWS and SSF) consist of a series of 100-gal plastic tubs filled with local soils, gravel, sharp sand and native wetland plants (cattail (Typha spp.), bulrush (Scirpus spp.), dwarf spikerush (Eleocharis)). Feed pumps control hydraulic retention time (HRT) and simple water control structures control the depth of water. The treated water is returned to the existing produced water treatment system. All NPDES discharge limits are met. Observations are included on training RMOTC summer students to do environmental work

78 FR 52941 - Cooperative Research and Development Agreement: Next Generation Arctic Navigational Safety...

Science.gov (United States)

2013-08-27

... advantages, disadvantages, required technology enhancements, performance, costs, and other issues associated... technology approach to the ``Next Generation Arctic Maritime Navigational Safety Information System,'' which... Federal Technology Transfer Act of 1986 (Pub. L. 99-502, codified at 15 U.S.C. 3710(a)). A CRADA [[Page...

77 FR 19678 - Cooperative Research and Development Agreement: Asset Tracking and Reporting Technology

Science.gov (United States)

2012-04-02

... Demonstration Concept Document, Technology Test Objectives, Test Plan, and Project Report for the CRADA work. We... Demonstration Concept Document, Technology Test Objectives, Test Plan, and Project Report; (2) Provide, install, operate, maintain, and remove all material (including hardware, software, and test equipment), along with...

76 FR 66728 - Government-Owned Inventions; Licensing and Collaborative Research Opportunity for PANVAC-Cancer...

Science.gov (United States)

2011-10-27

... identification of molecular targets associated with cancer, the focus of drug development has shifted from... Immunology and Biology, Center for Cancer Research, NCI. The CRADA partner will (a) generate and characterize...; Licensing and Collaborative Research Opportunity for PANVAC--Cancer Vaccine for the Prevention and Treatment...

Narrative Finality

Directory of Open Access Journals (Sweden)

Armine Kotin Mortimer

1981-01-01

Full Text Available The cloturai device of narration as salvation represents the lack of finality in three novels. In De Beauvoir's Tous les hommes sont mortels an immortal character turns his story to account, but the novel makes a mockery of the historical sense by which men define themselves. In the closing pages of Butor's La Modification , the hero plans to write a book to save himself. Through the thrice-considered portrayal of the Paris-Rome relationship, the ending shows the reader how to bring about closure, but this collective critique written by readers will always be a future book. Simon's La Bataille de Pharsale , the most radical attempt to destroy finality, is an infinite text. No new text can be written. This extreme of perversion guarantees bliss (jouissance . If the ending of De Beauvoir's novel transfers the burden of non-final world onto a new victim, Butor's non-finality lies in the deferral to a future writing, while Simon's writer is stuck in a writing loop, in which writing has become its own end and hence can have no end. The deconstructive and tragic form of contemporary novels proclaims the loss of belief in a finality inherent in the written text, to the profit of writing itself.

Final Report

Energy Technology Data Exchange (ETDEWEB)

Gurney, Kevin R. [Arizona Univ., Mesa, AZ (United States)

2015-01-12

This document constitutes the final report under DOE grant DE-FG-08ER64649. The organization of this document is as follows: first, I will review the original scope of the proposed research. Second, I will present the current draft of a paper nearing submission to Nature Climate Change on the initial results of this funded effort. Finally, I will present the last phase of the research under this grant which has supported a Ph.D. student. To that end, I will present the graduate student’s proposed research, a portion of which is completed and reflected in the paper nearing submission. This final work phase will be completed in the next 12 months. This final workphase will likely result in 1-2 additional publications and we consider the results (as exemplified by the current paper) high quality. The continuing results will acknowledge the funding provided by DOE grant DE-FG-08ER64649.

Demonstration of Laser Plasma X-Ray Source with X-Ray Collimator Final Report CRADA No. TC-1564-99

Energy Technology Data Exchange (ETDEWEB)

Lane, S. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Forber, R. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-28

This collaborative effort between the University of California, Lawrence Livermore National Laboratory (LLNL) and JMAR Research, Inc. (JRI), was to demonstrate that LLNL x-ray collimators can effectively increase the wafer throughput of JRI's laser based x-ray lithography systems. The technical objectives were expected to be achieved by completion of the following tasks, which are separated into two task lists by funding source. The organization (LLNL or JMAR) having primary responsibility is given parenthetically for each task.

Design of 3x3 Focusing Array for Heavy Ion Driver Final Report on CRADA TC-02082-04

Energy Technology Data Exchange (ETDEWEB)

Martovetsky, N. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-28

This memo presents a design of a 3x3 quadrupole array for HIF. It contains 3 D magnetic field computations of the array build with racetrack coils with and without different shields. It is shown that it is possible to have a low error magnetic field in the cells and shield the stray fields to acceptable levels. The array design seems to be a practical solution to any size array for future multi-beam heavy ion fusion drivers.

Development of Chemically Amplified Optical Sensors for Continuous Blood Glucose Monitoring Final Report CRADA No. TSB-1162-95

Energy Technology Data Exchange (ETDEWEB)

Lane, Stephen M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Univ. of California, Livermore, CA (United States); Mastrototaro, John J. [Minimed Technologies, Inc., Sylmar, CA (United States)

2018-01-22

Diabetes is a chronic disease that affects 14 million people in the U.S. and more than 110 million people worldwide. Each year in this country 27,000 diabetic patients become blind, 15,000 have kidney failure, and over 54,000 have peripheral limb amputations. In 1992, total healthcare costs in the U.S. for diabetes were more than $105 billion, approximately 15% of our healthcare budget. Conventional therapy for the most severe form of diabetes, insulin-dependent diabetes mellitus (IDDM) or Type I diabetes, is to administer one or two injections per day of various forms of insulin while monitoring blood glucose levels twice or three times daily with commercial glucometers that require blood samples. Near normal blood sugar levels (glycemic control) is difficult to achieve with conventional therapy. In the fall of 1993, the results of the 10-year $165 million Diabetes Control and Complications Trial (DCCT) were published which showed that intensive insulin management would lead to dramatically fewer cases of retinopathy (which leads to blindness), nephropathy (which leads to kidney failure), and neuropathy (which can lead to limb amputations) [New England Journal of Medicine, Vo1239, No.14 977-986 (1993)]. If existing commercial insulin pumps could be combined with a continuous glucose sensor, a more physiological and fine-tuned therapy could be provided - in effect, an artificial biomechanical pancreas would be available. Existing research suggested that such a development would dramatically improve glucose control, thus greatly reducing morbidity and mortality from this disease. MiniMed Technologies in Sylmar, CA, identified a number of optically based sensor strategies as well as candidate chemical reactions that could be used to implement a minimally invasive opto-chemical glucose sensor. LLNL evaluated these sensor strategies and chemical reactions. These evaluations were the first steps leading to development of a sensor of considerable importance that could maintain near normal physiological glycemic levels, thus dramatically reducing the risk of the microvascular complications mentioned above.

Extraction of Iodine from Source Rock and Oil for Radioiodine Dating Final Report CRADA No. TC-1550-98

Energy Technology Data Exchange (ETDEWEB)

Moran, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Summa, L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-19

This was a collaborative effort between the University of California, Lawrence Livermore National Laboratory (LLNL) and Exxon Production Research Company (EPR) to develop improved techniques for extracting, concentrating, and measuring iodine from large volumes of source rock and oil. The purpose of this project was to develop a technique for measuring total iodine extracted from rock, obtain isotopic ratios, and develop age models for samples provided by EPR.

Community Energy Storage Thermal Analysis and Management: Cooperative Research and Development Final Report, CRADA Number CRD-11-445

Energy Technology Data Exchange (ETDEWEB)

Smith, Kandler A. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2018-01-09

The goal of this project is to create thermal solutions and models for community energy storage devices using both purpose-designed batteries and EV or PHEV batteries. Modeling will be employed to identify major factors of a device's lifetime and performance. Simultaneously, several devices will be characterized to determine their electrical and thermal performance under controlled conditions. After the factors are identified, a variety of thermal design approaches will be evaluated to improve the performance of energy storage devices. Upon completion of this project, recommendations for community energy storage device enclosures, thermal management systems, and/or battery sourcing will be made. NREL's interest is in both new and aged batteries.

Research and Development of Zinc Air Fuel Cell To Achieve Commercialization Final Report CRADA No. TC-1544-98

Energy Technology Data Exchange (ETDEWEB)

Cooper, J. F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Haley, H. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-28

The specific goal of this project was to advance the development of the zinc air fuel cell (ZAFC) towards commercial readiness in different mobile applications, including motor bikes, passenger cars, vans, buses and off-road vehicles (golf carts, factory equipment), and different stationary applications including generator sets, uninterruptible power systems and electric utility loading leveling and distributive power.

Analysis and Design of a Fiber-optic Probe for DNA Sensors Final Report CRADA No. TSB-1147-95

Energy Technology Data Exchange (ETDEWEB)

Molau, Nicole [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Vail, Curtis [Accu.Photonics, Inc., Ann Arbor, MI (United States)

2018-01-24

In 1995, a challenge in the field of genetics dealt with the acquisition of efficient DNA sequencing techniques for reading the 3 billion base-pairs that comprised the human genome. AccuPhotonics, Inc. proposed to develop and manufacture a state-of-the-art near-field scanning optical microscopy (NSOM) fiber-optic probe that was expected to increase probe efficiency by two orders of magnitude over the existing state-of-the-art and to improve resolution to 10Å. The detailed design calculation and optimization of electrical properties of the fiber-optic probe tip geometry would be performed at LLNL, using existing finite-difference time-domain (FDTD) electromagnetic (EM) codes.

DISCOVERY OF TWO RARE RIGIDLY ROTATING MAGNETOSPHERE STARS IN THE APOGEE SURVEY

Energy Technology Data Exchange (ETDEWEB)

Eikenberry, Stephen S.; Garner, Alan [Department of Astronomy, University of Florida, 211 Bryant Space Science Center, Gainesville, FL 32611 (United States); Chojnowski, S. Drew; Majewski, Steven R.; Whelan, David G.; Borish, H. Jacob; Hearty, Fred; Li, Zhi-Yun; Nidever, David L.; Skrutskie, Michael [Department of Astronomy, University of Virginia, 530 McCormick Rd, Charlottesville, VA 22904 (United States); Wisniewski, John [Department of Astronomy, University of Oklahoma, 440 W. Brooks St., Norman, OK 73019 (United States); Shetrone, Matthew [University of Texas, McDonald Observatory, 3640 Dark Sky Drive, Fort Davis, TX (United States); Bizyaev, Dmitry; Ebelke, Garrett [Apache Point Observatory, 2001 Apache Point Rd, Sunspot, NM 88349 (United States); Davenport, James R. A. [Department of Astronomy, University of Washington, Box 351580, U.W., Seattle, WA 98195-1580 (United States); Feuillet, Diane; Holtzman, Jon [Department of Astronomy, New Mexico State University, 1780 E University Ave, Las Cruces, NM 88003 (United States); Frinchaboy, Peter M. [Department of Physics and Astronomy, Texas Christian University, Box 298840, Fort Worth, TX 76129 (United States); Mészáros, Sz. [Instituto de Astrofísica de Canarias (IAC), E-38200 La Laguna, Tenerife (Spain); Schneider, Donald P. [Department of Astronomy and Astrophysics, The Pennsylvania State University, 525 Davey Lab, University Park, PA 16802 (United States); and others

2014-04-01

The Apache Point Observatory Galactic Evolution Experiment (APOGEE)—one of the Sloan Digital Sky Survey III programs—is using near-infrared (NIR) spectra of ∼100,000 red giant branch star candidates to study the structure of the Milky Way. In the course of the survey, APOGEE also acquires spectra of hot field stars to serve as telluric calibrators for the primary science targets. We report the serendipitous discovery of two rare, fast-rotating B-stars of the σ Ori E type among those blue field stars observed during the first year of APOGEE operations. Both of the discovered stars display the spectroscopic signatures of rigidly rotating magnetospheres (RRM) common to this class of highly magnetized (B ∼ 10 kGauss) stars, increasing the number of known RRM stars by ∼10%. One (HD 345439) is a main-sequence B-star with unusually strong He absorption (similar to σ Ori E), while the other (HD 23478) fits a ''He-normal'' B3IV classification. We combine the APOGEE discovery spectra with other optical and NIR spectra of these two stars, and of σ Ori E itself, to show how NIR spectroscopy can be a uniquely powerful tool for discovering more of these rare objects, which may show little/no RRM signatures in their optical spectra. We discuss the potential for further discovery of σ Ori E type stars, as well as the implications of our discoveries for the population of these objects and insights into their origin and evolution.

DISCOVERY OF TWO RARE RIGIDLY ROTATING MAGNETOSPHERE STARS IN THE APOGEE SURVEY

International Nuclear Information System (INIS)

Eikenberry, Stephen S.; Garner, Alan; Chojnowski, S. Drew; Majewski, Steven R.; Whelan, David G.; Borish, H. Jacob; Hearty, Fred; Li, Zhi-Yun; Nidever, David L.; Skrutskie, Michael; Wisniewski, John; Shetrone, Matthew; Bizyaev, Dmitry; Ebelke, Garrett; Davenport, James R. A.; Feuillet, Diane; Holtzman, Jon; Frinchaboy, Peter M.; Mészáros, Sz.; Schneider, Donald P.

2014-01-01

The Apache Point Observatory Galactic Evolution Experiment (APOGEE)—one of the Sloan Digital Sky Survey III programs—is using near-infrared (NIR) spectra of ∼100,000 red giant branch star candidates to study the structure of the Milky Way. In the course of the survey, APOGEE also acquires spectra of hot field stars to serve as telluric calibrators for the primary science targets. We report the serendipitous discovery of two rare, fast-rotating B-stars of the σ Ori E type among those blue field stars observed during the first year of APOGEE operations. Both of the discovered stars display the spectroscopic signatures of rigidly rotating magnetospheres (RRM) common to this class of highly magnetized (B ∼ 10 kGauss) stars, increasing the number of known RRM stars by ∼10%. One (HD 345439) is a main-sequence B-star with unusually strong He absorption (similar to σ Ori E), while the other (HD 23478) fits a ''He-normal'' B3IV classification. We combine the APOGEE discovery spectra with other optical and NIR spectra of these two stars, and of σ Ori E itself, to show how NIR spectroscopy can be a uniquely powerful tool for discovering more of these rare objects, which may show little/no RRM signatures in their optical spectra. We discuss the potential for further discovery of σ Ori E type stars, as well as the implications of our discoveries for the population of these objects and insights into their origin and evolution

Final Technical Report

Energy Technology Data Exchange (ETDEWEB)

Schuur, Edward [Northern Arizona Univ., Flagstaff, AZ (United States); Luo, Yiqi [Univ. of Oklahoma, Norman, OK (United States)

2016-12-01

This final grant report is a continuation of the final grant report submitted for DE-SC0006982 as the Principle Investigator (Schuur) relocated from the University of Florida to Northern Arizona University. This report summarizes the original project goals, as well as includes new project activities that were completed in the final period of the project.

Improved Channel Allocation and RLC block scheduling for Downlink traffic in GPRS

DEFF Research Database (Denmark)

Wang, Haibo; Devendra, Devendra; Zhou, Xin

This paper investigates the Radio Resource Management (RRM) approaches for GSM/GPRS networks. The effort was put on Access Control(AC), Time-Slot (TS) allocation, and Radio Link Control (RLC) packet scheduling for down-link performance enhancement. A new credit-based algorithm was proposed...

Investigation for Low-Cost Permanent Magnets.

Science.gov (United States)

1981-09-01

Code RRM I | -. .. _ _ _ - -,’ .-- -- nnwi-- l aI l l ai Professor G.A. Ansell Professor N.S. Stoloff Rensselaer Polytechnic Institute Rensselaer...Polytechnic Institute Department of Metallurgical Engineering School of Engineering Troy, NY 02181 Troy, NY 12181 Dr. C. Adam Professor A. Lawley Pratt

Testing of Baker Flo-XS Pipeline Drag-Reducing Additive. Compilation of Tests and Results

National Research Council Canada - National Science Library

Guiliano, John

2000-01-01

... 0.8 ppm for errors in injection). Through a CRADA with Buckeye Pipeline Inc, thermal stability testing of the additive was completed. Additionally, low temperature testing, additive/additive compatibility testing and specification testing of additized fuel was also completed. Material compatibility testing was also taken into consideration.

Risk-reducing mastectomy for the prevention of primary breast cancer.

Science.gov (United States)

Carbine, Nora E; Lostumbo, Liz; Wallace, Judi; Ko, Henry

2018-04-05

Recent progress in understanding the genetic basis of breast cancer and widely publicized reports of celebrities undergoing risk-reducing mastectomy (RRM) have increased interest in RRM as a method of preventing breast cancer. This is an update of a Cochrane Review first published in 2004 and previously updated in 2006 and 2010. (i) To determine whether risk-reducing mastectomy reduces death rates from any cause in women who have never had breast cancer and in women who have a history of breast cancer in one breast, and (ii) to examine the effect of risk-reducing mastectomy on other endpoints, including breast cancer incidence, breast cancer mortality, disease-free survival, physical morbidity, and psychosocial outcomes. For this Review update, we searched Cochrane Breast Cancer's Specialized Register, MEDLINE, Embase and the WHO International Clinical Trials Registry Platform (ICTRP) on 9 July 2016. We included studies in English. Participants included women at risk for breast cancer in at least one breast. Interventions included all types of mastectomy performed for the purpose of preventing breast cancer. At least two review authors independently abstracted data from each report. We summarized data descriptively; quantitative meta-analysis was not feasible due to heterogeneity of study designs and insufficient reporting. We analyzed data separately for bilateral risk-reducing mastectomy (BRRM) and contralateral risk-reducing mastectomy (CRRM). Four review authors assessed the methodological quality to determine whether or not the methods used sufficiently minimized selection bias, performance bias, detection bias, and attrition bias. All 61 included studies were observational studies with some methodological limitations; randomized trials were absent. The studies presented data on 15,077 women with a wide range of risk factors for breast cancer, who underwent RRM.Twenty-one BRRM studies looking at the incidence of breast cancer or disease-specific mortality, or

Photochemistry research at NREL

Energy Technology Data Exchange (ETDEWEB)

Lyons, C.E.; Carlson, C.E. [National Renewable Energy Laboratory, Golden, CO (United States)

1996-09-01

Photochemistry research team at NREL conducts research and development work in all R&D areas, basic, applied, demonstration and transfer to commercialization. Basic research includes core PCO R&D and catalysts work as well as conducting research into new photochemistry areas such as photoinduced adsorption and high temperature solar PCO. Applied research work consists of remediation of chloroethylenes in gas phase, gas phase solar photoreactor development, and application research including indoor air quality, hybrid biological/PCO processes and more. We are demonstrating the PCO treatment technology in the gas phase with SEMATECH through CRADA work and remediation of organics in aqueous phase through the Solarchem Environmental Systems. We are working with IT through a CRADA to transfer the PCO gas phase remediation technology to IT to commercialize this promising -technology. Photochemistry research conducted at NREL spans the R&D spectrum from basic research through technology demonstration with the goal of technology commercialization.

40 CFR 61.134 - Standard: Naphthalene processing, final coolers, and final-cooler cooling towers.

Science.gov (United States)

2010-07-01

... coolers, and final-cooler cooling towers. 61.134 Section 61.134 Protection of Environment ENVIRONMENTAL... Standard: Naphthalene processing, final coolers, and final-cooler cooling towers. (a) No (“zero”) emissions are allowed from naphthalene processing, final coolers and final-cooler cooling towers at coke by...

An international survey of surveillance schemes for unaffected BRCA1 and BRCA2 mutation carriers

DEFF Research Database (Denmark)

Madorsky-Feldman, Dana; Sklair-Levy, Miri; Perri, Tamar

2016-01-01

Female BRCA1/BRCA2 mutation carriers are at substantially increased risk for developing breast and/or ovarian cancer, and are offered enhanced surveillance including screening from a young age and risk-reducing surgery (RRS)-mastectomy (RRM) and/or salpingo-oophorectomy (RRSO). While there are es...

Expanding the applicability of random regret minimization for route choice analysis

DEFF Research Database (Denmark)

Prato, Carlo Giacomo

2014-01-01

The discrete choice paradigm of random regret minimization (RRM) has been recently proposed in several choice contexts. In the route choice context, the paradigm has been used to model the choice among three routes and to formulate regret-based stochastic user equilibrium. However, in the same co...

78 FR 50424 - NIH Cooperative Research and Development Agreement Program: Invitation To Solicit Nonclinical and...

Science.gov (United States)

2013-08-19

... permit the transfer of funds from the NIH to a collaborator but does permit the collaborator to provide... areas of mutual interest. NIH investigators' proposals responsive to a solicitation will be reviewed by... research to be conducted and establishes benchmarks to chronicle its progress. The CRADA will include a...

Preliminary crystallographic analysis of the RNA-binding domain of HuR and its poly(U)-binding properties

International Nuclear Information System (INIS)

Wang, Hong; Li, Heng; Shi, Hui; Liu, Yang; Liu, Huihui; Zhao, Hui; Niu, Liwen; Teng, Maikun; Li, Xu

2011-01-01

Here, the recombinant ARE-binding region of HuR (residues 18–186) was crystallized in space group P2 1 2 1 2, with unit-cell parameters a = 41.2, b = 133.1, c = 31.4 Å. Human antigen R (HuR), a ubiquitously expressed member of the Hu protein family, is an important post-transcriptional regulator which has three RNA-recognition motif (RRM) domains. The two tandem N-terminal RRM domains can selectively bind to the AU-rich element (ARE), while the third one interacts with the poly(A) tail and other proteins. Here, the recombinant ARE-binding region of HuR (residues 18–186) was crystallized in space group P2 1 2 1 2, with unit-cell parameters a = 41.2, b = 133.1, c = 31.4 Å. X-ray diffraction data were collected to a resolution of 2.8 Å. Mutagenesis analysis and SPR assays revealed its poly(U)-binding properties

Elsevier Measurement of the production of high-$p_{\\rm T}$ electrons from heavy-flavour hadron decays in Pb-Pb collisions at $\\mathbf{\\sqrt{\\it s_{\\rm{NN}}}}$ = 2.76 TeV

CERN Document Server

Adam, Jaroslav; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahmad, Shakeel; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Alam, Sk Noor; Silva De Albuquerque, Danilo; Aleksandrov, Dmitry; Alessandro, Bruno; Alexandre, Didier; Alfaro Molina, Jose Ruben; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altinpinar, Sedat; Altsybeev, Igor; Alves Garcia Prado, Caio; An, Mangmang; Andrei, Cristian; Andrews, Harry Arthur; Andronic, Anton; Anguelov, Venelin; Anson, Christopher Daniel; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Anwar, Rafay; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Balasubramanian, Supraja; Baldisseri, Alberto; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartke, Jerzy Gustaw; Bartsch, Esther; Basile, Maurizio; Bastid, Nicole; Basu, Sumit; Bathen, Bastian; Batigne, Guillaume; Batista Camejo, Arianna; Batyunya, Boris; Batzing, Paul Christoph; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Espinoza Beltran, Lucina Gabriela; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhasin, Anju; Bhat, Inayat Rasool; Bhati, Ashok Kumar; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Livio; Bianchi, Nicola; Bianchin, Chiara; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biro, Gabor; Biswas, Rathijit; Biswas, Saikat; Bjelogrlic, Sandro; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Bock, Friederike; Bogdanov, Alexey; Boldizsar, Laszlo; Bombara, Marek; Bonora, Matthias; Book, Julian Heinz; Borel, Herve; Borissov, Alexander; Borri, Marcello; Botta, Elena; Bourjau, Christian; Braun-munzinger, Peter; Bregant, Marco; Broker, Theo Alexander; Browning, Tyler Allen; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buhler, Paul; Iga Buitron, Sergio Arturo; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Cabala, Jan; Caffarri, Davide; Caines, Helen Louise; Caliva, Alberto; Calvo Villar, Ernesto; Camerini, Paolo; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Cepila, Jan; Cerello, Piergiorgio; Cerkala, Jakub; Chang, Beomsu; Chapeland, Sylvain; Chartier, Marielle; Charvet, Jean-luc Fernand; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chauvin, Alex; Chelnokov, Volodymyr; Cherney, Michael Gerard; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Choi, Kyungeon; Chojnacki, Marek; Choudhury, Subikash; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Connors, Megan Elizabeth; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortes Maldonado, Ismael; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Crkovska, Jana; Crochet, Philippe; Cruz Albino, Rigoberto; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Danisch, Meike Charlotte; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Derradi De Souza, Rafael; Deisting, Alexander; Deloff, Andrzej; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Nezza, Pasquale; Di Ruzza, Benedetto; Diaz Corchero, Miguel Angel; Dietel, Thomas; Dillenseger, Pascal; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Drozhzhova, Tatiana; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Duggal, Ashpreet Kaur; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Endress, Eric; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erhardt, Filip; Espagnon, Bruno; Esumi, Shinichi; Eulisse, Giulio; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Eyyubova, Gyulnara; Fabbietti, Laura; Fabris, Daniela; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Ferencei, Jozef; Fernandez Tellez, Arturo; Gonzalez Ferreiro, Elena; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiore, Enrichetta Maria; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Francisco, Audrey; Frankenfeld, Ulrich Michael; Fronze, Gabriele Gaetano; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gajdosova, Katarina; Gallio, Mauro; Duarte Galvan, Carlos; Gangadharan, Dhevan Raja; Ganoti, Paraskevi; Gao, Chaosong; Garabatos Cuadrado, Jose; Garcia-solis, Edmundo Javier; Garg, Kunal; Garg, Prakhar; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; De Leone Gay, Maria Beatriz; Germain, Marie; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Gladysz-dziadus, Ewa; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Sanchez Gonzalez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Greiner, Leo Clifford; Grelli, Alessandro; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Grion, Nevio; Gronefeld, Julius Maximilian; Grosse-oetringhaus, Jan Fiete; Grosso, Raffaele; Gruber, Lukas; Guber, Fedor; Guernane, Rachid; Guerzoni, Barbara; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Bautista Guzman, Irais; Haake, Rudiger; Hadjidakis, Cynthia Marie; Hamagaki, Hideki; Hamar, Gergoe; Hamon, Julien Charles; Harris, John William; Harton, Austin Vincent; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Hellbar, Ernst; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Herrera Corral, Gerardo Antonio; Herrmann, Florian; Hess, Benjamin Andreas; Hetland, Kristin Fanebust; Hillemanns, Hartmut; Hippolyte, Boris; Hladky, Jan; Horak, David; Hosokawa, Ritsuya; Hristov, Peter Zahariev; Hughes, Charles; Humanic, Thomas; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Ilkaev, Radiy; Inaba, Motoi; Ippolitov, Mikhail; Irfan, Muhammad; Isakov, Vladimir; Islam, Md Samsul; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacak, Barbara; Jacazio, Nicolo; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jahnke, Cristiane; Jakubowska, Monika Joanna; Janik, Malgorzata Anna; Pahula Hewage, Sandun; Jena, Chitrasen; Jena, Satyajit; Jimenez Bustamante, Raul Tonatiuh; Jones, Peter Graham; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karayan, Lilit; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Khan, Mohammed Mohisin; Khan, Palash; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Khatun, Anisa; Khuntia, Arvind; Kileng, Bjarte; Kim, Do Won; Kim, Dong Jo; Kim, Daehyeok; Kim, Hyeonjoong; Kim, Jinsook; Kim, Jiyoung; Kim, Minjung; Kim, Minwoo; Kim, Se Yong; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Kiss, Gabor; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobdaj, Chinorat; Kofarago, Monika; Kollegger, Thorsten; Kolozhvari, Anatoly; Kondratev, Valerii; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Kopcik, Michal; Kour, Mandeep; Kouzinopoulos, Charalampos; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Koyithatta Meethaleveedu, Greeshma; Kralik, Ivan; Kravcakova, Adela; Krivda, Marian; Krizek, Filip; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Ajay; Kumar, Jitendra; Kumar, Lokesh; Kumar, Shyam; Kundu, Sourav; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lagana Fernandes, Caio; Lakomov, Igor; Langoy, Rune; Lapidus, Kirill; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Lattuca, Alessandra; Laudi, Elisa; Lazaridis, Lazaros; Lea, Ramona; Leardini, Lucia; Lee, Seongjoo; Lehas, Fatiha; Lehner, Sebastian; Lehrbach, Johannes; Lemmon, Roy Crawford; Lenti, Vito; Leogrande, Emilia; Leon Monzon, Ildefonso; Levai, Peter; Li, Shuang; Li, Xiaomei; Lien, Jorgen Andre; Lietava, Roman; Lindal, Svein; Lindenstruth, Volker; Lippmann, Christian; Lisa, Michael Annan; Ljunggren, Hans Martin; Llope, William; Lodato, Davide Francesco; Lonne, Per-ivar; Loginov, Vitaly; Loizides, Constantinos; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Lunardon, Marcello; Luparello, Grazia; Lupi, Matteo; Lutz, Tyler Harrison; Maevskaya, Alla; Mager, Magnus; Mahajan, Sanjay; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Maldonado Cervantes, Ivonne Alicia; Malinina, Liudmila; Mal'kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Mao, Yaxian; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martinengo, Paolo; Martinez Hernandez, Mario Ivan; Martinez-garcia, Gines; Martinez Pedreira, Miguel; Mas, Alexis Jean-michel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Mastroserio, Annalisa; Matyja, Adam Tomasz; Mayer, Christoph; Mazer, Joel Anthony; Mazzilli, Marianna; Mazzoni, Alessandra Maria; Meddi, Franco; Melikyan, Yuri; Menchaca-rocha, Arturo Alejandro; Meninno, Elisa; Mercado-perez, Jorge; Meres, Michal; Mhlanga, Sibaliso; Miake, Yasuo; Mieskolainen, Matti Mikael; Mikhaylov, Konstantin; Milano, Leonardo; Milosevic, Jovan; Mischke, Andre; Mishra, Aditya Nath; Mishra, Tribeni; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Bedangadas; Molnar, Levente; Montes Prado, Esther; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munning, Konstantin; Munzer, Robert Helmut; Murakami, Hikari; Murray, Sean; Musa, Luciano; Musinsky, Jan; Myers, Corey James; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Naru, Muhammad Umair; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Rosado Navarro, Sebastian; Nayak, Kishora; Nayak, Ranjit; Nayak, Tapan Kumar; Nazarenko, Sergey; Nedosekin, Alexander; Negrao De Oliveira, Renato Aparecido; Nellen, Lukas; Ng, Fabian; Nicassio, Maria; Niculescu, Mihai; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Saehanseul; Ohlson, Alice Elisabeth; Okubo, Tsubasa; Olah, Laszlo; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Oravec, Matej; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Ozdemir, Mahmut; Pachmayer, Yvonne Chiara; Pacik, Vojtech; Pagano, Davide; Pagano, Paola; Paic, Guy; Pal, Susanta Kumar; Palni, Prabhakar; Pan, Jinjin; Pandey, Ashutosh Kumar; Papikyan, Vardanush; Pappalardo, Giuseppe; Pareek, Pooja; Park, Jonghan; Park, Woojin; Parmar, Sonia; Passfeld, Annika; Paticchio, Vincenzo; Patra, Rajendra Nath; Paul, Biswarup; Pei, Hua; Peitzmann, Thomas; Peng, Xinye; Pereira Da Costa, Hugo Denis Antonio; Peresunko, Dmitry Yurevich; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrov, Viacheslav; Petrovici, Mihai; Petta, Catia; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Ozelin De Lima Pimentel, Lais; Pinazza, Ombretta; Pinsky, Lawrence; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Poppenborg, Hendrik; Porteboeuf, Sarah Julie; Porter, R Jefferson; Pospisil, Jan; Pozdniakov, Valeriy; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Puddu, Giovanna; Pujahari, Prabhat Ranjan; Punin, Valery; Putschke, Jorn Henning; Qvigstad, Henrik; Rachevski, Alexandre; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Rana, Dhan Bahadur; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Ratza, Viktor; Ravasenga, Ivan; Read, Kenneth Francis; Redlich, Krzysztof; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reolon, Anna Rita; Reshetin, Andrey; Reygers, Klaus Johannes; Riabov, Viktor; Ricci, Renato Angelo; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-lucian; Rodriguez Cahuantzi, Mario; Roeed, Ketil; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Ronchetti, Federico; Ronflette, Lucile; Rosnet, Philippe; Rossi, Andrea; Roukoutakis, Filimon; Roy, Ankhi; Roy, Christelle Sophie; Roy, Pradip Kumar; Rubio Montero, Antonio Juan; Rui, Rinaldo; Russo, Riccardo; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Saarinen, Sampo; Sadhu, Samrangy; Sadovskiy, Sergey; Safarik, Karel; Sahlmuller, Baldo; Sahoo, Baidyanath; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Salzwedel, Jai Samuel Nielsen; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandoval, Andres; Sano, Masato; Sarkar, Debojit; Sarkar, Nachiketa; Sarma, Pranjal; Sas, Mike Henry Petrus; Scapparone, Eugenio; Scarlassara, Fernando; Scharenberg, Rolf Paul; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schmidt, Martin; Schukraft, Jurgen; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Scott, Rebecca Michelle; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sett, Priyanka; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shadura, Oksana; Shahoyan, Ruben; Shangaraev, Artem; Sharma, Ankita; Sharma, Anjali; Sharma, Mona; Sharma, Monika; Sharma, Natasha; Sheikh, Ashik Ikbal; Shigaki, Kenta; Shou, Qiye; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Silvestre, Catherine Micaela; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singhal, Vikas; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Song, Jihye; Song, Myunggeun; Song, Zixuan; Soramel, Francesca; Sorensen, Soren Pontoppidan; Sozzi, Federica; Spiriti, Eleuterio; Sputowska, Iwona Anna; Srivastava, Brijesh Kumar; Stachel, Johanna; Stan, Ionel; Stankus, Paul; Stenlund, Evert Anders; Steyn, Gideon Francois; Stiller, Johannes Hendrik; Stocco, Diego; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Sumowidagdo, Suharyo; Suzuki, Ken; Swain, Sagarika; Szabo, Alexander; Szarka, Imrich; Szczepankiewicz, Adam; Szymanski, Maciej Pawel; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terasaki, Kohei; Terrevoli, Cristina; Teyssier, Boris; Thakur, Dhananjaya; Thomas, Deepa; Tieulent, Raphael Noel; Tikhonov, Anatoly; Timmins, Anthony Robert; Toia, Alberica; Tripathy, Sushanta; Trogolo, Stefano; Trombetta, Giuseppe; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Umaka, Ejiro Naomi; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vala, Martin; Van Der Maarel, Jasper; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vanat, Tomas; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vazquez Doce, Oton; Vechernin, Vladimir; Veen, Annelies Marianne; Velure, Arild; Vercellin, Ermanno; Vergara Limon, Sergio; Vernet, Renaud; Vertesi, Robert; Vickovic, Linda; Vigolo, Sonia; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Vinogradov, Leonid; Virgili, Tiziano; Vislavicius, Vytautas; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Voscek, Dominik; Vranic, Danilo; Vrlakova, Janka; Wagner, Boris; Wagner, Jan; Wang, Hongkai; Wang, Mengliang; Watanabe, Daisuke; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Weiser, Dennis Franz; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Willems, Guido Alexander; Williams, Crispin; Windelband, Bernd Stefan; Winn, Michael Andreas; Witt, William Edward; Yalcin, Serpil; Yang, Ping; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correia Zanoli, Henrique Jose; Zaporozhets, Sergey; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhang, Yonghong; Chunhui, Zhang; Zhang, Zuman; Zhao, Chengxin; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zichichi, Antonino; Zimmermann, Alice; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zmeskal, Johann

2017-05-29

Electrons from heavy-flavour hadron decays (charm and beauty) were measured with the ALICE detector in Pb–Pb collisions at a centre-of-mass of energy $\\sqrt{s_{\\rm NN}}=2.76$ TeV. The transverse momentum ($p_{\\rm T}$) differential production yields at mid-rapidity were used to calculate the nuclear modification factor $R_{\\rm AA}$ in the interval $3R_{\\rm AA}$ shows a strong suppression compared to binary scaling of pp collisions at the same energy (up to a factor of 4) in the 10% most central Pb–Pb collisions. There is a centrality trend of suppression, and a weaker suppression (down to a factor of 2) in semi-peripheral (50–80%) collisions is observed. The suppression of electrons in this broad $p_{\\rm T}$ interval indicates that both charm and beauty quarks lose energy when they traverse the hot medium formed in Pb-Pb collisions at LHC.

arXiv Azimuthally-differential pion femtoscopy relative to the third harmonic event plane in Pb-Pb collisions at $\\mathbf{\\sqrt{\\textit{s}_{_{\\rm NN}}}}$ = 2.76 TeV

CERN Document Server

Acharya, Shreyasi; The ALICE collaboration; Adamova, Dagmar; Adolfsson, Jonatan; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Al-turany, Mohammad; Alam, Sk Noor; Silva De Albuquerque, Danilo; Aleksandrov, Dmitry; Alessandro, Bruno; Alfaro Molina, Jose Ruben; Ali, Yasir; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altenkamper, Lucas; Altsybeev, Igor; Andrei, Cristian; Andreou, Dimitra; Andrews, Harry Arthur; Andronic, Anton; Angeletti, Massimo; Anguelov, Venelin; Anson, Christopher Daniel; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Apadula, Nicole; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Ball, Markus; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barioglio, Luca; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartsch, Esther; Bastid, Nicole; Basu, Sumit; Batigne, Guillaume; Batyunya, Boris; Batzing, Paul Christoph; Bazo Alba, Jose Luis; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Espinoza Beltran, Lucina Gabriela; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhaduri, Partha Pratim; Bhasin, Anju; Bhat, Inayat Rasool; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Antonio; Bianchi, Livio; Bianchi, Nicola; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biro, Gabor; Biswas, Rathijit; Biswas, Saikat; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Boca, Gianluigi; Bock, Friederike; Bogdanov, Alexey; Boldizsar, Laszlo; Bombara, Marek; Bonomi, Germano; Bonora, Matthias; Borel, Herve; Borissov, Alexander; Borri, Marcello; Botta, Elena; Bourjau, Christian; Bratrud, Lars; Braun-munzinger, Peter; Bregant, Marco; Broker, Theo Alexander; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buhler, Paul; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Cabala, Jan; Caffarri, Davide; Caines, Helen Louise; Caliva, Alberto; Calvo Villar, Ernesto; Soto Camacho, Rabi; Camerini, Paolo; Capon, Aaron Allan; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Chandra, Sinjini; Chang, Beomsu; Chang, Wan; Chapeland, Sylvain; Chartier, Marielle; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chauvin, Alex; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Choudhury, Subikash; Chowdhury, Tasnuva; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Concas, Matteo; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Costanza, Susanna; Crkovska, Jana; Crochet, Philippe; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Danisch, Meike Charlotte; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Derradi De Souza, Rafael; Franz Degenhardt, Hermann; Deisting, Alexander; Deloff, Andrzej; Delsanto, Silvia; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Ruzza, Benedetto; Arteche Diaz, Raul; Dietel, Thomas; Dillenseger, Pascal; Ding, Yanchun; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Van Doremalen, Lennart Vincent; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dudi, Sandeep; Duggal, Ashpreet Kaur; Dukhishyam, Mallick; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Endress, Eric; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erhardt, Filip; Ersdal, Magnus Rentsch; Espagnon, Bruno; Eulisse, Giulio; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Fabbietti, Laura; Faggin, Mattia; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Fernandez Tellez, Arturo; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Francisco, Audrey; Frankenfeld, Ulrich Michael; Fronze, Gabriele Gaetano; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gajdosova, Katarina; Gallio, Mauro; Duarte Galvan, Carlos; Ganoti, Paraskevi; Garabatos Cuadrado, Jose; Garcia-solis, Edmundo Javier; Garg, Kunal; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; De Leone Gay, Maria Beatriz; Germain, Marie; Ghosh, Jhuma; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Greiner, Leo Clifford; Grelli, Alessandro; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Gronefeld, Julius Maximilian; Grosa, Fabrizio; Grosse-oetringhaus, Jan Fiete; Grosso, Raffaele; Guernane, Rachid; Guerzoni, Barbara; Guittiere, Manuel; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Bautista Guzman, Irais; Haake, Rudiger; Habib, Michael Karim; Hadjidakis, Cynthia Marie; Hamagaki, Hideki; Hamar, Gergoe; Hamon, Julien Charles; Haque, Md Rihan; Harris, John William; Harton, Austin Vincent; Hassan, Hadi; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Hellbar, Ernst; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Gonzalez Hernandez, Emma; Herrera Corral, Gerardo Antonio; Herrmann, Florian; Hetland, Kristin Fanebust; Hilden, Timo Eero; Hillemanns, Hartmut; Hills, Christopher; Hippolyte, Boris; Hohlweger, Bernhard; Horak, David; Hornung, Sebastian; Hosokawa, Ritsuya; Hristov, Peter Zahariev; Hughes, Charles; Huhn, Patrick; Humanic, Thomas; Hushnud, Hushnud; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Iddon, James Philip; Iga Buitron, Sergio Arturo; Ilkaev, Radiy; Inaba, Motoi; Ippolitov, Mikhail; Islam, Md Samsul; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacak, Barbara; Jacazio, Nicolo; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jaelani, Syaefudin; Jahnke, Cristiane; Jakubowska, Monika Joanna; Janik, Malgorzata Anna; Pahula Hewage, Sandun; Jena, Chitrasen; Jercic, Marko; Jimenez Bustamante, Raul Tonatiuh; Jones, Peter Graham; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karayan, Lilit; Karczmarczyk, Przemyslaw; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Ketzer, Bernhard Franz; Khabanova, Zhanna; Khan, Shaista; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Khatun, Anisa; Khuntia, Arvind; Kielbowicz, Miroslaw Marek; Kileng, Bjarte; Kim, Byungchul; Kim, Daehyeok; Kim, Dong Jo; Kim, Eun Joo; Kim, Hyeonjoong; Kim, Jinsook; Kim, Jiyoung; Kim, Minjung; Kim, Se Yong; Kim, Taejun; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Kiss, Gabor; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobdaj, Chinorat; Varga-kofarago, Monika; Kohler, Markus Konrad; Kollegger, Thorsten; Kondratev, Valerii; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Konyushikhin, Maxim; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Kralik, Ivan; Kravcakova, Adela; Kreis, Lukas; Krivda, Marian; Krizek, Filip; Kruger, Mario; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Jitendra; Kumar, Lokesh; Kumar, Shyam; Kundu, Sourav; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lagana Fernandes, Caio; Lai, Yue Shi; Lakomov, Igor; Langoy, Rune; Lapidus, Kirill; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Larionov, Pavel; Lattuca, Alessandra; Laudi, Elisa; Lavicka, Roman; Lea, Ramona; Leardini, Lucia; Lee, Seongjoo; Lehas, Fatiha; Lehner, Sebastian; Lehrbach, Johannes; Lemmon, Roy Crawford; Leogrande, Emilia; Leon Monzon, Ildefonso; Levai, Peter; Li, Xiaomei; Li, Xing Long; Lien, Jorgen Andre; Lietava, Roman; Lim, Bong-hwi; Lindal, Svein; Lindenstruth, Volker; Lindsay, Scott William; Lippmann, Christian; Lisa, Michael Annan; Litichevskyi, Vladyslav; Liu, Alwina; Ljunggren, Hans Martin; Llope, William; Lodato, Davide Francesco; Loginov, Vitaly; Loizides, Constantinos; Loncar, Petra; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Luhder, Jens Robert; Lunardon, Marcello; Luparello, Grazia; Lupi, Matteo; Maevskaya, Alla; Mager, Magnus; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Malinina, Liudmila; Mal'kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Mao, Yaxian; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martinengo, Paolo; Martinez Hernandez, Mario Ivan; Martinez-garcia, Gines; Martinez Pedreira, Miguel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Masson, Erwann; Mastroserio, Annalisa; Mathis, Andreas Michael; Toledo Matuoka, Paula Fernanda; Matyja, Adam Tomasz; Mayer, Christoph; Mazzilli, Marianna; Mazzoni, Alessandra Maria; Meddi, Franco; Melikyan, Yuri; Menchaca-rocha, Arturo Alejandro; Mercado-perez, Jorge; Meres, Michal; Soncco Meza, Carlos; Mhlanga, Sibaliso; Miake, Yasuo; Micheletti, Luca; Mieskolainen, Matti Mikael; Mihaylov, Dimitar Lubomirov; Mikhaylov, Konstantin; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Auro Prasad; Mohanty, Bedangadas; Khan, Mohammed Mohisin; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munning, Konstantin; Arratia Munoz, Miguel Ignacio; Munzer, Robert Helmut; Murakami, Hikari; Murray, Sean; Musa, Luciano; Musinsky, Jan; Myers, Corey James; Myrcha, Julian Wojciech; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Narayan, Amrendra; Naru, Muhammad Umair; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Rosado Navarro, Sebastian; Nayak, Kishora; Nayak, Ranjit; Nayak, Tapan Kumar; Nazarenko, Sergey; Negrao De Oliveira, Renato Aparecido; Nellen, Lukas; Nesbo, Simon Voigt; Neskovic, Gvozden; Ng, Fabian; Nicassio, Maria; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Hoonjung; Ohlson, Alice Elisabeth; Olah, Laszlo; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Oravec, Matej; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Pachmayer, Yvonne Chiara; Pacik, Vojtech; Pagano, Davide; Paic, Guy; Palni, Prabhakar; Pan, Jinjin; Pandey, Ashutosh Kumar; Panebianco, Stefano; Papikyan, Vardanush; Pareek, Pooja; Park, Jonghan; Parmar, Sonia; Passfeld, Annika; Pathak, Surya Prakash; Patra, Rajendra Nath; Paul, Biswarup; Pei, Hua; Peitzmann, Thomas; Peng, Xinye; Pereira, Luis Gustavo; Pereira Da Costa, Hugo Denis Antonio; Peresunko, Dmitry Yurevich; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrovici, Mihai; Petta, Catia; Peretti Pezzi, Rafael; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Ozelin De Lima Pimentel, Lais; Pinazza, Ombretta; Pinsky, Lawrence; Pisano, Silvia; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pliquett, Fabian; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Poppenborg, Hendrik; Porteboeuf, Sarah Julie; Pozdniakov, Valeriy; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Punin, Valery; Putschke, Jorn Henning; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Rana, Dhan Bahadur; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Ratza, Viktor; Ravasenga, Ivan; Read, Kenneth Francis; Redlich, Krzysztof; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reshetin, Andrey; Revol, Jean-pierre; Reygers, Klaus Johannes; Riabov, Viktor; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-lucian; Rodriguez Cahuantzi, Mario; Roeed, Ketil; Rogalev, Roman; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Rokita, Przemyslaw Stefan; Ronchetti, Federico; Dominguez Rosas, Edgar; Roslon, Krystian; Rosnet, Philippe; Rossi, Andrea; Rotondi, Alberto; Roukoutakis, Filimon; Roy, Christelle Sophie; Roy, Pradip Kumar; Vazquez Rueda, Omar; Rui, Rinaldo; Rumyantsev, Boris; Rustamov, Anar; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Saarinen, Sampo; Sadhu, Samrangy; Sadovskiy, Sergey; Safarik, Karel; Saha, Sumit Kumar; Sahoo, Baidyanath; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandoval, Andres; Sarkar, Amal; Sarkar, Debojit; Sarkar, Nachiketa; Sarma, Pranjal; Sas, Mike Henry Petrus; Scapparone, Eugenio; Scarlassara, Fernando; Schaefer, Brennan; Scheid, Horst Sebastian; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schmidt, Marten Ole; Schmidt, Martin; Schmidt, Nicolas Vincent; Schukraft, Jurgen; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sett, Priyanka; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shahoyan, Ruben; Shaikh, Wadut; Shangaraev, Artem; Sharma, Anjali; Sharma, Ankita; Sharma, Natasha; Sheikh, Ashik Ikbal; Shigaki, Kenta; Shimomura, Maya; Shirinkin, Sergey; Shou, Qiye; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silaeva, Svetlana; Silvermyr, David Olle Rickard; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singhal, Vikas; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Song, Jihye; Soramel, Francesca; Sorensen, Soren Pontoppidan; Sozzi, Federica; Sputowska, Iwona Anna; Stachel, Johanna; Stan, Ionel; Stankus, Paul; Stenlund, Evert Anders; Stocco, Diego; Storetvedt, Maksim Melnik; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Sumowidagdo, Suharyo; Suzuki, Ken; Swain, Sagarika; Szabo, Alexander; Szarka, Imrich; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terrevoli, Cristina; Teyssier, Boris; Thakur, Dhananjaya; Thakur, Sanchari; Thomas, Deepa; Thoresen, Freja; Tieulent, Raphael Noel; Tikhonov, Anatoly; Timmins, Anthony Robert; Toia, Alberica; Topilskaya, Nataliya; Toppi, Marco; Rojas Torres, Solangel; Tripathy, Sushanta; Trogolo, Stefano; Trombetta, Giuseppe; Tropp, Lukas; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Trzcinski, Tomasz Piotr; Trzeciak, Barbara Antonina; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Umaka, Ejiro Naomi; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vala, Martin; Van Der Maarel, Jasper; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vanat, Tomas; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vazquez Doce, Oton; Vechernin, Vladimir; Veen, Annelies Marianne; Velure, Arild; Vercellin, Ermanno; Vergara Limon, Sergio; Vermunt, Luuk; Vernet, Renaud; Vertesi, Robert; Vickovic, Linda; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Vinogradov, Leonid; Virgili, Tiziano; Vislavicius, Vytautas; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Voscek, Dominik; Vranic, Danilo; Vrlakova, Janka; Wagner, Boris; Wang, Hongkai; Wang, Mengliang; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Wegrzynek, Adam; Weiser, Dennis Franz; Wenzel, Sandro Christian; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Willems, Guido Alexander; Williams, Crispin; Willsher, Emily; Windelband, Bernd Stefan; Witt, William Edward; Xu, Ran; Yalcin, Serpil; Yamakawa, Kosei; Yang, Ping; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correa Zanoli, Henrique Jose; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhang, Yonghong; Zhang, Zuman; Zhao, Chengxin; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zhu, Ya; Zichichi, Antonino; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zmeskal, Johann; Zou, Shuguang

2018-01-01

Azimuthally-differential femtoscopic measurements, being sensitive to spatio-temporal characteristics of the source as well as to the collective velocity fields at freeze out, provide very important information on the nature and dynamics of the system evolution. While the HBT radii oscillations relative to the second harmonic event plane measured recently reflect mostly the spatial geometry of the source, model studies have shown that the HBT radii oscillations relative to the third harmonic event plane are predominantly defined by the velocity fields. In this Letter, we present the first results on azimuthally-differential pion femtoscopy relative to the third harmonic event plane as a function of the pion pair transverse momentum $k_{\\rm T}$ for different collision centralities in Pb-Pb collisions at $\\sqrt{s_{\\rm NN}} = 2.76$ TeV. We find that the $R_{\\rm side}$ and $R_{\\rm out}$ radii, which characterize the pion source size in the directions perpendicular and parallel to the pion transverse momentum, osc...

Preliminary Physics Summary: Inclusive $\\Upsilon$ production in p-Pb collisions at $\\sqrt{s_{\\rm NN}} = 8.16$ TeV

CERN Document Server

2018-01-01

The inclusive $\\Upsilon$ production in p-Pb interactions at the centre-of-mass energy per nucleon-nucleon collision $\\sqrt{s_{\\rm NN}} = 8.16$ TeV is studied with the ALICE detector at the CERN LHC. The measurement has been performed reconstructing $\\Upsilon$(1S) and $\\Upsilon$(2S) mesons via their dimuon decay channel, in the centre-of-mass rapidities $2.03 < y_{\\rm cms} < 3.53$ and $-4.46 < y_{\\rm cms} < -2.96$, down to zero transverse momentum. Preliminary results on the inclusive $\\Upsilon$(1S) nuclear modification factors ($R_{\\rm pPb}$) as a function of rapidity, transverse momentum ($p_{\\rm T}$) and centrality of the collisions will be presented. The results will be compared with those obtained by ALICE in p-Pb collisions at $\\sqrt{s_{\\rm NN}} = 8.16$ TeV and with theoretical model calculations. The inclusive $\\Upsilon$(2S) $R_{\\rm pPb}$ will also be discussed and compared to the corresponding $\\Upsilon(1S)$ measurement.

Transduplication resulted in the incorporation of two protein-coding sequences into the Turmoil-1 transposable element of C. elegans

Directory of Open Access Journals (Sweden)

Pupko Tal

2008-10-01

Full Text Available Abstract Transposable elements may acquire unrelated gene fragments into their sequences in a process called transduplication. Transduplication of protein-coding genes is common in plants, but is unknown of in animals. Here, we report that the Turmoil-1 transposable element in C. elegans has incorporated two protein-coding sequences into its inverted terminal repeat (ITR sequences. The ITRs of Turmoil-1 contain a conserved RNA recognition motif (RRM that originated from the rsp-2 gene and a fragment from the protein-coding region of the cpg-3 gene. We further report that an open reading frame specific to C. elegans may have been created as a result of a Turmoil-1 insertion. Mutations at the 5' splice site of this open reading frame may have reactivated the transduplicated RRM motif. Reviewers This article was reviewed by Dan Graur and William Martin. For the full reviews, please go to the Reviewers' Reports section.

Development of Commercial Applications of a FAPY Alloy; TOPICAL

International Nuclear Information System (INIS)

Sikka, VK

2001-01-01

The Fe-16 at. (8.5 wt)% Al alloy, known as FAPY, has been identified as a superior material for heating element applications. However, while the 15-lb heats melted at the Oak Ridge National Laboratory (ORNL) could be processed into wire, the large heat melted at Hoskins Manufacturing Company (Hoskins) could not be processed under commercial processing conditions. The primary objective of the Cooperative Research and Development Agreement (CRADA) was to demonstrate that wire of the FAPY alloy could be produced under commercial conditions from air-induction-melted (AIM) heats. The specific aspects of this CRADA included: (1) Melting 15-lb heats by AIM or vacuum-induction melting (VIM) at ORNL. (2) Development of detailed processing steps including warm drawing and annealing temperature and time during cold-drawing steps. (3) Melting of 1400-lb heats at Hoskins by the Exo-Melt(trademark) process and their chemical analysis and microstructural characterization. (4) Development of tensile properties of sections of ingots from the large heats in the as-cast, hot-worked, and hot- and cold-worked conditions. (5) Microstructural characterization of cast and wrought structures and the fractured specimens. (6) Successful demonstration of processing of AIM heats at Hoskins to heating element wire. The aspects of this CRADA listed above have demonstrated that the FAPY alloy of the desired composition can be commercially produced by AIM by the use of the Exo-Melt(trademark) process. Furthermore, it also demonstrated that the wire processing steps developed for 15-lb heats at ORNL can be successfully applied to the production of wire from the large AIM heats

Schedulability Analysis for Java Finalizers

DEFF Research Database (Denmark)

Bøgholm, Thomas; Hansen, Rene Rydhof; Søndergaard, Hans

2010-01-01

Java finalizers perform clean-up and finalisation of objects at garbage collection time. In real-time Java profiles the use of finalizers is either discouraged (RTSJ, Ravenscar Java) or even disallowed (JSR-302), mainly because of the unpredictability of finalizers and in particular their impact...... on the schedulability analysis. In this paper we show that a controlled scoped memory model results in a structured and predictable execution of finalizers, more reminiscent of C++ destructors than Java finalizers. Furthermore, we incorporate finalizers into a (conservative) schedulability analysis for Predictable Java...... programs. Finally, we extend the SARTS tool for automated schedulability analysis of Java bytecode programs to handle finalizers in a fully automated way....

Air-Source Integrated Heat Pump System Development – Final Report

Energy Technology Data Exchange (ETDEWEB)

Baxter, Van D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Rice, C. Keith [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Munk, Jeffrey D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ally, Moonis R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Shen, Bo [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Uselton, R. B. [Lennox Industries, Inc., Knoxville, TN (United States)

2017-07-01

Between October 2007 and September 2017, Oak Ridge National Laboratory (ORNL) and Lennox Industries, Inc. (Lennox) engaged in a Cooperative Research and Development Agreement (CRADA) to develop an air-source integrated heat pump (AS-IHP) system for the US residential market. The Lennox AS-IHP concept consisted of a high-efficiency air-source heat pump (ASHP) for space heating and cooling services and a separate heat pump water heater/dehumidifier (WH/DH) module for domestic water heating and dehumidification (DH) services. A key feature of this system approach with the separate WH/DH is capability to pretreat (i.e., dehumidify) ventilation air and dedicated whole-house DH independent of the ASHP. Two generations of laboratory prototype WH/DH units were designed, fabricated, and lab tested. Performance maps for the system were developed using the latest research version of the US Department of Energy/ORNL heat pump design model (Rice 1992; Rice and Jackson 2005; Shen et al. 2012) as calibrated against the lab test data. These maps served as the input to TRNSYS (Solar Energy Laboratory et al. 2010) to predict annual performance relative to a baseline suite of equipment meeting minimum efficiency standards in effect in 2006 (i.e., a combination of an ASHP with a seasonal energy efficiency ratio (SEER) of 13 and resistance water heater with an energy factor (EF) of 0.9). Predicted total annual energy savings (based on use of a two-speed ASHP and the second-generation WH/DH prototype for the AS-IHP), while providing space conditioning, water heating, and dehumidification for a tight, well-insulated 2600 ft2 (242 m2) house at three US locations, ranged from 33 to 36%, averaging 35%, relative to the baseline system. The lowest savings were seen at the cold-climate Chicago location. Predicted energy use for water heating was reduced by about 50 to 60% relative to a resistance WH.

Studies on Post-Irradiation DNA Degradation in Micrococcus Radiodurans, Strain RII51

DEFF Research Database (Denmark)

Auda, H.; Emborg, C.

1973-01-01

The influence of irradiation condition on post-irradiation DNA degradation was studied in a radiation resistant mutant of M. radiodurans, strain ${\\rm R}_{{\\rm II}}5$. After irradiation with 1 Mrad or higher more DNA is degraded in cells irradiated in wet condition than in cells irradiated with t...

Multi-trait and random regression mature weight heritability and ...

African Journals Online (AJOL)

Legendre polynomials of orders 4, 3, 6 and 3 were used for animal and maternal genetic and permanent environmental effects, respectively, considering five classes of residual variances. Mature weight (five years) direct heritability estimates were 0.35 (MM) and 0.38 (RRM). Rank correlation between sires' breeding values ...

Quality of service management efficient scheme for the universal mobile telecommunications system

Directory of Open Access Journals (Sweden)

E. Zaleta–Alejandre

2008-04-01

Full Text Available This research work proposes a new Radio Resource Management (RRM scheme in order to accomplish the Quality of Service (QoS management for the Universal Mobile Telecommunications System (UMTS. The solution is based on UMTS standardization and a performance evaluation is presented to demonstrate its efficiency.

Personality disorder in convicted Jamaican murderers.

Science.gov (United States)

Hickling, F W; Walcott, G

2013-01-01

To establish the aetiology and historical prevalence of personality disorder in violent homicidal men in Jamaica. Examination and analysis of primary data from the psychosocial case study interviews of 36 convicted murderers from the Jamaican Government Barnett Commission of Enquiry in 1976. The disaggregated social and clinical data were analysed using a Chi-square statistical analysis. The mean age at time of arrest for the male convicted murderers was 24.26 ± 8.48 years. Twenty-three (66%) of the subjects had loving relationships with mothers, particularly in those men reared in the rural areas. Twenty-one (59%) cases showed marked paternal rejection and absence of integrated family life. Twenty-four (69%) of the cases experienced severe parental disciplinary methods, and two-thirds were illiterate or barely literate. Twenty-nine (83%) were from very poor socio-economic conditions. Thirty (86%) of all the murder victims were adult males. There were significant differences between the urban reared murderers (URM) and rural reared murderers (RRM). Sixteen (94%) of the victims of the URM ensued from robbery and police confrontation, while 13 (72%) of the victims of the RRM resulted from domestic disputes (p < 0.00). Seventeen (49%) of the men had normal personalities; 18 (51%) were diagnosed as having antisocial and inadequate personalities. Diagnosis of primary data using Diagnostic and Statistical Manual of Mental Disorders fourth edition, text revision (DSM-IV-TR) criteria revealed 23 (66%) men with Antisocial Personality Disorder (APD). There were significantly more APD in the URM than the RRM (p < 0.01). Antisocial personality disorder as an aetiological precursor of homicidal violence represents a major public health problem in contemporary Jamaica.

DIMEC - Final Report

DEFF Research Database (Denmark)

Conrad, Finn

1997-01-01

Final report of the research project DIMEC - Danish InfoMechatronic Control supported by the Danish Technical Research Council, STVF.......Final report of the research project DIMEC - Danish InfoMechatronic Control supported by the Danish Technical Research Council, STVF....

Final Technical Report

Energy Technology Data Exchange (ETDEWEB)

Glasser, Alan H. [Fusion Theory and Computation Inc., Kingston, WA (United States)

2018-02-02

Final technical report on DE-SC0016106. This is the final technical report for a portion of the multi-institutional CEMM project. This report is centered around 3 publications and a seminar presentation, which have been submitted to E-Link.

Application of random regression models to the genetic evaluation ...

African Journals Online (AJOL)

The model included fixed regression on AM (range from 30 to 138 mo) and the effect of herd-measurement date concatenation. Random parts of the model were RRM coefficients for additive and permanent environmental effects, while residual effects were modelled to account for heterogeneity of variance by AY. Estimates ...

Ionic Liquids as Multi-Functional Lubricant Additives to Enhance Engine Efficiency (final report NFE-12-03876)

Energy Technology Data Exchange (ETDEWEB)

Qu, Jun [ORNL; Barnhill, William C [ORNL; Luo, Huimin [ORNL; Toops, Todd J [ORNL; West, Brian H [ORNL; Blau, Peter Julian [ORNL; Dai, Sheng [ORNL; Papke, Brian L [Shell Global Solutions (US); Gao, Hong [Shell Global Solutions (US); Kheireddin, Bassem [Shell Global Solutions (US); Chen, Cheng [Shell Global Solutions (US)

2016-04-01

This ORNL-Shell CRADA developed and investigated ionic liquids (ILs) as multifunctional additives for next-generation low-viscosity engine oils. Several groups of oil-miscible ILs were successfully designed and synthesized with high thermal stability, non-corrosiveness, excellent wettability, and most importantly effective anti-scuffing/anti-wear and friction reduction characteristics. Synergistic effects between the common anti-wear additive zinc dialkyldithiophosphate (ZDDP) and a particular group of ILs were discovered with > 30% friction reduction and 70% wear reduction compared with using ZDDP or IL alone. The IL+ZDDP tribofilm distinguishes itself from the IL or ZDDP tribofilms with substantially higher contents of metal phosphates but less metal oxides and sulfur compounds. Notably, it was revealed that the actual concentrations of functional elements on the droplet surface of the oil containing IL+ZDDP are one order magnitude higher than their nominal values. Such significantly increased concentrations of anti-wear agents are presumably expected for the oilsolid interface and believed to be responsible for the superior lubricating performance. A prototype SAE 0W-16 engine oil using a synergistic IL+ZDDP pair as the anti-wear additive has been formulated based on the compatibility between the IL and other additives. Sequence VIE full-scale engine dynamometer tests demonstrated fuel economy improvement (FEI) for this prototype oil and revealed the individual contributions from the lower oil viscosity and reduced boundary friction. The impact of IL and IL+ZDDP on exhaust emission catalyst was investigated using an accelerated small engine aging test and results were benchmarked against ZDDP.

Economic and Performance Analysis of Gear Box Failures. Cooperative Research and Development Final Report, CRADA Number CRD-07-236

Energy Technology Data Exchange (ETDEWEB)

Keller, Jonathan [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2015-10-01

The National Renewable Energy Laboratory (NREL) in Golden, CO, USA is forming a collaborative within the wind energy industry to address reliability issues on wind turbines. The National Wind Technology Center (NWTC), leading the collaborative effort, will allow gearbox manufacturers, bearing manufacturers, wind turbine owner/operators, and wind turbine manufacturers to team up for joint projects that address specific issues regarding design and reliability of wind turbine gearboxes. The primary means of investigation will be through full scale testing and analysis of actual gearboxes, both in the field and in the NREL 2.5 MW dynamometer test facility. These teams would contribute resources into a campaign that is intended to serve the mutual interests of a majority of the wind and gearbox industry stakeholders in addition to the specific project team objectives. that address specific issues regarding design and reliability of wind turbine gearboxes. The primary means of investigation will be through full scale testing and analysis of actual gearboxes, both in the field and in the NREL 2.5 MW dynamometer test facility. These teams would contribute resources into a campaign that is intended to serve the mutual interests of a majority of the wind and gearbox industry stakeholders in addition to the specific project team objectives.

A Compact, Portable, Reduced-Cost, Gamma Ray Spectroscopic System for Nuclear Verification Final Report CRADA No. TSB-1551-98

Energy Technology Data Exchange (ETDEWEB)

Lavietes, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kalkhoran, N. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-10-19

The overall goal of this project was to demonstrate a compact gamma-ray spectroscopic system with better energy resolution and lower costs than scintillator-based detector systems for uranium enrichment analysis applications.

Fabrication, Tuning, Treatment and Testing of Two 3.5 Cell Photo-Injektor Cavities for the ELBE Linac

CERN Document Server

Arnold, A; Teichert, J; Xiang, R; Eremeev, G V; Kneisel, P; Stirbet, M; Turlington, L

2011-01-01

As part of a CRADA (Cooperative Research and Development Agreement) between Helmholtz-Zentrum Dresden-Rossendorf (HZDR) and Thomas Jefferson Lab National Accelerator Facility (TJNAF) we have fabricated and tested two 1.3 GHz 3.5 cell photo-injector cavities from polycrystalline RRR niobium and large grain RRR niobium, respectively. The cavity with the better performance will replace the presently used injector cavity in the ELBE linac [1]. The cavities have been fabricated and pre-tuned at TJNAF, while the more sophisticated final field tuning; the adjustment of the external couplings and the field profile measurement of transverse electric modes for RF focusing [2] was done at HZDR. The following standard surface treatment and the vertical test were carried out at TJNAF’s production facilities. A major challenge turned out to be the rinsing of the cathode cell, which has small opening (Ø10 mm) to receive the cathode stalk. Another unexpected problem encountered after etching, since large visible defects a...

Digital X-ray imager

CERN Document Server

LLNL &MedOptics Corporation

1998-01-01

The global objective of this cooperation was to lower the cost and improve the quality of breast health care in the United States. We planned to achieve it by designing a very high performance digital radiography unit for breast surgical specimen radiography in the operating room. These technical goals needed to be achieved at reasonable manufacturing costs to enable MedOptics to achieve high market penetration at a profit. Responsibility for overall project execution rested with MedOptics. MedOptics fabricated and demonstrated hardware, and selected components and handled the overall integration. After completion of this CRADA, MedOptics worked with collaborators to demonstrate clinical performance and utility. Finally, the company marketed the device. LLNL convened a multi-directorate expert panel for an intensive review of MedOptics point design. A written brief of panel conclusions and recommendations was prepared. In addition, LLNL was responsible for: computationally simulating the effects of varying so...

Characterization of three-way automotive catalysts

Energy Technology Data Exchange (ETDEWEB)

Kenik, E.A.; More, K.L. [Oak Ridge National Lab., TN (United States); LaBarge, W. [Delphi Automotive Systems, Flint, MI (United States)] [and others

1997-04-01

The CRADA between Delphi Automotive Systems (Delphi; formerly General Motors - AC Delco, Systems) and Lockheed Martin Energy Research (LMER) on automotive catalysts was completed at the end of FY96, after a ten month, no-cost extension. The CRADA was aimed at improved performance and lifetime of noble metal based three-way-catalysts (TWC), which are the primary catalytic system for automotive emission control systems. While these TWC can meet the currently required emission standards, higher than optimum noble metal loadings are often required to meet lifetime requirements. In addition, more stringent emission standards will be imposed in the near future, demanding improved performance and service life from these catalysts. Understanding the changes of TWC conversion efficiency with ageing is a critical need in improving these catalysts. Initially in a fresh catalyst, the active material is often distributed on a very fine scale, approaching single atoms or small atomic clusters. As such, a wide range of analytical techniques have been employed to provide high spatial resolution characterization of the evolving state of the catalytic material.

EPA and the Federal Technology Transfer Act: Opportunity knocks

Energy Technology Data Exchange (ETDEWEB)

Gatchett, A.M.; Fradkin, L.; Moore, M.; Gorman, T.; Ehrlich, A. [Environmental Protection Agency, Washington, DC (United States)

1990-12-31

In 1986, the Federal Technology Transfer Act (FTTA) was established to promote a closer, collaborative relationship between federal government agencies and the private sector. With the increasing need for new cost-effective technologies to prevent and control pollution, both the US Environmental Protection Agency (EPA) and private industry are encouraged to facilitate the transfer of knowledge and technology under this Act. The FTTA removed several of the legal and institutional barriers to cooperative research that existed before the Act`s passage. Through the FTTA, the government strives to promote the movement of its products, processes, skills, and knowledge into the private sector for further development and commercialization by encouraging the exchange of technical personnel and the sharing of facilities and other resources. Collaborative efforts between industry, federal agencies, and academia are made possible through cooperative research and development agreements (CRADAs). Forty-two CRADAs and five licensing agreements have been initiated with EPA under this program. This paper provides an overview of this new and innovative program within the EPA. 1 fig., 2 tabs.

Butanol / Gasoline Mercury CRADA Report

Science.gov (United States)

2015-03-01

synthetic rubber ) was replaced on 2 August 2013 with a Flexdraw hose (constructed of NBR - Nitrile Butadiene Rubber ). The manufacturer of the Flexdraw hose...likely contributed to the failure in combination with the swelling of the rubber . It is also noted that the parts are about 20 durometer points softer

Gemcitabine-Based Chemotherapy in Adrenocortical Carcinoma: A Multicenter Study of Efficacy and Predictive Factors.

Science.gov (United States)

Henning, Judith E K; Deutschbein, Timo; Altieri, Barbara; Steinhauer, Sonja; Kircher, Stefan; Sbiera, Silviu; Wild, Vanessa; Schlötelburg, Wiebke; Kroiss, Matthias; Perotti, Paola; Rosenwald, Andreas; Berruti, Alfredo; Fassnacht, Martin; Ronchi, Cristina L

2017-11-01

Adrenocortical carcinoma (ACC) is rare and confers an unfavorable prognosis in advanced stages. Other than combination chemotherapy with cisplatin, etoposide, doxorubicin, and mitotane, the second- and third-line regimens are not well-established. Gemcitabine (GEM)-based chemotherapy was suggested in a phase 2 clinical trial with 28 patients. In other solid tumors, human equilibrative nucleoside transporter type 1 (hENT1) and/or ribonucleotide reductase catalytic subunit M1 (RRM1) expression have been associated with resistance to GEM. To assess the efficacy of GEM-based chemotherapy in ACC in a real-world setting and the predictive role of molecular parameters. Retrospective multicenter study. Referral centers of university hospitals. A total of 145 patients with advanced ACC were treated with GEM-based chemotherapy (132 with concomitant capecitabine). Formalin-fixed paraffin-embedded tumor material was available for 70 patients for immunohistochemistry. The main outcome measures were progression-free survival (PFS) and an objective response to GEM-based chemotherapy. The secondary objective was the predictive role of hENT1 and RRM1. The median PFS for the patient population was 12 weeks (range, 1 to 94). A partial response or stable disease was achieved in 4.9% and 25.0% of cases, with a median duration of 26.8 weeks. Treatment was generally well tolerated, with adverse events of grade 3 or 4 occurring in 11.0% of cases. No substantial effect of hENT1 and/or RRM1 expression was observed in response to GEM-based chemotherapy. GEM-based chemotherapy is a well-tolerated, but modestly active, regimen against advanced ACC. No reliable molecular predictive factors could be identified. Owing to the scarce alternative therapeutic options, GEM-based chemotherapy remains an important option for salvage treatment for advanced ACC. Copyright © 2017 Endocrine Society

Gemcitabine-Based Chemogene Therapy for Pancreatic Cancer Using Ad-dCK::UMK GDEPT and TS/RR siRNA Strategies

Directory of Open Access Journals (Sweden)

Soukaina Réjiba

2009-07-01

Full Text Available Gemcitabine is a first-line agent for advanced pancreatic cancer therapy. However, its efficacy is often limited by its poor intracellular metabolism and chemoresistance. To exert its antitumor activity, gemcitabine requires to be converted to its active triphosphate form. Thus, our aim was to improve gemcitabine activation using gene-directed enzyme prodrug therapy based on gemcitabine association with the deoxycytidine kinase::uridine monophosphate kinase fusion gene (dCK::UMK and small interference RNA directed against ribonucleotide reductase (RRM2 and thymidylate synthase (TS. In vitro, cytotoxicity was assessed by 3-[4,5-dimethylthiazol-2-yl]-3,5-diphenyl tetrazolium bromide and [3H]thymidine assays. Apoptosis-related gene expression and activity were analyzed by reverse transcription-polymerase chain reaction, Western blot, and ELISA. For in vivo studies, the treatment efficacy was evaluated on subcutaneous and orthotopic pancreatic tumor models. Our data indicated that cell exposure to gemcitabine induced a down-regulation of dCK expression and up-regulation of TS and RR expression in Panc1-resistant cells when compared with BxPc3- and HA-hpc2-sensitive cells. The combination of TS/RRM2 small interference RNA with Ad-dCK::UMK induced a 40-fold decrease of gemcitabine IC50 in Panc1 cells. This strong sensitization was associated to apoptosis induction with a remarkable increase in TRAIL expression and a diminution of gemcitabine-induced nuclear factor-κB activity. In vivo, the gemcitabine-based tritherapy strongly reduced tumor volumes and significantly prolonged mice survival. Moreover, we observed an obvious increase of apoptosis and decrease of cell proliferation in tumors receiving the tritherapy regimens. Together, these findings suggest that simultaneous TS/RRM2-gene silencing and dCK::UMK gene overexpression markedly improved gemcitabine's therapeutic activity. Clearly, this combined strategy warrants further investigation.

Measurement of the D-meson nuclear modification factor and elliptic flow in Pb-Pb collisions at $\\sqrt{s_{\\rm NN}}=5.02~{\\rm TeV}$ with ALICE at the LHC arXiv

CERN Document Server

Grosa, Fabrizio

Heavy-flavour hadrons are recognised as a powerful probe for the characterisation of the deconfined medium created in heavy-ion collisions, the Quark-Gluon Plasma (QGP). The ALICE Collaboration measured the production of ${\\rm D}^{0}$, ${\\rm D}^{+}$, ${\\rm D}^*$ and ${\\rm D_s}^{+}$ mesons in Pb-Pb collisions at $\\sqrt{s_{\\rm NN}}=5.02~{\\rm TeV}$. The measurement of the nuclear modification factor ($R_{\\rm AA}$) provides a strong evidence of the in-medium parton energy loss. The comparison between the ${\\rm D_s}^{+}$ and the non-strange D-meson $R_{\\rm AA}$ can help to study the hadronisation mechanism of the charm quark in the QGP. In mid-central collisions, the measurement of the D-meson elliptic flow $v_2$ at low transverse momentum ($p_{\\rm T}$) gives insight into the participation of the charm quark into the collective motion of the system, while at high $p_{\\rm T}$ it constrains the path-length dependence of the energy loss. The ${\\rm D_s}^{+}$ $v_2$, measured for the first time at the LHC, is found to b...

Scaling of Elliptic Flow, Recombination and Sequential Freeze-Out of Hadrons in Heavy-Ion Collisions

Energy Technology Data Exchange (ETDEWEB)

Fries, R.; He, M., and Rapp, R.

2010-09-21

The scaling properties of elliptic flow of hadrons produced in ultrarelativistic heavy-ion collisions are investigated at low transverse momenta, p{sub T} {le} 2 GeV. Utilizing empirical parametrizations of a thermalized fireball with collective-flow fields, the resonance recombination model (RRM) is employed to describe hadronization via quark coalescence at the hadronization transition. We reconfirm that RRM converts equilibrium quark distribution functions into equilibrated hadron spectra including the effects of space-momentum correlations on elliptic flow. This provides the basis for a controlled extraction of quark distributions of the bulk matter at hadronization from spectra of multistrange hadrons which are believed to decouple close to the critical temperature. The resulting elliptic flow from empirical fits at the BNL Relativistic Heavy Ion Collider exhibits transverse kinetic-energy and valence-quark scaling. Utilizing the well-established concept of sequential freeze-out, the scaling at low momenta extends to bulk hadrons ({pi}, K, p) at thermal freeze-out, albeit with different source parameters compared to chemical freeze-out. Elliptic-flow scaling is thus compatible with both equilibrium hydrodynamics and quark recombination.

Measurement of jet suppression in central Pb-Pb collisions at $\\sqrt{s_{\\rm NN}}$ = 2.76 TeV

CERN Document Server

Adam, Jaroslav; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahmed, Ijaz; Ahn, Sang Un; Aimo, Ilaria; Aiola, Salvatore; Ajaz, Muhammad; Akindinov, Alexander; Alam, Sk Noor; Aleksandrov, Dmitry; Alessandro, Bruno; Alexandre, Didier; Alfaro Molina, Jose Ruben; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altinpinar, Sedat; Altsybeev, Igor; Alves Garcia Prado, Caio; Andrei, Cristian; Andronic, Anton; Anguelov, Venelin; Anielski, Jonas; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Armesto Perez, Nestor; Arnaldi, Roberta; Aronsson, Tomas; Arsene, Ionut Cristian; Arslandok, Mesut; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Bach, Matthias Jakob; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Ball, Markus; Baltasar Dos Santos Pedrosa, Fernando; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Bartke, Jerzy Gustaw; Bartsch, Esther; Basile, Maurizio; Bastid, Nicole; Basu, Sumit; Bathen, Bastian; Batigne, Guillaume; Batista Camejo, Arianna; Batyunya, Boris; Batzing, Paul Christoph; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Belmont Iii, Ronald John; Belmont Moreno, Ernesto; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Berceanu, Ionela; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhasin, Anju; Bhat, Inayat Rasool; Bhati, Ashok Kumar; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Livio; Bianchi, Nicola; Bianchin, Chiara; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biswas, Saikat; Bjelogrlic, Sandro; Blanco, Fernando; Blau, Dmitry; Blume, Christoph; Bock, Friederike; Bogdanov, Alexey; Boggild, Hans; Boldizsar, Laszlo; Bombara, Marek; Book, Julian Heinz; Borel, Herve; Borissov, Alexander; Borri, Marcello; Bossu, Francesco; Botje, Michiel; Botta, Elena; Boettger, Stefan; Braun-Munzinger, Peter; Bregant, Marco; Breitner, Timo Gunther; Broker, Theo Alexander; Browning, Tyler Allen; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Buxton, Jesse Thomas; Caffarri, Davide; Cai, Xu; Caines, Helen Louise; Calero Diaz, Liliet; Caliva, Alberto; Calvo Villar, Ernesto; Camerini, Paolo; Carena, Francesco; Carena, Wisla; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Cavicchioli, Costanza; Ceballos Sanchez, Cesar; Cepila, Jan; Cerello, Piergiorgio; Chang, Beomsu; Chapeland, Sylvain; Chartier, Marielle; Charvet, Jean-Luc Fernand; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chelnokov, Volodymyr; Cherney, Michael Gerard; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Chochula, Peter; Choi, Kyungeon; Chojnacki, Marek; Choudhury, Subikash; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-Urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Connors, Megan Elizabeth; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortes Maldonado, Ismael; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Crochet, Philippe; Cruz Albino, Rigoberto; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Deisting, Alexander; Deloff, Andrzej; Denes, Ervin Sandor; D'Erasmo, Ginevra; Di Bari, Domenico; Di Mauro, Antonio; Di Nezza, Pasquale; Diaz Corchero, Miguel Angel; Dietel, Thomas; Dillenseger, Pascal; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Dobrowolski, Tadeusz Antoni; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Engel, Heiko; Erazmus, Barbara Ewa; Erhardt, Filip; Eschweiler, Dominic; Espagnon, Bruno; Estienne, Magali Danielle; Esumi, Shinichi; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Eyyubova, Gyulnara; Fabbietti, Laura; Fabris, Daniela; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Felea, Daniel; Feliciello, Alessandro; Feofilov, Grigorii; Ferencei, Jozef; Fernandez Tellez, Arturo; Gonzalez Ferreiro, Elena; Ferretti, Alessandro; Festanti, Andrea; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiore, Enrichetta Maria; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Frankenfeld, Ulrich Michael; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gallio, Mauro; Gangadharan, Dhevan Raja; Ganoti, Paraskevi; Gao, Chaosong; Garabatos Cuadrado, Jose; Garcia-Solis, Edmundo Javier; Gargiulo, Corrado; Gasik, Piotr Jan; Germain, Marie; Gheata, Andrei George; Gheata, Mihaela; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Gladysz-Dziadus, Ewa; Glassel, Peter; Gomez Ramirez, Andres; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Grelli, Alessandro; Grigoras, Alina Gabriela; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Grynyov, Borys; Grion, Nevio; Grosse-Oetringhaus, Jan Fiete; Grossiord, Jean-Yves; Grosso, Raffaele; Guber, Fedor; Guernane, Rachid; Guerzoni, Barbara; Gulbrandsen, Kristjan Herlache; Gulkanyan, Hrant; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Haake, Rudiger; Haaland, Oystein Senneset; Hadjidakis, Cynthia Marie; Haiduc, Maria; Hamagaki, Hideki; Hamar, Gergoe; Hanratty, Luke David; Hansen, Alexander; Harris, John William; Hartmann, Helvi; Harton, Austin Vincent; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Heide, Markus Ansgar; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Herrera Corral, Gerardo Antonio; Hess, Benjamin Andreas; Hetland, Kristin Fanebust; Hilden, Timo Eero; Hillemanns, Hartmut; Hippolyte, Boris; Hristov, Peter Zahariev; Huang, Meidana; Humanic, Thomas; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Ilkaev, Radiy; Ilkiv, Iryna; Inaba, Motoi; Ionita, Costin; Ippolitov, Mikhail; Irfan, Muhammad; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacobs, Peter Martin; Jahnke, Cristiane; Jang, Haeng Jin; Janik, Malgorzata Anna; Pahula Hewage, Sandun; Jena, Chitrasen; Jena, Satyajit; Jimenez Bustamante, Raul Tonatiuh; Jones, Peter Graham; Jung, Hyungtaik; Jusko, Anton; Kadyshevskiy, Vladimir; Kalinak, Peter; Kalweit, Alexander Philipp; Kamin, Jason Adrian; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Khan, Kamal; Khan, Mohammed Mohisin; Khan, Palash; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Kileng, Bjarte; Kim, Beomkyu; Kim, Do Won; Kim, Dong Jo; Kim, Hyeonjoong; Kim, Jinsook; Kim, Mimae; Kim, Minwoo; Kim, Se Yong; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Kiss, Gabor; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-Boesing, Christian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobayashi, Taiyo; Kobdaj, Chinorat; Kofarago, Monika; Kohler, Markus Konrad; Kollegger, Thorsten; Kolozhvari, Anatoly; Kondratev, Valerii; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Kouzinopoulos, Charalampos; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Kox, Serge; Koyithatta Meethaleveedu, Greeshma; Kral, Jiri; Kralik, Ivan; Kravcakova, Adela; Krelina, Michal; Kretz, Matthias; Krivda, Marian; Krizek, Filip; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kucheryaev, Yury; Kugathasan, Thanushan; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kulakov, Igor; Kumar, Jitendra; Lokesh, Kumar; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lagana Fernandes, Caio; Lakomov, Igor; Langoy, Rune; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Lattuca, Alessandra; Laudi, Elisa; Lea, Ramona; Leardini, Lucia; Lee, Graham Richard; Lee, Seongjoo; Legrand, Iosif; Lehnert, Joerg Walter; Lemmon, Roy Crawford; Lenti, Vito; Leogrande, Emilia; Leon Monzon, Ildefonso; Leoncino, Marco; Levai, Peter; Li, Shuang; Li, Xiaomei; Lien, Jorgen Andre; Lietava, Roman; Lindal, Svein; Lindenstruth, Volker; Lippmann, Christian; Lisa, Michael Annan; Ljunggren, Hans Martin; Lodato, Davide Francesco; Lonne, Per-Ivar; Loggins, Vera Renee; Loginov, Vitaly; Loizides, Constantinos; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Lu, Xianguo; Luettig, Philipp Johannes; Lunardon, Marcello; Luparello, Grazia; Maevskaya, Alla; Mager, Magnus; Mahajan, Sanjay; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Maldonado Cervantes, Ivonne Alicia; Malinina, Liudmila; Mal'Kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manceau, Loic Henri Antoine; Manko, Vladislav; Manso, Franck; Manzari, Vito; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martin Blanco, Javier; Martinengo, Paolo; Martinez Hernandez, Mario Ivan; Martinez-Garcia, Gines; Martinez Pedreira, Miguel; Martynov, Yevgen; Mas, Alexis Jean-Michel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Mastroserio, Annalisa; Masui, Hiroshi; Matyja, Adam Tomasz; Mayer, Christoph; Mazer, Joel Anthony; Mazzoni, Alessandra Maria; Mcdonald, Daniel; Meddi, Franco; Menchaca-Rocha, Arturo Alejandro; Meninno, Elisa; Mercado-Perez, Jorge; Meres, Michal; Miake, Yasuo; Mieskolainen, Matti Mikael; Mikhaylov, Konstantin; Milano, Leonardo; Milosevic, Jovan; Minervini, Lazzaro Manlio; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Bedangadas; Molnar, Levente; Montano Zetina, Luis Manuel; Montes Prado, Esther; Morando, Maurizio; Moreira De Godoy, Denise Aparecida; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Muller, Hans; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Murray, Sean; Musa, Luciano; Musinsky, Jan; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Naru, Muhammad Umair; Nattrass, Christine; Nayak, Kishora; Nayak, Tapan Kumar; Nazarenko, Sergey; Nedosekin, Alexander; Nellen, Lukas; Ng, Fabian; Nicassio, Maria; Niculescu, Mihai; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Saehanseul; Oh, Sun Kun; Ohlson, Alice Elisabeth; Okatan, Ali; Okubo, Tsubasa; Olah, Laszlo; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Ozdemir, Mahmut; Pachmayer, Yvonne Chiara; Pagano, Paola; Paic, Guy; Pajares Vales, Carlos; Pal, Susanta Kumar; Pan, Jinjin; Pant, Divyash; Papikyan, Vardanush; Pappalardo, Giuseppe; Pareek, Pooja; Park, Woojin; Parmar, Sonia; Passfeld, Annika; Paticchio, Vincenzo; Paul, Biswarup; Pawlak, Tomasz Jan; Peitzmann, Thomas; Pereira Da Costa, Hugo Denis Antonio; Pereira De Oliveira Filho, Elienos; Peresunko, Dmitry Yurevich; Perez Lara, Carlos Eugenio; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrov, Viacheslav; Petrovici, Mihai; Petta, Catia; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Pinazza, Ombretta; Pinsky, Lawrence; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Porteboeuf, Sarah Julie; Porter, R Jefferson; Pospisil, Jan; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Puddu, Giovanna; Pujahari, Prabhat Ranjan; Punin, Valery; Putschke, Jorn Henning; Qvigstad, Henrik; Rachevski, Alexandre; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Read, Kenneth Francis; Real, Jean-Sebastien; Redlich, Krzysztof; Reed, Rosi Jan; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reicher, Martijn; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reolon, Anna Rita; Reshetin, Andrey; Rettig, Felix Vincenz; Revol, Jean-Pierre; Reygers, Klaus Johannes; Riabov, Viktor; Ricci, Renato Angelo; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-Lucian; Rivetti, Angelo; Rocco, Elena; Rodriguez Cahuantzi, Mario; Rodriguez Manso, Alis; Roeed, Ketil; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Romita, Rosa; Ronchetti, Federico; Ronflette, Lucile; Rosnet, Philippe; Rossi, Andrea; Roukoutakis, Filimon; Roy, Ankhi; Roy, Christelle Sophie; Roy, Pradip Kumar; Rubio Montero, Antonio Juan; Rui, Rinaldo; Russo, Riccardo; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Sadovskiy, Sergey; Safarik, Karel; Sahlmuller, Baldo; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Salgado Lopez, Carlos Alberto; Salzwedel, Jai Samuel Nielsen; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sanchez Castro, Xitzel; Sandor, Ladislav; Sandoval, Andres; Sano, Masato; Santagati, Gianluca; Sarkar, Debojit; Scapparone, Eugenio; Scarlassara, Fernando; Scharenberg, Rolf Paul; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schuchmann, Simone; Schukraft, Jurgen; Schulc, Martin; Schuster, Tim Robin; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Scott, Rebecca Michelle; Seeder, Karin Soraya; Seger, Janet Elizabeth; Sekiguchi, Yuko; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Seo, Jeewon; Serradilla Rodriguez, Eulogio; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shadura, Oksana; Shahoyan, Ruben; Shangaraev, Artem; Sharma, Ankita; Sharma, Natasha; Shigaki, Kenta; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Silvestre, Catherine Micaela; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singha, Subhash; Singhal, Vikas; Sinha, Bikash; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Soegaard, Carsten; Soltz, Ron Ariel; Song, Jihye; Song, Myunggeun; Song, Zixuan; Soramel, Francesca; Sorensen, Soren Pontoppidan; Spacek, Michal; Spiriti, Eleuterio; Sputowska, Iwona Anna; Spyropoulou-Stassinaki, Martha; Srivastava, Brijesh Kumar; Stachel, Johanna; Stan, Ionel; Stefanek, Grzegorz; Steinpreis, Matthew Donald; Stenlund, Evert Anders; Steyn, Gideon Francois; Stiller, Johannes Hendrik; Stocco, Diego; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Sultanov, Rishat; Sumbera, Michal; Symons, Timothy; Szabo, Alexander; Szanto De Toledo, Alejandro; Szarka, Imrich; Szczepankiewicz, Adam; Szymanski, Maciej Pawel; Takahashi, Jun; Tanaka, Naoto; Tangaro, Marco-Antonio; Tapia Takaki, Daniel Jesus; Tarantola Peloni, Attilio; Tariq, Mohammad; Tarzila, Madalina-Gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terasaki, Kohei; Terrevoli, Cristina; Teyssier, Boris; Thaeder, Jochen Mathias; Thomas, Deepa; Tieulent, Raphael Noel; Timmins, Anthony Robert; Toia, Alberica; Trogolo, Stefano; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vajzer, Michal; Vala, Martin; Valencia Palomo, Lizardo; Vallero, Sara; Van Der Maarel, Jasper; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vanat, Tomas; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vechernin, Vladimir; Veen, Annelies Marianne; Veldhoen, Misha; Velure, Arild; Venaruzzo, Massimo; Vercellin, Ermanno; Vergara Limon, Sergio; Vernet, Renaud; Verweij, Marta; Vickovic, Linda; Viesti, Giuseppe; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Vinogradov, Alexander; Vinogradov, Leonid; Vinogradov, Yury; Virgili, Tiziano; Vislavicius, Vytautas; Viyogi, Yogendra; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Vranic, Danilo; Vrlakova, Janka; Vulpescu, Bogdan; Vyushin, Alexey; Wagner, Boris; Wagner, Jan; Wang, Hongkai; Wang, Mengliang; Wang, Yifei; Watanabe, Daisuke; Weber, Michael; Weber, Steffen Georg; Wessels, Johannes Peter; Westerhoff, Uwe; Wiechula, Jens; Wikne, Jon; Wilde, Martin Rudolf; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Williams, Crispin; Windelband, Bernd Stefan; Winn, Michael Andreas; Yaldo, Chris G; Yamaguchi, Yorito; Yang, Hongyan; Yang, Ping; Yano, Satoshi; Yasnopolskiy, Stanislav; Yin, Zhongbao; Yokohama, Hiroki; Yoo, In-Kwon; Yurchenko, Volodymyr; Yushmanov, Igor; Zaborowska, Anna; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correia Zanoli, Henrique Jose; Zaporozhets, Sergey; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zgura, Sorin Ion; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhang, Yonghong; Zhao, Chengxin; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zhu, Xiangrong; Zichichi, Antonino; Zimmermann, Alice; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zyzak, Maksym

2015-04-22

The transverse momentum ($p_{\\rm T}$) spectrum and nuclear modification factor ($R_{\\rm AA}$) of reconstructed jets in 0-10% and 10-30% central Pb-Pb collisions at $\\sqrt{s_{\\rm NN}}=2.76$ TeV were measured. Jets were reconstructed from charged and neutral particles, utilizing the ALICE tracking detectors and Electromagnetic Calorimeter (EMCal), with the anti-$k_{\\rm T}$ jet algorithm with a resolution parameter of R=0.2. The jet $p_{\\rm T}$ spectra are reported in the pseudorapidity interval of $|{\\eta}_{\\rm jet}|5$ GeV/$c$ to suppress jets constructed from the combinatorial background in Pb-Pb collisions. The effect of the leading charged particle requirement has been studied in both pp and Pb-Pb collisions and has been shown to have negligible effects on the $R_{\\rm AA}$ within the uncertainties of the measurement. The nuclear modification factor is obtained by dividing the jet spectrum measured in Pb-Pb by that in pp collisions scaled by the number of independent nucleon-nucleon collisions estimated using...

Measurement of charged jet production cross sections and nuclear modification in p-Pb collisions at $\\sqrt{s_\\rm{NN}} = 5.02$ TeV

CERN Document Server

Adam, Jaroslav; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahn, Sang Un; Aimo, Ilaria; Aiola, Salvatore; Ajaz, Muhammad; Akindinov, Alexander; Alam, Sk Noor; Aleksandrov, Dmitry; Alessandro, Bruno; Alexandre, Didier; Alfaro Molina, Jose Ruben; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altinpinar, Sedat; Altsybeev, Igor; Alves Garcia Prado, Caio; Andrei, Cristian; Andronic, Anton; Anguelov, Venelin; Anielski, Jonas; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Armesto Perez, Nestor; Arnaldi, Roberta; Aronsson, Tomas; Arsene, Ionut Cristian; Arslandok, Mesut; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Bach, Matthias Jakob; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Baltasar Dos Santos Pedrosa, Fernando; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Bartke, Jerzy Gustaw; Bartsch, Esther; Basile, Maurizio; Bastid, Nicole; Basu, Sumit; Bathen, Bastian; Batigne, Guillaume; Batista Camejo, Arianna; Batyunya, Boris; Batzing, Paul Christoph; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Belmont Iii, Ronald John; Belmont Moreno, Ernesto; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Berceanu, Ionela; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhasin, Anju; Bhat, Inayat Rasool; Bhati, Ashok Kumar; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Livio; Bianchi, Nicola; Bianchin, Chiara; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biswas, Saikat; Bjelogrlic, Sandro; Blanco, Fernando; Blau, Dmitry; Blume, Christoph; Bock, Friederike; Bogdanov, Alexey; Boggild, Hans; Boldizsar, Laszlo; Bombara, Marek; Book, Julian Heinz; Borel, Herve; Borissov, Alexander; Borri, Marcello; Bossu, Francesco; Botje, Michiel; Botta, Elena; Boettger, Stefan; Braun-Munzinger, Peter; Bregant, Marco; Breitner, Timo Gunther; Broker, Theo Alexander; Browning, Tyler Allen; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Buxton, Jesse Thomas; Caffarri, Davide; Cai, Xu; Caines, Helen Louise; Calero Diaz, Liliet; Caliva, Alberto; Calvo Villar, Ernesto; Camerini, Paolo; Carena, Francesco; Carena, Wisla; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Cavicchioli, Costanza; Ceballos Sanchez, Cesar; Cepila, Jan; Cerello, Piergiorgio; Chang, Beomsu; Chapeland, Sylvain; Chartier, Marielle; Charvet, Jean-Luc Fernand; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chelnokov, Volodymyr; Cherney, Michael Gerard; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Chochula, Peter; Choi, Kyungeon; Chojnacki, Marek; Choudhury, Subikash; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-Urk; Zhang, Chunhui; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Connors, Megan Elizabeth; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortes Maldonado, Ismael; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Crochet, Philippe; Cruz Albino, Rigoberto; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Deisting, Alexander; Deloff, Andrzej; Denes, Ervin Sandor; D'Erasmo, Ginevra; Di Bari, Domenico; Di Mauro, Antonio; Di Nezza, Pasquale; Diaz Corchero, Miguel Angel; Dietel, Thomas; Dillenseger, Pascal; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Dobrowolski, Tadeusz Antoni; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Engel, Heiko; Erazmus, Barbara Ewa; Erhardt, Filip; Eschweiler, Dominic; Espagnon, Bruno; Estienne, Magali Danielle; Esumi, Shinichi; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Eyyubova, Gyulnara; Fabbietti, Laura; Fabris, Daniela; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Felea, Daniel; Feliciello, Alessandro; Feofilov, Grigorii; Ferencei, Jozef; Fernandez Tellez, Arturo; Gonzalez Ferreiro, Elena; Ferretti, Alessandro; Festanti, Andrea; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiore, Enrichetta Maria; Fleck, Martin Gabriel; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Frankenfeld, Ulrich Michael; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gallio, Mauro; Gangadharan, Dhevan Raja; Ganoti, Paraskevi; Gao, Chaosong; Garabatos Cuadrado, Jose; Garcia-Solis, Edmundo Javier; Gargiulo, Corrado; Gasik, Piotr Jan; Germain, Marie; Gheata, Andrei George; Gheata, Mihaela; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Gladysz-Dziadus, Ewa; Glassel, Peter; Gomez Ramirez, Andres; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Grelli, Alessandro; Grigoras, Alina Gabriela; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Grynyov, Borys; Grion, Nevio; Grosse-Oetringhaus, Jan Fiete; Grossiord, Jean-Yves; Grosso, Raffaele; Guber, Fedor; Guernane, Rachid; Guerzoni, Barbara; Gulbrandsen, Kristjan Herlache; Gulkanyan, Hrant; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Haake, Rudiger; Haaland, Oystein Senneset; Hadjidakis, Cynthia Marie; Haiduc, Maria; Hamagaki, Hideki; Hamar, Gergoe; Hanratty, Luke David; Hansen, Alexander; Harris, John William; Hartmann, Helvi; Harton, Austin Vincent; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Heide, Markus Ansgar; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Herrera Corral, Gerardo Antonio; Hess, Benjamin Andreas; Hetland, Kristin Fanebust; Hilden, Timo Eero; Hillemanns, Hartmut; Hippolyte, Boris; Hristov, Peter Zahariev; Huang, Meidana; Humanic, Thomas; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Ilkaev, Radiy; Ilkiv, Iryna; Inaba, Motoi; Ionita, Costin; Ippolitov, Mikhail; Irfan, Muhammad; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacobs, Peter Martin; Jahnke, Cristiane; Jang, Haeng Jin; Janik, Malgorzata Anna; Pahula Hewage, Sandun; Jena, Chitrasen; Jena, Satyajit; Jimenez Bustamante, Raul Tonatiuh; Jones, Peter Graham; Jung, Hyungtaik; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kamin, Jason Adrian; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Khan, Kamal; Khan, Mohammed Mohisin; Khan, Palash; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Kileng, Bjarte; Kim, Beomkyu; Kim, Do Won; Kim, Dong Jo; Kim, Hyeonjoong; Kim, Jinsook; Kim, Mimae; Kim, Minwoo; Kim, Se Yong; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Kiss, Gabor; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-Boesing, Christian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobayashi, Taiyo; Kobdaj, Chinorat; Kofarago, Monika; Kohler, Markus Konrad; Kollegger, Thorsten; Kolozhvari, Anatoly; Kondratev, Valerii; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Kouzinopoulos, Charalampos; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Kox, Serge; Koyithatta Meethaleveedu, Greeshma; Kral, Jiri; Kralik, Ivan; Kravcakova, Adela; Krelina, Michal; Kretz, Matthias; Krivda, Marian; Krizek, Filip; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kugathasan, Thanushan; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kulakov, Igor; Kumar, Jitendra; Lokesh, Kumar; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lagana Fernandes, Caio; Lakomov, Igor; Langoy, Rune; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Lattuca, Alessandra; Laudi, Elisa; Lea, Ramona; Leardini, Lucia; Lee, Graham Richard; Lee, Seongjoo; Legrand, Iosif; Lemmon, Roy Crawford; Lenti, Vito; Leogrande, Emilia; Leon Monzon, Ildefonso; Leoncino, Marco; Levai, Peter; Li, Shuang; Li, Xiaomei; Lien, Jorgen Andre; Lietava, Roman; Lindal, Svein; Lindenstruth, Volker; Lippmann, Christian; Lisa, Michael Annan; Ljunggren, Hans Martin; Lodato, Davide Francesco; Lonne, Per-Ivar; Loggins, Vera Renee; Loginov, Vitaly; Loizides, Constantinos; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Lunardon, Marcello; Luparello, Grazia; Ferreira Natal Da Luz, Pedro Hugo; Maevskaya, Alla; Mager, Magnus; Mahajan, Sanjay; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Maldonado Cervantes, Ivonne Alicia; Malinina, Liudmila; Mal'Kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manceau, Loic Henri Antoine; Manko, Vladislav; Manso, Franck; Manzari, Vito; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martin Blanco, Javier; Martinengo, Paolo; Martinez Hernandez, Mario Ivan; Martinez-Garcia, Gines; Martinez Pedreira, Miguel; Martynov, Yevgen; Mas, Alexis Jean-Michel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Mastroserio, Annalisa; Masui, Hiroshi; Matyja, Adam Tomasz; Mayer, Christoph; Mazer, Joel Anthony; Mazzoni, Alessandra Maria; Mcdonald, Daniel; Meddi, Franco; Menchaca-Rocha, Arturo Alejandro; Meninno, Elisa; Mercado-Perez, Jorge; Meres, Michal; Miake, Yasuo; Mieskolainen, Matti Mikael; Mikhaylov, Konstantin; Milano, Leonardo; Milosevic, Jovan; Minervini, Lazzaro Manlio; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Bedangadas; Molnar, Levente; Montano Zetina, Luis Manuel; Montes Prado, Esther; Morando, Maurizio; Moreira De Godoy, Denise Aparecida; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Muller, Hans; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Murray, Sean; Musa, Luciano; Musinsky, Jan; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Naru, Muhammad Umair; Nattrass, Christine; Nayak, Kishora; Nayak, Tapan Kumar; Nazarenko, Sergey; Nedosekin, Alexander; Nellen, Lukas; Ng, Fabian; Nicassio, Maria; Niculescu, Mihai; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Saehanseul; Oh, Sun Kun; Ohlson, Alice Elisabeth; Okatan, Ali; Okubo, Tsubasa; Olah, Laszlo; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Ozdemir, Mahmut; Pachmayer, Yvonne Chiara; Pagano, Paola; Paic, Guy; Pajares Vales, Carlos; Pal, Susanta Kumar; Pan, Jinjin; Pandey, Ashutosh Kumar; Pant, Divyash; Papikyan, Vardanush; Pappalardo, Giuseppe; Pareek, Pooja; Park, Woojin; Parmar, Sonia; Passfeld, Annika; Paticchio, Vincenzo; Paul, Biswarup; Peitzmann, Thomas; Pereira Da Costa, Hugo Denis Antonio; Pereira De Oliveira Filho, Elienos; Peresunko, Dmitry Yurevich; Perez Lara, Carlos Eugenio; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrov, Viacheslav; Petrovici, Mihai; Petta, Catia; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Pinazza, Ombretta; Pinsky, Lawrence; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Porteboeuf, Sarah Julie; Porter, R Jefferson; Pospisil, Jan; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Puddu, Giovanna; Pujahari, Prabhat Ranjan; Punin, Valery; Putschke, Jorn Henning; Qvigstad, Henrik; Rachevski, Alexandre; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Read, Kenneth Francis; Real, Jean-Sebastien; Redlich, Krzysztof; Reed, Rosi Jan; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reicher, Martijn; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reolon, Anna Rita; Reshetin, Andrey; Rettig, Felix Vincenz; Revol, Jean-Pierre; Reygers, Klaus Johannes; Riabov, Viktor; Ricci, Renato Angelo; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-Lucian; Rivetti, Angelo; Rocco, Elena; Rodriguez Cahuantzi, Mario; Rodriguez Manso, Alis; Roeed, Ketil; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Romita, Rosa; Ronchetti, Federico; Ronflette, Lucile; Rosnet, Philippe; Rossi, Andrea; Roukoutakis, Filimon; Roy, Ankhi; Roy, Christelle Sophie; Roy, Pradip Kumar; Rubio Montero, Antonio Juan; Rui, Rinaldo; Russo, Riccardo; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Sadovskiy, Sergey; Safarik, Karel; Sahlmuller, Baldo; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Salgado Lopez, Carlos Alberto; Salzwedel, Jai Samuel Nielsen; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sanchez Castro, Xitzel; Sandor, Ladislav; Sandoval, Andres; Sano, Masato; Santagati, Gianluca; Sarkar, Debojit; Scapparone, Eugenio; Scarlassara, Fernando; Scharenberg, Rolf Paul; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schuchmann, Simone; Schukraft, Jurgen; Schulc, Martin; Schuster, Tim Robin; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Scott, Rebecca Michelle; Seeder, Karin Soraya; Seger, Janet Elizabeth; Sekiguchi, Yuko; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Seo, Jeewon; Serradilla Rodriguez, Eulogio; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shadura, Oksana; Shahoyan, Ruben; Shangaraev, Artem; Sharma, Ankita; Sharma, Natasha; Shigaki, Kenta; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Silvestre, Catherine Micaela; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singha, Subhash; Singhal, Vikas; Sinha, Bikash; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Soegaard, Carsten; Soltz, Ron Ariel; Song, Jihye; Song, Myunggeun; Song, Zixuan; Soramel, Francesca; Sorensen, Soren Pontoppidan; Spacek, Michal; Spiriti, Eleuterio; Sputowska, Iwona Anna; Spyropoulou-Stassinaki, Martha; Srivastava, Brijesh Kumar; Stachel, Johanna; Stan, Ionel; Stefanek, Grzegorz; Steinpreis, Matthew Donald; Stenlund, Evert Anders; Steyn, Gideon Francois; Stiller, Johannes Hendrik; Stocco, Diego; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Sultanov, Rishat; Sumbera, Michal; Symons, Timothy; Szabo, Alexander; Szanto De Toledo, Alejandro; Szarka, Imrich; Szczepankiewicz, Adam; Szymanski, Maciej Pawel; Takahashi, Jun; Tanaka, Naoto; Tangaro, Marco-Antonio; Tapia Takaki, Daniel Jesus; Tarantola Peloni, Attilio; Tariq, Mohammad; Tarzila, Madalina-Gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terasaki, Kohei; Terrevoli, Cristina; Teyssier, Boris; Thaeder, Jochen Mathias; Thomas, Deepa; Tieulent, Raphael Noel; Timmins, Anthony Robert; Toia, Alberica; Trogolo, Stefano; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vajzer, Michal; Vala, Martin; Valencia Palomo, Lizardo; Vallero, Sara; Van Der Maarel, Jasper; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vanat, Tomas; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vechernin, Vladimir; Veen, Annelies Marianne; Veldhoen, Misha; Velure, Arild; Venaruzzo, Massimo; Vercellin, Ermanno; Vergara Limon, Sergio; Vernet, Renaud; Verweij, Marta; Vickovic, Linda; Viesti, Giuseppe; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Vinogradov, Alexander; Vinogradov, Leonid; Vinogradov, Yury; Virgili, Tiziano; Vislavicius, Vytautas; Viyogi, Yogendra; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Vranic, Danilo; Vrlakova, Janka; Vulpescu, Bogdan; Vyushin, Alexey; Wagner, Boris; Wagner, Jan; Wang, Hongkai; Wang, Mengliang; Wang, Yifei; Watanabe, Daisuke; Weber, Michael; Weber, Steffen Georg; Wessels, Johannes Peter; Westerhoff, Uwe; Wiechula, Jens; Wikne, Jon; Wilde, Martin Rudolf; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Williams, Crispin; Windelband, Bernd Stefan; Winn, Michael Andreas; Yaldo, Chris G; Yamaguchi, Yorito; Yang, Hongyan; Yang, Ping; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-Kwon; Yurchenko, Volodymyr; Yushmanov, Igor; Zaborowska, Anna; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correia Zanoli, Henrique Jose; Zaporozhets, Sergey; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zgura, Sorin Ion; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhang, Yonghong; Zhao, Chengxin; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zhu, Xiangrong; Zichichi, Antonino; Zimmermann, Alice; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zyzak, Maksym

2015-07-24

Charged jet production cross sections in p-Pb collisions at $\\sqrt{s_{\\rm NN}} = 5.02$ TeV measured with the ALICE detector at the LHC are presented. Using the anti-$k_{\\rm T}$ algorithm, jets have been reconstructed in the central rapidity region from charged particles with resolution parameters $R = 0.2$ and $R = 0.4$. The reconstructed jets have been corrected for detector effects and the underlying event background. To calculate the nuclear modification factor, $R_{\\rm pPb}$, of charged jets in p-Pb collisions, a pp reference was constructed by scaling previously measured charged jet spectra at $\\sqrt{s} = 7$ TeV. In the transverse momentum range $20 \\le p_{\\rm T,ch\\ jet} \\le 120$ GeV/$c$, $R_{\\rm pPb}$ is found to be consistent with unity, indicating the absence of strong nuclear matter effects on jet production. Major modifications to the radial jet structure are probed via the ratio of jet production cross sections reconstructed with the two different resolution parameters. This ratio is found to be si...

Measurement of electrons from heavy-flavour hadron decays in p–Pb collisions at $\\sqrt{s_{\\rm NN}} = 5.02$ TeV

CERN Document Server

Adam, Jaroslav; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Alam, Sk Noor; Aleksandrov, Dmitry; Alessandro, Bruno; Alexandre, Didier; Alfaro Molina, Jose Ruben; Alici, Andrea; Alkin, Anton; Millan Almaraz, Jesus Roberto; Alme, Johan; Alt, Torsten; Altinpinar, Sedat; Altsybeev, Igor; Alves Garcia Prado, Caio; Andrei, Cristian; Andronic, Anton; Anguelov, Venelin; Anielski, Jonas; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartke, Jerzy Gustaw; Bartsch, Esther; Basile, Maurizio; Bastid, Nicole; Basu, Sumit; Bathen, Bastian; Batigne, Guillaume; Batista Camejo, Arianna; Batyunya, Boris; Batzing, Paul Christoph; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Belmont Iii, Ronald John; Belmont Moreno, Ernesto; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Berceanu, Ionela; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhasin, Anju; Bhat, Inayat Rasool; Bhati, Ashok Kumar; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Livio; Bianchi, Nicola; Bianchin, Chiara; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biswas, Rathijit; Biswas, Saikat; Bjelogrlic, Sandro; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Bock, Friederike; Bogdanov, Alexey; Boggild, Hans; Boldizsar, Laszlo; Bombara, Marek; Book, Julian Heinz; Borel, Herve; Borissov, Alexander; Borri, Marcello; Bossu, Francesco; Botta, Elena; Boettger, Stefan; Bourjau, Christian; Braun-Munzinger, Peter; Bregant, Marco; Breitner, Timo Gunther; Broker, Theo Alexander; Browning, Tyler Allen; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Caffarri, Davide; Cai, Xu; Caines, Helen Louise; Calero Diaz, Liliet; Caliva, Alberto; Calvo Villar, Ernesto; Camerini, Paolo; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Cepila, Jan; Cerello, Piergiorgio; Cerkala, Jakub; Chang, Beomsu; Chapeland, Sylvain; Chartier, Marielle; Charvet, Jean-Luc Fernand; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chelnokov, Volodymyr; Cherney, Michael Gerard; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Choi, Kyungeon; Chojnacki, Marek; Choudhury, Subikash; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-Urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Connors, Megan Elizabeth; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortes Maldonado, Ismael; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Crochet, Philippe; Cruz Albino, Rigoberto; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Deisting, Alexander; Deloff, Andrzej; Denes, Ervin Sandor; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Nezza, Pasquale; Diaz Corchero, Miguel Angel; Dietel, Thomas; Dillenseger, Pascal; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Drozhzhova, Tatiana; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erdemir, Irem; Erhardt, Filip; Espagnon, Bruno; Estienne, Magali Danielle; Esumi, Shinichi; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Eyyubova, Gyulnara; Fabbietti, Laura; Fabris, Daniela; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Ferencei, Jozef; Fernandez Tellez, Arturo; Gonzalez Ferreiro, Elena; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiore, Enrichetta Maria; Fleck, Martin Gabriel; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Frankenfeld, Ulrich Michael; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gallio, Mauro; Gangadharan, Dhevan Raja; Ganoti, Paraskevi; Gao, Chaosong; Garabatos Cuadrado, Jose; Garcia-Solis, Edmundo Javier; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; Germain, Marie; Gheata, Andrei George; Gheata, Mihaela; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Gladysz-Dziadus, Ewa; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Grachov, Oleg Anatolievich; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Grelli, Alessandro; Grigoras, Alina Gabriela; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Grynyov, Borys; Grion, Nevio; Gronefeld, Julius Maximilian; Grosse-Oetringhaus, Jan Fiete; Grossiord, Jean-Yves; Grosso, Raffaele; Guber, Fedor; Guernane, Rachid; Guerzoni, Barbara; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Haake, Rudiger; Haaland, Oystein Senneset; Hadjidakis, Cynthia Marie; Haiduc, Maria; Hamagaki, Hideki; Hamar, Gergoe; Harris, John William; Harton, Austin Vincent; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Heide, Markus Ansgar; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Herrera Corral, Gerardo Antonio; Hess, Benjamin Andreas; Hetland, Kristin Fanebust; Hillemanns, Hartmut; Hippolyte, Boris; Hosokawa, Ritsuya; Hristov, Peter Zahariev; Huang, Meidana; Humanic, Thomas; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Ilkaev, Radiy; Inaba, Motoi; Ippolitov, Mikhail; Irfan, Muhammad; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jahnke, Cristiane; Jakubowska, Monika Joanna; Jang, Haeng Jin; Janik, Malgorzata Anna; Pahula Hewage, Sandun; Jena, Chitrasen; Jena, Satyajit; Jimenez Bustamante, Raul Tonatiuh; Jones, Peter Graham; Jung, Hyungtaik; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kamin, Jason Adrian; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karayan, Lilit; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Khan, Mohammed Mohisin; Khan, Palash; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Kileng, Bjarte; Kim, Do Won; Kim, Dong Jo; Kim, Daehyeok; Kim, Hyeonjoong; Kim, Jinsook; Kim, Mimae; Kim, Minwoo; Kim, Se Yong; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Kiss, Gabor; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-Boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobayashi, Taiyo; Kobdaj, Chinorat; Kofarago, Monika; Kollegger, Thorsten; Kolozhvari, Anatoly; Kondratev, Valerii; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Kopcik, Michal; Kour, Mandeep; Kouzinopoulos, Charalampos; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Koyithatta Meethaleveedu, Greeshma; Kralik, Ivan; Kravcakova, Adela; Kretz, Matthias; Krivda, Marian; Krizek, Filip; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Ajay; Kumar, Jitendra; Lokesh, Kumar; Kumar, Shyam; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Ladron De Guevara, Pedro; Lagana Fernandes, Caio; Lakomov, Igor; Langoy, Rune; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Lattuca, Alessandra; Laudi, Elisa; Lea, Ramona; Leardini, Lucia; Lee, Graham Richard; Lee, Seongjoo; Lehas, Fatiha; Lemmon, Roy Crawford; Lenti, Vito; Leogrande, Emilia; Leon Monzon, Ildefonso; Leon Vargas, Hermes; Leoncino, Marco; Levai, Peter; Li, Shuang; Li, Xiaomei; Lien, Jorgen Andre; Lietava, Roman; Lindal, Svein; Lindenstruth, Volker; Lippmann, Christian; Lisa, Michael Annan; Ljunggren, Hans Martin; Lodato, Davide Francesco; Lonne, Per-Ivar; Loginov, Vitaly; Loizides, Constantinos; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Lunardon, Marcello; Luparello, Grazia; Maevskaya, Alla; Mager, Magnus; Mahajan, Sanjay; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Maldonado Cervantes, Ivonne Alicia; Malinina, Liudmila; Mal'Kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martin Blanco, Javier; Martinengo, Paolo; Martinez Hernandez, Mario Ivan; Martinez-Garcia, Gines; Martinez Pedreira, Miguel; Mas, Alexis Jean-Michel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Mastroserio, Annalisa; Matyja, Adam Tomasz; Mayer, Christoph; Mazer, Joel Anthony; Mazzoni, Alessandra Maria; Mcdonald, Daniel; Meddi, Franco; Melikyan, Yuri; Menchaca-Rocha, Arturo Alejandro; Meninno, Elisa; Mercado-Perez, Jorge; Meres, Michal; Miake, Yasuo; Mieskolainen, Matti Mikael; Mikhaylov, Konstantin; Milano, Leonardo; Milosevic, Jovan; Minervini, Lazzaro Manlio; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Bedangadas; Molnar, Levente; Montano Zetina, Luis Manuel; Montes Prado, Esther; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munzer, Robert Helmut; Murray, Sean; Musa, Luciano; Musinsky, Jan; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Naru, Muhammad Umair; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Nayak, Kishora; Nayak, Tapan Kumar; Nazarenko, Sergey; Nedosekin, Alexander; Nellen, Lukas; Ng, Fabian; Nicassio, Maria; Niculescu, Mihai; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Saehanseul; Oh, Sun Kun; Ohlson, Alice Elisabeth; Okatan, Ali; Okubo, Tsubasa; Olah, Laszlo; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Ozdemir, Mahmut; Pachmayer, Yvonne Chiara; Pagano, Paola; Paic, Guy; Pal, Susanta Kumar; Pan, Jinjin; Pandey, Ashutosh Kumar; Papcun, Peter; Papikyan, Vardanush; Pappalardo, Giuseppe; Pareek, Pooja; Park, Woojin; Parmar, Sonia; Passfeld, Annika; Paticchio, Vincenzo; Patra, Rajendra Nath; Paul, Biswarup; Pei, Hua; Peitzmann, Thomas; Pereira Da Costa, Hugo Denis Antonio; Pereira De Oliveira Filho, Elienos; Peresunko, Dmitry Yurevich; Perez Lara, Carlos Eugenio; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrov, Viacheslav; Petrovici, Mihai; Petta, Catia; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Pinazza, Ombretta; Pinsky, Lawrence; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Porteboeuf, Sarah Julie; Porter, R Jefferson; Pospisil, Jan; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Puddu, Giovanna; Pujahari, Prabhat Ranjan; Punin, Valery; Putschke, Jorn Henning; Qvigstad, Henrik; Rachevski, Alexandre; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Read, Kenneth Francis; Redlich, Krzysztof; Reed, Rosi Jan; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reolon, Anna Rita; Reshetin, Andrey; Revol, Jean-Pierre; Reygers, Klaus Johannes; Riabov, Viktor; Ricci, Renato Angelo; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-Lucian; Rocco, Elena; Rodriguez Cahuantzi, Mario; Rodriguez Manso, Alis; Roeed, Ketil; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Romita, Rosa; Ronchetti, Federico; Ronflette, Lucile; Rosnet, Philippe; Rossi, Andrea; Roukoutakis, Filimon; Roy, Ankhi; Roy, Christelle Sophie; Roy, Pradip Kumar; Rubio Montero, Antonio Juan; Rui, Rinaldo; Russo, Riccardo; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Sadovskiy, Sergey; Safarik, Karel; Sahlmuller, Baldo; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Salzwedel, Jai Samuel Nielsen; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandor, Ladislav; Sandoval, Andres; Sano, Masato; Sarkar, Debojit; Scapparone, Eugenio; Scarlassara, Fernando; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schuchmann, Simone; Schukraft, Jurgen; Schulc, Martin; Schuster, Tim Robin; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Scott, Rebecca Michelle; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shadura, Oksana; Shahoyan, Ruben; Shangaraev, Artem; Sharma, Ankita; Sharma, Mona; Sharma, Monika; Sharma, Natasha; Shigaki, Kenta; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Silvestre, Catherine Micaela; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singha, Subhash; Singhal, Vikas; Sinha, Bikash; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Soegaard, Carsten; Song, Jihye; Song, Myunggeun; Song, Zixuan; Soramel, Francesca; Sorensen, Soren Pontoppidan; Sozzi, Federica; Spacek, Michal; Spiriti, Eleuterio; Sputowska, Iwona Anna; Spyropoulou-Stassinaki, Martha; Stachel, Johanna; Stan, Ionel; Stefanek, Grzegorz; Stenlund, Evert Anders; Steyn, Gideon Francois; Stiller, Johannes Hendrik; Stocco, Diego; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Szabo, Alexander; Szanto De Toledo, Alejandro; Szarka, Imrich; Szczepankiewicz, Adam; Szymanski, Maciej Pawel; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tangaro, Marco-Antonio; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-Gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terasaki, Kohei; Terrevoli, Cristina; Teyssier, Boris; Thaeder, Jochen Mathias; Thomas, Deepa; Tieulent, Raphael Noel; Timmins, Anthony Robert; Toia, Alberica; Trogolo, Stefano; Trombetta, Giuseppe; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vajzer, Michal; Vala, Martin; Valencia Palomo, Lizardo; Vallero, Sara; Van Der Maarel, Jasper; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vanat, Tomas; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vechernin, Vladimir; Veen, Annelies Marianne; Veldhoen, Misha; Velure, Arild; Venaruzzo, Massimo; Vercellin, Ermanno; Vergara Limon, Sergio; Vernet, Renaud; Verweij, Marta; Vickovic, Linda; Viesti, Giuseppe; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Vinogradov, Leonid; Vinogradov, Yury; Virgili, Tiziano; Vislavicius, Vytautas; Viyogi, Yogendra; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Vranic, Danilo; Vrlakova, Janka; Vulpescu, Bogdan; Vyushin, Alexey; Wagner, Boris; Wagner, Jan; Wang, Hongkai; Wang, Mengliang; Watanabe, Daisuke; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Weiser, Dennis Franz; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilde, Martin Rudolf; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Williams, Crispin; Windelband, Bernd Stefan; Winn, Michael Andreas; Yaldo, Chris G; Yang, Hongyan; Yang, Ping; Yano, Satoshi; Yasar, Cigdem; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-Kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Yushmanov, Igor; Zaborowska, Anna; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correia Zanoli, Henrique Jose; Zaporozhets, Sergey; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zgura, Sorin Ion; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhang, Yonghong; Chunhui, Zhang; Zhang, Zuman; Zhao, Chengxin; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zichichi, Antonino; Zimmermann, Alice; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zyzak, Maksym

2016-03-10

The production of electrons from heavy-flavour hadron decays was measured as a function of transverse momentum ($p_{\\rm T}$) in minimum-bias p–Pb collisions at $\\sqrt{s_{\\rm NN}} = 5.02$ TeV with ALICE at the LHC for $0.5 < p_{\\rm T} < 12$ GeV/$c$ in the rapidity range $-1.06 < y_{\\rm cms} < 0.14$ in the centre-of-mass frame. To estimate the contribution of electrons from background sources an invariant mass approach was used. The nuclear modification factor $R_{\\rm pPb}$ was calculated by comparing the $p_{\\rm T}$-differential invariant cross section in p–Pb collisions to a pp reference at the same centre-of-mass energy, which was obtained by interpolating measurements at $\\sqrt{s}=2.76$ TeV and $\\sqrt{s}=7$ TeV. The $R_{\\rm pPb}$ is consistent with unity within uncertainties of about 25%, which become larger below $p_{\\rm T} = 1$ GeV/$c$. The data are also reproduced by model calculations including cold nuclear matter effects.

TARGET 2 and Settlement Finality

Directory of Open Access Journals (Sweden)

Ivan MANGATCHEV

2011-03-01

Full Text Available This article examines how TARGET 2 as system implements the idea of settlement finality regulated by Directive 98/26 EC of the European parliament and of the Council of 19 May 1998 on settlement finality in payment and securities settlement systems (Settlement Finality Directive and Directive 2009/44/EC of the European parliament and of the Council of 6 May 2009 amending Directive 98/26/EC on settlement finality in payment and securities settlement systems and Directive 2002/47/EC on financial collateral arrangements as regards linked systems and credit claims (Directive 2009/44/EC. As the title of the arti and finality of the settlement in this system.

A random regression model in analysis of litter size in pigs | Lukovi& ...

African Journals Online (AJOL)

Dispersion parameters for number of piglets born alive (NBA) were estimated using a random regression model (RRM). Two data sets of litter records from the Nemščak farm in Slovenia were used for analyses. The first dataset (DS1) included records from the first to the sixth parity. The second dataset (DS2) was extended ...

Final Report for NFE-07-00912: Development of Model Fuels Experimental Engine Data Base & Kinetic Modeling Parameter Sets

Energy Technology Data Exchange (ETDEWEB)

Bunting, Bruce G [ORNL

2012-10-01

The automotive and engine industries are in a period of very rapid change being driven by new emission standards, new types of after treatment, new combustion strategies, the introduction of new fuels, and drive for increased fuel economy and efficiency. The rapid pace of these changes has put more pressure on the need for modeling of engine combustion and performance, in order to shorten product design and introduction cycles. New combustion strategies include homogeneous charge compression ignition (HCCI), partial-premixed combustion compression ignition (PCCI), and dilute low temperature combustion which are being developed for lower emissions and improved fuel economy. New fuels include bio-fuels such as ethanol or bio-diesel, drop-in bio-derived fuels and those derived from new crude oil sources such as gas-to-liquids, coal-to-liquids, oil sands, oil shale, and wet natural gas. Kinetic modeling of the combustion process for these new combustion regimes and fuels is necessary in order to allow modeling and performance assessment for engine design purposes. In this research covered by this CRADA, ORNL developed and supplied experimental data related to engine performance with new fuels and new combustion strategies along with interpretation and analysis of such data and consulting to Reaction Design, Inc. (RD). RD performed additional analysis of this data in order to extract important parameters and to confirm engine and kinetic models. The data generated was generally published to make it available to the engine and automotive design communities and also to the Reaction Design Model Fuels Consortium (MFC).

75 FR 62133 - Notice of Availability of Final Environmental Assessment (FINAL EA) and a Finding of No...

Science.gov (United States)

2010-10-07

... Availability of Final Environmental Assessment (FINAL EA) and a Finding of No Significant Impact (FONSI) for... of No Significant Impact (FONSI) for Land Purchase, Access Road Construction and Access Tunnel... Impact (FONSI) based on the Final Environmental Assessment (FINAL EA) for Land Purchase, Access Road...

14 CFR 1214.1105 - Final ranking.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Final ranking. 1214.1105 Section 1214.1105... Recruitment and Selection Program § 1214.1105 Final ranking. Final rankings will be based on a combination of... preference will be included in this final ranking in accordance with applicable regulations. ...

Novel Biocatalytic Platform for Ethanol Production from Lignocellulosic Feedstock

Energy Technology Data Exchange (ETDEWEB)

Chen, Chyi-Shin [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Tachea, Firehiwot [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Brown, Sarah [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Coffman, Philip [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Tanjore, Deepti [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Gregg, Allison [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Rolison-Welch, Kristina [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Shirazi, Fatemeh [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); He, Qian [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Sun, Ning [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

2017-01-23

The goals of the CRADA were achieved by illustrating the scalability of immobilized yeast technology, demonstrating lignocellulosic feedstock consumption by the immobilized cells, and confirming Microvi’s proprietary polymer matrix ethanol toxicity tolerance. We conducted fermentations at 2L and 300L scales. For carbon source, we performed pretreatment and saccharification at 100L scale to produce lignocellulosic sugars with glucose and xylose.

Is Sordac’s Rapid Acquisition Process Best Prepared To Field Solutions For Future Technological Challenges

Science.gov (United States)

2016-03-31

to leverage game changing technologies such as cyber, robotics, nanotechnology, and ISR to ensure our comparative advantage and ability to achieve...of Defense for Special Operations and Low Intensity Conflict ( ASD -SO/LIC) to provide oversight and advocacy for SOCOM. The result is SOCOM...CRADA ( Cooperative Research & Development Agreements) are legal agreements for RDT&E, 10 providing a collaborative effort with non-federal

Supply Chain Resilience: Assessing Resilience over the Life Cycle of Capital Equipment

Science.gov (United States)

2014-07-09

Purposes): [] CRADA (Cooperative Research and Development Agreement) exists [] Photo/ Video Opportunities [] STEM -outreach Related [] New Invention...Recovery C9 10.6 / 0.7 9.8 / -1.1 Dispersion ClO 8.4 13.4 15.3 /11.0 Collaboration Cll -0.1 I -10.5 3.6 / -9.0 Organization Cl2 6.3 / -3.2 Security C l3

Report to Congress on the Activities of the DoD Office of Technology Transition

Science.gov (United States)

2006-08-01

protection, and protected remote access solutions for telecommuting . NetTop inventors/engineers of this technology will soon be engaged in a CRADA...from each Service and Defense Agency and representatives from the Joint Requirements Oversight Council. An annual call for TTI proposals is...Electronics Oversight Council proposed the start of the RH Microelectronics Advanced Technology Development (RHMATD) program. The program called for two

Hyperspectral Geobotanical Remote Sensing for Monitoring and Verifying CO₂ Containment Final Report CRADA No. TC-2036-02

Energy Technology Data Exchange (ETDEWEB)

Pickles, W. L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ebrom, D. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-09-28

This collaborative effort was in support of the CO₂ Capture Project (CCP), to develop techniques that integrate overhead images of plant species, plant health, geological formations, soil types, aquatic, and human use spatial patterns for detection and discrimination of any CO₂ releases from underground storage formations. The goal of this work was to demonstrate advanced hyperspectral geobotanical remote sensing methods to assess potential leakage of CO₂ from underground storage. The timeframes and scales relevant to the long-term storage of CO₂ in the subsurface make remote sensing methods attractive. Moreover, it has been shown that individual field measurements of gas composition are subject to variability on extremely small temporal and spatial scales. The ability to verify ultimate reservoir integrity and to place individual surface measurements into context will be crucial to successful long-term monitoring and verification activities. The desired results were to produce a defined and tested procedure that could be easily used for long-term monitoring of possible CO₂ leakage from underground CO₂ sequestration sites. This testing standard will be utilized on behalf of the oil industry.

Catalytic Depolymerization and Upgrading of Lignin for Vanillin Production: Cooperative Research and Development Final Report, CRADA Number CRD-14-545

Energy Technology Data Exchange (ETDEWEB)

Beckham, Gregg [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2017-03-31

Examine catalytic conversion of lignin using multifunctional catalysts that are able to depolymerize and oxidize lignin to a vanillin-rich stream. Examine separation processes for isolation of vanillin from product mixtures. Conduct preliminary experiments to determine if deconstructed lignin streams can be metabolized by Pseudomonas putida.

Synthesis of a Novel Energetic Heterocyclic Oxidizer with Higher Energy and Lower Sensitivity Final Report CRADA No. TC02099.0

Energy Technology Data Exchange (ETDEWEB)

Pagoria, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Racoveanu, A. [Physical Sciences, Inc., Andover, MD (United States)

2017-09-08

The project involved the synthesis of 5g of a target energetic compound, 3,4-bis(5-nitro-1,2,5- oxadiazol-4-yl)-1,2,5-oxadiazole-1-oxide (DNTF. The deliverables were the synthesis of 5g of DNTF along with quantities of the precursor compounds. In addition, small-scale safety tests on DNTF were performed, which to confirmed that DNTF has no undesirable safety properties before scaling up the synthesis in Phase II of this project.

Catalysis for Mixed Alcohol Synthesis from Biomass Derived Syngas: Cooperative Research and Development Final Report, CRADA Number CRD-08-292

Energy Technology Data Exchange (ETDEWEB)

Hensley, J.

2013-04-01

The Dow Chemical Company (Dow) developed and tested catalysts for production of mixed alcohols from synthesis gas (syngas), under research and development (R&D) projects that were discontinued a number of years ago. Dow possesses detailed laboratory notebooks, catalyst samples, and technical expertise related to this past work. The National Renewable Energy Laboratory (NREL) is conducting R&D in support of the United States Department of Energy (DOE) to develop methods for economically producing ethanol from gasified biomass. NREL is currently conducting biomass gasification research at an existing 1/2 ton/day thermochemical test platform. Both Dow and NREL believe that the ability to economically produce ethanol from biomass-derived syngas can be enhanced through collaborative testing, refinement, and development of Dow's mixed-alcohol catalysts at NREL's and/or Dow's bench- and pilot-scale facilities. Dow and NREL further agree that collaboration on improvements in catalysts as well as gasifier operating conditions (e.g., time, temperature, upstream gas treatment) will be necessary to achieve technical and economic goals for production of ethanol and other alcohols.

78 FR 43912 - Final Candidate Conservation Agreement with Assurances, Final Environmental Assessment, and...

Science.gov (United States)

2013-07-22

...-FF02ENEH00] Final Candidate Conservation Agreement with Assurances, Final Environmental Assessment, and Finding of No Significant Impact; Rio Grande Cutthroat Trout, New Mexico and Colorado AGENCY: Fish and... environmental assessment (EA) and the draft Finding of No Significant Impact (FONSI) under the National...

NREL Quickens its Tech Transfer Efforts

Energy Technology Data Exchange (ETDEWEB)

Lammers, H.

2012-02-01

.' While NREL maintains a robust patent portfolio, often companies are looking to do more than just license a technology. These relationships are invaluable in successfully moving technologies from NREL to the marketplace. 'We may generate new and potentially valuable innovations, but our commercialization partners do the heavy work of building a successful business around our technology,' Farris said. Tools such as CRADAs (Cooperative Research and Development Agreements) allow NREL to continue working with companies to refine and develop technologies. And, working with businesses is an area where NREL excels. NREL is responsible for one quarter of the CRADAs in the DOE system. 'When you look at the results of our CRADA program, you can demonstrate that we are actively engaged with companies in collaborating on research and moving technologies to market,' Farris said. NREL is first among DOE labs with 186 active CRADAs. And last year, NREL also was first with the number of new CRADAs signed. 'Part of the success in our working with industry goes back to NREL's mission to grow and support new industries,' Farris added. 'NREL has basic research capabilities, but we are never going to be the ultimate producer of a commercial product. That is the role of the private sector.' Farris also credits the advocacy and support that the Office of Energy Efficiency and Renewable Energy at DOE provides for these technology transfer activities. 'EERE's support is critical to our success,' Farris said. To assist the private sector in moving a technology from the lab to the manufacturing line, NREL has a number of programs in place to give that first, or even final, nudge toward commercialization. For instance, the Commercialization Assistance Program helps startups overcome technical barriers by granting free access to 40 hours of work at the lab. Through the Innovation and Entrepreneurship Center, NREL also helps clean energy

10 CFR 51.93 - Distribution of final environmental impact statement and supplement to final environmental impact...

Science.gov (United States)

2010-01-01

... 10 Energy 2 2010-01-01 2010-01-01 false Distribution of final environmental impact statement and supplement to final environmental impact statement; news releases. 51.93 Section 51.93 Energy NUCLEAR... Environmental Impact Statements-General Requirements § 51.93 Distribution of final environmental impact...

Assessment of the radioprotective effect of propolis in breast cancer patients undergoing radiotherapy. New perspective for an old honey bee product

Directory of Open Access Journals (Sweden)

Samia A. Ebeid

2016-10-01

Conclusions: Supplementation of propolis with radiotherapy treatment offers a quite measurable protection against DNA damage caused by ionizing radiation in BC patients leukocytes and inhibits RRM2 overexpression. Moreover, propolis has beneficial effects on the serum antioxidant capacity and improves the digestive utilization of iron and the regeneration efficiency of hemoglobin. Larger prospective studies are required to confirm our findings.

Interaction of the RNP1 motif in PRT1 with HCR1 promotes 40S binding of eukaryotic initiation factor 3 in yeast

DEFF Research Database (Denmark)

Nielsen, Klaus H; Valásek, Leos; Sykes, Caroah

2006-01-01

We found that mutating the RNP1 motif in the predicted RRM domain in yeast eukaryotic initiation factor 3 (eIF3) subunit b/PRT1 (prt1-rnp1) impairs its direct interactions in vitro with both eIF3a/TIF32 and eIF3j/HCR1. The rnp1 mutation in PRT1 confers temperature-sensitive translation initiation...

Dgroup: DG00688 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available itabine hydrochloride (JAN/USAN) ... D10222 ... Gemcitabine elaidate (USAN/INN) Antineoplastic ... DG01958 ... Nucleic... acid derivative, antineoplastic ... DG01439 ... Arabinofuranosyl type antineoplastic ... DG01439 ... Arabinofuranosyl type antineoplastic...ic ... DG01439 ... Arabinofuranosyl type antineoplastic ATC code: L01BC05 Antineoplastics, Antimetabolite RRM1 [HSA:6240] [KO:K10807] ... ... Unclassified ... DG02018 ... Antimetabolite ... DG01958 ... Nucleic acid derivative, antineoplast

The NOAA Big Data Project

Science.gov (United States)

de la Beaujardiere, J.

2015-12-01

The US National Oceanic and Atmospheric Administration (NOAA) is a Big Data producer, generating tens of terabytes per day from hundreds of sensors on satellites, radars, aircraft, ships, and buoys, and from numerical models. These data are of critical importance and value for NOAA's mission to understand and predict changes in climate, weather, oceans, and coasts. In order to facilitate extracting additional value from this information, NOAA has established Cooperative Research and Development Agreements (CRADAs) with five Infrastructure-as-a-Service (IaaS) providers — Amazon, Google, IBM, Microsoft, Open Cloud Consortium — to determine whether hosting NOAA data in publicly-accessible Clouds alongside on-demand computational capability stimulates the creation of new value-added products and services and lines of business based on the data, and if the revenue generated by these new applications can support the costs of data transmission and hosting. Each IaaS provider is the anchor of a "Data Alliance" which organizations or entrepreneurs can join to develop and test new business or research avenues. This presentation will report on progress and lessons learned during the first 6 months of the 3-year CRADAs.

Geysers advanced direct contact condenser research

Energy Technology Data Exchange (ETDEWEB)

Henderson, J.; Bahning, T.; Bharathan, D.

1997-12-31

The first geothermal application of the Advanced Direct Contact Condenser (ADCC) technology developed by the National Renewable Energy Laboratory (NREL) is now operational and is being tested at The Geysers Power Plant Unit 11. This major research effort is being supported through the combined efforts of NREL, The Department of Energy (DOE), and Pacific Gas and Electric (PG&E). NREL and PG&E have entered into a Cooperative Research And Development Agreement (CRADA) for a project to improve the direct-contact condenser performance at The Geysers Power Plant. This project is the first geothermal adaptation of an advanced condenser design developed for the Ocean Thermal Energy Conversion (OTEC) systems. PG&E expects this technology to improve power plant performance and to help extend the life of the steam field by using steam more efficiently. In accordance with the CRADA, no money is transferred between the contracting parties. In this case the Department of Energy is funding NREL for their efforts in this project and PG&E is contributing funds in kind. Successful application of this technology at The Geysers will provide a basis for NREL to continue to develop this technology for other geothermal and fossil power plant systems.

Final Report

Energy Technology Data Exchange (ETDEWEB)

DeTar, Carleton [P.I.

2012-12-10

This document constitutes the Final Report for award DE-FC02-06ER41446 as required by the Office of Science. It summarizes accomplishments and provides copies of scientific publications with significant contribution from this award.

Continuous CO2 extractor and methods

International Nuclear Information System (INIS)

2010-01-01

The purpose of this CRADA was to assist in technology transfer from Russia to the US and assist in development of the technology improvements and applications for use in the U.S. and worldwide. Over the period of this work, ORNL has facilitated design, development and demonstration of a low-pressure liquid extractor and development of initial design for high-pressure supercritical CO2 fluid extractor.

Continuous CO2 extractor and methods

Energy Technology Data Exchange (ETDEWEB)

None listed

2010-06-15

The purpose of this CRADA was to assist in technology transfer from Russia to the US and assist in development of the technology improvements and applications for use in the U.S. and worldwide. Over the period of this work, ORNL has facilitated design, development and demonstration of a low-pressure liquid extractor and development of initial design for high-pressure supercritical CO2 fluid extractor.

Welding and Weldability of Directionally Solidified Single Crystal Nickel-Base Superalloys

Energy Technology Data Exchange (ETDEWEB)

Vitek, J M; David, S A; Reed, R W; Burke, M A; Fitzgerald, T J

1997-09-01

Nickel-base superalloys are used extensively in high-temperature service applications, and in particular, in components of turbine engines. To improve high-temperature creep properties, these alloys are often used in the directionally-solidified or single-crystal form. The objective of this CRADA project was to investigate the weldability of both experimental and commercial nickel-base superalloys in polycrystalline, directionally-solidified, and single-crystal forms.

UPF201 Archaeal Specific Family Members Reveals Structural Similarity to RNA-Binding Proteins but Low Likelihood for RNA-Binding Function

Energy Technology Data Exchange (ETDEWEB)

Rao, K.N.; Swaminathan, S.; Burley, S. K.

2008-12-11

We have determined X-ray crystal structures of four members of an archaeal specific family of proteins of unknown function (UPF0201; Pfam classification: DUF54) to advance our understanding of the genetic repertoire of archaea. Despite low pairwise amino acid sequence identities (10-40%) and the absence of conserved sequence motifs, the three-dimensional structures of these proteins are remarkably similar to one another. Their common polypeptide chain fold, encompassing a five-stranded antiparallel {beta}-sheet and five {alpha}-helices, proved to be quite unexpectedly similar to that of the RRM-type RNA-binding domain of the ribosomal L5 protein, which is responsible for binding the 5S- rRNA. Structure-based sequence alignments enabled construction of a phylogenetic tree relating UPF0201 family members to L5 ribosomal proteins and other structurally similar RNA binding proteins, thereby expanding our understanding of the evolutionary purview of the RRM superfamily. Analyses of the surfaces of these newly determined UPF0201 structures suggest that they probably do not function as RNA binding proteins, and that this domain specific family of proteins has acquired a novel function in archaebacteria, which awaits experimental elucidation.

Wax Point Determinations Using Acoustic Resonance Spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Bostick, D.T.; Jubin, R.T.; Schmidt, T.W.

2001-06-01

The thermodynamic characterization of the wax point of a given crude is essential in order to maintain flow conditions that prevent plugging of undersea pipelines. This report summarizes the efforts made towards applying an Acoustic Cavity Resonance Spectrometer (ACRS) to the determination of pressures and temperatures at which wax precipitates from crude. Phillips Petroleum Company, Inc., the CRADA participant, supplied the ACRS. The instrumentation was shipped to Dr. Thomas Schmidt of ORNL, the CRADA contractor, in May 2000 after preliminary software development performed under the guidance of Dr. Samuel Colgate and Dr. Evan House of the University of Florida, Gainesville, Fl. Upon receipt it became apparent that a number of modifications still needed to be made before the ACRS could be precisely and safely used for wax point measurements. This report reviews the sequence of alterations made to the ACRS, as well as defines the possible applications of the instrumentation once the modifications have been completed. The purpose of this Cooperative Research and Development Agreement (CRADA) between Phillips Petroleum Company, Inc. (Participant) and Lockheed Martin Energy Research Corporation (Contractor) was the measurement of the formation of solids in crude oils and petroleum products that are commonly transported through pipelines. This information is essential in the proper design, operation and maintenance of the petroleum pipeline system in the United States. Recently, new petroleum discoveries in the Gulf of Mexico have shown that there is a potential for plugging of undersea pipeline because of the precipitation of wax. It is important that the wax points of the expected crude oils be well characterized so that the production facilities for these new wells are capable of properly transporting the expected production. The goal of this work is to perform measurements of solids formation in crude oils and petroleum products supplied by the Participant. It is

5 CFR 1216.206 - Final determination.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Final determination. 1216.206 Section... PROCEEDINGS Demands or Requests for Testimony and Production of Documents § 1216.206 Final determination. The General Counsel makes the final determination on demands to requests to employees for production of...

45 CFR 150.219 - Final determination.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Final determination. 150.219 Section 150.219... Are Failing To Substantially Enforce HIPAA Requirements § 150.219 Final determination. If, after... the State a written notice of its final determination. The notice includes the following: (a...

78 FR 69817 - Polyethylene Retail Carrier Bags From Thailand: Final Court Decision and Amended Final Results of...

Science.gov (United States)

2013-11-21

... Bags From Thailand: Final Court Decision and Amended Final Results of Administrative Review of the..., which recalculated the weighted-average duty margin for polyethylene retail carrier bags (PRCBs) from... Packaging at the CIT. \\2\\ See Polyethylene Retail Carrier Bags from Thailand: Final Results and Partial...

Final Report

DEFF Research Database (Denmark)

Heiselberg, Per; Brohus, Henrik; Nielsen, Peter V.

This final report for the Hybrid Ventilation Centre at Aalborg University describes the activities and research achievement in the project period from August 2001 to August 2006. The report summarises the work performed and the results achieved with reference to articles and reports published...

Transition of NOAA's GPS-Met Data Acquisition and Processing System to the Commercial Sector: Inital Results

Science.gov (United States)

Jackson, Michael; Blatt, Stephan; Holub, Kirk

2015-04-01

In April of 2014, NOAA/OAR/ESRL Global Systems Division (GSD) and Trimble, in collaboration with Earth Networks, Inc. (ENI) signed a Cooperative Research and Development Agreement (CRADA) to transfer the existing NOAA GPS-Met Data Acquisition and Processing System (GPS-Met DAPS) technology to a commercial Trimble/ENI partnership. NOAA's GPS-Met DAPS is currently operated in a pseudo-operational mode but has proven highly reliable and running at over 95% uptime. The DAPS uses the GAMIT software to ingest dual frequency carrier phase GPS/GNSS observations and ancillary information such as real-time satellite orbits to estimate the zenith-scaled tropospheric (ZTD) signal delays and, where surface MET data are available, retrieve integrated precipitable water vapor (PWV). The NOAA data and products are made available to end users in near real-time. The Trimble/ENI partnership will use the Trimble Pivot™ software with the Atmosphere App to calculate zenith tropospheric (ZTD), tropospheric slant delay, and integrated precipitable water vapor (PWV). Evaluation of the Trimble software is underway starting with a comparison of ZTD and PWV values determined from four sub networks of GPS stations located 1. near NOAA Radiosonde Observation (Upper-Air Observation) launch sites; 2. Stations with low terrain/high moisture variability (Gulf Coast); 3. Stations with high terrain/low moisture variability (Southern California); and 4. Stations with high terrain/high moisture variability (high terrain variability elev. > 1000m). For each network GSD and T/ENI run the same stations for 30 days, compare results, and perform an evaluation of the long-term solution accuracy, precision and reliability. Metrics for success include T/ENI PWV estimates within 1.5 mm of ESRL/GSD's estimates 95% of the time (ZTD uncertainty of less than 10 mm 95% of the time). The threshold for allowable variations in ZTD between NOAA GPS-Met and T/ENI processing are 10mm. The CRADA 1&2 Trimble processing

11 CFR 9409.9 - Final determination.

Science.gov (United States)

2010-01-01

... 11 Federal Elections 1 2010-01-01 2010-01-01 false Final determination. 9409.9 Section 9409.9... INFORMATION AND PRODUCTION OF OFFICIAL RECORDS IN LEGAL PROCEEDINGS § 9409.9 Final determination. The General Counsel will make the final determination on demands and requests to employees for production of official...

48 CFR 32.605 - Final decisions.

Science.gov (United States)

2010-10-01

... REQUIREMENTS CONTRACT FINANCING Contract Debts 32.605 Final decisions. (a) The contracting officer shall issue a final decision as required by 33.211 if— (1) The contracting officer and the contractor are unable... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Final decisions. 32.605...

75 FR 50930 - Final Determination To Approve Alternative Final Cover Request for the Lake County, Montana Landfill

Science.gov (United States)

2010-08-18

... Determination To Approve Alternative Final Cover Request for the Lake County, Montana Landfill AGENCY... VIII is making a final determination to approve an alternative final cover for the Lake County landfill, a municipal solid waste landfill (MSWLF) owned and operated by Lake County, Montana on the...

32 CFR 536.64 - Final offers.

Science.gov (United States)

2010-07-01

... 32 National Defense 3 2010-07-01 2010-07-01 true Final offers. 536.64 Section 536.64 National... UNITED STATES Investigation and Processing of Claims § 536.64 Final offers. (a) When claims personnel... less than the amount claimed, a settlement authority will make a written final offer within his or her...

Dgroup: DG00685 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available ne phosphate (JAN/USP) ... Antineoplastic ... DG01958 ... Nucleic acid derivative, antineoplastic ... DG01439 ... Arabin...ofuranosyl type antineoplastic ... DG01439 ... Arabinofuranosyl type antineoplastic Unclassified ... DG02018 ... Antimet...abolite ... DG01958 ... Nucleic acid derivative, antineoplastic ... DG01439 ... Arabinofuranosyl type antineoplasti...c ATC code: L01BB05 Antineoplastics, Antimetabolite RRM [HSA:6240 6241 50484] [KO:K10807 K10808] DNA polymerase RNA polymerase ...

Deep inelastic final states

International Nuclear Information System (INIS)

Girardi, G.

1980-11-01

In these lectures we attempt to describe the final states of deep inelastic scattering as given by QCD. In the first section we shall briefly comment on the parton model and give the main properties of decay functions which are of interest for the study of semi-inclusive leptoproduction. The second section is devoted to the QCD approach to single hadron leptoproduction. First we recall basic facts on QCD log's and derive after that the evolution equations for the fragmentation functions. For this purpose we make a short detour in e + e - annihilation. The rest of the section is a study of the factorization of long distance effects associated with the initial and final states. We then show how when one includes next to leading QCD corrections one induces factorization breaking and describe the double moments useful for testing such effects. The next section contains a review on the QCD jets in the hadronic final state. We begin by introducing the notion of infrared safe variable and defining a few useful examples. Distributions in these variables are studied to first order in QCD, with some comments on the resummation of logs encountered in higher orders. Finally the last section is a 'gaullimaufry' of jet studies

36 CFR 908.33 - Final determination.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Final determination. 908.33... DEVELOPMENT AREA Review Procedure § 908.33 Final determination. (a) The Chairman or designee(s) shall make a final determination on the claim within 45 days of receipt of the file from the Director of Real Estate...

Identification of boosted, hadronically-decaying $W$ and $Z$ bosons in $\\sqrt{s} = 13$ TeV Monte Carlo Simulations for ATLAS

CERN Document Server

The ATLAS collaboration

2015-01-01

This document summarises Monte Carlo simulation-based studies of tagging boosted, hadronically-decaying $W$ and $Z$ bosons at a centre-of-mass energy of $\\sqrt{s} = 13$ TeV. The studies presented here are based indirectly on a large body of work carried out in both real and simulated data from Run 1, and thoroughly re-evaluated and extended in simulated data at $\\sqrt{s} = 13$ TeV. The selected baseline strategy for tagging vector bosons in Run 2 is to use jets reconstructed with the anti-$k_t$ R = 1.0 algorithm and then trimmed with a subjet radius of $R_{\\rm subjet} = 0.2$ and a minimum transverse momentum fraction of $f_{cut} = 5\\%$. A combination of transverse momenta - dependent cuts on the calibrated, trimmed jet mass and the energy correlation ratio $D_{2}^{\\beta=1}$ is then used to separate jets coming from hadronic decays of $W$ and $Z$ bosons from the multijet background. Working points for efficiency and background rejection in the $W^{\\prime}\\rightarrow WZ \\rightarrow jjjj$ final state event topol...

Data breaches. Final rule.

Science.gov (United States)

2008-04-11

This document adopts, without change, the interim final rule that was published in the Federal Register on June 22, 2007, addressing data breaches of sensitive personal information that is processed or maintained by the Department of Veterans Affairs (VA). This final rule implements certain provisions of the Veterans Benefits, Health Care, and Information Technology Act of 2006. The regulations prescribe the mechanisms for taking action in response to a data breach of sensitive personal information.

Final focus system for TLC

International Nuclear Information System (INIS)

Oide, K.

1988-11-01

A limit of the chromaticity correction for the final focus system of a TeV Linear Collider (TLC) is investigated. As the result, it becomes possible to increase the aperture of the final doublet with a small increase of the horizontal β function. The new optics design uses a final doublet of 0.5 mm half-aperture and 1.4 T pole-tip field. The length of the system is reduced from 400 m to 200 m by several optics changes. Tolerances for various machine errors with this optics are also studied. 5 refs., 7 figs., 2 tabs

Cassini's Grand Finale Overview

Science.gov (United States)

Spilker, L. J.

2017-12-01

After 13 years in orbit, the Cassini-Huygens Mission to Saturn ended in a science-rich blaze of glory. Cassini sent back its final bits of unique science data on September 15, 2017, as it plunged into Saturn's atmosphere, vaporizing and satisfying planetary protection requirements. Cassini's final phase covered roughly ten months and ended with the first time exploration of the region between the rings and planet. In late 2016 Cassini transitioned to a series of 20 Ring Grazing orbits with peripases just outside Saturn's F ring, providing close flybys of tiny ring moons, including Pan, Daphnis and Atlas, and high-resolution views of Saturn's A and F rings. A final Titan flyby in late April 2017 propelled Cassini across Saturn's main rings and into its Grand Finale orbits. Comprised of 22 orbits, Cassini repeatedly dove between Saturn's innermost rings and upper atmosphere to answer fundamental questions unattainable earlier in the mission. The last orbit turned the spacecraft into the first Saturn atmosphere probe. The Grand Finale orbits provided highest resolution observations of both the rings and Saturn, and in-situ sampling of the ring particle composition, Saturn's atmosphere, plasma, and innermost radiation belts. The gravitational field was measured to unprecedented accuracy, providing information on the interior structure of the planet, winds in the deeper atmosphere, and mass of the rings. The magnetic field provided insight into the physical nature of the magnetic dynamo and structure of the internal magnetic field. The ion and neutral mass spectrometer sampled the upper atmosphere for molecules that escape the atmosphere in addition to molecules originating from the rings. The cosmic dust analyzer directly sampled the composition from different parts of the main rings for the first time. Fields and particles instruments directly measured the plasma environment between the rings and planet. Science highlights and new mysteries collected in the Grand

A Human-Automation Interface Model to Guide Automation Design of System Functions: A Way to Achieve Manning Goals in New Systems

Science.gov (United States)

2005-12-01

Manual (Army) FoS Family of Systems FRMV FCS Recovery and Maintenance Vehicle GDLS General Dynamics Land Systems HFE Human Factors Engineering...Thanks goes to our CRADA partners at BAE Systems (formerly UDLP) in Santa Clara, CA. Jeff Powers, Doug Neil, Gene Brennan, and Ron Natividad were eager...above in the HFE implications, MWL can be modeled during system design to assess if it is reasonable throughout system functional flow. Besides

77 FR 14416 - Notice of Availability of a Final Environmental Impact Statement and Final Environmental Impact...

Science.gov (United States)

2012-03-09

...In accordance with the National Environmental Policy Act of 1969, as amended (NEPA), and the Federal Land Policy and Management Act of 1976, as amended (FLPMA), the Bureau of Land Management (BLM) has prepared a Proposed California Desert Conservation Area (CDCA) Plan Amendment (PA)/Final Environmental Impact Statement (EIS) and Final Environmental Impact Report (EIR) for the Ocotillo Express Wind Energy Facility (OWEF) and by this notice is announcing the availability of the Proposed PA and Final EIS/EIR.

Biomass Pyrolysis to Hydrocarbon Fuels in the Petroleum Refining Context: Cooperative Research and Development Final Report, CRADA Number CRD-12-500

Energy Technology Data Exchange (ETDEWEB)

Chum, Helena L. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2018-01-01

This work focuses on developing a thermochemical route to produce biofuels from agricultural wastes such as sugar cane bagasse, wood chips or corn stover; more specifically it intends to develop the biomass pyrolysis route, which produces bio-oils. Production of bio-oils by pyrolysis is a commercial technology. However, bio-oils are currently not being used for liquid fuels production. Although bio-oils can be produced by high-pressure liquefaction, pyrolysis is a less expensive technology. Nevertheless, bio-oils cannot be used directly as a transportation fuel without upgrading, since they are generally unstable, viscous, and acidic. Thus NREL and Petrobras intend to use their combined expertise to develop a two-step route to biofuels production: in the first step, a stable bio-oil is produced by NREL biomass pyrolysis technology, while in the second step it is upgraded by using two distinct catalytic processes under development by Petrobras. The first process converts bio-oil into gasoline, LPG, and fuel oil using the catalytic cracking process, while the second one, converts bio-oil into synthesis gas. Syngas gasification catalysts provided by both NREL and Petrobras will be tested. The work includes experiments at both sites to produce bio-oil and then biofuels, life-cycle analysis of each route, personnel training and development of analytical methods with a duration time of two years.

Portfolio-Scale Optimization of Customer Energy Efficiency Incentive and Marketing: Cooperative Research and Development Final Report, CRADA Number CRD-13-535

Energy Technology Data Exchange (ETDEWEB)

Brackney, Larry J. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2016-02-17

North East utility National Grid (NGrid) is developing a portfolio-scale application of OpenStudio designed to optimize incentive and marketing expenditures for their energy efficiency (EE) programs. NGrid wishes to leverage a combination of geographic information systems (GIS), public records, customer data, and content from the Building Component Library (BCL) to form a JavaScript Object Notation (JSON) input file that is consumed by an OpenStudio-based expert system for automated model generation. A baseline model for each customer building will be automatically tuned using electricity and gas consumption data, and a set of energy conservation measures (ECMs) associated with each NGrid incentive program will be applied to the model. The simulated energy performance and return on investment (ROI) will be compared with customer hurdle rates and available incentives to A) optimize the incentive required to overcome the customer hurdle rate and B) determine if marketing activity associated with the specific ECM is warranted for that particular customer. Repeated across their portfolio, this process will enable NGrid to substantially optimize their marketing and incentive expenditures, targeting those customers that will likely adopt and benefit from specific EE programs.

Development of Carbon-14 Waste Destruction and Recovery System Using AC Plasma Torch Technology Final Report CRADA No. TC02108.0

Energy Technology Data Exchange (ETDEWEB)

Althouse, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McKannay, R. H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2017-08-15

This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and ISOFLEX USA (ISOFLEX), to 1) develop and test a prototype waste destruction system ("System") using AC plasma torch technology to break down and drastically reduce the volume of Carbon-14 (C-14) contaminated medical laboratory wastes while satisfying all environmental regulations, and 2) develop and demonstrate methods for recovering 99%+ of the carbon including the C-14 allowing for possible re-use as a tagging and labeling tool in the biomedical industry.

CRADA with Teledyne Electronic Technologies and Pacific Northwest National Laboratory (PNL-096): The Exposure-to-Risk monitoring system. Final letter report

Energy Technology Data Exchange (ETDEWEB)

Thrall, K.D.

1996-10-01

The purpose of this project was to demonstrate the ``Exposure-to- Risk`` monitoring system in an actual occupational environment. The system is a unique combination of existing hardware with proprietary software to create an integrated means of assessing occupational exposures to volatile organic compounds. One component of this system utilizes a portable mass spectrometer developed by Teledyne Electronic Technologies. Integration of the system was accomplished under Laboratory Directed Research and Development (LDRD) funding. Commercialization of the system will take place following demonstration in an actual occupational environment, and will include, in part, Teledyne Electronic Technologies. The Exposure-to-Risk monitoring system will benefit DOE by overcoming present-day limitations in worker health protection monitoring. There are numerous sites within the` DOE complex where many different hazardous chemicals are used on a routine basis. These chemicals range from paint stripers and cleaning solvents to chemical warfare agents, each having its own degree of potential adverse health risk to a worker. Thus, a real concern for DOE is to ensure that a worker is properly monitored to assess any adverse health risk from exposure to potentially hazardous chemicals. With current industrial hygiene technologies, this is an arduous task. The Exposure-to-Risk monitoring system integrates a patented breath-inlet device connecting a subject`s exhaled breath directly with a field-portable mass spectrometer with physiologically based pharmacokinetic (PBPK) modeling to estimate the target tissue dose following a chemical exposure. Estimation of the adverse health risk prediction follows from the exposure/dose calculation based on currently accepted methodologies. This new system can determine, in the field, the possible adverse health risks on a daily basis to an individual worker.

Benign Breast Disease: Toward Molecular Prediction of Breast Cancer Risk

Science.gov (United States)

2009-06-01

Surg i’athol • Volume 30, Number 6, lune 2006 FIGURE 3. At scanning magnification this papilloma is characterized by marked hypercellul3rity and...ume 30, Number 6, lune 2006 TARI F l . f)pmnomrhir r harnrtP.ri>l ir< anrl ~ IR• nf RrM<I CardnnnM OP.vPtrmm•n•· fnr thP M., yn Cnhnrl Cnmr"’Prl Wi1h

Uses of biotechnology in waste treatment

International Nuclear Information System (INIS)

Holmes, R.G.G.; Benson, J.

1996-01-01

BNFL have invested in a Biotechnology programme to address waste treatment problems. The use of biotechnology to destroy organic pollutants is well known and has been successfully employed both in-situ and ex-situ. The BNFL approach has been to concentrate on the interaction of microbial systems with inorganic materials. This study has resulted in two major programmes of work that show every indication of being suitable for large scale application. The first programme of work investigated using, to decontaminate concrete surfaces, the phenomena of concrete degradation by sulphur oxidizing bacteria. Laboratory tests proved encouraging and have resulted in a Co-operative Research and Development Agreement (CRADA), between BNFL and Lockheed Martin Idaho Technologies Company for the INEL site. The CRADA will lead to a demonstration of the technology. The second major area of investigation is the development of an integrated bioremediation process for the removal and recovery of toxic heavy metals from contaminated land. The two stage process, which can be employed in an in-situ or ex-situ mode, involves the use of indigenous micro-organisms to generate sulphuric acid and environmental consortia to generate hydrogen sulphide. This project has reached the point of field trials. Results from both programmes will be presented and their applications at nuclear sites detailed

Critical parameters for electron beam curing of cationic epoxies and property comparison of electron beam cured cationic epoxies versus thermal cured resins and composites

International Nuclear Information System (INIS)

Janke, C.J.; Norris, R.E.; Yarborough, K.; Lopata, V.J.

1997-01-01

Electron beam curing of composites is a nonthermal, nonautoclave curing process offering the following advantages compared to conventional thermal curing: substantially reduced manufacturing costs and curing times; improvements in part quality and performance; reduced environmental and health concerns; and improvements in material handling. In 1994 a Cooperative Research and Development Agreement (CRADA), sponsored by the Department of Energy Defense Programs and 10 industrial partners, was established to advance electron beam curing of composites. The CRADA has successfully developed hundreds of new toughened and untoughened resins, offering unlimited formulation and processing flexibility. Several patent applications have been filed for this work. Composites made from these easily processable, low shrinkage material match the performance of thermal cured composites and exhibit: low void contents comparable to autoclave cured composites (less than 1%); superb low water absorption values in the same range as cyanate esters (less than 1%); glass transition temperatures rivaling those of polyimides (greater than 390 C); mechanical properties comparable to high performance, autoclave cured composites; and excellent property retention after cryogenic and thermal cycling. These materials have been used to manufacture many composite parts using various fabrication processes including hand lay-up, tow placement, filament winding, resin transfer molding and vacuum assisted resin transfer molding

Final Focus Systems in Linear Colliders

International Nuclear Information System (INIS)

Raubenheimer, Tor

1998-01-01

In colliding beam facilities, the ''final focus system'' must demagnify the beams to attain the very small spot sizes required at the interaction points. The first final focus system with local chromatic correction was developed for the Stanford Linear Collider where very large demagnifications were desired. This same conceptual design has been adopted by all the future linear collider designs as well as the SuperConducting Supercollider, the Stanford and KEK B-Factories, and the proposed Muon Collider. In this paper, the over-all layout, physics constraints, and optimization techniques relevant to the design of final focus systems for high-energy electron-positron linear colliders are reviewed. Finally, advanced concepts to avoid some of the limitations of these systems are discussed

Expanded studies of linear collider final focus systems at the Final Focus Test Beam

International Nuclear Information System (INIS)

Tenenbaum, P.G.

1995-12-01

In order to meet their luminosity goals, linear colliders operating in the center-of-mass energy range from 3,50 to 1,500 GeV will need to deliver beams which are as small as a few Manometers tall, with x:y aspect ratios as large as 100. The Final Focus Test Beam (FFTB) is a prototype for the final focus demanded by these colliders: its purpose is to provide demagnification equivalent to those in the future linear collider, which corresponds to a focused spot size in the FFTB of 1.7 microns (horizontal) by 60 manometers (vertical). In order to achieve the desired spot sizes, the FFTB beam optics must be tuned to eliminate aberrations and other errors, and to ensure that the optics conform to the desired final conditions and the measured initial conditions of the beam. Using a combination of incoming-beam diagnostics. beam-based local diagnostics, and global tuning algorithms, the FFTB beam size has been reduced to a stable final size of 1.7 microns by 70 manometers. In addition, the chromatic properties of the FFTB have been studied using two techniques and found to be acceptable. Descriptions of the hardware and techniques used in these studies are presented, along with results and suggestions for future research

Expanded studies of linear collider final focus systems at the Final Focus Test Beam

Energy Technology Data Exchange (ETDEWEB)

Tenenbaum, Peter Gregory [Stanford Univ., CA (United States)

1995-12-01

In order to meet their luminosity goals, linear colliders operating in the center-of-mass energy range from 3,50 to 1,500 GeV will need to deliver beams which are as small as a few Manometers tall, with x:y aspect ratios as large as 100. The Final Focus Test Beam (FFTB) is a prototype for the final focus demanded by these colliders: its purpose is to provide demagnification equivalent to those in the future linear collider, which corresponds to a focused spot size in the FFTB of 1.7 microns (horizontal) by 60 manometers (vertical). In order to achieve the desired spot sizes, the FFTB beam optics must be tuned to eliminate aberrations and other errors, and to ensure that the optics conform to the desired final conditions and the measured initial conditions of the beam. Using a combination of incoming-beam diagnostics. beam-based local diagnostics, and global tuning algorithms, the FFTB beam size has been reduced to a stable final size of 1.7 microns by 70 manometers. In addition, the chromatic properties of the FFTB have been studied using two techniques and found to be acceptable. Descriptions of the hardware and techniques used in these studies are presented, along with results and suggestions for future research.

Final focus nomenclature

International Nuclear Information System (INIS)

Erickson, R.

1986-01-01

The formal names and common names for all devices in the final focus system of the SLC are listed. The formal names consist of a device type designator, microprocessor designator, and a four-digit unit number

FameLab - Swiss Semi Finals

CERN Multimedia

Corinne Pralavorio

2012-01-01

Twenty-two young scientists participated in the FameLab semi-final at CERN's Globe of Science and Innovation on 4 February, supported by a large audience and by more than 100 fans following via webcast. A panel of judges chose Lemmer and four other candidates to join five other semi-finalists at the national finals in Zurich on 30 March.

Catarse e Final Feliz

Directory of Open Access Journals (Sweden)

Myriam Ávila

2001-12-01

Full Text Available Resumo: É a certeza de que nada mais – ou nada importante – pode acontecer após o final de um conto que permite o acontecimento da catarse. Se na maioria das narrativas existe algum tipo de dénouement, em algumas delas isso acontece de maneira especialmente satisfatória e afirmativa. O conto de fadas é uma dessas formas narrativas onde o efeito catártico é extremo e preenche objetivos específicos, de acordo com Bruno Bettelheim. Hollywood mimetizou essa forma como estratégia de sedução, iniciando a tradição do final feliz no cinema. A partir do conto de fadas Cinderela, em diferentes versões, juntamente com a animação homônima da Disney e ainda duas versões do filme Sabrina, será traçada aqui uma relação entre a catarse e o final feliz nos contos de fada, bem como seu uso pela indústria cultural. Palavras-chave: catarse, contos de fada, Hollywood

Final focus nomenclature

Energy Technology Data Exchange (ETDEWEB)

Erickson, R.

1986-08-08

The formal names and common names for all devices in the final focus system of the SLC are listed. The formal names consist of a device type designator, microprocessor designator, and a four-digit unit number. (LEW)

10 CFR 603.890 - Final performance report.

Science.gov (United States)

2010-01-01

... to Other Administrative Matters Financial and Programmatic Reporting § 603.890 Final performance report. A TIA must require a final performance report that addresses all major accomplishments under the... 10 Energy 4 2010-01-01 2010-01-01 false Final performance report. 603.890 Section 603.890 Energy...

CERDEC Fuel Cell Team: Military Transitions for Soldier Fuel Cells

Science.gov (United States)

2008-10-27

Fuel Cell (DMFC) (PEO Soldier) Samsung: 20W DMFC (CRADA) General Atomics & Jadoo: 50W Ammonia Borane Fueled PEMFC Current Fuel Cell Team Efforts...Continued Ardica: 20W Wearable PEMFC operating on Chemical Hydrides Spectrum Brands w/ Rayovac: Hydrogen Generators and Alkaline Fuel Cells for AA...100W Ammonia Borane fueled PEMFC Ultralife: 150W sodium borohydride fueled PEMFC Protonex: 250W RMFC and Power Manager (ARO) NanoDynamics: 250W SOFC

Natick Soldier Systems Center Science and Technology Board (9th)

Science.gov (United States)

2012-05-29

NSRDEC overarching CRADA’s with all five UMass campuses (in routing) • Patent License Agreement with Niche, Inc , New Bedford, MA (Ground impact...84.2 1 201 1 2014 GEAR4 UNITY REMOTE (Ben created.’deveil)j)ild~icensed) 2017 :>O?O SUM DEVICES QUANTIFIED SELF JAWBONE UP ATBIT ULTRA NIKE FUEL...Rudolph gained system development experience in multiple IT companies. In March 1994, he co-founded Paradigm Technologies, Inc ., an industry partner

Nucleic acid-binding properties of the RRM-containing protein RDM1

International Nuclear Information System (INIS)

Hamimes, Samia; Bourgeon, Dominique; Stasiak, Alicja Z.; Stasiak, Andrzej; Van Dyck, Eric

2006-01-01

RDM1 (RAD52 Motif 1) is a vertebrate protein involved in the cellular response to the anti-cancer drug cisplatin. In addition to an RNA recognition motif, RDM1 contains a small amino acid motif, named RD motif, which it shares with the recombination and repair protein, RAD52. RDM1 binds to single- and double-stranded DNA, and recognizes DNA distortions induced by cisplatin adducts in vitro. Here, we have performed an in-depth analysis of the nucleic acid-binding properties of RDM1 using gel-shift assays and electron microscopy. We show that RDM1 possesses acidic pH-dependent DNA-binding activity and that it binds RNA as well as DNA, and we present evidence from competition gel-shift experiments that RDM1 may be capable of discrimination between the two nucleic acids. Based on reported studies of RAD52, we have generated an RDM1 variant mutated in its RD motif. We find that the L 119 GF → AAA mutation affects the mode of RDM1 binding to single-stranded DNA

SLC Final Performance and Lessons

International Nuclear Information System (INIS)

Phinney, Nan

2000-01-01

The Stanford Linear Collider (SLC) was the first prototype of a new type of accelerator, the electron-positron linear collider. Many years of dedicated effort were required to understand the physics of this new technology and to develop the techniques for maximizing performance. Key issues were emittance dilution, stability, final beam optimization and background control. Precision, non-invasive diagnostics were required to measure and monitor the beams throughout the machine. Beam-based feedback systems were needed to stabilize energy, trajectory, intensity and the final beam size at the interaction point. variety of new tuning techniques were developed to correct for residual optical or alignment errors. The final focus system underwent a series of refinements in order to deliver sub-micron size beams. It also took many iterations to understand the sources of backgrounds and develop the methods to control them. The benefit from this accumulated experience was seen in the performance of the SLC during its final run in 1997-98. The luminosity increased by a factor of three to 3*10 30 and the 350,000 Z data sample delivered was nearly double that from all previous runs combined

Conserved binding of GCAC motifs by MEC-8, couch potato, and the RBPMS protein family

Science.gov (United States)

Soufari, Heddy

2017-01-01

Precise regulation of mRNA processing, translation, localization, and stability relies on specific interactions with RNA-binding proteins whose biological function and target preference are dictated by their preferred RNA motifs. The RBPMS family of RNA-binding proteins is defined by a conserved RNA recognition motif (RRM) domain found in metazoan RBPMS/Hermes and RBPMS2, Drosophila couch potato, and MEC-8 from Caenorhabditis elegans. In order to determine the parameters of RNA sequence recognition by the RBPMS family, we have first used the N-terminal domain from MEC-8 in binding assays and have demonstrated a preference for two GCAC motifs optimally separated by >6 nucleotides (nt). We have also determined the crystal structure of the dimeric N-terminal RRM domain from MEC-8 in the unbound form, and in complex with an oligonucleotide harboring two copies of the optimal GCAC motif. The atomic details reveal the molecular network that provides specificity to all four bases in the motif, including multiple hydrogen bonds to the initial guanine. Further studies with human RBPMS, as well as Drosophila couch potato, confirm a general preference for this double GCAC motif by other members of the protein family and the presence of this motif in known targets. PMID:28003515

Norepinephrine accumulation by the rat caudal artery in the presence of hypertensive plasma

International Nuclear Information System (INIS)

Freas, W.; Thompson, D.A.; Hart, J.L.; Muldoon, S.M.

1986-01-01

We have partially isolated endogenous factors from canine plasma which inhibit 3 H-norepinephrine (NE) accumulation by the canine saphenous vein. The purpose of this study is to determine if these circulating factors may account for the observed differences in 3 H-NE uptake by hypertensive and normotensive blood vessels. Three models of hypertension were examined in this study. Blood vessels were compared from SHR and WKY rats, deoxycorticosterone acetate (DOCA) and control rats, and reduced renal mass (RRM) and control rats. There was no significant difference in 3 H-NE accumulation between blood vessels obtained from RRM and paired control rats. However, both the SHR and DOCA hypertensive caudal arteries and aorta accumulated significantly more 3 H-NE than their corresponding control tissues. There was not a significant change in 3 H-NE accumulation between hypertensive and control vena cava and mesenteric arteries. Normotensive and hypertensive plasma inhibited 3 H-NE accumulation by the rat caudal artery. However, there was not a correlation between blood pressure of plasma donor rats and accumulation of 3 H-NE. Therefore, although there are differences in 3 H-NE accumulation between hypertensive and normotensive blood vessels, plasma does not contain a factor responsible for this observed difference

Transverse momentum dependence of D-meson production in Pb–Pb collisions at $\\sqrt{s_{\\rm NN}}$ = 2.76 TeV

CERN Document Server

Adam, Jaroslav; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Alam, Sk Noor; Aleksandrov, Dmitry; Alessandro, Bruno; Alexandre, Didier; Alfaro Molina, Jose Ruben; Alici, Andrea; Alkin, Anton; Millan Almaraz, Jesus Roberto; Alme, Johan; Alt, Torsten; Altinpinar, Sedat; Altsybeev, Igor; Alves Garcia Prado, Caio; Andrei, Cristian; Andronic, Anton; Anguelov, Venelin; Anielski, Jonas; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartke, Jerzy Gustaw; Bartsch, Esther; Basile, Maurizio; Bastid, Nicole; Basu, Sumit; Bathen, Bastian; Batigne, Guillaume; Batista Camejo, Arianna; Batyunya, Boris; Batzing, Paul Christoph; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Belmont Iii, Ronald John; Belmont Moreno, Ernesto; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Berceanu, Ionela; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhasin, Anju; Bhat, Inayat Rasool; Bhati, Ashok Kumar; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Livio; Bianchi, Nicola; Bianchin, Chiara; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biswas, Rathijit; Biswas, Saikat; Bjelogrlic, Sandro; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Bock, Friederike; Bogdanov, Alexey; Boggild, Hans; Boldizsar, Laszlo; Bombara, Marek; Book, Julian Heinz; Borel, Herve; Borissov, Alexander; Borri, Marcello; Bossu, Francesco; Botta, Elena; Boettger, Stefan; Bourjau, Christian; Braun-Munzinger, Peter; Bregant, Marco; Breitner, Timo Gunther; Broker, Theo Alexander; Browning, Tyler Allen; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Caffarri, Davide; Cai, Xu; Caines, Helen Louise; Calero Diaz, Liliet; Caliva, Alberto; Calvo Villar, Ernesto; Camerini, Paolo; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Cepila, Jan; Cerello, Piergiorgio; Cerkala, Jakub; Chang, Beomsu; Chapeland, Sylvain; Chartier, Marielle; Charvet, Jean-Luc Fernand; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chelnokov, Volodymyr; Cherney, Michael Gerard; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Choi, Kyungeon; Chojnacki, Marek; Choudhury, Subikash; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-Urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Connors, Megan Elizabeth; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortes Maldonado, Ismael; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Crochet, Philippe; Cruz Albino, Rigoberto; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Deisting, Alexander; Deloff, Andrzej; Denes, Ervin Sandor; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Nezza, Pasquale; Diaz Corchero, Miguel Angel; Dietel, Thomas; Dillenseger, Pascal; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Drozhzhova, Tatiana; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erdemir, Irem; Erhardt, Filip; Espagnon, Bruno; Estienne, Magali Danielle; Esumi, Shinichi; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Eyyubova, Gyulnara; Fabbietti, Laura; Fabris, Daniela; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Ferencei, Jozef; Fernandez Tellez, Arturo; Gonzalez Ferreiro, Elena; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiore, Enrichetta Maria; Fleck, Martin Gabriel; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Frankenfeld, Ulrich Michael; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gallio, Mauro; Gangadharan, Dhevan Raja; Ganoti, Paraskevi; Gao, Chaosong; Garabatos Cuadrado, Jose; Garcia-Solis, Edmundo Javier; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; Germain, Marie; Gheata, Andrei George; Gheata, Mihaela; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Gladysz-Dziadus, Ewa; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Grachov, Oleg Anatolievich; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Grelli, Alessandro; Grigoras, Alina Gabriela; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Grynyov, Borys; Grion, Nevio; Gronefeld, Julius Maximilian; Grosse-Oetringhaus, Jan Fiete; Grossiord, Jean-Yves; Grosso, Raffaele; Guber, Fedor; Guernane, Rachid; Guerzoni, Barbara; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Haake, Rudiger; Haaland, Oystein Senneset; Hadjidakis, Cynthia Marie; Haiduc, Maria; Hamagaki, Hideki; Hamar, Gergoe; Harris, John William; Harton, Austin Vincent; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Heide, Markus Ansgar; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Herrera Corral, Gerardo Antonio; Hess, Benjamin Andreas; Hetland, Kristin Fanebust; Hillemanns, Hartmut; Hippolyte, Boris; Hosokawa, Ritsuya; Hristov, Peter Zahariev; Huang, Meidana; Humanic, Thomas; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Ilkaev, Radiy; Inaba, Motoi; Ippolitov, Mikhail; Irfan, Muhammad; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jahnke, Cristiane; Jakubowska, Monika Joanna; Jang, Haeng Jin; Janik, Malgorzata Anna; Pahula Hewage, Sandun; Jena, Chitrasen; Jena, Satyajit; Jimenez Bustamante, Raul Tonatiuh; Jones, Peter Graham; Jung, Hyungtaik; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kamin, Jason Adrian; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karayan, Lilit; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Khan, Mohammed Mohisin; Khan, Palash; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Kileng, Bjarte; Kim, Do Won; Kim, Dong Jo; Kim, Daehyeok; Kim, Hyeonjoong; Kim, Jinsook; Kim, Mimae; Kim, Minwoo; Kim, Se Yong; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Kiss, Gabor; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-Boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobayashi, Taiyo; Kobdaj, Chinorat; Kofarago, Monika; Kollegger, Thorsten; Kolozhvari, Anatoly; Kondratev, Valerii; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Kopcik, Michal; Kour, Mandeep; Kouzinopoulos, Charalampos; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Koyithatta Meethaleveedu, Greeshma; Kralik, Ivan; Kravcakova, Adela; Kretz, Matthias; Krivda, Marian; Krizek, Filip; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Ajay; Kumar, Jitendra; Lokesh, Kumar; Kumar, Shyam; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Ladron De Guevara, Pedro; Lagana Fernandes, Caio; Lakomov, Igor; Langoy, Rune; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Lattuca, Alessandra; Laudi, Elisa; Lea, Ramona; Leardini, Lucia; Lee, Graham Richard; Lee, Seongjoo; Lehas, Fatiha; Lemmon, Roy Crawford; Lenti, Vito; Leogrande, Emilia; Leon Monzon, Ildefonso; Leon Vargas, Hermes; Leoncino, Marco; Levai, Peter; Li, Shuang; Li, Xiaomei; Lien, Jorgen Andre; Lietava, Roman; Lindal, Svein; Lindenstruth, Volker; Lippmann, Christian; Lisa, Michael Annan; Ljunggren, Hans Martin; Lodato, Davide Francesco; Lonne, Per-Ivar; Loginov, Vitaly; Loizides, Constantinos; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Lunardon, Marcello; Luparello, Grazia; Maevskaya, Alla; Mager, Magnus; Mahajan, Sanjay; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Maldonado Cervantes, Ivonne Alicia; Malinina, Liudmila; Mal'Kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martin Blanco, Javier; Martinengo, Paolo; Martinez Hernandez, Mario Ivan; Martinez-Garcia, Gines; Martinez Pedreira, Miguel; Mas, Alexis Jean-Michel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Mastroserio, Annalisa; Matyja, Adam Tomasz; Mayer, Christoph; Mazer, Joel Anthony; Mazzoni, Alessandra Maria; Mcdonald, Daniel; Meddi, Franco; Melikyan, Yuri; Menchaca-Rocha, Arturo Alejandro; Meninno, Elisa; Mercado-Perez, Jorge; Meres, Michal; Miake, Yasuo; Mieskolainen, Matti Mikael; Mikhaylov, Konstantin; Milano, Leonardo; Milosevic, Jovan; Minervini, Lazzaro Manlio; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Bedangadas; Molnar, Levente; Montano Zetina, Luis Manuel; Montes Prado, Esther; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munzer, Robert Helmut; Murray, Sean; Musa, Luciano; Musinsky, Jan; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Naru, Muhammad Umair; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Nayak, Kishora; Nayak, Tapan Kumar; Nazarenko, Sergey; Nedosekin, Alexander; Nellen, Lukas; Ng, Fabian; Nicassio, Maria; Niculescu, Mihai; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Saehanseul; Oh, Sun Kun; Ohlson, Alice Elisabeth; Okatan, Ali; Okubo, Tsubasa; Olah, Laszlo; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Ozdemir, Mahmut; Pachmayer, Yvonne Chiara; Pagano, Paola; Paic, Guy; Pal, Susanta Kumar; Pan, Jinjin; Pandey, Ashutosh Kumar; Papcun, Peter; Papikyan, Vardanush; Pappalardo, Giuseppe; Pareek, Pooja; Park, Woojin; Parmar, Sonia; Passfeld, Annika; Paticchio, Vincenzo; Patra, Rajendra Nath; Paul, Biswarup; Peitzmann, Thomas; Pereira Da Costa, Hugo Denis Antonio; Pereira De Oliveira Filho, Elienos; Peresunko, Dmitry Yurevich; Perez Lara, Carlos Eugenio; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrov, Viacheslav; Petrovici, Mihai; Petta, Catia; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Pinazza, Ombretta; Pinsky, Lawrence; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Porteboeuf, Sarah Julie; Porter, R Jefferson; Pospisil, Jan; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Puddu, Giovanna; Pujahari, Prabhat Ranjan; Punin, Valery; Putschke, Jorn Henning; Qvigstad, Henrik; Rachevski, Alexandre; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Read, Kenneth Francis; Redlich, Krzysztof; Reed, Rosi Jan; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reolon, Anna Rita; Reshetin, Andrey; Revol, Jean-Pierre; Reygers, Klaus Johannes; Riabov, Viktor; Ricci, Renato Angelo; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-Lucian; Rocco, Elena; Rodriguez Cahuantzi, Mario; Rodriguez Manso, Alis; Roeed, Ketil; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Romita, Rosa; Ronchetti, Federico; Ronflette, Lucile; Rosnet, Philippe; Rossi, Andrea; Roukoutakis, Filimon; Roy, Ankhi; Roy, Christelle Sophie; Roy, Pradip Kumar; Rubio Montero, Antonio Juan; Rui, Rinaldo; Russo, Riccardo; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Sadovskiy, Sergey; Safarik, Karel; Sahlmuller, Baldo; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Salzwedel, Jai Samuel Nielsen; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandor, Ladislav; Sandoval, Andres; Sano, Masato; Sarkar, Debojit; Scapparone, Eugenio; Scarlassara, Fernando; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schuchmann, Simone; Schukraft, Jurgen; Schulc, Martin; Schuster, Tim Robin; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Scott, Rebecca Michelle; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shadura, Oksana; Shahoyan, Ruben; Shangaraev, Artem; Sharma, Ankita; Sharma, Mona; Sharma, Monika; Sharma, Natasha; Shigaki, Kenta; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Silvestre, Catherine Micaela; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singha, Subhash; Singhal, Vikas; Sinha, Bikash; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Soegaard, Carsten; Song, Jihye; Song, Myunggeun; Song, Zixuan; Soramel, Francesca; Sorensen, Soren Pontoppidan; Sozzi, Federica; Spacek, Michal; Spiriti, Eleuterio; Sputowska, Iwona Anna; Spyropoulou-Stassinaki, Martha; Stachel, Johanna; Stan, Ionel; Stefanek, Grzegorz; Stenlund, Evert Anders; Steyn, Gideon Francois; Stiller, Johannes Hendrik; Stocco, Diego; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Szabo, Alexander; Szanto De Toledo, Alejandro; Szarka, Imrich; Szczepankiewicz, Adam; Szymanski, Maciej Pawel; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tangaro, Marco-Antonio; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-Gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terasaki, Kohei; Terrevoli, Cristina; Teyssier, Boris; Thaeder, Jochen Mathias; Thomas, Deepa; Tieulent, Raphael Noel; Timmins, Anthony Robert; Toia, Alberica; Trogolo, Stefano; Trombetta, Giuseppe; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vajzer, Michal; Vala, Martin; Valencia Palomo, Lizardo; Vallero, Sara; Van Der Maarel, Jasper; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vanat, Tomas; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vechernin, Vladimir; Veen, Annelies Marianne; Veldhoen, Misha; Velure, Arild; Venaruzzo, Massimo; Vercellin, Ermanno; Vergara Limon, Sergio; Vernet, Renaud; Verweij, Marta; Vickovic, Linda; Viesti, Giuseppe; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Vinogradov, Leonid; Vinogradov, Yury; Virgili, Tiziano; Vislavicius, Vytautas; Viyogi, Yogendra; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Vranic, Danilo; Vrlakova, Janka; Vulpescu, Bogdan; Vyushin, Alexey; Wagner, Boris; Wagner, Jan; Wang, Hongkai; Wang, Mengliang; Watanabe, Daisuke; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Weiser, Dennis Franz; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilde, Martin Rudolf; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Williams, Crispin; Windelband, Bernd Stefan; Winn, Michael Andreas; Yaldo, Chris G; Yang, Hongyan; Yang, Ping; Yano, Satoshi; Yasar, Cigdem; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-Kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Yushmanov, Igor; Zaborowska, Anna; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correia Zanoli, Henrique Jose; Zaporozhets, Sergey; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zgura, Sorin Ion; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhang, Yonghong; Chunhui, Zhang; Zhang, Zuman; Zhao, Chengxin; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zichichi, Antonino; Zimmermann, Alice; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zyzak, Maksym

2016-03-14

The production of prompt charmed mesons D$^0$, D$^+$ and D$^{*+}$, and their antiparticles, was measured with the ALICE detector in Pb–Pb collisions at the centre-of-mass energy per nucleon pair, $\\sqrt{s_{\\rm NN}}$ of 2.76 TeV. The production yields for rapidity $|y| < 0.5$ are presented as a function of transverse momentum, $p_{\\rm T}$, in the interval 1–36 GeV/$c$ for the centrality class 0–10\\% and in the interval 1–16 GeV/$c$ for the centrality class 30–50\\%. The nuclear modification factor $R_{\\rm AA}$ was computed using a proton–proton reference at $\\sqrt{s}=2.76$ TeV, based on measurements at $\\sqrt{s}=7$ TeV and on theoretical calculations. A maximum suppression by a factor of 5–6 with respect to binary-scaled pp yields is observed for the most central collisions at $p_{\\rm T}$ of about 10 GeV/$c$. A suppression of a factor of about 2–3 persists at the highest $p_{\\rm T}$ covered by the measurements. At low $p_{\\rm T}$ (1–3 GeV/$c$), the $R_{\\rm AA}$ has large uncertainties that ...

Cassini's Grand Finale Science Highlights

Science.gov (United States)

Spilker, Linda

2017-10-01

After 13 years in orbit, the Cassini-Huygens Mission to Saturn ended in a science-rich blaze of glory. Cassini returned its final bits of unique science data on September 15, 2017, as it plunged into Saturn's atmosphere satisfying planetary protection requirements. Cassini's Grand Finale covered a period of roughly five months and ended with the first time exploration of the region between the rings and planet.The final close flyby of Titan in late April 2017 propelled Cassini across Saturn’s main rings and into its Grand Finale orbits; 22 orbits that repeatedly dove between Saturn’s innermost rings and upper atmosphere making Cassini the first spacecraft to explore this region. The last orbit turned the spacecraft into the first Saturn upper atmospheric probe.The Grand Finale orbits provided highest resolution observations of both the rings and Saturn, and in-situ sampling of the ring particle composition, Saturn's atmosphere, plasma, and innermost radiation belts. The gravitational field was measured to unprecedented accuracy, providing information on the interior structure of the planet, winds in the deeper atmosphere, and mass of the rings. The magnetic field provided insight into the physical nature of the magnetic dynamo and structure of the internal magnetic field. The ion and neutral mass spectrometer sampled the upper atmosphere for molecules that escape the atmosphere in addition to molecules originating from the rings. The cosmic dust analyzer directly sampled the composition from different parts of the main rings for the first time. Fields and particles instruments directly measured the plasma environment between the rings and planet.Science highlights and new mysteries gleaned to date from the Grand Finale orbits will be discussed.The research described in this paper was carried out in part at the Jet Propulsion Laboratory, California Institute of Technology, under a contract with the National Aeronautics and Space Administration. Copyright 2017

Final focus systems for linear colliders

International Nuclear Information System (INIS)

Helm, R.; Irwin, J.

1992-08-01

Final focus systems for linear colliders present many exacting challenges in beam optics, component design, and beam quality. Efforts to resolve these problems as they relate to a new generation of linear colliders are under way at several laboratories around the world. We will outline criteria for final focus systems and discuss the current state of understanding and resolution of the outstanding problems. We will discuss tolerances on alignment, field quality and stability for optical elements, and the implications for beam parameters such as emittance, energy spread, bunch length, and stability in position and energy. Beam-based correction procedures, which in principle can alleviate many of the tolerances, will be described. Preliminary results from the Final Focus Test Beam (FFTB) under construction at SLAC will be given. Finally, we mention conclusions from operating experience at the Stanford Linear Collider (SLC)