WorldWideScience

Sample records for rockfish sebastes jordani

  1. AFSC/ABL: Rockfish allozyme species identification (Sebastes aleutianus and borealis)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Rougheye rockfish (Sebastes aleutianus) and shortraker rockfish (Sebastes borealis) were collected from the Washington coast, the Gulf of Alaska, the southern Bering...

  2. Movements of blue rockfish (Sebastes mystinus off central California with comparisons to similar species.

    Directory of Open Access Journals (Sweden)

    Kristen M Green

    Full Text Available Olive (Sebastes serranoides, black (Sebastes melanops, and blue rockfish (Sebastes mystinus are all common inhabitants of nearshore ecosystems on the West coast of North America and important components of the recreational fishery off California. Acoustic monitoring studies indicate that olive rockfish are highly residential and that black rockfish are capable of long migrations and have less site fidelity; yet little is known about the long-term movements of blue rockfish. External tag-recapture studies indicate that blue rockfish may have intermediate movements relative to these congener nearshore species. To better understand the site fidelity, and daily and seasonal movements of blue rockfish over long (>1-year time scales, we placed acoustic transmitters into 21 adult blue rockfish (30-41 cm total length in Carmel Bay, California. Blue rockfish displayed intermediate movement patterns and residency relative to other similar kelp forest rockfish species. Two-thirds of tagged blue rockfish (13 fish exhibited high residency to the study area (>12 mo. When in residence, mean home range of blue rockfish was 0.23 km2, however as many as 30% of tagged blue rockfish shifted their core home range area during the study. Most shifts in home range occurred during upwelling season, and tagged fish moved up to 3.1 km when in residence. Blue rockfish with short residence times were last detected in the study area in late winter and early spring. Blue rockfish were observed at shallower depths during day than night, likely indicative of diurnal feeding. However, over longer time scales, blue rockfish were detected at deeper depths during upwelling periods and with increased wave heights. Daily and seasonal vertical movements of blue rockfish may be influenced by upwelling conditions and local prey abundance.

  3. Characteristics of pathogenic Vibrio sp. isolated from the rockfish, Sebastes schlegeli

    International Nuclear Information System (INIS)

    Kim, Jong Hwa

    1995-02-01

    At the summer time, an infectious bacterial disease occurs and damages the net cage farms of rockfish (Sebastes schlegeli) at the western coast of Korea. The symptoms of this disease include darkness of body color, ulceration of skin, anemia of gill-filaments, and congestion of operculum. In order to know the attributes of pathogenicity of this disease, the study is performed with isolated bacteria from the rockfish sampled at the fish farm, located at Taean-gun Chungcheongnam-do, from June to September in 1994. The pathogenic bacteria cna be isolated from dermal lesion, kidney, liver, and spleen of the sick fish, and classified as Vibrio sp. based on the morphological, biological, and biochemical examinations. These isolates are proliferated in BTB teepol, TCBS, TSA, XA, BHIA, media, not in SS and MacConkey media, and the optimal growth conditions for NaCl concentration, pH, and temperature are 3%, 7∼8, and 25∼30 .deg. C, respectively. They turn out to be sensitive to three chemicals such as SXT (sulfamethoxazol + trimethoprim), nalidixic acid, and tetracycline, but resistant to ampicillin and penicillin G. Finally, the virulence of infectious bacteria is appeared at both 20 .deg. C and 27 .deg. C when isolated pathogenic strains are injected into the muscle of healthy rockfish

  4. Daily growth increments in otoliths of juvenile black rockfish, Sebastes melanops: an evaluation of autoradiography as a new method of validation

    International Nuclear Information System (INIS)

    Anon.

    1988-01-01

    This study evaluates the commonly used oxytetracycline hydrochloride (OTC) and an alternate chemical, the radioisotope calcium-45, in terms of their success as time-markers to validate daily growth increment formation in the otoliths of juvenile black rockfish, Sebastes melanops

  5. Effects of dietary chromium exposure to rockfish, Sebastes schlegelii are ameliorated by ascorbic acid.

    Science.gov (United States)

    Kim, Jun-Hwan; Kang, Ju-Chan

    2017-05-01

    Juvenile rockfish Sebastes schlegelii (mean length 10.8±1.4cm, and mean weight 31.7±3.6g) were exposed for 4 weeks with the different levels of dietary chromium (Cr 6+ ) at 0, 120 and 240mg/L and ascorbic acids (AsA) at 100, 200 and 400mg/L. Significant accumulation occurred in specific tissues and hematological parameters were altered: red blood cell count, hematocrit, and hemoglobin increased; plasma components were altered including calcium, glucose, cholesterol, total protein, glutamic oxalate transaminase, and glutamic pyruvate transaminase. However, magnesium and alkaline phosphatase concentrations were unchanged. Ascorbic acids reduced both chromium uptake into tissues and altered hematological parameters. Copyright © 2017. Published by Elsevier Inc.

  6. Age validation of canary rockfish (Sebastes pinniger) using two independent otolith techniques: lead-radium and bomb radiocarbon dating.

    Energy Technology Data Exchange (ETDEWEB)

    Andrews, A H; Kerr, L A; Cailliet, G M; Brown, T A; Lundstrom, C C; Stanley, R D

    2007-11-04

    Canary rockfish (Sebastes pinniger) have long been an important part of recreational and commercial rockfish fishing from southeast Alaska to southern California, but localized stock abundances have declined considerably. Based on age estimates from otoliths and other structures, lifespan estimates vary from about 20 years to over 80 years. For the purpose of monitoring stocks, age composition is routinely estimated by counting growth zones in otoliths; however, age estimation procedures and lifespan estimates remain largely unvalidated. Typical age validation techniques have limited application for canary rockfish because they are deep dwelling and may be long lived. In this study, the unaged otolith of the pair from fish aged at the Department of Fisheries and Oceans Canada was used in one of two age validation techniques: (1) lead-radium dating and (2) bomb radiocarbon ({sup 14}C) dating. Age estimate accuracy and the validity of age estimation procedures were validated based on the results from each technique. Lead-radium dating proved successful in determining a minimum estimate of lifespan was 53 years and provided support for age estimation procedures up to about 50-60 years. These findings were further supported by {Delta}{sup 14}C data, which indicated a minimum estimate of lifespan was 44 {+-} 3 years. Both techniques validate, to differing degrees, age estimation procedures and provide support for inferring that canary rockfish can live more than 80 years.

  7. AFSC/ABL: Rockfish Barotrauma

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Because rockfish (Sebastes spp.) are physoclystic, i.e. their gas bladders are closed off from the gut, they often suffer internal injuries from rapid, internal air...

  8. An integrative mating system assessment of a nonmodel, economically important Pacific rockfish (Sebastes melanops) reveals nonterritorial polygamy and conservation implications for a large species flock

    OpenAIRE

    Karageorge, Kurt W.; Wilson, Raymond R.

    2017-01-01

    Abstract Characterizing the mating systems of long‐lived, economically important Pacific rockfishes comprising the viviparous Sebastes species flock is crucial for their conservation. However, direct assignment of mating success to sires is precluded by open, offshore populations and high female fecundity. We addressed this challenge by integrating paternity‐assigned mating success of females with the adult sex ratio (ASR) of the population, male evolutionary responses to receptive females, a...

  9. AFSC/ABL: Rockfish Habitat Dive Video Transects

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Many species of commercially valuable rockfish (Sebastes spp.) inhabit waters on the outer continental shelf in the Gulf of Alaska typically between depths of...

  10. AFSC/ABL: Juvenile rockfish DNA species identification

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Many pelagic juvenile rockfish (Sebastes) were collected in juvenile salmonid surveys in the Gulf of Alaska (GOA) from 1998 to 2002. Often species identification of...

  11. Comparative analysis of two thioredoxin-like genes in black rockfish Sebastes schlegelii and their possible involvement in redox homeostasis and innate immune responses.

    Science.gov (United States)

    Kugapreethan, Roopasingam; Umasuthan, Navaneethaiyer; Wan, Qiang; Thulasitha, William Shanthakumar; Kim, Chul; Lee, Jehee

    2017-02-01

    Elevated levels of ROS can cause serious intracellular damages by reacting readily with nucleic acids, proteins and lipids, thus triggering tissue damage and cell death. Thioredoxin system is one of the principal factors that maintain the intracellular redox balance via its antioxidant property. In this study, we characterized two new thioredoxin isoforms (SsTXN-like 1 and SsMtTXN-like) from black rockfish, Sebastes schlegelii. The molecular and structural characteristics, as well as the evolutionary relationships of SsTXN-like 1 and SsMtTXN-like confirmed that they belong to the thioredoxin superfamily. A classical thioredoxin domain was found in both proteins with a conserved redox-active site CXYC, however, only the precursor of SsMtTXN-like protein possessed a mitochondrial targeting signal. The results from insulin disulfide reduction activity assay demonstrated that their recombinant proteins are capable of reducing the disulfide bonds of oxidatively damaged proteins via their oxidoreductase activities. The free radical scavenging activity assay revealed the prominent hydroxyl and DPPH scavenging activities of rSsTXN-like 1 and rSsMtTXN-like in a dose-dependent manner. Transcriptional studies showed a broad distribution of SsTXN-like 1 and SsMtTXN-like transcripts in all the examined tissues. Significant (p immune-related tissues after LPS, poly I:C and Streptococcus iniae challenges reflect their critical role in redox homeostasis in black rockfish. Taken together, SsTXN-like 1 and SsMtTXN-like, as two active members of thioredoxin superfamily, have significant antioxidant properties to housekeep the redox potential during various stress conditions and innate immune response of Sebastes schlegelii. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. Toxic effects on bioaccumulation and hematological parameters of juvenile rockfish Sebastes schlegelii exposed to dietary lead (Pb) and ascorbic acid.

    Science.gov (United States)

    Kim, Jun-Hwan; Kang, Ju-Chan

    2017-06-01

    Juvenile rockfish, Sebastes schlegelii (mean length 11.3 ± 1.2 cm, and mean weight 32.5 ± 4.1 g) were exposed for four weeks to dietary lead (Pb 2+ ) at 0, 120, and 240 mg/L and ascorbic acid (AsA) at 100, 200, and 400 mg/L. The exposure concentrations and duration of significant Pb-induced accumulations in specific tissues of S. schlegelii were assessed. High levels of ascorbic acid significantly attenuated accumulations following exposure to dietary Pb. Dietary Pb exposure caused a significant increase in blood Pb concentrations, whereas red blood cell (RBC) count, hematocrit, and hemoglobin were significantly decreased. Notable changes were also observed in plasma calcium, magnesium, glucose, cholesterol, glutamic oxaloacetic transaminase (GOT), and glutamic pyruvate transaminase (GPT). The growth performance of S. schlegelii was significantly decreased. High doses AsA supplemention were effective in attenuating the changes brought about by dietary Pb exposure. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Evaluation of a point-of-care blood analyzer and determination of reference ranges for blood parameters in rockfish.

    Science.gov (United States)

    Harrenstien, Lisa A; Tornquist, Susan J; Miller-Morgan, Timothy J; Fodness, Brian G; Clifford, Kevin E

    2005-01-15

    To compare values of blood parameters in rockfish obtained by use of a point-of-care portable blood analyzer with values determined by a veterinary diagnostic laboratory, calculate reference ranges for various blood parameters in black rockfish, and compare values of blood parameters in clinically normal fish with those of fish with clinical abnormalities. Prospective study. 41 captive adult black rockfish (Sebastes melanops) and 4 captive adult blue rockfish (Sebastes mystinus). Rockfish were anesthetized with tricaine methanesulfonate for collection of blood samples. Heparinized blood samples were immediately analyzed with a point-of-care analyzer. Blood sodium, potassium, chloride, urea nitrogen, and glucose concentrations; Hct; pH; partial pressure of carbon dioxide; total carbon dioxide concentration; bicarbonate concentration; base excess; and hemoglobin concentration were determined. A microhematocrit technique was used to determine PCV, and a refractometer was used to estimate total plasma protein concentration. Paired heparinized blood samples were transported to a veterinary diagnostic laboratory for analyses. Data obtained with the point-of-care analyzer were reproducible; however, values for most blood parameters were significantly different from those obtained by the veterinary diagnostic laboratory. Fish with poor body condition had several blood parameter values that were lower than corresponding values in clinically normal fish. Point-of-care blood analyses may prove useful in rockfish. Point-of-care data for a large number of clinically normal fish must be obtained for reference ranges to be calculated, and further assessments of clinically abnormal fish are necessary to determine the relevance of the data.

  14. Otolith shape lends support to the sensory drive hypothesis in rockfishes.

    Science.gov (United States)

    Tuset, V M; Otero-Ferrer, J L; Gómez-Zurita, J; Venerus, L A; Stransky, C; Imondi, R; Orlov, A M; Ye, Z; Santschi, L; Afanasiev, P K; Zhuang, L; Farré, M; Love, M S; Lombarte, A

    2016-10-01

    The sensory drive hypothesis proposes that environmental factors affect both signalling dynamics and the evolution of signals and receivers. Sound detection and equilibrium in marine fishes are senses dependent on the sagittae otoliths, whose morphological variability appears intrinsically linked to the environment. The aim of this study was to understand if and which environmental factors could be conditioning the evolution of this sensory structure, therefore lending support to the sensory drive hypothesis. Thus, we analysed the otolith shape of 42 rockfish species (Sebastes spp.) to test the potential associations with the phylogeny, biological (age), ecological (feeding habit and depth distribution) and biogeographical factors. The results showed strong differences in the otolith shapes of some species, noticeably influenced by ecological and biogeographical factors. Moreover, otolith shape was clearly conditioned by phylogeny, but with a strong environmental effect, cautioning about the use of this structure for the systematics of rockfishes or other marine fishes. However, our most relevant finding is that the data supported the sensory drive hypothesis as a force promoting the radiation of the genus Sebastes. This hypothesis holds that adaptive divergence in communication has significant influence relative to other life history traits. It has already been established in Sebastes for visual characters and organs; our results showed that it applies to otolith transformations as well (despite the clear influence of feeding and depth), expanding the scope of the hypothesis to other sensory structures. © 2016 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2016 European Society For Evolutionary Biology.

  15. Prevalence and spatial distribution of intraerythrocytic parasite(s) in Puget Sound rockfish (Sebastes emphaeus) from the San Juan Archipelago, Washington (USA)

    Science.gov (United States)

    Van Der Straaten, N.; Jacobson, A.; Halos, D.; Hershberger, P.; Kocan, A.A.; Kocan, R.

    2005-01-01

    Two morphologically distinct forms of an intraerythrocytic parasite(s) were detected by microscopic observation of Giemsa-stained blood films in 45.7% of 119 rockfish (Sebastes emphaeus) from the San Juan Archipelago (Washington State, U.S.A.). Infection prevalence for both forms was 53% in males, 44% in females, and 33% in fish of undetermined gender. A binucleate "ring-stage" was present at all 4 geographic sites, with a mean prevalence of 45.7%, while mean prevalence of a larger gamont-like form from the same sites was 5.1%. The relationship of the 2 forms to each other could not be determined. Neither schizogony nor binary fission was evident in any of the infected erythrocytes and the parasites contained no obvious pigment. The possibility of the 2 morphologic forms being 2 distinct species is supported by the observation that no difference in parasitemia was seen in the binucleate form among sites (1.6-1.9%), while parasitemia of the gamont-like form varied significantly among sites, ranging from a high of 4% to a low of 0.1%. Taxonomic status of either form could not be determined at this time based on limited existing morphologic data. ?? American Society of Parasitologists 2005.

  16. Population Consequences of Age-Dependent Maternal Effects in Rockfish (Sebastes spp.)

    OpenAIRE

    Lucero, Yasmin

    2007-01-01

    I present a model of the early life history of a rockfish that includes an age-dependent maternal effect. The model is designed to accurately reflect the diverse uncertainties we have about early life history processes. The first portion of this thesis is devoted to an analytical treatment of the deterministic early life history model. I emphasize uncertainty about the functional form of density-dependent processes in the juvenile stage. The remainder of the thesis is devoted to demonstrating...

  17. An integrative mating system assessment of a nonmodel, economically important Pacific rockfish (Sebastes melanops) reveals nonterritorial polygamy and conservation implications for a large species flock.

    Science.gov (United States)

    Karageorge, Kurt W; Wilson, Raymond R

    2017-12-01

    Characterizing the mating systems of long-lived, economically important Pacific rockfishes comprising the viviparous Sebastes species flock is crucial for their conservation. However, direct assignment of mating success to sires is precluded by open, offshore populations and high female fecundity. We addressed this challenge by integrating paternity-assigned mating success of females with the adult sex ratio (ASR) of the population, male evolutionary responses to receptive females, and reproductive life history traits-in the framework of sexual selection theory-to assess the mating system of Sebastes melanops . Microsatellite parentage analysis of 17 pregnant females, 1,256 of their progeny, and 106 adults from the population yielded one to four sires per brood, a mean of two sires, and a female mate frequency distribution with a truncated normal (random) pattern. The 11 multiple paternity broods all contained higher median allele richness than the six single paternity broods (Wilcoxon test: W  = 0, p  distributions that distinguish polygynandry and polyandrogyny mating systems, that is, variations of polygamy, but not polyandry. Inference for polygamy is consistent with weak premating sexual selection on males, expected in mid-water, schooling S. melanops , owing to polyandrous mating, moderately aggregated receptive females, an even ASR, and no territories and nests used for reproduction. Each of these characteristics facilitates more mating males and erodes conspicuous sexual dimorphism. Evaluation of male evolutionary responses of demersal congeners that express reproductively territorial behavior revealed they have more potential mechanisms for producing premating sexual selection, greater variation in reproductive success, and a reduced breeding effective population size of adults and annual effective size of a cohort, compared to S. melanops modeled with two mates per adult. Such divergence in behavior and mating system by territorial species may

  18. Ichthyophonus in Puget Sound rockfish from the San Juan Islands archipelago and Puget Sound, Washington, USA

    Science.gov (United States)

    Halos, D.; Hart, S.A.; Hershberger, P.; Kocan, R.

    2005-01-01

    In vitro explant cultures identified Ichthyophonus in 10.9% of 302 Puget Sound rockfish Sebastes emphaeus sampled from five sites in the San Juan Islands archipelago and Puget Sound, Washington, in 2003. None of the infected fish exhibited visible lesions and only a single fish was histologically positive. Significantly more females were infected (12.4%) than males (6.8%), and while infected males were only detected at two of the five sites, infected females were identified at all sites, with no significant differences in infection prevalence. Genomic sequences of Ichthyophonus isolates obtained from Puget Sound rockfish, Pacific herring Clupea pallasii, and Yukon River Chinook salmon Oncorhynchus tshawytscha were identical in both the A and B regions of the small subunit 18S ribosomal DNA but were different from Ichthyophonus sequences previously isolated from four different species of rockfish from the northeastern Pacific Ocean. Ichthyophonus in Puget Sound rockfish may not have been previously detected because the infection is subclinical in this species and earlier investigators did not utilize in vitro techniques for diagnosis of ichthyophoniasis. However, since clinical ichthyophoniasis has recently been identified in several other species of northeast Pacific rockfishes, it is hypothesized that this either is an emerging disease resulting from changing marine conditions or the result of introduction by infected southern species that appear during periodic El Nin??o events. ?? Copyright by the American Fisheries Society 2005.

  19. The effects of temperature and water concentration on the otolith incorporation of barium and manganese in black rockfish Sebastes melanops.

    Science.gov (United States)

    Miller, J A

    2009-07-01

    Observations of multiple years of geographic variation in [Ba:Ca](otolith) and [Mn:Ca](otolith) in black rockfish Sebastes melanops prompted this study to examine the effects of temperature and water concentration on the otolith incorporation of Ba and Mn in this wholly marine species. The replicated experiment design consisted of two water temperatures (7.4 and 13.0 degrees C) and four water concentrations of Ba:Ca and Mn:Ca. A positive, linear relationship between [Ba:Ca](water) and [Ba:Ca](otolith) was observed at both temperatures. A positive temperature effect was also observed with mean partition coefficients for Ba (D(Ba)) greater in the 13 degrees C than in the 7.4 degrees C treatments (mean = 0.061 and 0.048, respectively). There was no relationship between [Mn:Ca](water) and [Mn:Ca](otolith) although a negative temperature effect was observed. Mean partition coefficients for Mn (D(Mn)) were lower in the 13 degrees C than in the 7.4 degrees C treatments (mean = 0.027 and 0.036, respectively). The data presented support the assumption of a positive, linear relationship between water and otolith Metal:Ca concentrations for Ba:Ca but not for Mn:Ca. Thus, although indicative of residence in distinct water masses, observed variation in [Metal:Ca](otolith) may not reflect variation in water concentration and can be affected by temperature. Caution should be applied in the interpretation of geographic variation of [Mn:Ca](otolith) until the mechanisms regulating its incorporation are more fully understood.

  20. Examining the utility of bulk otolith δ13C to describe diet in wild-caught black rockfish Sebastes melanops

    Science.gov (United States)

    von Biela, Vanessa; Newsome, Seth D.; Zimmerman, Christian E.

    2015-01-01

    Otolith carbon isotope δ13C values may provide temporally resolved diet proxies in fish. If otolith δ13C values reflect diet, isotope values from recent otolith and muscle tissue should correlate and known ontogenetic diet shifts should be reflected in comparisons between otolith material deposited during different life history stages. We analyzed paired otolith and muscle samples for δ13C from black rockfish Sebastes melanops to examine the potential of otoliths to reflect diet in small (200-299 mm fork length) and large (≥300 mm) fish. We found a significant positive regression between δ13C values from recent (~12 mo) otolith material and muscle in large fish, but not in small fish. Within individual otoliths, δ13C values were enriched by ~3‰ in recent otolith edge material compared to age-0 otolith core material and were consistent with known nearshore-offshore gradients in δ13C values at the base of the food web. Bulk otolith δ13C appeared to provide a broad indicator of dietary carbon sources, but variation in metabolism and dissolved inorganic carbon δ13C among and within individuals likely influences otolith δ13C as well and limits precision. Nevertheless, the results are promising and bulk otolith δ13C may be an appropriate tool to examine large trophic and ecosystem level shifts that have occurred concurrently with changes in habitat, commercial fishing, invasive species, climate change, and other direct or indirect human impacts using historic or ancient otoliths. Future studies should continue to consider the utility of bulk otolith δ13C to describe diet in other marine fish using this simple approach.

  1. The application of stereo-video technology for the assessment on population change of black rockfish Sebastes schlegeli in a vessel reef area in Haizhou Bay, China

    Science.gov (United States)

    Liu, Hui; Xu, Qiang; Xu, Qinzeng; Zhang, Yingqiu; Yang, Hongsheng

    2015-01-01

    The assessment of population structure and abundance of fish assemblages associated with artificial reefs (ARs) is an important aspect of AR management. In the present study, we used a Dive-Operated Stereo Video (stereo-DOV) technique to assess the population structure and abundance of Sebastes schlegeli associated with two metallic, and three wooden, vessel reefs in Haizhou Bay during 2012 and 2013. The study used video systems to obtain length measurements and estimates of abundance. The size composition of S. schlegeli differed among reefs and individuals around vessel reefs were all adults, with total lengths (TL) of >20 cm. Juvenile fish were encountered by divers in a rocky area near the island away from the vessel reefs. The largest individual S. schlegeli (with the highest TL) among five reefs were found around a metallic vessel reef in both 2012 and 2013. TL of S. s chlegeli from all reefs increased by an average of 3.2 cm ( P<0.05) from 2012 to 2013, with an estimated mean weight increase of 250.4 g ( P<0.05). The video survey also indicated a decrease in the biomass of schools near two metallic vessels between the years. Stereo-video technology was found to be suitable for rockfish surveys around the reefs.

  2. Retrospective analysis: bile hydrocarbons and histopathology of demersal rockfish in Prince William Sound, Alaska, after the Exxon Valdez oil spill

    International Nuclear Information System (INIS)

    Marty, G.D.; Okihiro, M.S.; Hanes, D.

    2003-01-01

    Demersal rockfish are the only fish species that have been found dead in significant numbers after major oil spills, but the link between oil exposure and effect has not been well established. After the 1989 Exxon Valdez oil spill in Prince William Sound, Alaska, several species of rockfish (Sebastes spp.) from oiled and reference sites were analyzed for hydrocarbon metabolites in bile (1989-1991) and for microscopic lesions (1990 and 1991). Biliary hydrocarbons consistent with exposure to Exxon Valdez oil were elevated in 1989, but not in 1990 or 1991. Significant microscopic findings included pigmented macrophage aggregates and hepatic megalocytosis, fibrosis, and lipid accumulation. Site differences in microscopic findings were significant with respect to previous oil exposure in 1991 (P=0.038), but not in 1990. However, differences in microscopic findings were highly significant with respect to age and species in both years (P<0.001). We concluded that demersal rockfish were exposed to Exxon Valdez oil in 1989, but differences in microscopic changes in 1990 and 1991 were related more to age and species differences than to previous oil exposure. (author)

  3. Application of acoustic telemetry to assess residency and movements of rockfish and lingcod at created and natural habitats in Prince William Sound.

    Directory of Open Access Journals (Sweden)

    Brad F Reynolds

    Full Text Available Loss and/or degradation of nearshore habitats have led to increased efforts to restore or enhance many of these habitats, particularly those that are deemed essential for marine fishes. Copper rockfish (Sebastes caurinus and lingcod (Ophiodon enlongatus are dominant members of the typical reef fish community that inhabit rocky and high-relief substrates along the Pacific Northwest. We used acoustic telemetry to document their residency and movements in the nearshore waters of Prince William Sound, Alaska in order to assess use of created reef habitat in an individual-based manner. A total of 57 fish were surgically implanted with acoustic transmitters. Forty-five fish were captured and monitored in three habitats: artificial reef, low-relief natural reef, and patchy high-relief natural reef. Within each habitat, both rockfish and lingcod exhibited long periods of residency with limited movements. Twelve rockfish were captured at the natural reefs and displaced a distance of 4.0 km to the artificial reef. Five of the 12 rockfish returned within 10 d of their release to their initial capture site. Another five of the 12 displaced fish established residency at the artificial reef through the duration of our study. Our results suggest the potential for artificial reefs to provide rockfish habitat in the event of disturbances to natural habitat.

  4. The chromium accumulation and its physiological effects in juvenile rockfish, Sebastes schlegelii, exposed to different levels of dietary chromium (Cr(6+)) concentrations.

    Science.gov (United States)

    Kim, Jun-Hwan; Kang, Ju-Chan

    2016-01-01

    Juvenile rockfish (mean length 13.7±1.7 cm, and mean weight 55.6±4.8 g) were exposed for 4 weeks with the different levels of dietary chromium (Cr(6+)) at 0, 30, 60, 120 and 240 mg/kg. The profile of chromium in the tissues of rockfish is dependent on the exposure periods and chromium concentration. After 4 weeks, the order of chromium accumulation in tissues was liver>kidney>spleen>intestine>gill>muscle. The dietary chromium exposure decreased the growth rate and hepatosomatic index of rockfish. The major hematological findings were significant decrease in the red blood cell (RBC) count, hematocrit (Ht) value, and hemoglobin (Hb) concentration exposed to ≥120 mg/kg chromium concentrations. The dietary chromium exposure (≥120 mg/kg) led to notable increase in glucose, cholesterol, glutamic oxalate transaminase (GOT), and glutamic pyruvate transaminase (GPT) in plasma, whereas there was no considerable change in calcium, magnesium, total protein, and alkaline phosphatase (ALP). The results indicated that the dietary chromium exposure to rockfish can induce significant chromium accumulation in the specific tissues, inhibition of growth, and hematological alterations. Copyright © 2015 Elsevier B.V. All rights reserved.

  5. Larval abundances of rockfishes that were historically targeted by fishing increased over 16 years in association with a large marine protected area.

    Science.gov (United States)

    Thompson, Andrew R; Chen, Dustin C; Guo, Lian W; Hyde, John R; Watson, William

    2017-09-01

    Marine protected areas (MPAs) can facilitate recovery of diminished stocks by protecting reproductive adults. To effectively augment fisheries, however, reproductive output must increase within the bounds of MPAs so that larvae can be exported to surrounding areas and seed the region. In response to dramatic declines of rockfishes ( Sebastes spp.) in southern California by the late 1990s two large MPAs, the Cowcod Conservation Areas (CCAs), were established in 2001. To evaluate whether the CCAs affected rockfish productivity we evaluated the dynamics of 8 species that were, and 7 that were not, historically targeted by fishing. Abundances of 6/8 targeted and 4/7 non-targeted species increased regionally from 1998 to 2013. These upturns were probably affected by environmental conditions in addition to changes in fishing pressure as the presence of most species correlated negatively with temperature, and temperature was lower than the historic average in 11/15 years. Seventy-five per cent of the targeted, but none of the non-targeted species increased at a greater rate inside than outside the CCAs while controlling for environmental factors. Results indicate that management actions, coupled with favourable environmental conditions, facilitated the resurgence of multiple rockfish species that were targeted by intense fishing effort for decades.

  6. Deep Transcriptomic Analysis of Black Rockfish (Sebastes schlegelii) Provides New Insights on Responses to Acute Temperature Stress.

    Science.gov (United States)

    Lyu, Likang; Wen, Haishen; Li, Yun; Li, Jifang; Zhao, Ji; Zhang, Simin; Song, Min; Wang, Xiaojie

    2018-06-14

    In the present study, we conducted an RNA-Seq analysis to characterize the genes and pathways involved in acute thermal and cold stress responses in the liver of black rockfish, a viviparous teleost that has the ability to cope with a wide range of temperature changes. A total of 584 annotated differentially expressed genes (DEGs) were identified in all three comparisons (HT vs NT, HT vs LT and LT vs NT). Based on an enrichment analysis, DEGs with a potential role in stress accommodation were classified into several categories, including protein folding, metabolism, immune response, signal transduction, molecule transport, membrane, and cell proliferation/apoptosis. Considering that thermal stress has a greater effect than cold stress in black rockfish, 24 shared DEGs in the intersection of the HT vs LT and HT vs NT groups were enriched in 2 oxidation-related gene ontology (GO) terms. Nine important heat-stress-reducing pathways were significantly identified and classified into 3 classes: immune and infectious diseases, organismal immune system and endocrine system. Eight DEGs (early growth response protein 1, bile salt export pump, abcb11, hsp70a, rtp3, 1,25-dihydroxyvitamin d(3) 24-hydroxylase, apoa4, transcription factor jun-b-like and an uncharacterized gene) were observed among all three comparisons, strongly implying their potentially important roles in temperature stress responses.

  7. Species-Specific Responses of Juvenile Rockfish to Elevated pCO2: From Behavior to Genomics.

    Directory of Open Access Journals (Sweden)

    Scott L Hamilton

    Full Text Available In the California Current ecosystem, global climate change is predicted to trigger large-scale changes in ocean chemistry within this century. Ocean acidification-which occurs when increased levels of atmospheric CO2 dissolve into the ocean-is one of the biggest potential threats to marine life. In a coastal upwelling system, we compared the effects of chronic exposure to low pH (elevated pCO2 at four treatment levels (i.e., pCO2 = ambient [500], moderate [750], high [1900], and extreme [2800 μatm] on behavior, physiology, and patterns of gene expression in white muscle tissue of juvenile rockfish (genus Sebastes, integrating responses from the transcriptome to the whole organism level. Experiments were conducted simultaneously on two closely related species that both inhabit kelp forests, yet differ in early life history traits, to compare high-CO2 tolerance among species. Our findings indicate that these congeners express different sensitivities to elevated CO2 levels. Copper rockfish (S. caurinus exhibited changes in behavioral lateralization, reduced critical swimming speed, depressed aerobic scope, changes in metabolic enzyme activity, and increases in the expression of transcription factors and regulatory genes at high pCO2 exposure. Blue rockfish (S. mystinus, in contrast, showed no significant changes in behavior, swimming physiology, or aerobic capacity, but did exhibit significant changes in the expression of muscle structural genes as a function of pCO2, indicating acclimatization potential. The capacity of long-lived, late to mature, commercially important fish to acclimatize and adapt to changing ocean chemistry over the next 50-100 years is likely dependent on species-specific physiological tolerances.

  8. 50 CFR 679.82 - Rockfish Program use caps and sideboard limits.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Rockfish Program use caps and sideboard... ECONOMIC ZONE OFF ALASKA Rockfish Program § 679.82 Rockfish Program use caps and sideboard limits. (a) Use caps—(1) General. Use caps limit the amount of rockfish QS and CQ of primary rockfish species that may...

  9. Pacific Canada's Rockfish Conservation Areas: using Ostrom's design principles to assess management effectiveness

    Directory of Open Access Journals (Sweden)

    Darienne Lancaster

    2015-09-01

    Full Text Available International declines in marine biodiversity have lead to the creation of marine protected areas and fishery reserve systems. In Canada, 164 Rockfish Conservation Areas (RCAs were implemented between 2003 and 2007 and now cover 4847.2 km² of ocean. These reserves were created in response to widespread concern from fishers and nongovernmental organizations about inshore rockfish (genus Sebastes population declines. We used the design principles for effective common-pool resource management systems, originally developed by Elinor Ostrom, to assess the social and ecological effectiveness of these conservation areas more than 10 years after their initial implementation. We assessed the relative presence or absence of each design principle within current RCA management. We found that 2 of the 11 design principles were moderately present in the recreational fishery. All other design principles were lacking for the recreational sector. We found that 2 design principles were fully present and 5 were moderately present in the commercial sector. Four design principles were lacking in the commercial sector. Based on this analysis, we highlight 4 main areas for management improvement: (1 create an education and outreach campaign to explain RCA rules, regulations, boundaries, and the need for marine conservation; (2 increase monitoring of users and resources to discourage noncompliance and gather the necessary data to create social buy-in for marine conservation; (3 encourage informal nested governance through stakeholder organizations for education and self-regulation (e.g. fisher to fisher; and (4 most importantly, create a formal, decadal RCA review process to gather stakeholder input and make amendments to regulations and RCA boundaries. This information can be used to inform spatial management systems both in Canada and internationally. This analysis also contributes to a growing literature on effectively scaling up small-scale management techniques

  10. Central Gulf of Alaska Rockfish Permit Program

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The North Pacific Fishery Management Council adopted the Central Gulf of Alaska Rockfish Program (Rockfish Program) on June 14, 2010, to replace the expiring Pilot...

  11. 50 CFR 679.81 - Rockfish Program annual harvester and processor privileges.

    Science.gov (United States)

    2010-10-01

    ... as permitted by general antitrust law; and (ii) The rockfish cooperative must establish a monitoring... cooperative is formed or is operating in compliance with antitrust law. (5) Application for the rockfish... the antitrust laws of the rockfish cooperative's proposed conduct. Membership in a rockfish...

  12. AFSC/ABL: Gulf of Alaska Diel Trawl Survey, 2005-2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Diel epipelagic sampling for juvenile Pacific salmon (Oncorhynchus spp.), rockfish (Sebastes spp.), sablefish (Anoplopoma fimbria), and associated species was...

  13. Feasibility of partial replacement of fishmeal with proteins from different sources in diets of Korean rockfish ( Sebastes schlegeli)

    Science.gov (United States)

    Yan, Quangen; Zhu, Xiaoming; Yang, Yunxia; Han, Dong; Xie, Shouqi

    2014-12-01

    An 8-week feeding experiment was conducted in an indoor recirculation seawater system to investigate the effects of partial replacement of dietary fishmeal with proteins from five sources on the growth performance and feed utilization of Sebastes schlegeli. Six isonitrogenous and isoenergetic diets were formulated using fishmeal (FM, the control) as sole protein source, or proteins from five sources including poultry by-product meal (PBM), meat and bone meal (MBM), soybean meal (SBM), cottonseed meal (CSM) and canola meal (CNM). Fifteen percent of the crude protein provided by fish meal was replaced, respectively. The results showed that the differences in specific growth rate (SGR) and survival rate (SR) among fish fed PBM, MBM, SBM, CSM and whole FM diets were not significant. However, SGR and SR of fish fed CNM diet was significantly lower than that of other treatments. Feeding rate, feed conversion, nutrient retention showed similar patterns to that of growth. Fish fed CSM and CNM showed significantly lower apparent digestibility coefficient (ADC) of dry matter and gross energy than those fed others while fish fed CNM showed lower ADC of crude protein than those fed others ( Preplacement with CNM reduced fish growth and feed utilization.

  14. New Record of Gadella jordani and Redescription of Physiculus japonicus (Pisces: Moridae in Korea

    Directory of Open Access Journals (Sweden)

    Jin-Koo Kim

    2016-01-01

    Full Text Available We describe the morphological characteristics of two morids, Gadella jordani and Physiculus japonicus, belonging to the order Gadiformes, based on Korean specimens collected from the Korean ocean. Two specimens of Gadella jordani was first collected from Jeju Island, Korea and the East Sea, Korea, in 2013-2014. This species is characterized by 8, 67-69 dorsal fin rays, 66-71 anal fin rays, 5+13 gill rakers, no barbel on the lower jaw, no vomerine teeth, and a ventral luminous organ closer to the anus than to the interventral line. We described it as the first record to the Korean fish fauna, and proposed the new Korean name “Min-su-yeom-dae-gu-sok” for the genus Gadella, and “Min-su-yeom-dae-gu” for the species G. jordani. Physiculus japonicus was first reported by Koh and Moon in the year 1999 based on a single specimen in Korea. However, no study has been attempted to describe the morphological characteristics in Korea since then. In 2013-2014, three specimens of P. japonicus was collected from Jeju Island, Korea and the East Sea, Korea, and we redescribe P. japonicus in detail. This species is characterized by 9-10, 63-64 dorsal fin rays, 70-73 anal fin rays, 3+7-8 gill rakers, a short barbel on the lower jaw, and a ventral luminous organ equidistant between the interventral line and the anus.

  15. AFSC/RACE/GAP/Conrath: Reproduction of Groundfish

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data are currently limited or lacking for several federally managed rockfish species of the genus Sebastes found within the Gulf of Alaska. This project is related...

  16. Task 1: Whole-body concentrations of elements in kelp bass (Paralabrax clathratus), kelp rockfish (Sebastes atrovirens), and Pacific sanddab (Citharichthys sordidus) from offshore oil platforms and natural areas in the Southern California Bight

    Science.gov (United States)

    Love, Milton S.

    2009-01-01

    Resource managers are concerned that offshore oil platforms in the Southern California Bight may be contributing to environmental contaminants accumulated by marine fishes. To examine this possibility, 18 kelp bass (Paralabrax clathratus), 80 kelp rockfish (Sebastes atrovirens), and 98 Pacific sanddab (Citharichthys sordidus) were collected from five offshore oil platforms and 10 natural areas during 2005-2006 for whole-body analysis of 63 elements. The natural areas, which served as reference sites, were assumed to be relatively uninfluenced by contaminants originating from platforms. Forty-two elements were excluded from statistical comparisons for one of three reasons: they consisted of major cations that were unlikely to accumulate to potentially toxic concentrations under ambient exposure conditions; they were not detected by the analytical procedures; or they were detected at concentrations too low to yield reliable quantitative measurements. The remaining 21 elements consisted of aluminum, arsenic, barium, cadmium, chromium, cobalt, copper, gallium, iron, lead, lithium, manganese, mercury, nickel, rubidium, selenium, strontium, tin, titanium, vanadium, and zinc. Statistical comparisons of these 21 elements indicated that none consistently exhibited higher concentrations at oil platforms than at natural areas. Eight comparisons yielded significant interaction effects between total length (TL) of the fish and the two habitat types (oil platforms and natural areas). This indicated that relations between certain elemental concentrations (i.e., copper, rubidium, selenium, tin, titanium, and vanadium) and habitat type varied by TL of affected fish species. To better understand these interactions, we examined elemental concentrations in very small and very large individuals of affected species. Although significant interactions were detected for rubidium, tin, and selenium in kelp rockfish, the concentrations of these elements did not differ significantly between

  17. Juvenile Rockfish Recruitment Cruise

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In 1983, the groundfish analysis project began a series of yearly cruises designed to assess the annual abundance of juvenile rockfish along the central California...

  18. The Optimum Feeding Frequency in Growing Korean Rockfish ( Rearing at the Temperature of 15°C and 19°C

    Directory of Open Access Journals (Sweden)

    Rahman Md Mizanur

    2014-09-01

    Full Text Available Two feeding trials were conducted to determine the optimum feeding frequency in growing Korean rockfish, (Sebastes schlegeli reared at the temperatures of 15°C and 19°C. Fish averaging 92.2±0.7 g (mean±standard deviation [SD] at 15.0±0.5°C and 100.2±0.4 g (mean±SD at 19.0±0.5°C water temperature were randomly distributed into each of 15 indoor tanks containing 250-L sea water from a semi-recirculation system. A total of five feeding frequency groups were set up in three replicates as follows: one meal in a day at 08:00 hour, two meals a day at 08:00 and 17:00 hours, three meals a day at 08:00, 14:00, and 20:00 hours, four meals a day at 08:00, 12:00, 16:00, and 20:00 hours, and one meal every 2 days at 08:00 hour. Fish were fed at the rate of 1.2% body weight (BW/d at 15°C and 1.5% BW/d at 19°C. At the end of 8 wks of feeding trial weight gain and specific growth rate were significantly higher at the fish fed groups of one meal a day and two meals a day at 15°C and fish fed groups of 1 meal every 2 days at 19°C were significantly lower than those of all other fish fed groups. Glutamic oxaloacetic transaminase and glutamic pyruvic transaminase of fish fed group at 1 meal every 2 days was significantly higher than those of all other fish fed groups in both experiments. Weight gain, specific growth rate and condition factor were gradually decreased as the feeding frequency increased. The results indicate that growing Korean rockfish 92 and 100 g perform better at 15°C than 19°C water temperature. As we expected, current results have indicated that a feeding frequency of 1 meal a day is optimal for the improvement of weight gain in growing Korean rockfish grown from 92 g to 133 g at 15°C and 100 g to 132 g at 19°C water temperature.

  19. Rockfish Pilot Permit Program (RPP)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Rockfish Pilot Program was a five-year project that allowed harvesters to form voluntary cooperatives and receive an exclusive harvest privilege for groundfish...

  20. Isolation and expression analysis of FTZ-F1 encoding gene of black rock fish ( Sebastes schlegelii)

    Science.gov (United States)

    Shafi, Muhammad; Wang, Yanan; Zhou, Xiaosu; Ma, Liman; Muhammad, Faiz; Qi, Jie; Zhang, Quanqi

    2013-03-01

    Sex related FTZ-F1 is a transcriptional factor regulating the expression of fushi tarazu (a member of the orphan nuclear receptors) gene. In this study, FTZ-F1 gene ( FTZ-F1) was isolated from the testis of black rockfish ( Sebastes schlegeli) by homology cloning. The full-length cDNA of S. schlegeli FTZ-F1 ( ssFTZ-F1) contained a 232bp 5' UTR, a 1449bp ORF encoding FTZ-F1 (482 amino acid residules in length) with an estimated molecular weight of 5.4kD and a 105bp 3' UTR. Sequence, tissue distribution and phylogenic analysis showed that ssFTZ-F1 belonged to FTZ group, holding highly conserved regions including I, II and III FTZ-F1 boxes and an AF-2 hexamer. Relatively high expression was observed at different larva stages. In juveniles (105 days old), the transcript of ssFTZ-F1 can be detected in all tissues and the abuncance of the gene transcript in testis, ovary, spleen and brain was higher than that in other tissues. In mature fish, the abundance of gene transcript was higher in testis, ovary, spleen and brain than that in liver (trace amount), and the gene was not transcribed in other tissues. The highest abundance of gene transcript was always observed in gonads of both juvenile and mature fish. In addition, the abundance of gene transcript in male tissues were higher than that in female tissue counterparts ( P<0.05).

  1. West Coast Rockfish Conservation Areas, 2015

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These data delineate Rockfish Conservation Areas (RCA) off the West Coast of the United States for 2015. There are three types of areas closures depicted in this...

  2. Cryptic Sebastes norvegicus species in Greenland waters revealed by microsatellites

    DEFF Research Database (Denmark)

    Saha, Atal; Hauser, Lorenz; Hedeholm, Rasmus

    2017-01-01

    Identification of cryptic species can have profound implications in fishery management, conservation and biodiversity contexts. In the North Atlantic, the genus Sebastes is currently represented by four species, although additional cryptic species have been assumed. The connectivity of the gene...

  3. AFSC/ABL: Embryonic development of quillback rockfish

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Maternal effects on the quality of progeny can have direct impacts on population productivity. Rockfish are viviparous and the oil globule size of larvae at...

  4. ÉTUDE DE CAS — Jordanie : Une solution au problème de la rareté ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    20 déc. 2010 ... Il est donc étonnant qu'une étude menée par le ministère de la Statistique de la Jordanie, avec le soutien du Centre de recherches pour le développement international (CRDI), ait révélé qu'environ 50 000 ménages d'Amman, la capitale — soit environ un sur six — pratiquent l'agriculture urbaine.

  5. Isotopic signatures of otoliths and the stock structure of canary rockfish along the Washington and Oregon coast

    International Nuclear Information System (INIS)

    Gao, Yongwen; Svec, Russell A.; Wallace, Farron R.

    2013-01-01

    Highlights: ► Otoliths of 120 canary rockfish were analyzed for δ 18 O and δ 13 C. ► δ 18 O and δ 13 C values of the otoliths ranged from −0.2‰ to +1.7‰ and −5.4‰ to −1.4‰. ► No separation was observed from the isotopic data and δ 18 O vs. δ 13 C correlation. ► No significant difference was computed between WA and OR samples especially in δ 13 C. ► Canary rockfish may belong to a single spawning stock or population coast-wide. - Abstract: Canary rockfish are one of the commercially important rockfish species along the US Pacific coast. Yet little is known about their life history and stock structure. In this study 120 canary rockfish otoliths were collected from waters off the Washington and Oregon coast and subjected to stable O and C isotope (δ 18 O and δ 13 C) analyses. One powder sample was taken from the nucleus of each otolith, and the other from the 5th annual ring. Data from otolith nuclei can provide information on the natal sources and spawning stock separations, while data from age-1 to age-5 may indicate changes in fish habitat. Overall the δ 18 O values in otoliths of canary rockfish ranged from −0.2‰ to +1.7‰, whereas δ 13 C values of the same samples ranged from −5.4‰ to −1.4‰. The isotopic data and correlation of δ 18 O versus δ 13 C did not show clear separation between Washington and Oregon samples, similar to those for a previous study on yelloweye rockfish from the same region. These results suggest that canary rockfish may belong to a single spawning stock or population along the Washington and Oregon coast

  6. ÉTUDE DE CAS — Jordanie : Une solution au problème de la rareté ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    20 déc. 2010 ... L'Organisation mondiale de la santé (OMS) estime qu'à moins de 1 000 mètres cubes d'eau par année par personne, le développement économique est menacé et la santé humaine est en danger. Il est donc étonnant qu'une étude menée par le ministère de la Statistique de la Jordanie, avec le soutien du ...

  7. SITUACIÓN DE Menidia jordani (Pisces: Atherinopsidae EN EL EMBALSE LA GOLETA, ESTADO DE MÉXICO

    Directory of Open Access Journals (Sweden)

    N. A. Navarrete-Salgado

    2010-01-01

    Full Text Available En este estudio se analiza la situación del charal Menidia jordani (Pisces, Atherinopsidae en el embalse La Goleta, Estado de México y las variaciones poblacionales desde 1998, cuando se registró por primera vez en el embalse. Para ello se realizaron visitas en 1998, 2007 y 2008 durante las épocas secas y de lluvias. Los peces fueron capturados con un chinchorro charalero de 30.0 m de largo, 1.5 m de caída y 8.0 mm de abertura de malla, fijados con formalina al 10 %, llevados al laboratorio e identificados. Los resultados muestran que la mayor abundancia de M. jordani se registró en 1998 (3,000 peces·1000 m-2, mientras que la menor abundancia se presentó en 2008 (5 orgs.·1000 m-2. Se concluye que estas variaciones están en función de la presencia de especies exóticas como la carpa común (Cyprinus carpio y la carpa dorada (Carassius auratus, con las cuales compite, asimismo, la presencia de una especie carnívora (Micropterus salmoides afecta la población del charal en el embalse. El céstodo (Bothriocephalus acheilognathi, influyó en la disminución de este pez y el vertido de aguas negras hacia este sistema afectaron también su abundancia.

  8. Ichthyophonus in sport-caught groundfishes from southcentral Alaska.

    Science.gov (United States)

    Harris, Bradley P; Webster, Sarah R; Wolf, Nathan; Gregg, Jacob L; Hershberger, Paul K

    2018-05-07

    This report of Ichthyophonus in common sport-caught fishes throughout the marine waters of southcentral Alaska represents the first documentation of natural Ichthyophonus infections in lingcod Ophiodon elongates and yelloweye rockfish Sebastes ruberrimus. In addition, the known geographic range of Ichthyophonus in black rockfish S. melanops has been expanded northward to include southcentral Alaska. Among all species surveyed, the infection prevalence was highest (35%, n = 334) in Pacific halibut Hippoglossus stenolepis. There were no gross indications of high-level infections or clinically diseased individuals. These results support the hypothesis that under typical conditions Ichthyophonus can occur at high infection prevalence accompanied with low-level infection among a variety of fishes throughout the eastern North Pacific Ocean, including southcentral Alaska.

  9. Otolith patterns of rockfishes from the northeastern Pacific.

    Science.gov (United States)

    Tuset, Victor M; Imondi, Ralph; Aguado, Guillermo; Otero-Ferrer, José L; Santschi, Linda; Lombarte, Antoni; Love, Milton

    2015-04-01

    Sagitta otolith shape was analysed in twenty sympatric rockfishes off the southern California coast (Northeastern Pacific). The variation in shape was quantified using canonical variate analysis based on fifth wavelet function decomposition of otolith contour. We selected wavelets because this representation allow the identifications of zones or single morphological points along the contour. The entire otoliths along with four subsections (anterior, ventral, posterodorsal, and anterodorsal) with morphological meaning were examined. Multivariate analyses (MANOVA) showed significant differences in the contours of whole otolith morphology and corresponding subsection among rockfishes. Four patterns were found: fusiform, oblong, and two types of elliptic. A redundancy analysis indicated that anterior and anterodorsal subsections contribute most to define the entire otolith shape. Complementarily, the eco-morphological study indicated that the depth distribution and strategies for capture prey were correlated to otolith shape, especially with the anterodorsal zone. © 2014 Wiley Periodicals, Inc.

  10. Genetic diversity and population structure of the marbled rockfish ...

    Indian Academy of Sciences (India)

    Key Laboratory for Marine Living Resources and Molecular Engineering, College of Marine Science,. Zhejiang ... MgCl2, 0.2 mM dNTPs, 0.2 μM of the forward and reverse ..... and tolerance, and oxygen consumption of the marbled rockfish,.

  11. 50 CFR Table 2b to Part 660... - 2010, and Beyond, Harvest Guidelines for Minor Rockfish by Depth Sub-groups (weights in metric tons)

    Science.gov (United States)

    2010-10-01

    ... unexploited rockfish population in the California Current ecosystem, a non-quantitative assessment was... current equilibrium with these harvest specifications. q Widow rockfish was assessed in 2005, and an... Canary rockfish—A canary rockfish stock assessment was completed in 2007 and the stock was estimated to...

  12. A new trichosomoidid from the skin of Sebastes spp. (Pisces) from British Columbia, Canada

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Conboy, G. A.; Speare, D. J.

    2005-01-01

    Roč. 91, č. 2 (2005), s. 411-414 ISSN 0022-3395 R&D Projects: GA AV ČR IAA6022201 Institutional research plan: CEZ:AV0Z60220518 Keywords : Huffmanela * Sebastes * Canada Subject RIV: EA - Cell Biology Impact factor: 1.524, year: 2005

  13. Ichthyophonus in sport-caught groundfishes from southcentral Alaska

    Science.gov (United States)

    Harris, Bradley P.; Webster, Sarah R.; Wolf, Nathan; Gregg, Jacob L.; Hershberger, Paul

    2018-01-01

    This report of Ichthyophonus in common sport-caught fishes throughout the marine waters of southcentral Alaska represents the first documentation of natural Ichthyophonus infections in lingcod Ophiodon elongates and yelloweye rockfish Sebastes ruberrimus. In addition, the known geographic range of Ichthyophonus in black rockfish S. melanops has been expanded northward to include southcentral Alaska. Among all species surveyed, the infection prevalence was highest (35%, n = 334) in Pacific halibut Hippoglossus stenolepis. There were no gross indications of high-level infections or clinically diseased individuals. These results support the hypothesis that under typical conditions Ichthyophonus can occur at high infection prevalence accompanied with low-level infection among a variety of fishes throughout the eastern North Pacific Ocean, including southcentral Alaska.

  14. Using RAD-seq to recognize sex-specific markers and sex chromosome systems.

    Science.gov (United States)

    Gamble, Tony

    2016-05-01

    Next-generation sequencing methods have initiated a revolution in molecular ecology and evolution (Tautz et al. ). Among the most impressive of these sequencing innovations is restriction site-associated DNA sequencing or RAD-seq (Baird et al. ; Andrews et al. ). RAD-seq uses the Illumina sequencing platform to sequence fragments of DNA cut by a specific restriction enzyme and can generate tens of thousands of molecular genetic markers for analysis. One of the many uses of RAD-seq data has been to identify sex-specific genetic markers, markers found in one sex but not the other (Baxter et al. ; Gamble & Zarkower ). Sex-specific markers are a powerful tool for biologists. At their most basic, they can be used to identify the sex of an individual via PCR. This is useful in cases where a species lacks obvious sexual dimorphism at some or all life history stages. For example, such tests have been important for studying sex differences in life history (Sheldon ; Mossman & Waser ), the management and breeding of endangered species (Taberlet et al. ; Griffiths & Tiwari ; Robertson et al. ) and sexing embryonic material (Hacker et al. ; Smith et al. ). Furthermore, sex-specific markers allow recognition of the sex chromosome system in cases where standard cytogenetic methods fail (Charlesworth & Mank ; Gamble & Zarkower ). Thus, species with male-specific markers have male heterogamety (XY) while species with female-specific markers have female heterogamety (ZW). In this issue, Fowler & Buonaccorsi () illustrate the ease by which RAD-seq data can generate sex-specific genetic markers in rockfish (Sebastes). Moreover, by examining RAD-seq data from two closely related rockfish species, Sebastes chrysomelas and Sebastes carnatus (Fig. ), Fowler & Buonaccorsi () uncover shared sex-specific markers and a conserved sex chromosome system. © 2016 John Wiley & Sons Ltd.

  15. SWFSC FED Mid Water Trawl Juvenile Rockfish Survey, Surface Data, 1987-2015

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — SWFSC FED Mid Water Trawl Juvenile Rockfish Survey: Station Information and Surface Data. Surveys have been conducted along the central California coast in May/June...

  16. SWFSC FED Mid Water Trawl Juvenile Rockfish Survey, CTD Data, 1987-2015

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — SWFSC FED Mid Water Trawl Juvenile Rockfish Survey: CTD Data. Surveys have been conducted along the central California coast in May/June every year since 1983. In...

  17. Quantifying Physiological, Behavioral and Ecological Consequences of Hypoxic Events in Kelp Forest

    Science.gov (United States)

    Litvin, S. Y.; Beers, J. M.; Woodson, C. B.; Leary, P.; Fringer, O. B.; Goldbogen, J. A.; Micheli, F.; Monismith, S. G.; Somero, G. N.

    2016-02-01

    Rocky reef kelp forests that extend along the coast of central California, like many habitats in upwelling systems, often experience inundations of low dissolved oxygen (DO) or hypoxic waters. These events have the potential to influence the structure and function of coastal ecosystems. The ecological consequences of hypoxia for these systems will be mediated by physiological thresholds and behavioral responses of resident organisms in the context of the spatial and temporal variability of DO, and other potential stressors. Our research focuses on Sebastes (i.e. rockfish) because of their commercial, recreational and ecological importance, high abundance across near shore habitats and the potentially severe impacts of physiological stress due to hypoxia. In the lab, to investigate how hypoxic events physiologically effect rockfish, we exposed young of the year (YOY) of 5 species and two life stages of blue rockfish, S. mystinus (YOY and 1+), to DO concentrations representative of upwelling conditions and measured a suite of whole organisms and tissue level responses including metabolic rate, ventilation, tissue-level metabolism, and blood biochemistry. Results demonstrate species and life stage specific differences in physiological stress under upwelling driven hypoxic conditions and suggest YOY rockfishes may currently be living near their physiological limits. In the laboratory we further explored if physiological impacts result in behavioral consequences by examining the startle response of YOY rockfish, a relative measure of predator avoidance ability, under a range of DO concentrations and exposure durations. To further explore behavioral responses of rockfish to low in DO within the kelp forest we are using two approaches, monitoring the vertical distribution of fish communities across the water column using an acoustic imaging camera (ARIS 3000, Soundmetrics Inc.) and acoustic tagging, with 3-D positioning ability (VPS, VEMCO Inc.), of larger blue rockfish

  18. Les autres Irakiens : émigrés et exilés d’avant 2003 en Jordanie et leurs récits d’appartenance (Une recherche en cours

    Directory of Open Access Journals (Sweden)

    Hala Fattah

    2007-07-01

    Full Text Available Cet article s’intéresse à une importante minorité de la communauté irakienne exilée à Amman (Jordanie, à savoir la génération des années 1950. Après une brève présentation de l’histoire de l’émigration irakienne en Jordanie, l’auteur évoque les quelques travaux sociologiques sur les Irakiens à Amman et dans les autres villes jordaniennes. La seconde section de l’article est consacrée à l’analyse de la manière dont cette génération formule l’identité ou les identités irakiennes, la question communautaire, celle des droits des femmes et la notion de gouvernance. Bien qu’il s’agisse d’une étude à ses débuts, l’exploration par l’auteur de cette histoire orale introduit des nuances passionnantes à notre connaissance de l’histoire irakienne, qu’elle s’efforce de relier (de façon encore impressionniste au récit plus large de la mémoire irakienne.

  19. 50 CFR 679.84 - Rockfish Program recordkeeping, permits, monitoring, and catch accounting.

    Science.gov (United States)

    2010-10-01

    ..., monitoring, and catch accounting. 679.84 Section 679.84 Wildlife and Fisheries FISHERY CONSERVATION AND..., permits, monitoring, and catch accounting. (a) Recordkeeping and reporting. See § 679.5(r). (b) Permits... cooperative or rockfish limited access fishery. The requirements under paragraphs (c)(1) through (9) of this...

  20. Henneguya sp. (Cnidospora:Myxosporida) parasitic in the heart of the bluefish, Pomatomus saltatrix.

    Science.gov (United States)

    Meyers, T R; Sawyer, T K; MacLean, S A

    1977-10-01

    A myxosporidan parasite, Henneguya sp., was discovered in the bulbus and truncus arteriosus of bluefish, Pomatomus saltatrix. Infected fish were captured from the Atlantic Ocean near Montauk Point, Long Island, New York, Raritan Bay, New Jersey, and Chesapeake Bay, Maryland. Comparative features of mature spores showed that they were similar to those of Henneguya sebasta Moser and Love 1975, from the bulbus arteriosus of seven species of California rockfish, Sebastes. Studies on growth stages of the parasite from both host species are necessary before a definite identification of the bluefish parasite can be made.

  1. Evidence of bottom-up limitations in nearshore marine systems based on otolith proxies of fish growth

    Science.gov (United States)

    von Biela, Vanessa R.; Kruse, Gordon H.; Mueter, Franz J.; Black, Bryan A.; Douglas, David C.; Helser, Thomas E.; Zimmerman, Christian E.

    2015-01-01

    Fish otolith growth increments were used as indices of annual production at nine nearshore sites within the Alaska Coastal Current (downwelling region) and California Current (upwelling region) systems (~36–60°N). Black rockfish (Sebastes melanops) and kelp greenling (Hexagrammos decagrammus) were identified as useful indicators in pelagic and benthic nearshore food webs, respectively. To examine the support for bottom-up limitations, common oceanographic indices of production [sea surface temperature (SST), upwelling, and chlorophyll-a concentration] during summer (April–September) were compared to spatial and temporal differences in fish growth using linear mixed models. The relationship between pelagic black rockfish growth and SST was positive in the cooler Alaska Coastal Current and negative in the warmer California Current. These contrasting growth responses to SST among current systems are consistent with the optimal stability window hypothesis in which pelagic production is maximized at intermediate levels of water column stability. Increased growth rates of black rockfish were associated with higher chlorophyll concentrations in the California Current only, but black rockfish growth was unrelated to the upwelling index in either current system. Benthic kelp greenling growth rates were positively associated with warmer temperatures and relaxation of downwelling (upwelling index near zero) in the Alaska Coastal Current, while none of the oceanographic indices were related to their growth in the California Current. Overall, our results are consistent with bottom-up forcing of nearshore marine ecosystems—light and nutrients constrain primary production in pelagic food webs, and temperature constrains benthic food webs.

  2. 76 FR 53840 - Fisheries of the Exclusive Economic Zone Off Alaska; Other Rockfish, Other Flatfish, Sharks, and...

    Science.gov (United States)

    2011-08-30

    ... Flatfish, Sharks, and Skates in the Bering Sea and Aleutian Islands Management Area AGENCY: National Marine...-specified reserve to the initial total allowable catch of other rockfish, other flatfish, sharks, and skates..., BSAI other flatfish, BSAI sharks, and BSAI skates was established as 425 metric tons (mt), 2,550 mt, 43...

  3. Interspecific variation in life history relates to antipredator decisions by marine mesopredators on temperate reefs.

    Directory of Open Access Journals (Sweden)

    Alejandro Frid

    Full Text Available As upper-level predatory fishes become overfished, mesopredators rise to become the new 'top' predators of over-exploited marine communities. To gain insight into ensuing mechanisms that might alter indirect species interactions, we examined how behavioural responses to an upper-level predatory fish might differ between mesopredator species with different life histories. In rocky reefs of the northeast Pacific Ocean, adult lingcod (Ophiodon elongatus are upper-level predators that use a sit-and-wait hunting mode. Reef mesopredators that are prey to adult lingcod include kelp greenling (Hexagrammos decagrammus, younger lingcod, copper rockfish (Sebastes caurinus and quillback rockfish (S. maliger. Across these mesopredators species, longevity and age at maturity increases and, consequently, the annual proportion of lifetime reproductive output decreases in the order just listed. Therefore, we hypothesized that the level of risk taken to acquire resources would vary interspecifically in that same order. During field experiments we manipulated predation risk with a model adult lingcod and used fixed video cameras to quantify interactions between mesopredators and tethered prey (Pandalus shrimps. We predicted that the probabilities of inspecting and attacking tethered prey would rank from highest to lowest and the timing of these behaviours would rank from earliest to latest as follows: kelp greenling, lingcod, copper rockfish, and quillback rockfish. We also predicted that responses to the model lingcod, such as avoidance of interactions with tethered prey, would rank from weakest to strongest in the same order. Results were consistent with our predictions suggesting that, despite occupying similar trophic levels, longer-lived mesopredators with late maturity have stronger antipredator responses and therefore experience lower foraging rates in the presence of predators than mesopredators with faster life histories. The corollary is that the fishery

  4. Interspecific variation in life history relates to antipredator decisions by marine mesopredators on temperate reefs.

    Science.gov (United States)

    Frid, Alejandro; Marliave, Jeff; Heithaus, Michael R

    2012-01-01

    As upper-level predatory fishes become overfished, mesopredators rise to become the new 'top' predators of over-exploited marine communities. To gain insight into ensuing mechanisms that might alter indirect species interactions, we examined how behavioural responses to an upper-level predatory fish might differ between mesopredator species with different life histories. In rocky reefs of the northeast Pacific Ocean, adult lingcod (Ophiodon elongatus) are upper-level predators that use a sit-and-wait hunting mode. Reef mesopredators that are prey to adult lingcod include kelp greenling (Hexagrammos decagrammus), younger lingcod, copper rockfish (Sebastes caurinus) and quillback rockfish (S. maliger). Across these mesopredators species, longevity and age at maturity increases and, consequently, the annual proportion of lifetime reproductive output decreases in the order just listed. Therefore, we hypothesized that the level of risk taken to acquire resources would vary interspecifically in that same order. During field experiments we manipulated predation risk with a model adult lingcod and used fixed video cameras to quantify interactions between mesopredators and tethered prey (Pandalus shrimps). We predicted that the probabilities of inspecting and attacking tethered prey would rank from highest to lowest and the timing of these behaviours would rank from earliest to latest as follows: kelp greenling, lingcod, copper rockfish, and quillback rockfish. We also predicted that responses to the model lingcod, such as avoidance of interactions with tethered prey, would rank from weakest to strongest in the same order. Results were consistent with our predictions suggesting that, despite occupying similar trophic levels, longer-lived mesopredators with late maturity have stronger antipredator responses and therefore experience lower foraging rates in the presence of predators than mesopredators with faster life histories. The corollary is that the fishery removal of top

  5. Incidence of Ichthyophonus hoferi in Puget Sound fishes and its increase with age of Pacific herring

    Science.gov (United States)

    Hershberger, P.K.; Stick, K.; Bui, B.; Carroll, C.; Fall, B.; Mork, C.; Perry, J.A.; Sweeney, E.; Wittouck, J.; Winton, J.; Kocan, R.

    2002-01-01

    A recent decrease in the mean age of adult Pacific herring Clupea pallasi in Puget Sound was associated with a high prevalence of Ichthyophonus hoferi, a protistan parasite that can be highly pathogenic to Pacific herring. In Puget Sound, high intensities of I. hoferiinfection may be maintained in older cohorts of Pacific herring because the prevalence ofI. hoferi increased with age from 12% among juveniles to 58% among the oldest, age-6 and older cohorts. Low intensities of I. hoferi infection in the region may be maintained in alternative fish hosts, such as surf smelt Hypomesus pretiosus, Puget Sound rockfishSebastes emphaeus, Pacific tomcod Microgadus proximus, and speckled sanddabCithanichthys stigmaeus.

  6. 一株许氏平鲉(Sebastes schlegelii)肠道乳酸菌的分离鉴定及特性分析%IDENTIFICATION AND CHARACTERISTICS OF A LACTIC ACID BACTERIA ASSOCIATED FROM INTESTINE OF BLACK ROCKFISH SEBASTES SCHLEGELII

    Institute of Scientific and Technical Information of China (English)

    王腾腾; 韦秀梅; 常城; 韩慧宗; 姜海滨

    2017-01-01

    为筛选具有广谱抑菌活性的乳酸菌用于微生态制剂开发,本研究自野生许氏平鲉肠道内共分离出35株细菌,从中筛选出1株乳酸菌YH1,其革兰氏染色呈阳性,且可发酵脱脂乳产生凝固、无气泡、呈酸性现象,基于形态学观察、生理生化和16S rDNA序列鉴定乳酸菌YH1为食窦魏斯氏菌.分析了酸碱度、温度和NaC1含量对食窦魏斯氏菌YH1生长的影响;选取金黄色葡萄球菌、嗜水气单胞菌、溶藻弧菌、副溶血弧菌、迟钝爱德华氏菌、鳗弧菌、假交替单胞菌和哈维氏弧菌等多种病原指示菌,以琼脂扩散法测定YH1培养12h产物的抑菌活性;并采用肌肉注射和腹腔注射两种方式对YH1的动物安全性进行检测.实验结果显示,食窦魏斯氏菌YH1适宜的生长条件为pH5.7-8.8、温度20-40℃,最适生长条件为pH7.2-8.4,温度35℃,在MRS培养基中添加NaC1会抑制YH1的生长;食窦魏斯氏菌YH1的无菌培养产物可显著抑制金黄色葡萄球菌、嗜水气单胞菌、溶藻弧菌、副溶血弧菌、迟钝爱德华氏菌、鳗弧菌、假交替单胞菌、哈维氏弧菌等病原指示菌的生长;食窦魏斯氏菌YH1在108CFU/mL及以下浓度对许氏平鲉是相对安全的.以上研究表明了食窦魏斯氏菌YH1具有广谱抑菌性和动物安全性,为其应用于水产养殖业奠定了理论基础.%To screen wide-spectrum bacteriostatic activity for probiotics application,a lactic acid bacteria strain Weissella cibaria YH1 was recognized among 35 bacterial strains isolated from the intestine of wild Sebastes schlegelii.Morphological observation,physiological and biochemical characteristic analyses,and 16S rDNA sequencing were applied.Skim milk was fermented into coagulation with this gram-positive YH1 without bubbling,and the supernatant was acidic.The effects of pH,temperature,and NaC1 content on the growth of strain YH1 were analyzed.Some indicator pathogens(Staphylococcus aureus

  7. Biochemical characteristics of four marine fish skins in Korea.

    Science.gov (United States)

    Cho, Jae-Kwon; Jin, Young-Guk; Rha, Sung-Ju; Kim, Seon-Jae; Hwang, Jae-Ho

    2014-09-15

    In this study, we investigated the biochemical characteristics of the fish skins of four industrial species: olive flounder (Paralichthys olivaceus), black rockfish (Sebastes schlegeli), sea bass (Lateolabrax maculatus) and red sea bream (Pagrus major). There is high domestic demand in Korea for farming of these fish for human consumption. Crude protein contents in the skin of these fish ranged from 73% to 94% by dry weight; this was in part due to a high content of the structural protein, collagen. Among the four species, olive flounder had the thickest dermal and epidermal layers in the dorsal skin. This species was also associated with the highest extraction ratio of acid-soluble collagen. We also examined whether fish skin could be a cost-effective alternative to current fish meal sources. Our analysis indicates that, when supplemented with additional fish oils and essential amino acids, fish skin is a viable alternative for fish meal formulations. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. Histopathology of Marine and Freshwater Fish Lymphocytosis Disease Virus (LCDV)

    International Nuclear Information System (INIS)

    Hossain, M.; Myung-Joo, Oh

    2011-01-01

    Lymphocytosis disease (LCD) in fishes is caused by the agent called lymphocytosis disease virus (LCDV). LCDV is a chronic and benign virus. The disease affects 96 species of marine and fresh water fishes ranged among 34 families in the world. Affected fish with LCD has a typical external symptom with clusters consisted of enormously hypertrophied dermal cells on the skin and fins. The hypertrophied cells, generally named lymphocytosis cells, have a thick hyaline capsule, an enlarged nucleus and prominent basophilic cytoplasmic inclusions. Among the four species of fishes, olive flounder Paralichthys olivaceus, and rockfish Sebastes schlegeli were marine cultured fish, and gourami Trichogaster leeri and painted glass fish Channa baculis were freshwater ornamental fish. Although LCD causes low mortality, the disfigurement of infected fish can make them unsellable. Thus LCD has resulted in an important economic loss in the aquaculture industry. This study of histopathology may be adequate for a presumptive diagnosis of lymphocytosis diseases both in marine and freshwater fish species. (author)

  9. Dicty_cDB: Contig-U05027-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available au_evk_975886 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE814922 ) EST_scau_e...vk_965902 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE812759 ) EST_scau_evk_973993 scauevk mixed_tissue Sebaste...s... 60 1e-04 1 ( GE812758 ) EST_scau_evk_963625 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE8089...60 ) EST_scau_evk_977800 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE808959 )... EST_scau_evk_962440 scauevk mixed_tissue Sebastes... 60 1e-04 1 ( GE806311 ) EST_scau_evk_971428 scauevk mixed_tissue Sebaste

  10. Dicty_cDB: Contig-U05475-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 44 5.3 1 ( GE816148 ) EST_scau_evk_967301 scauevk mixed_tissue Sebastes... 44 5...1904 srasevg mixed_tissue Sebastes... 44 5.3 1 ( EW980904 ) EST_sras_evg_781520 srasevg mixed_tissue Sebaste...s... 44 5.3 1 ( EW979029 ) EST_sras_evg_780173 srasevg mixed_tissue Sebastes... 4

  11. Osteological development of wild-captured larvae and a juvenile Sebastes koreanus (Pisces, Scorpaenoidei from the Yellow Sea

    Directory of Open Access Journals (Sweden)

    Hyo Jae Yu

    2016-06-01

    Full Text Available Abstract The osteological development in Sebastes koreanus is described and illustrated on the basis of 32 larvae [6.11–11.10 mm body length (BL] and a single juvenile (18.60 mm BL collected from the Yellow Sea. The first-ossified skeletal elements, which are related to feeding, swimming, and respiration, appear in larvae of 6.27 mm BL; these include the jaw bones, palatine, opercular, hyoid arch, and pectoral girdle. All skeletal elements are fully ossified in the juvenile observed in the study. Ossification of the neurocranium started in the frontal, pterotic, and parietal regions at 6.27 mm BL, and then in the parasphenoid and basioccipital regions at 8.17 mm BL. The vertebrae had started to ossify at ~7.17 mm BL, and their ossification was nearly complete at 11.10 mm BL. In the juvenile, although ossification of the pectoral girdle was fully complete, the fusion of the scapula and uppermost radial had not yet occurred. Thus, the scapula and uppermost radial fuse during or after the juvenile stage. The five hypurals in the caudal skeleton were also fused to form three hypural elements. The osteological results are discussed from a functional viewpoint and in terms of the comparative osteological development in related species.

  12. Dicty_cDB: Contig-U04940-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iscoideum chromosome 2 map 3622643... 32 0.081 12 ( GE806545 ) EST_scau_evk_971547 scauevk mixed_tissue Sebaste...s... 40 0.092 2 ( EW978238 ) EST_sras_evg_777463 srasevg mixed_tissue Sebastes... 40 0.093 2 ( EW984986 )... EST_sras_evg_777879 srasevg mixed_tissue Sebastes... 40 0.095 2 ( EW985351 ) EST..._sras_evg_778065 srasevg mixed_tissue Sebastes... 40 0.096 2 ( AC116305 ) Dictyostelium discoideum chromosom

  13. Comparison of fishes taken by a sportfishing party vessel around oil platforms and adjacent natural reefs near Santa Barbara, California

    International Nuclear Information System (INIS)

    Love, M.S.; Westphal, W.

    1990-01-01

    Since 1958, 29 oil platforms have been sited in the southern California Bight of which 28 still remain in place. However, little is known of the fish populations surrounding these structures, particularly those sited in water deeper than 30 m. In the course of research on the Santa Barbara, California, party vessel sport fishery, it was noted that the platforms off Santa Barbara supported considerable sportfishing activity. Those platforms, located to the southeast of Santa Barbara in depths of 48-62 m, were particularly important and were fished intensively for various rockfishes (genus Sebastes). When fishing a platform, the vessel pulled up to within 5-10 m of a platform and drifts along one side, with the vessel operator using intermittent power to keep it near the structure. Most of the desirable species, particularly rockfishes, remained close to the platforms, rarely venturing more than perhaps 20 m from the structure. The party vessels also spent considerable time fishing over nearby natural reefs. In this survey, it was noted that there appeared to be differences in species catch composition and fish size between oil platforms and these natural reefs. Increased offshore oil drilling off California has raised interest in the role platforms play in marine systems. Questions have been raised regarding what fish live around platforms, how these structures influence populations over surrounding reefs, and whether the platforms act as fish enhancers (promoting recruitment) or only as aggregators. These questions are particularly relevant when the platforms are to be decommissioned and the possibility of allowing them to remain as artificial reefs is raised. This paper describes the results of the study on the fish populations around oil platforms and nearby natural reefs off Santa Barbara

  14. Dicty_cDB: Contig-U04780-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Ancylostoma ceylanicum L3 Ancylostoma ... 44 6.7 1 ( GE813038 ) EST_scau_evk_974138 scauevk mixed_tissue Sebaste...s... 44 6.7 1 ( GE802768 ) EST_scau_evk_897256 scauevk mixed_tissue Sebastes... 44 6.7 1 ( GE802767 ) ES...T_scau_evk_896872 scauevk mixed_tissue Sebastes... 44 6.7 1 ( GE800881 ) EST_scau..._evk_891797 scauevk mixed_tissue Sebastes... 44 6.7 1 ( FD779328 ) NADG-aaa04h04.g1 Rhodnius_prolixus_EST_NA

  15. Ecological conversion efficiency and its influencers in twelve species of fish in the Yellow Sea Ecosystem

    Science.gov (United States)

    Tang, Qisheng; Guo, Xuewu; Sun, Yao; Zhang, Bo

    2007-09-01

    The ecological conversion efficiencies in twelve species of fish in the Yellow Sea Ecosystem, i.e., anchovy ( Engraulis japonicus), rednose anchovy ( Thrissa kammalensis), chub mackerel ( Scomber japonicus), halfbeak ( Hyporhamphus sajori), gizzard shad ( Konosirus punctatus), sand lance ( Ammodytes personatus), red seabream ( Pagrus major), black porgy ( Acanthopagrus schlegeli), black rockfish ( Sebastes schlegeli), finespot goby ( Chaeturichthys stigmatias), tiger puffer ( Takifugu rubripes), and fat greenling ( Hexagrammos otakii), were estimated through experiments conducted either in situ or in a laboratory. The ecological conversion efficiencies were significantly different among these species. As indicated, the food conversion efficiencies and the energy conversion efficiencies varied from 12.9% to 42.1% and from 12.7% to 43.0%, respectively. Water temperature and ration level are the main factors influencing the ecological conversion efficiencies of marine fish. The higher conversion efficiency of a given species in a natural ecosystem is acquired only under the moderate environment conditions. A negative relationship between ecological conversion efficiency and trophic level among ten species was observed. Such a relationship indicates that the ecological efficiency in the upper trophic levels would increase after fishing down marine food web in the Yellow Sea ecosystem.

  16. Dicty_cDB: Contig-U01585-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA, clone: ARN01A01NGRM0003_F0... 54 0.010 1 ( GE817509 ) EST_scau_evk_969928 scauevk mixed_tissue Sebaste...s... 54 0.010 1 ( GE798818 ) EST_scau_evk_889236 scauevk mixed_tissue Sebastes... 54 0.010 1 ( FK742846 ) av...Mus musculus NOD-derived CD11c +ve dendritic cell... 52 0.038 1 ( GE798817 ) EST_scau_evk_887700 scauevk mixed_tissue Sebaste

  17. Résultats de recherche | Page 11 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Moyen-Orient 9 Apply Moyen-Orient filter · Irak 6 Apply Irak filter · Maroc 5 Apply Maroc filter · Antilles 4 Apply Antilles filter · Jordanie 4 Apply Jordanie filter · Liban 4 Apply Liban filter · Inde 3 Apply Inde filter · Mali 3 Apply Mali filter · Territoires palestiniens 3 Apply Territoires palestiniens filter · Yémen 3 Apply Yémen filter ...

  18. Dicty_cDB: Contig-U04933-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available scauevk mixed_tissue Sebastes... 44 7.6 1 ( GE817117 ) EST_scau_evk_970879 scauevk mixed_tissue Sebastes... ...44 7.6 1 ( GE813196 ) EST_scau_evk_963850 scauevk mixed_tissue Sebastes... 44 7.6... 1 ( EW983400 ) EST_sras_evg_775142 srasevg mixed_tissue Sebastes... 44 7.6 1 ( CP001287 ) Cyanothece sp. PC...( BM514186 ) kx97c10.y1 Parastrongyloides trichosuri PA SL1 TO... 44 7.6 1 ( GE819488 ) EST_scau_evk_964044

  19. Dicty_cDB: Contig-U04429-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BP230009B10H9 Soares normalized bovine placenta B... 46 2.4 1 ( EW982243 ) EST_sras_evg_774543 srasevg mixed_tissue Sebaste...s... 46 2.4 1 ( EW982242 ) EST_sras_evg_774159 srasevg mixed_tissue Sebastes... 46 2.4 1 ( C

  20. L'agriculture urbaine pourrait accroître la sécurité alimentaire dans ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Eau embouteillée ou eau du robinet ? Étude de la perception de l'eau au Liban et en Jordanie. Des chercheurs ont évalué la qualité de l'eau distribuée dans deux établissements spontanés, l'un au Liban et l'autre en Jordanie. Ils ont réalisé. Voir davantageEau embouteillée ou eau du robinet ? Étude de la perception de ...

  1. Temporal and sex-specific variability in Rhinoceros Auklet diet in the central California Current system

    Science.gov (United States)

    Carle, Ryan D.; Beck, Jessie N.; Calleri, David M.; Hester, Michelle M.

    2015-06-01

    We used stable isotopes (δ15N and δ13C) and compared prey provided to chicks by each sex to evaluate seasonal and sex-specific diets in Rhinoceros Auklets (Cerorhinca monocerata) in the central California Current system during 2012-2013. Mixing models indicated northern anchovy (Engraulis mordax) were important prey for adults during fall/winter and juvenile rockfishes (Sebastes spp.) were important prey during incubation both years. Adult trophic level increased between incubation and chick-rearing periods in both years. During 2012, δ15N and δ13C of chick-rearing males and females differed significantly; mixing models indicated that females ate more Pacific saury (Cololabis saira) and less market squid (Doryteuthis opalescens) than males. Likewise, females delivered significantly more Pacific saury and less market squid to chicks than males during 2012. Chick growth (g d- 1) and chick survival to fledging were significantly lower during 2012 than 2013, likely because chicks were fed lesser quality prey or fed less frequently in 2012. Lesser body mass of females during incubation in 2012 indicated sex-specific diet differences may have been related to female energetic constraints. The observed variability in Rhinoceros Auklet diet underscores the importance of managing multiple prey populations in this system so that generalist predators have sufficient resources through changing conditions.

  2. Innovations en apprentissage numérique pour les réfugiés syriens ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les répercussions du conflit syrien et de la conséquente crise des réfugiés syriens sur les systèmes scolaires en Jordanie et au Liban sont très lourdes. Selon les estimations, quelque 714 000 enfants syriens déplacés ne fréquentent pas l'école et environ la moitié de ce nombre est en Jordanie et au Liban. Plus de 100 ...

  3. 75 FR 75417 - Magnuson-Stevens Act Provisions; Fisheries Off West Coast States; Pacific Coast Groundfish...

    Science.gov (United States)

    2010-12-03

    ... more heavily towards the most recent year, to predict how current management measures will affect the... bycatch rate of co-occurring overfished species, primarily widow rockfish and canary rockfish, in the... initial testing of the jig gear, some additional catch of widow rockfish and canary rockfish is...

  4. Comparison of concentrations and profiles of polycyclic aromatic hydrocarbon metabolites in bile of fishes from offshore oil platforms and natural reefs along the California coast

    Science.gov (United States)

    Gale, Robert W.; Tanner, Michael J.; Love, Milton S.; Nishimoto, Mary M.; Schroeder, Donna M.

    2012-01-01

    To determine the environmental consequences of decommissioning offshore oil platforms on local and regional fish populations, contaminant loads in reproducing adults were investigated at seven platform sites and adjacent, natural sites. Specimens of three species (Pacific sanddab, Citharichthys sordidus; kelp rockfish, Sebastes atrovirens; and kelp bass, Paralabrax clathratus) residing at platforms and representing the regional background within the Santa Barbara Channel and within the San Pedro Basin were collected. Some of the most important contaminant classes related to oil operations are polycyclic aromatic hydrocarbons (PAHs) because of their potential toxicity and carcinogenicity. However, acute exposure cannot be related directly to PAH tissue concentrations because of rapid metabolism of the parent chemicals in fish; therefore, PAH metabolites in bile were measured, targeting free hydroxylated PAHs (OH-PAHs) liberated by enzymatic hydrolysis of the bound PAH glucuronides and sulfates. An ion-pairing method was developed for confirmatory analysis that targeted PAH glucuronides and sulfates. Concentrations of hydroxylated PAHs in all samples (76 fish from platforms and 64 fish from natural sites) were low, ranging from less than the limits of detection (5 to 120 nanograms per milliliter bile; 0.03 to 42 nanograms per milligram protein) to a maximum of 320 nanograms per milliliter bile (32 nanograms per milligram protein). A previously proposed dosimeter of PAH exposure in fish, 1-hydroxypyrene, was not detected at any platform site. Low concentrations of 1-hydroxypyrene were detected in 3 of 12 kelp rockfish collected from a natural reef site off Santa Barbara. The most prevalent OH-PAH, 2-hydroxyfluorene, was detected at low concentrations in seven fish of various species; of these, four were from two of the seven platform sites. The greatest concentrations of 2-hydroxyfluorene were found in three fish of various species from Platform Holly and were only

  5. Predatory fishes affect trophic cascades and apparent competition in temperate reefs.

    Science.gov (United States)

    Frid, Alejandro; Marliave, Jeff

    2010-08-23

    We provide evidence for a trophic cascade involving apex predators and mesopredators of marine temperate reefs, lingcod and rockfish, respectively. We measured spatio-temporal variation in the relative abundance of lingcod, subadult rockfish and two shrimp groups eaten by rockfish (Pandalus sp. and three smaller-bodied genera aggregated). Lingcod had an indirect positive effect on shrimps, as mediated by the direct negative effects of lingcod on rockfish and of rockfish on shrimps. These top-down effects on shrimps, however, were stronger for Pandalus than for small-bodied shrimps. Further, abundances of Pandalus and small-bodied shrimps were negatively correlated and the latter had a stronger positive effect on rockfish, suggesting that rockfish mediated asymmetrical apparent competition between shrimps. Our results indicate mechanisms by which predatory fishes may influence the structure of marine communities.

  6. Parasites as Biological Tags for Stock Discrimination of Beaked Redfish (Sebastes mentella: Parasite Infra-Communities vs. Limited Resolution of Cytochrome Markers.

    Directory of Open Access Journals (Sweden)

    Regina Klapper

    Full Text Available The use of parasites as biological tags for discrimination of fish stocks has become a commonly used approach in fisheries management. Metazoan parasite community analysis and anisakid nematode population genetics based on a mitochondrial cytochrome marker were applied in order to assess the usefulness of the two parasitological methods for stock discrimination of beaked redfish Sebastes mentella of three fishing grounds in the North East Atlantic. Multivariate, model-based approaches demonstrated that the metazoan parasite fauna of beaked redfish from East Greenland differed from Tampen, northern North Sea, and Bear Island, Barents Sea. A joint model (latent variable model was used to estimate the effects of covariates on parasite species and identified four parasite species as main source of differences among fishing grounds; namely Chondracanthus nodosus, Anisakis simplex s.s., Hysterothylacium aduncum, and Bothriocephalus scorpii. Due to its high abundance and differences between fishing grounds, Anisakis simplex s.s. was considered as a major biological tag for host stock differentiation. Whilst the sole examination of Anisakis simplex s.s. on a population genetic level is only of limited use, anisakid nematodes (in particular, A. simplex s.s. can serve as biological tags on a parasite community level. This study confirmed the use of multivariate analyses as a tool to evaluate parasite infra-communities and to identify parasite species that might serve as biological tags. The present study suggests that S. mentella in the northern North Sea and Barents Sea is not sub-structured.

  7. 77 FR 2478 - Fisheries of the Exclusive Economic Zone Off Alaska; Groundfish of the Gulf of Alaska; Amendment 88

    Science.gov (United States)

    2012-01-18

    .... Rockfish cooperatives formed under the Rockfish Program are subject to existing antitrust laws. Collective price negotiation by a rockfish cooperative must be conducted in accordance with existing antitrust laws...

  8. Detection of lymphocystis disease virus in Japanese flounder Paralichthys olivaceus and other marine teleosts from northern China

    Science.gov (United States)

    Zhan, Wenbin; Li, Yongqin; Sheng, Xiuzhen; Xing, Jing; Tang, Xiaoqian

    2010-11-01

    We isolated a strain of lymphocystis disease virus (LCDV) from Japanese flounder ( Paralichthys olivaceus) cultured in northern China. Based on published sequences of major capsid protein (MCP) gene of LCDV-cn (GenBank: AF126405), we designed two primer sets P1/P2 and P3/P4. We then used one-step or nested PCR and in-situ hybridization (ISH) to detect LCDV and identify the target tissues or cells in infected Japanese flounder. The PCR products were positive in purified viral supernatant, skin nodules, gut, gill, kidney, spleen, stomach, heart, and liver of Japanese flounder. We compared the DNA sequence with 14 MCP nucleotide sequences from GenBank, including Megalocytivirus (OFIV and RSIV), Iridovirus (CzIV and WIV), Ranavirus (TFV and FV3), and Lymphocystivirus (8 LCDV). Based on the alignment, we confirmed the PCR product was from Lymphocystivirus (GenBank accession number DQ279090 (LCDV-HD)). Using ISH, we noted the presence of LCDV in the skin nodules, gut, gill, spleen, stomach, and heart of spontaneously infected Japanese flounders. We successfully amplified LCDV fragments from Schlegel’s black rockfish ( Sebastes schlegeli Higendorf), redwing sea robin ( Lepidotrigla microptera Günther) and turbot ( Scophthalmus maximus) using the one-step and nested PCR, suggesting the target genes can be widely detected in fish using this method.

  9. Le CRDI en Jordanie

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... dans les pays en développement afin d'y favoriser la croissance et le développement. Il en résulte des solutions novatrices et durables qui ont pour but d'améliorer les conditions de vie et les moyens de subsistance. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G 3H9.

  10. Bathymetric and longitudinal distribution analyysis of the rockfish Helicolenus Dactylopterus (Delaroche, 1809 in the southern Tyrrhenian Sea (central Mediterranean

    Directory of Open Access Journals (Sweden)

    T. ROMEO

    2009-06-01

    Full Text Available This study provides information on bathymetric and longitudinal distribution heterogeneity of the rockfish Helicolenus dactylopterus in the southern Tyrrhenian Sea. Data were drawn from experimental bottom trawl (1996-2002 plus bottom trap (2001-02 surveys. The frequency of occurrence and mean relative density (N/km2 and biomass (kg/km2 indexes were calculated for two survey seasons (spring and autumn, four geographic sectors and three depth strata. MANOVA was used to test fish abundance among years, sectors and strata. Analysis of the length-frequency distributions was carried out by two-way (gears and depths ANOVA, post hoc multiple comparisons for testing differences among depths and Student’s t test for testing differences between gears. Length-weight relationship was also estimated and the allometric coefficient was tested with the Student’s t test. The results showed a significant positive bathymetric gradient of sizes both for trawl and trap surveys; at same depths, fish caught by traps were significantly longer than those caught by trawl. In spring surveys, significant differences were found among strata for both abundance indexes; in autumn surveys, significant differences between depth strata were found only for density indices. The distribution and abundance patterns of H. dactylopterus along the southern Tyrrhenian Sea was homogeneous among sectors. Length-weight relationship showed a significant positive allometric growth.

  11. 50 CFR Table 2c to Part 660... - 2010, and Beyond, Open Access and Limited Entry Allocations by Species or Species Goup (weights...

    Science.gov (United States)

    2010-10-01

    ... abundance of an unexploited rockfish population in the California Current ecosystem, a non-quantitative... remain at its current equilibrium with these harvest specifications. q/ Widow rockfish was assessed in... fishing activities. r/ Canary rockfish—A canary rockfish stock assessment was completed in 2007 and the...

  12. Dicty_cDB: Contig-U16210-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available omic DNA, comple... 38 7.6 3 ( EW976837 ) EST_sras_evg_784027 srasevg mixed_tissue Sebaste... ) EST_sras_evg_783643 srasevg mixed_tissue Sebastes... 32 8.7 2 ( CR382400 ) Plasmodium falciparum chromoso

  13. Dicty_cDB: Contig-U00298-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available OK001788... 44 3.8 1 ( GE818144 ) EST_scau_evk_967951 scauevk mixed_tissue Sebaste...ras_evg_778912 srasevg mixed_tissue Sebastes... 44 3.8 1 ( BA000032 ) Vibrio parahaemolyticus RIMD 2210633 D

  14. 50 CFR 660.160 - Catcher/processor (C/P) Coop Program.

    Science.gov (United States)

    2010-10-01

    ... Pacific whiting, canary rockfish, darkblotched rockfish, Pacific Ocean perch, widow rockfish; (ii) Species... issuance for C/P endorsement—(i) Eligibility criteria for C/P endorsement. Only current owners of a current... with the current limited entry trawl permit accrues to the current permit owner. NMFS will not...

  15. Dicty_cDB: Contig-U14691-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available eus mitochondrial gene for 16S... 34 0.077 3 ( EW986758 ) EST_sras_evg_779179 srasevg mixed_tissue Sebastes...... 38 0.079 2 ( EW986759 ) EST_sras_evg_779563 srasevg mixed_tissue Sebastes... 38 0.079 2 ( CP001078 ) Clos

  16. Dicty_cDB: Contig-U12374-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 372F20, 5'... 48 0.38 1 ( EW983915 ) EST_sras_evg_776173 srasevg mixed_tissue Sebastes... 48 0.38 1 ( EW9839...14 ) EST_sras_evg_775789 srasevg mixed_tissue Sebastes... 48 0.38 1 ( CP000382 ) Clostridium novyi NT, compl

  17. Evaluating the Potential for Marine and Hydrokinetic Devices to Act as Artificial Reefs or Fish Aggregating Devices. Based on Analysis of Surrogates in Tropical, Subtropical, and Temperate U.S. West Coast and Hawaiian Coastal Waters

    Energy Technology Data Exchange (ETDEWEB)

    Kramer, Sharon H. [H. T. Harvey & Associates, Honolulu, HI (United States); Hamilton, Christine D. [H. T. Harvey & Associates, Honolulu, HI (United States); Spencer, Gregory C. [H. T. Harvey & Associates, Honolulu, HI (United States); Ogston, Heather O. [H. T. Harvey & Associates, Honolulu, HI (United States)

    2015-05-12

    Wave energy converters (WECs) and tidal energy converters (TECs) are only beginning to be deployed along the U.S. West Coast and in Hawai‘i, and a better understanding of their ecological effects on fish, particularly on special-status fish (e.g., threatened and endangered) is needed to facilitate project design and environmental permitting. The structures of WECs and TECs placed on to the seabed, such as anchors and foundations, may function as artificial reefs that attract reef-associated fishes, while the midwater and surface structures, such as mooring lines, buoys, and wave or tidal power devices, may function as fish aggregating devices (FADs), forming the nuclei for groups of fishes. Little is known about the potential for WECs and TECs to function as artificial reefs and FADs in coastal waters of the U.S. West Coast and Hawai‘i. We evaluated these potential ecological interactions by reviewing relevant information about fish associations with surrogate structures, such as artificial reefs, natural reefs, kelps, floating debris, oil and gas platforms, marine debris, anchored FADs deployed to enhance fishing opportunities, net-cages used for mariculture, and piers and docks. Based on our review, we postulate that the structures of WECs and TECs placed on or near the seabed in coastal waters of the U.S. West Coast and Hawai‘i likely will function as small-scale artificial reefs and attract potentially high densities of reef-associated fishes (including special-status rockfish species [Sebastes spp.] along the mainland), and that the midwater and surface structures of WECs placed in the tropical waters of Hawai‘i likely will function as de facto FADs with species assemblages varying by distance from shore and deployment depth. Along the U.S. West Coast, frequent associations with midwater and surface structures may be less likely: juvenile, semipelagic, kelp-associated rockfishes may occur at midwater and surface structures of WECs in coastal waters of

  18. Dicty_cDB: Contig-U01337-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sophila willi... 34 5.4 2 ( GE797277 ) EST_scau_evk_889972 scauevk mixed_tissue Sebastes... 34 5.4 2 ( AC123...888797 ) CeleSEQ6116 Cunninghamella elegans pBluescript (E... 38 5.5 2 ( GE797278 ) EST_scau_evk_888052 scauevk mixed_tissue Sebaste

  19. Dicty_cDB: Contig-U14789-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available srasevg mixed_tissue Sebastes... 58 2e-04 1 ( EW978379 ) EST_sras_evg_773311 srasevg mixed_tissue Sebaste...FC752071 ) CBBI6157.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 58 2e-04 1 ( EW978380 ) EST_sras_evg_777535

  20. Structure-forming corals and sponges and their use as fish habitat in Bering Sea submarine canyons.

    Science.gov (United States)

    Miller, Robert J; Hocevar, John; Stone, Robert P; Fedorov, Dmitry V

    2012-01-01

    Continental margins are dynamic, heterogeneous settings that can include canyons, seamounts, and banks. Two of the largest canyons in the world, Zhemchug and Pribilof, cut into the edge of the continental shelf in the southeastern Bering Sea. Here currents and upwelling interact to produce a highly productive area, termed the Green Belt, that supports an abundance of fishes and squids as well as birds and marine mammals. We show that in some areas the floor of these canyons harbors high densities of gorgonian and pennatulacean corals and sponges, likely due to enhanced surface productivity, benthic currents and seafloor topography. Rockfishes, including the commercially important Pacific ocean perch, Sebastes alutus, were associated with corals and sponges as well as with isolated boulders. Sculpins, poachers and pleuronectid flounders were also associated with corals in Pribilof Canyon, where corals were most abundant. Fishes likely use corals and sponges as sources of vertical relief, which may harbor prey as well as provide shelter from predators. Boulders may be equivalent habitat in this regard, but are sparse in the canyons, strongly suggesting that biogenic structure is important fish habitat. Evidence of disturbance to the benthos from fishing activities was observed in these remote canyons. Bottom trawling and other benthic fishing gear has been shown to damage corals and sponges that may be very slow to recover from such disturbance. Regulation of these destructive practices is key to conservation of benthic habitats in these canyons and the ecosystem services they provide.

  1. Dicty_cDB: Contig-U04374-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Anolis sagre... 46 1.6 1 ( GE801267 ) EST_scau_evk_891626 scauevk mixed_tissue Sebastes... 46 1.6 1 ( GE80...1266 ) EST_scau_evk_892010 scauevk mixed_tissue Sebastes... 46 1.6 1 ( FG735927 ) G1145P337RE22.T0 Anolis ca

  2. AcEST: DK950544 [AcEST

    Lifescience Database Archive (English)

    Full Text Available some 3 SCAF14756, whole genome shot... 77 3e-13 tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste...|A8IF50_9PERC Intestinal peptide transporter OS=Sebastes nebulosus GN=SLC15A1 PE=2 SV=1 Length = 742 Score =

  3. AcEST: DK951699 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8IF50_9PERC Intestinal peptide transporter OS=Sebaste... 93 8e-18 tr|A7ST97|A7ST97_NEMVE Predicted protein (...++D +L KY TI+YLS+ Y Sbjct: 66 ALCYLTPILGAIVADSWLGKYKTIVYLSIVY 96 >tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste

  4. 77 FR 22679 - Magnuson-Stevens Act Provisions; Fisheries off West Coast States; Biennial Specifications and...

    Science.gov (United States)

    2012-04-17

    ... (50 CFR part 660, subparts C through G). Changes to current groundfish management measures implemented... indicate that the probability of encountering canary rockfish, darkblotched rockfish, Pacific ocean perch...

  5. 76 FR 54713 - Magnuson-Stevens Act Provisions; Fisheries Off West Coast States; Pacific Coast Groundfish...

    Science.gov (United States)

    2011-09-02

    ... final rule and current codified regulations that resulted from incorrect amendatory instructions in the... bag limit is 10 RCG Complex fish per day coastwide. Retention of canary rockfish, yelloweye rockfish...

  6. Luupaljas hüljesnaine ja mineviku vangid / Aare Ermel

    Index Scriptorium Estoniae

    Ermel, Aare, 1957-2013

    2010-01-01

    PÖFFi filmidest: Neil Jordani "Undiin" (Iirimaa - USA, 2009), Debra Graniku "Luupaljas" (USA, 2010), Urszula Antoniaki "Ei midagi isiklikku" (Iirimaa - Holland, 2009) ja Juan Jose Campanella "Saladus nende silmades" (Hispaania - Argentiina, 2009)

  7. 75 FR 39178 - Magnuson-Stevens Act Provisions; Fisheries Off West Coast States; Pacific Coast Groundfish...

    Science.gov (United States)

    2010-07-08

    ..., cowcod, and yelloweye rockfish. Order on Remedy, Dkt. No. 342 (April 29, 2010) (Opinion). The Court held... Order on Remedy, Dkt. No. 342 (April 29, 2010). For darkblotched rockfish, NMFS notes that modifying the...

  8. Reproductive data for groundfish

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The ROCKFISH database houses data from rockfish species collected by the SWFSC FED along the California coast as part of a reproductive study originating in the...

  9. Structure-forming corals and sponges and their use as fish habitat in Bering Sea submarine canyons.

    Directory of Open Access Journals (Sweden)

    Robert J Miller

    Full Text Available Continental margins are dynamic, heterogeneous settings that can include canyons, seamounts, and banks. Two of the largest canyons in the world, Zhemchug and Pribilof, cut into the edge of the continental shelf in the southeastern Bering Sea. Here currents and upwelling interact to produce a highly productive area, termed the Green Belt, that supports an abundance of fishes and squids as well as birds and marine mammals. We show that in some areas the floor of these canyons harbors high densities of gorgonian and pennatulacean corals and sponges, likely due to enhanced surface productivity, benthic currents and seafloor topography. Rockfishes, including the commercially important Pacific ocean perch, Sebastes alutus, were associated with corals and sponges as well as with isolated boulders. Sculpins, poachers and pleuronectid flounders were also associated with corals in Pribilof Canyon, where corals were most abundant. Fishes likely use corals and sponges as sources of vertical relief, which may harbor prey as well as provide shelter from predators. Boulders may be equivalent habitat in this regard, but are sparse in the canyons, strongly suggesting that biogenic structure is important fish habitat. Evidence of disturbance to the benthos from fishing activities was observed in these remote canyons. Bottom trawling and other benthic fishing gear has been shown to damage corals and sponges that may be very slow to recover from such disturbance. Regulation of these destructive practices is key to conservation of benthic habitats in these canyons and the ecosystem services they provide.

  10. Recovery of Coastal Fauna after the 2011 Tsunami in Japan as Determined by Bimonthly Underwater Visual Censuses Conducted over Five Years.

    Directory of Open Access Journals (Sweden)

    Reiji Masuda

    Full Text Available Massive tsunamis induce catastrophic disturbance in marine ecosystems, yet they can provide unique opportunities to observe the process of regeneration. Here, we report the recovery of fauna after the 2011 tsunami in northeast Japan based on underwater visual censuses performed every two months over five years. Both total fish abundance and species richness increased from the first to the second year after the tsunami followed by stabilization in the following years. Short-lived fish, such as the banded goby Pterogobius elapoides, were relatively abundant in the first two years, whereas long-lived species, such as the black rockfish Sebastes cheni, increased in the latter half of the survey period. Tropical fish species were recorded only in the second and third years after the tsunami. The body size of long-lived fish increased during the survey period resulting in a gradual increase of total fish biomass. The recovery of fish assemblages was slow at one site located in the inner bay, where the impact of the tsunami was the strongest. Apart from fish, blooms of the moon jellyfish Aurelia sp. occurred only in the first two years after the tsunami, whereas the abundances of sea cucumber Apostichopus japonicus and abalone Haliotis discus hannai increased after the second year. Although we lack quantitative data prior to the tsunami, we conclude that it takes approximately three years for coastal reef fish assemblages to recover from a heavy disturbance such as a tsunami and that the recovery is dependent on species-specific life span and habitat.

  11. Systèmes d'information sanitaire ou santé sexuelle et reproductive ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Orient et de l'Afrique du Nord (MOAN) : Égypte, Jordanie, Liban, Maroc, Tunisie et Cisjordanie. Les propositions de recherche multinationale concernant des pays figurant sur cette liste seront acceptées. Les projets peuvent ...

  12. Malaisie : tous les projets | Page 2 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... médias sociaux et à la multiplication des applications commerciales en ligne offrent ... social et économique du Moyen-Orient, notamment en Jordanie, au Liban, ... South Asia, Jordan, Lebanon, Malaysia, Syria, Yemen, Palestine, Réunion.

  13. 78 FR 44213 - Spring 2013 Semiannual Agenda of Regulations

    Science.gov (United States)

    2013-07-23

    ... Distinct Population Segments of Yelloweye Rockfish, Canary Rockfish, and Bocaccio. 64 Amending the Atlantic... Biological Opinion; and, (3) consider revising the current smoothhound shark quota based on updated catch... generic amendment is to change the current reporting requirements for those dealers who purchase fish...

  14. 76 FR 79122 - Magnuson-Stevens Act Provisions; Fisheries Off West Coast States; Pacific Coast Groundfish...

    Science.gov (United States)

    2011-12-21

    ... (50 CFR part 660, subparts C through G). Changes to current groundfish management measures implemented... Groundfish Fishery Management Measures The State of Washington manages canary and yelloweye rockfish under a... guidelines for canary and/or yelloweye rockfish. During 2011, the Washington State Department of Fish and...

  15. 77 FR 28497 - Magnuson-Stevens Act Provisions; Fisheries Off West Coast States; Pacific Coast Groundfish...

    Science.gov (United States)

    2012-05-15

    ... decrease in estimated current abundance from the prior assessment. The SRG met in Seattle, Washington, from... that the current modeling approach, which implements a relatively simple base case in the Stock...[deg] N. lat. The 2012 allocations of Pacific Ocean perch, canary rockfish, darkblotched rockfish, and...

  16. 77 FR 22683 - Fisheries of the Exclusive Economic Zone Off Alaska; Gulf of Alaska; Final 2012 and 2013 Harvest...

    Science.gov (United States)

    2012-04-17

    .... Chirikof (620) 0.0031 7,282 23 Kodiak (630) 0.0002 8,986 2 Annual WYK (640) 0.0000 3,244 0 SEO (650) 0.0000... 293 0 Demersal shelf rockfish Annual SEO 0.0000 293 0 Thornyhead rockfish Annual W 0.0047 150 1 C 0...

  17. 75 FR 22276 - Endangered and Threatened Wildlife and Plants: Threatened Status for the Puget Sound/Georgia...

    Science.gov (United States)

    2010-04-28

    ... Sound/ Georgia Basin DPS designation. Comment 2: One reviewer stated that the genetic data from other... finding of discreteness was questionable for each species given the lack of genetic data. One of the.... Response: While we lack genetic data for yelloweye rockfish, canary rockfish and bocaccio within each DPS...

  18. malaysia : tous les projets | Page 2 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... de la capacité de stockage des données conjuguée à l'essor des médias sociaux et ... social et économique du Moyen-Orient, notamment en Jordanie, au Liban, ... South Asia, Jordan, Lebanon, Malaysia, Syria, Yemen, Palestine, Réunion.

  19. Larval fish feeding ecology, growth and mortality from two basins with contrasting environmental conditions of an inner sea of northern Patagonia, Chile.

    Science.gov (United States)

    Landaeta, Mauricio F; Bustos, Claudia A; Contreras, Jorge E; Salas-Berríos, Franco; Palacios-Fuentes, Pámela; Alvarado-Niño, Mónica; Letelier, Jaime; Balbontín, Fernando

    2015-05-01

    During austral spring 2011, a survey was carried out in the inland sea (41°30'-44°S) of north Patagonia, South Pacific, studying a northern basin (NB: Reloncaví Fjord, Reloncaví Sound and Ancud Gulf) characterized by estuarine regime with stronger vertical stratification and warmer (11-14 °C) and most productive waters, and a southern basin (SB: Corcovado Gulf and Guafo mouth), with more oceanic water influence, showed mixed conditions of the water column, colder (11-10.5 °C) and less productive waters. Otolith microstructure and gut content analysis of larval lightfish Maurolicus parvipinnis and rockfish Sebastes oculatus were studied. Larval M. parvipinnis showed similar growth rates in both regions (0.13-0.15 mm d(-1)), but in NB larvae were larger-at-age than in SB. Larval S. oculatus showed no differences in size-at-age and larval growth (0.16 and 0.11 mm d(-1) for NB and SB, respectively). M. parvipinnis larvae from NB had larger number of prey items (mostly invertebrate eggs), similar total volume in their guts and smaller prey size than larvae collected in SB (mainly calanoid copepods). Larval S. oculatus had similar number, volume and body width of prey ingested at both basins, although prey ingestion rate by size was 5 times larger in NB than in SB, and prey composition varied from nauplii in NB to copepodites in SB. This study provides evidence that physical-biological interactions during larval stages of marine fishes from Chilean Patagonia are species-specific, and that in some cases large size-at-age correspond to increasing foraging success. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Per Diem Tables

    International Development Research Centre (IDRC) Digital Library (Canada)

    Marissa Farruggia

    15 avr. 2017 ... JAPAN / JAPON. Tokyo. 467. JAPAN / JAPON. Elsewhere / Ailleurs dans le pays. 313. JORDAN / JORDANIE. Everywhere / Dans tout le pays. 363 ... PERU / PÉROU. Everywhere / Dans tout le pays. 378. PHILIPPINES. Everywhere / Dans tout le pays. 356. POLAND / POLOGNE. Everywhere / Dans tout le ...

  1. Karunahk ja Berlinale kroonijuveel / Lauri Kärk

    Index Scriptorium Estoniae

    Kärk, Lauri, 1954-

    2006-01-01

    56. Berliini filmifestivali filmide auhindamisest- Kuldkaru saanud Jasmila Zhbavici "Grbavica", režii Hõbekaru saajad britid Michael Winterbottom ja Mat Whitecross filmi eest "Teekond Guatanamosse" ("The Road to Guantanamo"). Autori lemmik oli aga Panorama kavas olnud Neil Jordani "Hommikusöök Pluutol". Lisatud nimekiri "56. Berlinale peaauhinnad"

  2. طبق نتايج بدست آمده محتواي يون سديم در A

    African Journals Online (AJOL)

    Shadan

    2011-11-07

    Nov 7, 2011 ... NaCl on the carboxylating activity of Rubisco from Tamarix jordanis in · the presence or absence of praline related compatible solutes. Physiol. Plant. 90: 198-204. Su J, Wu R (2004). Stress-inducible synthesis of proline in transgenic · rice confers faster growth under stress conditions than that with.

  3. : tous les projets | Page 538 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Région: Middle East, Central Asia, Far East Asia, South Asia, Jordan, Lebanon, Malaysia, Syria, Yemen, Palestine, Réunion ... et de la communication (TIC) pour le développement humain, social et économique du Moyen-Orient, notamment en Jordanie, au Liban, en Palestine (Cisjordanie et Gaza), en Syrie et au Yémen.

  4. Potential Fish Production Impacts from Partial Removal of Decommissioned Oil and Gas Platforms off the Coast of California

    Science.gov (United States)

    Claisse, J.; Pondella, D.; Love, M.; Zahn, L.; Williams, C.; Bull, A. S.

    2016-02-01

    When oil and gas platforms become obsolete they go through a decommissioning process. This may include partial removal (from the surface to 26 m depth) or complete removal of the platform structure. While complete removal would likely eliminate most of the existing fish biomass and associated secondary production, we find that the potential impacts of partial removal would likely be limited on all but one platform off the coast of California. On average 80% of fish biomass and 86% of secondary fish production would be retained after partial removal, with above 90% retention expected for both metrics on many platforms. Partial removal would likely result in the loss of fish biomass and production for species typically found residing in the shallow portions of the platform structure. However, these fishes generally represent a small proportion of the fishes associated with these platforms. More characteristic of platform fauna are the primarily deeper-dwelling rockfishes (genus Sebastes). "Shell mounds" are biogenic reefs that surround some of these platforms resulting from an accumulation of mollusk shells that have fallen from the shallow areas of the platforms mostly above the depth of partial removal. We found that shell mounds are moderately productive fish habitats, similar to or greater than natural rocky reefs in the region at comparable depths. The complexity and areal extent of these biogenic habitats, and the associated fish biomass and production, will likely be reduced after either partial or complete platform removal. Habitat augmentation by placing the partially removed platform superstructure or some other additional habitat enrichment material (e.g., rock boulders) on the seafloor adjacent to the base of partially removed platforms provides additional options to enhance fish production, potentially mitigating reductions in shell mound habitat.

  5. Impacts from Partial Removal of Decommissioned Oil and Gas Platforms on Fish Biomass and Production on the Remaining Platform Structure and Surrounding Shell Mounds.

    Science.gov (United States)

    Claisse, Jeremy T; Pondella, Daniel J; Love, Milton; Zahn, Laurel A; Williams, Chelsea M; Bull, Ann S

    2015-01-01

    When oil and gas platforms become obsolete they go through a decommissioning process. This may include partial removal (from the surface to 26 m depth) or complete removal of the platform structure. While complete removal would likely eliminate most of the existing fish biomass and associated secondary production, we find that the potential impacts of partial removal would likely be limited on all but one platform off the coast of California. On average 80% of fish biomass and 86% of secondary fish production would be retained after partial removal, with above 90% retention expected for both metrics on many platforms. Partial removal would likely result in the loss of fish biomass and production for species typically found residing in the shallow portions of the platform structure. However, these fishes generally represent a small proportion of the fishes associated with these platforms. More characteristic of platform fauna are the primarily deeper-dwelling rockfishes (genus Sebastes). "Shell mounds" are biogenic reefs that surround some of these platforms resulting from an accumulation of mollusk shells that have fallen from the shallow areas of the platforms mostly above the depth of partial removal. We found that shell mounds are moderately productive fish habitats, similar to or greater than natural rocky reefs in the region at comparable depths. The complexity and areal extent of these biogenic habitats, and the associated fish biomass and production, will likely be reduced after either partial or complete platform removal. Habitat augmentation by placing the partially removed platform superstructure or some other additional habitat enrichment material (e.g., rock boulders) on the seafloor adjacent to the base of partially removed platforms provides additional options to enhance fish production, potentially mitigating reductions in shell mound habitat.

  6. Impacts from Partial Removal of Decommissioned Oil and Gas Platforms on Fish Biomass and Production on the Remaining Platform Structure and Surrounding Shell Mounds.

    Directory of Open Access Journals (Sweden)

    Jeremy T Claisse

    Full Text Available When oil and gas platforms become obsolete they go through a decommissioning process. This may include partial removal (from the surface to 26 m depth or complete removal of the platform structure. While complete removal would likely eliminate most of the existing fish biomass and associated secondary production, we find that the potential impacts of partial removal would likely be limited on all but one platform off the coast of California. On average 80% of fish biomass and 86% of secondary fish production would be retained after partial removal, with above 90% retention expected for both metrics on many platforms. Partial removal would likely result in the loss of fish biomass and production for species typically found residing in the shallow portions of the platform structure. However, these fishes generally represent a small proportion of the fishes associated with these platforms. More characteristic of platform fauna are the primarily deeper-dwelling rockfishes (genus Sebastes. "Shell mounds" are biogenic reefs that surround some of these platforms resulting from an accumulation of mollusk shells that have fallen from the shallow areas of the platforms mostly above the depth of partial removal. We found that shell mounds are moderately productive fish habitats, similar to or greater than natural rocky reefs in the region at comparable depths. The complexity and areal extent of these biogenic habitats, and the associated fish biomass and production, will likely be reduced after either partial or complete platform removal. Habitat augmentation by placing the partially removed platform superstructure or some other additional habitat enrichment material (e.g., rock boulders on the seafloor adjacent to the base of partially removed platforms provides additional options to enhance fish production, potentially mitigating reductions in shell mound habitat.

  7. Environmental conditions and prey-switching by a seabird predator impact juvenile salmon survival

    Science.gov (United States)

    Wells, Brian K.; Santora, Jarrod A.; Henderson, Mark J.; Warzybok, Pete; Jahncke, Jaime; Bradley, Russell W.; Huff, David D.; Schroeder, Isaac D.; Nelson, Peter; Field, John C.; Ainley, David G.

    2017-10-01

    Due to spatio-temporal variability of lower trophic-level productivity along the California Current Ecosystem (CCE), predators must be capable of switching prey or foraging areas in response to changes in environmental conditions and available forage. The Gulf of the Farallones in central California represents a biodiversity hotspot and contains the largest common murre (Uria aalge) colonies along the CCE. During spring, one of the West Coast's most important Chinook salmon (Oncorhynchus tshawytscha) populations out-migrates into the Gulf of the Farallones. We quantify the effect of predation on juvenile Chinook salmon associated with ecosystem-level variability by integrating long-term time series of environmental conditions (upwelling, river discharge), forage species abundance within central CCE, and population size, at-sea distribution, and diet of the common murre. Our results demonstrate common murres typically forage in the vicinity of their offshore breeding sites, but in years in which their primary prey, pelagic young-of-year rockfish (Sebastes spp.), are less available they forage for adult northern anchovies (Engraulis mordax) nearshore. Incidentally, while foraging inshore, common murre consumption of out-migrating juvenile Chinook salmon, which are collocated with northern anchovy, increases and population survival of the salmon is significantly reduced. Results support earlier findings that show timing and strength of upwelling, and the resultant forage fish assemblage, is related to Chinook salmon recruitment variability in the CCE, but we extend those results by demonstrating the significance of top-down impacts associated with these bottom-up dynamics. Our results demonstrate the complexity of ecosystem interactions and impacts between higher trophic-level predators and their prey, complexities necessary to quantify in order to parameterize ecosystem models and evaluate likely outcomes of ecosystem management options.

  8. Surface distribution of brachyuran megalopae and ichthyoplankton in the Columbia River plume during transition from downwelling to upwelling conditions

    Science.gov (United States)

    Roegner, G. Curtis; Daly, Elizabeth A.; Brodeur, Richard D.

    2013-06-01

    In the California Current coastal boundary zone, the spring transition between downwelling and upwelling conditions, along with the fluctuating structure of the Columbia River plume, creates highly dynamic interactions. In this study, we investigated whether the surface distribution of brachyuran larvae and ichthyoplankton would track the dynamics of the Columbia River plume. By happenstance, the cruise period coincided with the spring transition from downwelling to sustained upwelling conditions in 2010, a year when the transition was delayed and Columbia River flow was substantially higher than average. We used time series of wind and freshwater input to evaluate the influence of physical forcing on oceanographic patterns, and sampled hydrography and surface plankton concentrations within a 182 km2 grid off Willapa Bay, WA. Additionally, two longer transects, one cross-shelf and the other along-shore, were made to discern the extent of plume influence on larval crab and fish abundance. We found that plume waters that were trapped in a northward-flowing coastal-boundary current during downwelling conditions were advected offshore after several days of upwelling-favorable winds. Neustonic collections of brachyuran larvae and ichthyoplankton varied in response to this large seaward advective event. Megalopae of cancrid crabs exhibited patterns of both offshore transport (Cancer oregonensis/productus) and nearshore retention (C. magister). Additionally, abundant numbers of large juvenile widow (Sebastes entomelas) and yellowtail (S. flavidus) rockfish of a size appropriate for settlement were sampled during a period when ocean conditions favored high recruitment success. These results demonstrated that the response of planktonic crab larvae and ichthyoplankton to large-scale advection varied by species, with larger and more vagile fish exhibiting less evidence of passive transport than smaller crab larvae. Importantly, portions of the planktonic fish and crab

  9. Long-term variation in a central California pelagic forage assemblage

    Science.gov (United States)

    Ralston, Stephen; Field, John C.; Sakuma, Keith M.

    2015-06-01

    A continuous 23 year midwater trawl survey (1990-2012) of the epipelagic forage assemblage off the coast of central California (lat. 36°30‧-38°20‧ N) is described and analyzed. Twenty taxa occurred in ≥ 10% of the 2037 trawls that were completed at 40 distinct station locations. The dominant taxa sampled by the 9.5 mm mesh net included a suite of young-of-the-year (YOY) groundfish, including rockfish (Sebastes spp.) and Pacific hake (Merluccius productus), two clupeoids (Engraulis mordax and Sardinops sagax), krill (Euphausiacea), cephalopods (Doryteuthis opalescens and Octopus sp.), and a variety of mesopelagic species, i.e., Diaphus theta, Tarltonbeania crenularis, "other" lanternfish (Myctophidae), deep-sea smelts (Bathylagidae), and sergestid shrimp. Annual abundance estimates of the 20 taxa were obtained from analysis of variance models, which included year and station as main effects. Principal components analysis of the abundance estimates revealed that 61% of assemblage variance was explained by the first three components. The first component revealed a strong contrast in the abundance of: (a) YOY groundfish, market squid (D. opalescens), and krill with (b) mesopelagics and clupeoids; the second component was associated with long-term trends in abundance. An evaluation of 10 different published oceanographic data sets and CTD data collected during the survey indicated that seawater properties encountered each year were significantly correlated with abundance patterns, as were annual sea-level anomalies obtained from an analysis of AVISO satellite information. A comparison of our findings with several other recent studies of biological communities occurring in the California Current revealed a consistent structuring of forage assemblages, which we conjecture is primarily attributable to large-scale advection patterns in the California Current ecosystem.

  10. Résultats de recherche | Page 148 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Analyse comparative de l'amélioration des services d'approvisionnement en eau et d'assainissement à Tripoli, au Liban, et à Irbid, en Jordanie. Tripoli, la deuxième ville du Liban, ... Renforcement des capacités relatives à l'Open Medical Records System (OpenMRS) au Rwanda. Le gouvernement du Rwanda sait que les ...

  11. Résultats de recherche | Page 4 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le projet vise à produire des connaissances sur les perceptions et les besoins en matière de services de santé sexuelle et reproductive des adolescentes dans les camps de réfugiés palestiniens en Cisjordanie et en Jordanie. Projet. Vers des chaînes d'approvisionnement durables et éthiques : Promouvoir des conditions ...

  12. Redescription of the Indo-Pacific scorpionfish Scorpaenodes guamensis (Quoy & Gaimard 1824) (Scorpaenidae), a senior synonym of seven nominal species.

    Science.gov (United States)

    Motomura, Hiroyuki; Causse, Romain; Struthers, Carl D

    2016-01-21

    The Indo-Pacific scorpionfish, Scorpaenodes guamensis (Quoy & Gaimard 1824), is redescribed on the basis of 137 specimens, including types, from a wide geographic range in the Indo-Pacific. Seven nominal species, Scorpaena rubropunctata Cuvier in Cuvier & Valenciennes 1829, Sebastes minutus Cuvier in Cuvier & Valenciennes 1829, Scorpaena chilioprista Rüppell 1838, Scorpaena polylepis Bleeker 1851, Centropogon echinatus Macleay 1881, Scorpaena erinacea Garman 1903, and Scorpaenopsis quiescens Seale 1906, are regarded here as junior synonyms of S. guamensis. The type status of these nominal species is discussed, and lectotypes of Scorpaena guamensis, Scorpaena rubropunctata, Sebastes minutus, and Scorpaena polylepis are herein designated. Validity of Scorpaenopsis scaber (Ramsay & Ogilby 1886) is also discussed.

  13. Dialogue avec les groupes islamistes au Moyen-Orient | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Par exemple, les groupes islamistes en Égypte, en Jordanie, au Koweït, au Maroc et au Yémen rejettent la violence politique, appuient la primauté du droit et acceptent le pluralisme politique. Il n'en demeure pas moins que certaines politiques des groupes islamistes, même les plus modérés, continuent à poser problème ...

  14. Résultats de recherche | Page 164 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Encore aujourd'hui, la tribu continue de jouer un rôle de premier plan dans les structures sociales au Moyen-Orient, en particulier au Yémen, en Iraq et en Jordanie. Il existe en effet un lien étroit entre le politique et l'organisation tribale. Projet. Cybergouvernement à Fès, au Maroc. Dans la phase pilote du projet (no ...

  15. La maîtrise des sciences de l'environnement au Moyen-Orient ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 janv. 2011 ... En outre, Peter Johnson, ancien professeur de géographie à l'Université Carleton, aujourd'hui retraité, a consulté plusieurs personnes qui connaissent bien et la Jordanie et le Canada afin de tracer les grandes lignes du programme de maîtrise destiné à l'Université du Yarmouk. Ouvrir les portes aux ...

  16. Marine and Anadromous Fish :: NOAA Fisheries

    Science.gov (United States)

    Conservation Commission bocaccio Bocaccio (Sebastes paucispinis) Photo: NOAA sand tiger shark Sand Tiger Shark Updated: June 29, 2017 Fisheries Service Home Information Quality Exit Disclaimer Linking Policy Privacy

  17. L'ICARDA et le CRDI : un partenariat durable et fructueux | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    21 juin 2013 ... En raison de l'agitation en Syrie, l'ICARDA a déplacé son siège à Beyrouth, au Liban, et ses chercheurs ont été relocalisés dans des bureaux régionaux et des stations de recherche en Jordanie, au Liban, en Égypte, au Maroc, en Tunisie, en Turquie et en Éthiopie; ils pourront ainsi poursuivre l'important ...

  18. Résultats de recherche | Page 3 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    5 mars 2018 ... Établir un registre de santé reproductive normalisé en Jordanie pour améliorer la santé des mères et des enfants. L'absence de données fiables limite la capacité des fournisseurs de soins, des planificateurs et des membres de la collectivité à prendre des décisions éclairées pouvant avoir une incidence ...

  19. Combined pericarditis and pneumonia caused by Legionella infection

    DEFF Research Database (Denmark)

    Svendsen, Jesper Hastrup; Jønsson, V; Niebuhr, U

    1987-01-01

    During a one year period acute pericarditis was diagnosed in 16 consecutive patients without acute infarction or malignancy. In two of these patients with both pericarditis and pneumonia Legionella infection was present. One case was caused by Legionella longbeachae and the other by both Legionella...... longbeachae and Legionella jordanis. When pericarditis is associated with pneumonia Legionella infection should be sought so that effective treatment with erythromycin may be started early....

  20. Régulation juridique et sociale de la criminalité liée à « l’honneur » en Jordanie et dans les territoires palestiniens occupés Legal and Social Regulation of “Honour” Crimes in Jordan and the Palestinian Occupied Territories

    Directory of Open Access Journals (Sweden)

    Nisrin Abu Amara

    2010-07-01

    Full Text Available La question de la criminalité faite aux femmes, objet d’une attention médiatique internationale accrue depuis la fin du XXe siècle, suscite un débat juridique, social et médiatique au Moyen-Orient. Dans cet article est proposée une analyse du débat politique actuel sur ce sujet en Jordanie et dans les territoires palestiniens. Nous verrons que ces évolutions provoquent des polémiques dans lesquelles s’affrontent les activistes en faveur des droits des femmes et les membres conservateurs, généralement hostiles à cette cause. Les différentes initiatives, aidées par une solidarité régionale grandissante et des financements de l’étranger, ont mené à de véritables changements dans ce domaine, par exemple, la loi pour la prévention des violences familiales votée en janvier 2008 par le Parlement jordanien. Néanmoins, la régulation juridique discriminatoire de la sexualité et de la criminalité faite aux femmes continue à privilégier une vision inégalitaire des rapports hommes-femmes au sein du couple et de la famille.The question of crimes against women – the focus of international media attention since the end of the twentieth century – has given rise to legal, social and media debate across the Middle East. This article offers an analysis of the current political debate on this subject in Jordan and in the Palestinian territories. We shall see that these developments have provoked polemics – pitting activists in support of women’s rights against conservatives, who are generally hostile on this question. Various initiatives, aided by growing regional solidarity and foreign funding, have yielded real changes – for example, Jordan’s law for the prevention of family violence, passed by the parliament in January, 2008. Nevertheless, discriminatory regulation of sexuality and of crimes against women continues to privilege a vision of inequality with regard to relationships between men and women as couples and

  1. DNA data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Raw DNA chromatogram data produced by the ABI 373, 377, 3130 and 3730 automated sequencing machines in ABI format. These are from fish (primarily Sebastes spp.,...

  2. Selective algicidal action of peptides against harmful algal bloom species.

    Directory of Open Access Journals (Sweden)

    Seong-Cheol Park

    Full Text Available Recently, harmful algal bloom (HAB, also termed "red tide", has been recognized as a serious problem in marine environments according to climate changes worldwide. Many novel materials or methods to prevent HAB have not yet been employed except for clay dispersion, in which can the resulting sedimentation on the seafloor can also cause alteration in marine ecology or secondary environmental pollution. In the current study, we investigated that antimicrobial peptide have a potential in controlling HAB without cytotoxicity to harmless marine organisms. Here, antimicrobial peptides are proposed as new algicidal compounds in combating HAB cells. HPA3 and HPA3NT3 peptides which exert potent antimicrobial activity via pore forming action in plasma membrane showed that HPA3NT3 reduced the motility of algal cells, disrupted their plasma membrane, and induced the efflux of intracellular components. Against raphidoflagellate such as Heterosigma akashiwo, Chattonella sp., and C. marina, it displayed a rapid lysing action in cell membranes at 1~4 µM within 2 min. Comparatively, its lysing effects occurred at 8 µM within 1 h in dinoflagellate such as Cochlodium polykrikoides, Prorocentrum micans, and P. minimum. Moreover, its lysing action induced the lysis of chloroplasts and loss of chlorophyll a. In the contrary, this peptide was not effective against Skeletonema costatum, harmless algal cell, even at 256 µM, moreover, it killed only H. akashiwo or C. marina in co-cultivation with S. costatum, indicating to its selective algicidal activity between harmful and harmless algal cells. The peptide was non-hemolytic against red blood cells of Sebastes schlegeli, the black rockfish, at 120 µM. HAB cells were quickly and selectively lysed following treatment of antimicrobial peptides without cytotoxicity to harmless marine organisms. Thus, the antibiotic peptides examined in our study appear to have much potential in effectively controlling HAB with minimal

  3. Ichthyoplankton spatial distribution and its relation with water column stratification in fjords of southern Chile (46°48‧-50°09‧S) in austral spring 1996 and 2008

    Science.gov (United States)

    Bustos, Claudia A.; Landaeta, Mauricio F.; Balbontín, Fernando

    2011-03-01

    The occidental shore of the southern tip of South America is one of the largest estuarine ecosystems around the world. Although demersal finfish fisheries are currently in full exploitation in the area, the fjords south of 47°S have been poorly investigated. Two bio-oceanographic cruises carried out in austral spring 1996 and 2008 between 47°S and 50°09'S were utilized to investigate the spatial distribution of fish eggs and larvae. Small differences in the environmental conditions were identified in the top 200 m of the water column between years (5.3-10.5 °C and 0.7-33.9 units of salinity in October 1996; 6.3-11.5 °C and 1.2-34.2 units of salinity in November 2008). The low salinity surface layer generated a highly stable water column within the fjords (Brunt-Väisälä frequency, N>0.1 rad/s; wave period ichthyoplankton analysis showed that early life stages of lightfish Maurolicus parvipinnis were dominant (>75% total eggs and >70% total larvae) and they were collected throughout the area, irrespective of the water column stratification. However, other components of the ichthyoplankton such as Falkland sprat Sprattus fuegensis, rockfish Sebastes oculatus, and hoki Macruronus magellanicus were more abundant and found in a wider range of larval sizes in less stable waters ( N<0.1 rad/s). Oceanic taxa such as myctophids ( Lampanyctodes hectoris) and gonostomatids ( Cyclothone sp.) were collected exclusively in open waters. The October 1996 observation of Engraulis ringens eggs in plankton samples corresponded to the southernmost record of early stages of this fish in the Pacific Ocean. We found a significant negative relationship between the number of larval species and N, and a significant positive relationship between the number of larval species and wave period. Therefore, only some marine fish species are capable to utilize fjords systems as spawning and nursery grounds in areas having high amounts of freshwater discharges and very high vertical

  4. Rôle politique des tribus : une analyse du tribalisme, de l'islamisme ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Encore aujourd'hui, la tribu continue de jouer un rôle de premier plan dans les structures sociales au Moyen-Orient, en particulier au Yémen, en Iraq et en Jordanie. Il existe en effet un lien étroit entre le politique et l'organisation tribale. Au Yémen, par exemple, la tribu pose tout un défi à l'État, et il semble même parfois lui ...

  5. Résultats de recherche | Page 7 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet vise à établir et à mettre en œuvre un système de surveillance électronique pour la collecte et la déclaration de données normalisées sur la mortalité périnatale et néonatale dans quatre principaux hôpitaux de la Jordanie. Projet. Villes côtières en danger aux Philippines : investir dans la résilience face aux ...

  6. Strontium-90 and cesium-137 in sea fish from Nov. 1983 to Jun. 1984

    International Nuclear Information System (INIS)

    1984-01-01

    Sr-90 and Cs-137 in sea fish were determined using radiochemical analysis. Seven species of fish (Branchiostegus sp., Katsuwonus pelamis, Limanda herzensteini, Sillago sihama, Pneumatophorus japonicus, Caesio chrysozonus cuvier, and Sebastes Inermis) were collected during the fishing season from 8 sampling locations. Only the edible part was used in case of larger sized fish, and the whole part was used in case of smaller ones. Each sample was weighed and placed in a stainless steel pan or a porcelain dish. After carbonized, the sample was ashed in an electric muffle furnace. The maximum values of Sr-90 was 1.0+-0.25 pCi/kg in Sebastes Inermis collected from Yamaguchi in April 1984; the maximum value of Cs-137 was 14.0+-0.60 pCi/kg in Katsuwonus pelamis collected from Kochi in May 1984. (Namekawa, K.)

  7. Species Profiles: Life Histories and Environmental Requirements of Coastal Fishes and Invertebrates (Pacific Southwest). Brown Rockfish, Copper Rockfish, and Black Rockfish

    Science.gov (United States)

    1989-09-01

    years (430 mm). 1977). Adults usually remain in one Females may mature at 5 years area, but may travel more than 600 km (300 mm); all are mature by 11...and Miller is primarily pelagic nekton (smelt, 1982). anchovies) and zooplankton such as salps , mysids, and crab megalops Parasites include leeches

  8. Réforme du secteur de la sécurité dans les pays arabes | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'ARI analysera le secteur de la sécurité dans huit pays (l'Algérie, l'Égypte, l'Iraq, la Jordanie, le Liban, le Maroc, la Palestine et l'Arabie Saoudite), puis élaborera un programme de réformes fondé sur une compréhension interne des enjeux. Ce projet favorisera également un débat éclairé sur la réforme du secteur de la ...

  9. Dicty_cDB: Contig-U04690-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available scauevk mixed_tissue Sebastes... 34 9.9 2 >( AU071707 ) Dictyostelium discoideum slug cDNA, clone SSC319. L... ( AP006852 ) Candida albicans genomic DNA, chromosome 7, compl... 32 9.3 2 ( GE799624 ) EST_scau_evk_888927

  10. Dicty_cDB: Contig-U05126-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CP000939 ) Clostridium botulinum B1 str. Okra, complete genome. 34 2.5 18 ( GE803619 ) EST_scau_evk_893885 ...scauevk mixed_tissue Sebastes... 32 2.6 3 ( AM462416 ) Vitis vinifera contig VV78X219254.19, whole genom...

  11. New data to the earthworm fauna of Israel (Oligochaeta, Lumbricidae

    Directory of Open Access Journals (Sweden)

    Szederjesi, T.

    2013-11-01

    Full Text Available Elaborating several smaller earthworm samples collected in different parts of Israel resulted in recording 20 earthworm species including Bimastos parvus (Eisen, 1874 a North American peregrine which represents new record for the country. Three other species; Dendrobaena nevoi Csuzdi & Pavlíček, 1999, Healyella jordanis (Csuzdi & Pavlíček, 1999and Perelia shamsi Csuzdi & Pavlíček, 2005 were first recorded after their original descriptions. The present list of lumbricidearthworms recorded for Israel is raised to 28.

  12. 77 FR 15722 - Southern California Hook and Line Survey; Public Meeting

    Science.gov (United States)

    2012-03-16

    ... and Line survey design and protocols; (2) examine the analytical methods used to generate rockfish... emergency. Special Accommodations This meeting is physically accessible to people with disabilities...

  13. Novel biodiversity baselines outpace models of fish distribution in Arctic waters

    DEFF Research Database (Denmark)

    Christiansen, Jørgen Schou; Bonsdorff, Erik; Byrkjedal, Ingvar

    2016-01-01

    During a recent marine biological expedition to the Northeast Greenland shelf break (latitudes 74–77 °N), we made the first discovery of Atlantic cod (Gadus morhua), beaked redfish (Sebastes mentella) and capelin (Mallotus villosus). Our novel observations shift the distribution range of Atlantic...

  14. Jordanie : tous les projets | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le projet vise à produire des connaissances sur les perceptions et les ... Sujet: BRAIN, MATERNAL AND CHILD HEALTH, CANCER, THERAPY, ... Sujet: HUMAN RIGHTS, GENDER EQUALITY, DEMOCRATIZATION, CULTURAL RELATIONS ... Central Asia, Far East Asia, South Asia, Jordan, Lebanon, Morocco, Yemen, ...

  15. 75 FR 38030 - Magnuson-Stevens Act Provisions; Fisheries Off West Coast States; Pacific Coast Groundfish...

    Science.gov (United States)

    2010-07-01

    ... disruption to summer fisheries, as no additional restrictions to fishery management measures are necessary at... impacts within the lowered yelloweye rockfish OY in accordance with the court's order; makes routine in...

  16. Dicty_cDB: VHH251 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available srasevg mixed_tissue Sebastes... 32 0.80 2 dna update 2008.11. 7 Homology vs Protein Score E Sequences prod...( AM954142 ) Sparus aurata EST, clone cDN02P0004P17, 5'-end se... 32 0.80 2 ( EW981227 ) EST_sras_evg_782073

  17. AFSC/RACE/GAP/Rooper: Triggered camera for determining fish height off bottom by species and size

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Assessing rockfish abundance in untrawlable habitats is a key area of study for the Alaska Fisheries Science Center. In order to accurately estimate abundance...

  18. AFSC/RACE/GAP/Rooper: Response of fish to drop camera systems

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Assessing rockfish abundance in untrawlable habitats is a key area of study for the Alaska Fisheries Science Center. In order to accurately estimate abundance...

  19. 76 FR 55865 - Fisheries Off West Coast States; Notice of Availability for Secretarial Amendment 1 to the...

    Science.gov (United States)

    2011-09-09

    ... in the Monterey and Conception areas; canary rockfish; cowcod south of Point Conception to the U.S... easy access to the current rebuilding plans. Consistent with the existing provisions of the FMP, any...

  20. Genetic data for groundfish - Genetics and genomics of northeastern Pacific groundfish

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Conduct genetic analyses of groundfish in the northeastern Pacific, with a focus on population genetics and genomics of rockfishes and sablefish. Genetic data for...

  1. A new species of parasitic copepod, Sarcotretes umitakae sp. n. (Siphonostomatoida, Pennellidae, on the rattail (Actinopterygii, Macrouridae from the East China Sea, Japan

    Directory of Open Access Journals (Sweden)

    Daisuke Uyeno

    2012-11-01

    Full Text Available A new species of copepod, Sarcotretes umitakae sp. n., of the siphonostomatoid family Pennellidae is described based on female specimens from the rattail Coelorinchus jordani Smith and Pope (Actinopterygii: Gadiformes: Macrouridae caught in the East China Sea. This species is characterized by exhibiting the following characters: the large proboscis projects strongly; the head bears paired lateral processes which are bulbous and taper into a slender horn; the twisting neck is significantly longer than the trunk; and the trunk bears an anterior constriction with a reduced abdomen.

  2. Southern California Hook and Line Survey - Annual So. CA Bight hook and line data collection/survey

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This is an annual, fishery-independent survey aimed at collecting abundance and biological data for use in the stock assessments of several key rockfish species...

  3. A biomonitoring plan for assessing potential radionuclide exposure using Amchitka Island in the Aleutian chain of Alaska as a case study

    Energy Technology Data Exchange (ETDEWEB)

    Burger, Joanna [Division of Life Sciences, Rutgers University, 604 Allison Road, Nelson Hall, Piscataway, NJ 08854-8082 (United States); Consortium for Risk Evaluation with Stakeholder Participation (CRESP), Nashville, TN, and Piscataway, NJ (United States); Environmental and Occupational Health Sciences Institute (EOHSI), Piscataway, NJ (United States)], E-mail: burger@biology.rutgers.edu; Gochfeld, Michael [Consortium for Risk Evaluation with Stakeholder Participation (CRESP), Nashville, TN, and Piscataway, NJ (United States); Environmental and Occupational Health Sciences Institute (EOHSI), Piscataway, NJ (United States); Environmental and Occupational Medicine, UMDNJ - Robert Wood Johnson Medical School, Piscataway, NJ (United States); Kosson, D.S. [Consortium for Risk Evaluation with Stakeholder Participation (CRESP), Nashville, TN, and Piscataway, NJ (United States); Department of Civil and Environmental Engineering, Vanderbilt University, Nashville, TN (United States); Powers, Charles W. [Consortium for Risk Evaluation with Stakeholder Participation (CRESP), Nashville, TN, and Piscataway, NJ (United States); Environmental and Occupational Health Sciences Institute (EOHSI), Piscataway, NJ (United States); Environmental and Occupational Medicine, UMDNJ - Robert Wood Johnson Medical School, Piscataway, NJ (United States); Department of Civil and Environmental Engineering, Vanderbilt University, Nashville, TN (United States)

    2007-12-15

    mussel (Mytilus trossulus), dolly varden (Salvelinus malma), black rockfish (Sebastes melanops), Pacific cod (Gadus macrocephalus), Pacific halibut (Hippoglossus stenolepis), and glaucous-winged gull (Larus glaucescens) as bioindicators. This combination of species included mainly subsistence foods, commercial fish, and nodes on different food chains.

  4. Modeling the impacts of two age-related portfolio effects on recruitment variability with and without a marine reserve.

    Science.gov (United States)

    McGilliard, Carey R; Punt, André E; Hilborn, Ray; Essington, Tim

    2017-10-01

    Many rockfish species are long-lived and thought to be susceptible to being overfished. Hypotheses about the importance of older female rockfish to population persistence have led to arguments that marine reserves are needed to ensure the sustainability of rockfish populations. However, the implications of these hypotheses for rockfish population dynamics are still unclear. We modeled two mechanisms by which reducing the proportion of older fish in a population has been hypothesized to influence sustainability, and explored whether these mechanisms influenced mean population dynamics and recruitment variability. We explored whether populations with these mechanisms could be managed more sustainably with a marine reserve in addition to a constant fishing mortality rate (F) than with a constant F alone. Both hypotheses can be seen as portfolio effects whereby risk of recruitment failure is spread over a "portfolio" of maternal ages. First, we modeled a spawning window effect whereby mothers of different ages spawned in different times or locations (windows) with local environmental conditions. Second, we modeled an offspring size effect whereby older mothers produced larger offspring than younger mothers, where length of a starvation period over which offspring could survive increased with maternal age. Recruitment variability resulting from both models was 55-65% lower than for models without maternal age-related portfolio effects in the absence of fishing and increased with increases in Fs for both models. An offspring size effect caused lower output reproductive rates such that the specified reproductive rate input as a model parameter was no longer the realized rate measured as the reproductive rate observed in model results; this quirk is not addressed in previous analyses of offspring size effects. We conducted a standardization such that offspring size effect and control models had the same observed reproductive rates. A comparison of long-term catch, the

  5. 78 FR 579 - Magnuson-Stevens Act Provisions; Fisheries Off West Coast States; Pacific Coast Groundfish...

    Science.gov (United States)

    2013-01-03

    ... would not provide a viable targeting opportunity and will force fishers to target sablefish instead... action to reduce overall targeting of rockfish using hook and line gears, both commercial and... appropriate harvest levels while providing for fishing and marketing opportunities. Ultimately, taking the...

  6. 78 FR 56641 - Fisheries Off West Coast States; Pacific Coast Groundfish Fishery Management Plan; Commercial...

    Science.gov (United States)

    2013-09-13

    ... rationalization program, including the shorebased IFQ program, was intended to increase net economic benefits, create individual economic stability, provide full utilization of the trawl sector allocation, consider..., Pacific cod and yellowtail rockfish and would likely have a favorable economic impact to groundfish...

  7. Influence of on-board irradiation on the shelflife of redfish

    International Nuclear Information System (INIS)

    Reinacher, E.; Ehlermann, D.

    1978-01-01

    Continuing former investigations during two voyages of the RV 'Anton Dohrn' redfish (Sebastes marinus) was irradiated on board and stored under different conditions, wrapped and unwrapped under melting ice. A part of the irradiated, unwrapped samples was stored under irradiated ice. As in the former investigations the irradiation treatment effected no prolongation of shelflife in the range of marketable quality. (orig.) [de

  8. 78 FR 74079 - Fisheries of the Exclusive Economic Zone Off Alaska; Gulf of Alaska; Proposed 2014 and 2015...

    Science.gov (United States)

    2013-12-10

    ...-sea sole. \\6\\ ``Shallow-water flatfish'' means flatfish not including ``deep-water flatfish... change the process for setting halibut PSC limits, as well as reducing such limits from their current... trend for pollock, Pacific cod, deep-water flatfish, Pacific ocean perch, northern rockfish, shortraker...

  9. 78 FR 56224 - Hydro Nelson, Ltd.; Hydro-WM, LLC; Notice of Transfer of Exemption

    Science.gov (United States)

    2013-09-12

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 3401-049] Hydro Nelson, Ltd.; Hydro-WM, LLC; Notice of Transfer of Exemption 1. By documentation filed July 8, 2013 and supplemented... Hydro-WM, LLC. The project is located on the Rockfish River in Nelson County, Virginia. The transfer of...

  10. 78 FR 13161 - Fisheries of the Exclusive Economic Zone Off Alaska; Gulf of Alaska; Final 2013 and 2014 Harvest...

    Science.gov (United States)

    2013-02-26

    ... halibut PSC trawl limits between the trawl gear deep-water and the shallow-water species fishery... specifications set forth in Tables 1 through 31 of this document reflect the outcome of this process, as required... for pollock, sablefish, deep-water flatfish, rex sole, Pacific ocean perch, northern rockfish...

  11. 75 FR 23620 - Magnuson-Stevens Act Provisions; Fisheries Off West Coast States; Pacific Coast Groundfish...

    Science.gov (United States)

    2010-05-04

    ... based on a linear interpolation of the bycatch rates for widow rockfish from 2006-2009. From the overall... defined by the RFA (although some of these vessels may be affiliated with larger processing companies... processing companies). Tribal trawlers are presumed to be small entities, whereas the Tribes are presumed to...

  12. 77 FR 5473 - Pacific Halibut Fisheries; Catch Sharing Plan

    Science.gov (United States)

    2012-02-03

    ... regulations in one Federal Register notice. Section 300.63(b)(1) of the current regulations provides that NMFS... primary directed sablefish fishery north of Point Chehalis, WA, in 2012 under the current preliminary IPHC... of the ESA because of the listing of yelloweye, canary, and bocaccio rockfish of the Puget Sound...

  13. 50 CFR 660.150 - Mothership (MS) Coop Program.

    Science.gov (United States)

    2010-10-01

    ... follows: (i) Species with formal allocations to the MS Coop Program are Pacific whiting, canary rockfish... issuance for MS permit—(i) Eligibility criteria for MS permit. Only the current owner of a vessel that... mail the application by certified mail to the current address of record in the NMFS permit database...

  14. 76 FR 32142 - Proposed Information Collection; Comment Request; Alaska Saltwater Sportfishing Economic Survey

    Science.gov (United States)

    2011-06-03

    ... marine sport species in Alaska (e.g., lingcod and rockfish). The data collected from the survey will be... a survey to collect data for conducting economic analyses of marine sport fishing in Alaska. This... management of the Pacific halibut sport fishery off Alaska, while the State of Alaska manages the salmon...

  15. A new oligonucleotide microarray for detection of pathogenic and non-pathogenic Legionella spp.

    Directory of Open Access Journals (Sweden)

    Boyang Cao

    Full Text Available Legionella pneumophila has been recognized as the major cause of legionellosis since the discovery of the deadly disease. Legionella spp. other than L. pneumophila were later found to be responsible to many non-pneumophila infections. The non-L. pneumophila infections are likely under-detected because of a lack of effective diagnosis. In this report, we have sequenced the 16S-23S rRNA gene internal transcribed spacer (ITS of 10 Legionella species and subspecies, including L. anisa, L. bozemanii, L. dumoffii, L. fairfieldensis, L. gormanii, L. jordanis, L. maceachernii, L. micdadei, L. pneumophila subspp. fraseri and L. pneumophila subspp. pasculleii, and developed a rapid oligonucleotide microarray detection technique accordingly to identify 12 most common Legionella spp., which consist of 11 pathogenic species of L. anisa, L. bozemanii, L. dumoffii, L. gormanii, L. jordanis, L. longbeachae, L. maceachernii, L. micdadei, and L. pneumophila (including subspp. pneumophila, subspp. fraseri, and subspp. pasculleii and one non-pathogenic species, L. fairfieldensis. Twenty-nine probes that reproducibly detected multiple Legionella species with high specificity were included in the array. A total of 52 strains, including 30 target pathogens and 22 non-target bacteria, were used to verify the oligonucleotide microarray assay. The sensitivity of the detection was at 1.0 ng with genomic DNA or 13 CFU/100 mL with Legionella cultures. The microarray detected seven samples of air conditioner-condensed water with 100% accuracy, validating the technique as a promising method for applications in basic microbiology, clinical diagnosis, food safety, and epidemiological surveillance. The phylogenetic study based on the ITS has also revealed that the non-pathogenic L. fairfieldensis is the closest to L. pneumophila than the nine other pathogenic Legionella spp.

  16. A New Oligonucleotide Microarray for Detection of Pathogenic and Non-Pathogenic Legionella spp.

    Science.gov (United States)

    Cao, Boyang; Liu, Xiangqian; Yu, Xiang; Chen, Min; Feng, Lu; Wang, Lei

    2014-01-01

    Legionella pneumophila has been recognized as the major cause of legionellosis since the discovery of the deadly disease. Legionella spp. other than L. pneumophila were later found to be responsible to many non-pneumophila infections. The non-L. pneumophila infections are likely under-detected because of a lack of effective diagnosis. In this report, we have sequenced the 16S-23S rRNA gene internal transcribed spacer (ITS) of 10 Legionella species and subspecies, including L. anisa, L. bozemanii, L. dumoffii, L. fairfieldensis, L. gormanii, L. jordanis, L. maceachernii, L. micdadei, L. pneumophila subspp. fraseri and L. pneumophila subspp. pasculleii, and developed a rapid oligonucleotide microarray detection technique accordingly to identify 12 most common Legionella spp., which consist of 11 pathogenic species of L. anisa, L. bozemanii, L. dumoffii, L. gormanii, L. jordanis, L. longbeachae, L. maceachernii, L. micdadei, and L. pneumophila (including subspp. pneumophila, subspp. fraseri, and subspp. pasculleii) and one non-pathogenic species, L. fairfieldensis. Twenty-nine probes that reproducibly detected multiple Legionella species with high specificity were included in the array. A total of 52 strains, including 30 target pathogens and 22 non-target bacteria, were used to verify the oligonucleotide microarray assay. The sensitivity of the detection was at 1.0 ng with genomic DNA or 13 CFU/100 mL with Legionella cultures. The microarray detected seven samples of air conditioner-condensed water with 100% accuracy, validating the technique as a promising method for applications in basic microbiology, clinical diagnosis, food safety, and epidemiological surveillance. The phylogenetic study based on the ITS has also revealed that the non-pathogenic L. fairfieldensis is the closest to L. pneumophila than the nine other pathogenic Legionella spp. PMID:25469776

  17. Établir un registre de santé reproductive normalisé en Jordanie pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... normalisé électronique à l'aide d'approches participatives et de directives établies par l'Organisation mondiale de la Santé; à renforcer la représentation des groupes mal desservis de femmes, d'hommes et de jeunes dans les réunions des parties prenantes et les processus de gouvernance; à établir un tableau de bord ...

  18. TRAMA TRÓFICA DE LOS PECES DEL EMBALSE LA GOLETA (PRIMAVERA 2007 EN EL ESTADO DE MÉXICO

    Directory of Open Access Journals (Sweden)

    N. A. Navarrete-Salgado

    2010-01-01

    Full Text Available En este estudio se determinó la posición trófica de la ictiofauna del embalse La Goleta, Estado de México. Se realizó un muestreo en la primavera de 2007, donde se registraron los siguientes parámetros del agua, temperatura, profundidad, transparencia, turbidez, oxígeno disuelto, conductividad, pH, dureza, y alcalinidad, también se realizó la captura de peces utilizando un chinchorro charalero. El análisis del contenido estomacal se determinó con el método numérico y volumétrico. Los peces capturados pertenecen a tres especies: Menidia jordani, la cual se considera una especie zooplanctófaga generalista; Cyprinus carpio, es omnívoro muy generalista y Carassius auratus que es un pez herbívoro generalista.

  19. À la découverte des eaux du désert de Jordanie | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 janv. 2011 ... Grâce à des photos-satellites, à la connaissance de la géologie locale et à un brin d'intuition, les chercheurs ont pu observer un système d'aquifères peu profonds qui pourraient constituer une source d'eau vitale pour la population semi-nomade de la région. Comme dans tout milieu écologique fragile, ...

  20. Distribution and transmission of the highly pathogenic parasite Ichthyophonus in marine fishes of Alaska

    Science.gov (United States)

    Gregg, Jacob L.; Grady, Courtney A.; Thompson, Rachel L.; Purcell, Maureen K.; Friedman, Carolyn S.; Hershberger, Paul K.

    2014-01-01

    A combination of field surveys, molecular typing, and laboratory experiments were used to improve our understanding of the distribution and transmission mechanisms of fish parasites in the genus Ichthyophonus. Ichthyophonus spp. infections were detected from the Bering Sea to the coast of Oregon in 10 of 13 host species surveyed. Sequences of rDNA extracted from these isolates indicate that a ubiquitous Ichthyophonus type occurs in the NE Pacific Ocean and Bering Sea and accounts for nearly all the infections encountered. Among NE Pacific isolates, only parasites from yellowtail rockfish and Puget Sound rockfish varied at the DNA locus examined. These data suggest that a single source population of these parasites is available to fishes in diverse niches across a wide geographic range. A direct life cycle within a common forage species could account for the relatively low parasite diversity we encountered. In the laboratory we tested the hypothesis that waterborne transmission occurs among Pacific herring, a common NE Pacific forage species. No horizontal transmission occurred during a four-month cohabitation experiment involving infected herring and conspecific sentinels. The complete life cycle of Ichthyophonus spp. is not known, but these results suggest that system-wide processes maintain a relatively homogenous parasite population.

  1. Trematodiasis en algunos peces del lago de Cuitzeo, Michoacán, México

    Directory of Open Access Journals (Sweden)

    Ma. del Carmen Guzmán-Cornejo

    1999-09-01

    Full Text Available In September, 1995 and January, 1996, six species of fishes from Lake Cuitzeo, Michoacan, Mexico, were collected (Alloophorus robustus n=30, Goodea atripinnis n=30, Xenotoca variata n=41, Chirostoma jordani n=30, Carassius auratus n=30 and Oreochromis aureus n=30, to establish the infection levels reached by Posthodiplostomum minimum, Clinostomum complanatum and Diplostomum (Tylodelphys sp., in their hosts. Infection caused by P. minimum metacercariae was the most important helminthiasis considering the number of hosts they parasite (five of six, and the high levels of abundance of the infection; we suggest that fish preferences and the generalist character of the trematode are the causes that determine this infection. Finally, the role of goodeids and atherinids in transmission of infections in the lake is confirmed; the former being the main group mantaining such infections.

  2. Seasonal fish and invertebrate communities in three northern California estuaries

    OpenAIRE

    Osborn, Katherine

    2017-01-01

    The majority of Northern California estuaries are small, flooded, river valleys that are largely unstudied due to their small sizes and remote locations. Yet these estuaries serve as important nursery areas for many marine fish species including rockfish, flatfish, smelt, and herring, and they are vital to anadromous species such as Chinook Salmon (Oncorhynchus tshawytscha) and Steelhead (O. mykiss). I sampled the summer and winter fish and invertebrate communities of the Big, Mad, and Ten Mi...

  3. Trophic structure in a pilot system for the integrated multi-trophic aquaculture off the east coast of Korean peninsula as determined by stable isotopes

    International Nuclear Information System (INIS)

    Park, Hyun Je; Han, Eunah; Lee, Won Chan; Kwak, Jung Hyun; Kim, Hyung Chul; Park, Mi Seon; Kang, Chang-Keun

    2015-01-01

    Highlights: • A pilot system for the integrated multi-trophic aquaculture was installed. • The black rockfish, sea cucumber, oyster, and macroalgae were co-cultured. • Co-cultured sea cucumber at the IMTA site assimilated aquaculture wastes. • Fish cage-waste contribution to food web in/around the IMTA system was minor. • The sea cucumber was identified as an extractive species of fish cage wastes. - Abstract: To assess the potential for nutritional exploitation of caged-fish-derived waste through the use of extractive co-cultured species in a pilot system for an integrated multi-trophic aquaculture (IMTA), we compared their C and N stable isotope ratios with those of uncultured macroinvertebrates in and around the system. Black rockfish were co-cultured with sea cucumber, oyster, and two macroalgae as extractive species. Isotope signatures of the co-cultured sea cucumber at the IMTA site differed from those at the control site, indicating their assimilation of aquaculture wastes. In contrast, δ 13 C and δ 15 N of individual taxa of the cultured oyster and uncultured invertebrates were consistent between sites, suggesting a minor contribution of the aquaculture waste to benthic and pelagic food chains in and around the IMTA system. These results provide evidence of the suitability of using sea cucumber as an extractive species to reduce the impact of a monoculture system on the ambient environment

  4. 50 CFR 679.80 - Initial allocation of rockfish QS.

    Science.gov (United States)

    2010-10-01

    ... another person by the express terms of a written contract that clearly and unambiguously provides that... that processing history by the express terms of a written contract that clearly and unambiguously... history had been transferred by the express terms of a written contract. (3) Eligible entry level fishery...

  5. Fish age validation study with bomb-produced radiocarbon (14C) conducted on yellowfin sole (Limanda aspera) and northern rockfish (Sebastes polyspinis) by Alaska Fisheries Science Center, Fisheries Monitoring and Analysis division from 1987-01-01 to 2004-01-01 (NCEI Accession 0134853)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish age validation with bomb-produced radiocarbon (14C) requires a known-age Delta14C reference chronology spanning the era of a marine increase in bomb-produced...

  6. Monthly variation in the Bioaccumulation of heavy metals and other safety issues in some marine and fresh water fish species in Ghana

    International Nuclear Information System (INIS)

    Arthur, W.

    2014-07-01

    Fish is one of the major sources of animal protein in Ghana and the fisheries industry is vital to the economy of the country. Unfortunately, most of the aquatic systems in Ghana are being polluted with domestic and industrial wastes which results in bioaccumulation of heavy metals in fish species. The traditional method for preserving fish in the country is by hot smoking or smoke drying, through freezing may be preferred where facilities are available. The presence of high levels of heavy metals in both fresh and smoked fish as well as other fish products is a matter of public health concern in Ghana. Variations in the level of bioaccumulation of heavy metals in both fresh and smoked marine fish, Sebastes marinus (red fish) and fresh water fish, Oreochromis niloticus (tilapia) caught off the coast of James Town in Accra and from the Volta river at Kpong respectively were monitored monthly from September 2013 to March 2014. Extension of two shelf life of the smoked fish species by gamma irradiation was also studied during 4 weeks of low temperature (5± 1 C ) storage by refrigeration. The total concentration of Iron (Fe), Zinc (Zn), Copper (Cu), Magnesium (Mg), Manganese (Mn), Cobalt (Co), Cadmium (Cd), Chromium (Cr), Arsenic (As) and Mercury (Hg) in the fish species as well as in their muscles, gills and bones were determined by Flame or Hydride Generation Atomic Absorption Spectrophotometry. The moisture content, pH, sensory analysis and population of aerobic mesophiles (on PCA), yeast and moulds (on OGYE), Escherichia coli (on EMB), Staphylococcus aureus (on BPA) and Salmonella (on XLD) in fresh fish, and smoked fish after treatment with 1, 2 and 3kGy of gamma irradiation and during storage were determined. Four patterns in the bioaccumulation of heavy metals in both Sebastes marinus and Oreochromis niloticus were observed over the 6 months monitoring period. Fe, Cu, Co and Cr accumulated heavily in the fish species during September and October after which the

  7. Les TIC permettent d'accroître l'équité en santé en Jordanie | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    24 oct. 2013 ... L'un des problèmes les plus graves auxquels se heurtent les collectivités rurales est le manque d'accès à des services de santé de qualité et à de l'information adéquate en matière de santé.

  8. Food limitation of sea lion pups and the decline of forage off central and southern California

    Science.gov (United States)

    McClatchie, Sam; Field, John; Thompson, Andrew R.; Gerrodette, Tim; Lowry, Mark; Fiedler, Paul C.; Watson, William; Nieto, Karen M.; Vetter, Russell D.

    2016-01-01

    California sea lions increased from approximately 50 000 to 340 000 animals in the last 40 years, and their pups are starving and stranding on beaches in southern California, raising questions about the adequacy of their food supply. We investigated whether the declining sea lion pup weight at San Miguel rookery was associated with changes in abundance and quality of sardine, anchovy, rockfish and market squid forage. In the last decade off central California, where breeding female sea lions from San Miguel rookery feed, sardine and anchovy greatly decreased in biomass, whereas market squid and rockfish abundance increased. Pup weights fell as forage food quality declined associated with changes in the relative abundances of forage species. A model explained 67% of the variance in pup weights using forage from central and southern California and 81% of the variance in pup weights using forage from the female sea lion foraging range. A shift from high to poor quality forage for breeding females results in food limitation of the pups, ultimately flooding animal rescue centres with starving sea lion pups. Our study is unusual in using a long-term, fishery-independent dataset to directly address an important consequence of forage decline on the productivity of a large marine predator. Whether forage declines are environmentally driven, are due to a combination of environmental drivers and fishing removals, or are due to density-dependent interactions between forage and sea lions is uncertain. However, declining forage abundance and quality was coherent over a large area (32.5–38° N) for a decade, suggesting that trends in forage are environmentally driven. PMID:27069651

  9. PIXE analysis of otoliths from several species of teleost fish

    International Nuclear Information System (INIS)

    Arai, Nobuaki; Sakamoto, Wataru; Maeda, Kuniko.

    1994-01-01

    In-air PIXE was used to analyze trace elements in otoliths from several species of teleost fish in order to examine the correlation between the trace elements concentrations and environmental conditions. Mn, Fe, Zn and Sr were detected accurately in the order of ppm by using the in-air PIXE. It seemed that concentrations of Sr and Zn in red sea bream otoliths increased in proportion to higher seawater temperature. In addition, there were significant differences in trace element composition between that of reared red sea bream and rockfish and that of wild ones. Preliminary results indicate that the PIXE is a powerful technique to investigate fish otoliths. (author)

  10. AFSC/RACE/GAP/Rooper: Acoustic assessment of rockfish in untrawlable areas

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The core function of the Resource Assessment and Conservation Engineering (RACE) Division is to conduct quantitative fishery surveys and related ecological and...

  11. Composición taxonómica y relaciones zoogeográficas de los peces demersales de la costa occidental de Baja California Sur, México

    Directory of Open Access Journals (Sweden)

    Jesús Rodríguez-Romero

    2008-12-01

    Full Text Available Se presenta la composición sistemática de peces demersales de la costa occidental de Baja California Sur, límite de distribución norte de la ictiofauna del Pacífico Oriental Tropical. Se realizaron cuatro cruceros oceanográficos durante otoño de 2004 a marzo de 2006. Este listado incluye 220 especies, 132 géneros y 73 familias. El 26.3% corresponde a especies de amplia distribución desde la Provincia de San Diego a la Provincia Panámica y el 21.7% son especies restringidas a la región del Pacífico Oriental Tropical. Seis especies representan nuevos registros para la zona o ampliación de su ámbito de distribución. Las familias mejor representadas en número de especies fueron Paralichthyidae y Scorpaenidae, con 16 especies cada una. El género mejor representado fue Sebastes con 9 especies. Se presentan los nombres comunes, intervalo de tallas y el estatus de cada especie dentro de la comunidadTaxonomic composition and zoogeographic relations of demersal in the western coast of Baja California Sur, Mexico. The composition of demersal fish along the western coast of the State of Baja California Sur, México, including the limit of the northern distribution of the ichthyofauna of the eastern tropical Pacific, is presented. The survey was carried out on four oceanographic cruises between autumn 2004 and March 2006. Of 220 species in 132 genera and 73 families, 26.3% are species of wide distribution from San Diego County, USA to Panama and 21.7% are species restricted to the eastern tropical Pacific. Six species are new findings for the area or range expansions. The families with the most species are Paralichthyidae and Scorpaenidae, each with 16 species. The most frequent genus was Sebastes, with nine species. We present a table with common Spanish names, size range and status of each species inside the community. Rev. Biol. Trop. 56 (4: 1765-1783. Epub 2008 December 12.

  12. A Process for Evaluating Adverse Environmental Impacts by Cooling-Water System Entrainment at a California Power Plant

    Directory of Open Access Journals (Sweden)

    C.P. Ehrler

    2002-01-01

    Full Text Available A study to determine the effects of entrainment by the Diablo Canyon Power Plant (DCPP was conducted between 1996 and 1999 as required under Section 316(b of the Clean Water Act. The goal of this study was to present the U.S. Environmental Protection Agency (EPA and Central Coast Regional Water Quality Control Board (CCRWQCB with results that could be used to determine if any adverse environmental impacts (AEIs were caused by the operation of the plant’s cooling-water intake structure (CWIS. To this end we chose, under guidance of the CCRWQCB and their entrainment technical working group, a unique approach combining three different models for estimating power plant effects: fecundity hindcasting (FH, adult equivalent loss (AEL, and the empirical transport model (ETM. Comparisons of the results from these three approaches provided us a relative measure of confidence in our estimates of effects. A total of 14 target larval fish taxa were assessed as part of the DCPP 316(b. Example results are presented here for the kelp, gopher, and black-and-yellow (KGB rockfish complex and clinid kelpfish. Estimates of larval entrainment losses for KGB rockfish were in close agreement (FH is approximately equals to 550 adult females per year, AEL is approximately equals to 1,000 adults [male and female] per year, and ETM = larval mortality as high as 5% which could be interpreted as ca. 2,600 1 kg adult fish. The similar results from the three models provided confidence in the estimated effects for this group. Due to lack of life history information needed to parameterize the FH and AEL models, effects on clinid kelpfish could only be assessed using the ETM model. Results from this model plus ancillary information about local populations of adult kelpfish suggest that the CWIS might be causing an AEI in the vicinity of DCPP.

  13. Historical Patterns and Drivers of Spatial Changes in Recreational Fishing Activity in Puget Sound, Washington.

    Directory of Open Access Journals (Sweden)

    Anne H Beaudreau

    Full Text Available Small-scale fisheries are the primary users of many coastal fish stocks; yet, spatial and temporal patterns of recreational and subsistence fishing in coastal marine ecosystems are poorly documented. Knowledge about the spatial distribution of fishing activities can inform place-based management that balances species conservation with opportunities for recreation and subsistence. We used a participatory mapping approach to document changes in spatial fishing patterns of 80 boat-based recreational anglers from 1950 to 2010 in Puget Sound, Washington, USA. Hand-drawn fishing areas for salmon, rockfishes, flatfishes, and crabs were digitized and analyzed in a Geographic Information System. We found that recreational fishing has spanned the majority of Puget Sound since the 1950s, with the heaviest use limited to small areas of central and northern Puget Sound. People are still fishing in the same places they were decades ago, with relatively little change in specific locations despite widespread declines in salmon and bottomfish populations during the second half of the 20th century. While the location of core fishing areas remained consistent, the size of those areas and intensity of use changed over time. The size of fishing areas increased through the 2000s for salmon but declined after the 1970s and 1980s for rockfishes, flatfishes, and crabs. Our results suggest that the spatial extent of recreational bottomfishing increased after the 1960s, when the availability of motorized vessels and advanced fish-finding technologies allowed anglers to expand their scope beyond localized angling from piers and boathouses. Respondents offered a wide range of reasons for shifts in fishing areas over time, reflecting substantial individual variation in motivations and behaviors. Changes in fishing areas were most commonly attributed to changes in residence and declines in target species and least tied to fishery regulations, despite the implementation of at

  14. Historical Patterns and Drivers of Spatial Changes in Recreational Fishing Activity in Puget Sound, Washington

    Science.gov (United States)

    Beaudreau, Anne H.; Whitney, Emily J.

    2016-01-01

    Small-scale fisheries are the primary users of many coastal fish stocks; yet, spatial and temporal patterns of recreational and subsistence fishing in coastal marine ecosystems are poorly documented. Knowledge about the spatial distribution of fishing activities can inform place-based management that balances species conservation with opportunities for recreation and subsistence. We used a participatory mapping approach to document changes in spatial fishing patterns of 80 boat-based recreational anglers from 1950 to 2010 in Puget Sound, Washington, USA. Hand-drawn fishing areas for salmon, rockfishes, flatfishes, and crabs were digitized and analyzed in a Geographic Information System. We found that recreational fishing has spanned the majority of Puget Sound since the 1950s, with the heaviest use limited to small areas of central and northern Puget Sound. People are still fishing in the same places they were decades ago, with relatively little change in specific locations despite widespread declines in salmon and bottomfish populations during the second half of the 20th century. While the location of core fishing areas remained consistent, the size of those areas and intensity of use changed over time. The size of fishing areas increased through the 2000s for salmon but declined after the 1970s and 1980s for rockfishes, flatfishes, and crabs. Our results suggest that the spatial extent of recreational bottomfishing increased after the 1960s, when the availability of motorized vessels and advanced fish-finding technologies allowed anglers to expand their scope beyond localized angling from piers and boathouses. Respondents offered a wide range of reasons for shifts in fishing areas over time, reflecting substantial individual variation in motivations and behaviors. Changes in fishing areas were most commonly attributed to changes in residence and declines in target species and least tied to fishery regulations, despite the implementation of at least 25 marine

  15. Strontium-90 and cesium-137 in sea fish (from Nov. 1984 to Jun. 1985)

    International Nuclear Information System (INIS)

    1985-01-01

    Sr-90 and Cs-137 in sea fish were determined using radiochemical analysis. Seven species of fish (Branchiostegus sp., Katsuwonus pelamis, Limanda herzensteini, Sillago sihama, Scomber japonicus, Caesio chrysozonus cuvier, and Sebastes Inermis) were collected during the fishing season from nine sampling locations. Only the edible part was used in cases of larger sized fish, and the whole part was used in cases of smaller ones. Each sample was weighed and placed in a stainless steel pan or a porcelain dish. After carbonization, the sample was ashed in an electric muffle furnace. The maximum value of Sr-90 was 0.9 +- 0.26 pCi/kg in Limanda herzensteini collected from Hiroshima in March 1985; and that of Cs-137 was 12 +- 0.5 pCi/kg in Katsuwonus pelamis collected from Kochi in May 1985. (Namekawa, K.)

  16. Geographical, and seasonal variation in the diet of harbour porpoises (Phocoena phocoena in Icelandic coastal waters

    Directory of Open Access Journals (Sweden)

    Gísli A Víkingsson

    2003-07-01

    Overall capelin (Mallotus villosus comprised the predominant prey, followed by sandeel (Ammodytidae sp., then gadids, cephalopods and redfish (Sebastes marinus, while other taxa were of less importance. Differences were detected in diet composition among 5 areas around Iceland with redfish and gadids more prominent in the northern areas. Off SW Iceland there was considerable seasonal variation in the porpoise diet, where capelin appeared to be dominant in late winter and spring and sandeel in the summer through early winter. Predominance of capelin in the diet coincided with the spawning migration of capelin from northern waters along the east, south and west coasts of Iceland. Mature females appeared to have a more diverse diet than other reproductive classes. The length distributions of fish consumed by the porpoises ranged from 1 to 51 cm although most fish prey were less than 30 cm.

  17. Characterizing the sponge grounds of Grays Canyon, Washington, USA

    Science.gov (United States)

    Powell, Abby N.; Clarke, M. Elizabeth; Fruh, Erica; Chaytor, Jason; Reiswig, Henry M.; Whitmire, Curt E.

    2018-01-01

    Deep-sea sponge grounds are relatively understudied ecosystems that may provide key habitats for a large number of fish and invertebrates including commercial species. Glass sponge grounds have been discovered from the tropics to polar regions but there are only a few places with high densities of dictyonine sponges. Dictyonine glass sponges have a fused skeleton, which stays intact when they die and in some areas the accumulation of successive generations of sponges leads to the formation of reefs. In 2010 and 2016, we surveyed an area near Grays Canyon in Washington, USA, where dense aggregations of glass sponges and potential sponge reefs were discovered in 2007. Our primary aims were to make a preliminary assessment of whether the glass sponges form reefs at this location, characterize the sponge assemblage present at this site and examine associations between the sponges and commercially important species. Multibeam mapping and sub-bottom profiling indicate that the glass sponges at this site do not form reefs and are mostly attached to hard substrates. Analysis of photographs collected by an autonomous underwater vehicle and samples collected by a remotely operated vehicle guided by telepresence revealed the presence of two abundant dictyonine sponge species at this site, Heterochone calyx and Aphrocallistes vastus (mean densities = 1.43 ± 0.057 per 10 m2, max = 24 per 10 m2). We also observed a large number of non-reef-building glass sponges and various demosponges including a potentially new species in the genus Acarnus. A diverse fish assemblage was recorded at this site including eight species of rockfish. Rockfish abundance was positively related to sponge abundance. Spot prawns (Pandalus platyceros) were also abundant and were strongly associated with sponges. Despite not finding sponge reefs, this is an ecologically significant area. Further research is necessary to determine the environmental factors that give rise to the abundance of large

  18. Elevated temperature exacerbates Ichthyophonus infections in buffalo sculpin

    Science.gov (United States)

    Halpenny, C.M.; Kocan, R.M.; Winton, J.R.; Perry, J.A.; Hershberger, P.K.

    2002-01-01

    High incidences of Ichthyophonus hoferi, a parasite primarily of marine and estuarine fishes, have recently been reported in rockfishes and Pacific herring from the eastern North Pacific (Kent et al 2001, Hershberger et al 2002). Taxonomic position of I. hoferi remains unresolved, but recent phylogenetic studies have grouped the organism with Dermocystidium, Psorospermium, the rosette agent of salmonids, and Rhinosporidium in the Mesomycetozoa, a novel clade of protists near the animal-fungal divergence (Herr et al 1999). Genetic differences among isolates from the east coast of North America indicate that more than one species of Ichthyophonus exist (Rand et al 2000), and different species have likely been assigned the same name based on morphological characteristics. Therefore, hereafter in this manuscript, the organism will be referred to as Ichthyophonus .

  19. Feeding habits of harp and hooded seals in Greenland waters

    Directory of Open Access Journals (Sweden)

    Finn O Kapel

    2000-05-01

    Full Text Available Results of stomach contents analyses of harp and hooded seals collected in West Greenland waters in the period 1986-1993 are reviewed, and compared with published data and circumstantial information from local hunters.  The diet of harp seals in this region is variable but consists mainly of pelagic crustaceans (Thysanoessa spp. and Parathemisto libellula and small fish species like capelin (Mallotus villosus, sandeel (Ammodytes spp., polar cod (Boreogadus saida and Arctic cod (Arctogadus glacialis. Species of importance for commercial fisheries in Greenland, such as Northern prawn (Pandalus borealis, Atlantic cod (Gadus morhua, and Greenland halibut (Reinhardtius hippoglossoides play a minor role in the diet of harp seals in this area. Variation in the diet of hooded seals is less well documented, but in addition to the species also taken by harp seals, larger demersal fishes like Greenland halibut, redfish (Sebastes spp., cod, and wolffish (Anarhichas minor are apparently important prey items.

  20. Parasite infection and immune and health-state in wild fish exposed to marine pollution.

    Science.gov (United States)

    Sueiro, María Cruz; Bagnato, Estefanía; Palacios, María Gabriela

    2017-06-15

    Association between parasitism and immunity and health-state was investigated in wild Sebastes oculatus after having determined that pollution exposure is associated with altered immune and health-state parameters. Given the importance of the immune system in antiparasite defense we predicted: (i) parasite infection would be higher in pollution-exposed than in control fish and (ii) fish with lower immune and health-state parameters would show higher parasitism than fish in better condition. Metazoan parasite fauna was compared between pollution-exposed and non-exposed fish and parasitic indices were correlated with integrated measures of immunity and health-state. Results provided little support for the predictions; some parasite taxa increased, some decreased, and some were not affected in pollution-exposed fish despite their altered health and immunity. Furthermore, there was no link between individual immune and health-state parameters and parasitism. These findings highlight the complexity of host-parasite-environment interactions in relation to pollution in natural marine ecosystems. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Legionella cardiaca sp. nov., isolated from a case of native valve endocarditis in a human heart

    Science.gov (United States)

    Pearce, Meghan M.; Theodoropoulos, Nicole; Mandel, Mark J.; Brown, Ellen; Reed, Kurt D.

    2012-01-01

    A Gram-negative, rod-shaped bacterium, designated H63T, was isolated from aortic valve tissue of a patient with native valve endocarditis. 16S rRNA gene sequencing revealed that H63T belongs to the genus Legionella, with its closest neighbours being the type strains of Legionella brunensis (98.8 % similarity), L. londiniensis (97.0 %), L. jordanis (96.8 %), L. erythra (96.2 %), L. dresdenensis (96.0 %) and L. rubrilucens, L. feeleii, L. pneumophila and L. birminghamensis (95.7 %). DNA–DNA hybridization studies yielded values of Legionella. H63T was distinguishable from its neighbours based on it being positive for hippurate hydrolysis. H63T was further differentiated by its inability to grow on BCYE agar at 17 °C, its poor growth on low-iron medium and the absence of sliding motility. Also, H63T did not react with antisera generated from type strains of Legionella species. H63T replicated within macrophages. It also grew in mouse lungs, inducing histopathological evidence of pneumonia and dissemination to the spleen. Together, these results confirm that H63T represents a novel, pathogenic Legionella species, for which the name Legionella cardiaca sp. nov. is proposed. The type strain is H63T ( = ATCC BAA-2315T  = DSM 25049T  = JCM 17854T). PMID:22286905

  2. 78 FR 47635 - Endangered and Threatened Species; Designation of Critical Habitat for Yelloweye Rockfish, Canary...

    Science.gov (United States)

    2013-08-06

    ...) dredging and disposal of dredged material; (3) pollution and runoff; (4) underwater construction and..., at the northern tip of Whidbey Island. Pollution and runoff are also concerns in this basin, mostly... areas deeper than 98 ft (30 m) along Possession Point, Admiralty Inlet and the rims of Puget Sound...

  3. Rapidly shifting environmental baselines among fishers of the Gulf of California

    Science.gov (United States)

    Sáenz-Arroyo, Andrea; Roberts, Callum M; Torre, Jorge; Cariño-Olvera, Micheline; Enríquez-Andrade, Roberto R

    2005-01-01

    Shifting environmental baselines are inter-generational changes in perception of the state of the environment. As one generation replaces another, people's perceptions of what is natural change even to the extent that they no longer believe historical anecdotes of past abundance or size of species. Although widely accepted, this phenomenon has yet to be quantitatively tested. Here we survey three generations of fishers from Mexico's Gulf of California (N=108), where fish populations have declined steeply over the last 60 years, to investigate how far and fast their environmental baselines are shifting. Compared to young fishers, old fishers named five times as many species and four times as many fishing sites as once being abundant/productive but now depleted (Kruskal–Wallis tests, both p<0.001) with no evidence of a slowdown in rates of loss experienced by younger compared to older generations (Kruskal–Wallis test, n.s. in both cases). Old fishers caught up to 25 times as many Gulf grouper Mycteroperca jordani as young fishers on their best ever fishing day (regression r2=0.62, p<0.001). Despite times of plentiful large fish still being within living memory, few young fishers appreciated that large species had ever been common or nearshore sites productive. Such rapid shifts in perception of what is natural help explain why society is tolerant of the creeping loss of biodiversity. They imply a large educational hurdle in efforts to reset expectations and targets for conservation. PMID:16191603

  4. Parasites as biological tags of marine, freshwater and anadromous fishes in North America from the Tropics to the Arctic.

    Science.gov (United States)

    Marcogliese, David J; Jacobson, Kym C

    2015-01-01

    Parasites have been considered as natural biological tags of marine fish populations in North America for almost 75 years. In the Northwest Atlantic, the most studied species include Atlantic cod (Gadus morhua), Atlantic herring (Clupea harengus) and the redfishes (Sebastes spp.). In the North Pacific, research has centred primarily on salmonids (Oncorhynchus spp.). However, parasites have been applied as tags for numerous other pelagic and demersal species on both the Atlantic and Pacific coasts. Relatively few studies have been undertaken in the Arctic, and these were designed to discriminate anadromous and resident salmonids (Salvelinus spp.). Although rarely applied in fresh waters, parasites have been used to delineate certain fish stocks within the Great Lakes-St Lawrence River basin. Anisakid nematodes and the copepod Sphyrion lumpi frequently prove useful indicators in the Northwest Atlantic, while myxozoan parasites prove very effective on the coast and open seas of the Pacific Ocean. Relative differences in the ability of parasites to discriminate between fish stocks on the Pacific and Atlantic coasts may be due to oceanographic and bathymetric differences between regions. Molecular techniques used to differentiate populations and species of parasites show promise in future applications in the field.

  5. Influence of on-board irradiation on the shelflife of redfish. Pt. 2

    International Nuclear Information System (INIS)

    Karnop, G.; Antonacopoulos, N.; Muenzer, R.

    1978-01-01

    Bacteriological and chemical investigations on extending the shelflife of fresh iced unpacked redfish (Sebastes marinus) be 100 krad irradiation were carried out during two voyages of RV 'Anton Dohrn'. Bacteriological criteria indicated no shelflife extension on one voyage and an extension by 5 - 7 days on the other voyage. Chemical indices indicated an extension of 4 - 6 and more then 10 days, respectively. Delayed irradiation after 7 days storage in ice influenced only the chemical values (4 - 6 days shelflife extension), while reirradiation on the 6th day affected both the bacteriological (some days extension) and the chemical values (more than 10 days extension). The greatest effect was obtained with whole fish irradiated and stored in plastic bags, which - due to the dominance of biologically largely inactive Moraxella sp. - on the 28th day showed nearly the initial chemical values. Together with the previously published sensoric findings (13) these results indicate no or only a slight prolongation of shelflife of unpacked iced redfish due to irradiation at once or on the 7th day or both at once and on the 7th day. (orig.) [de

  6. Concentration of trace elements in marine organisms

    International Nuclear Information System (INIS)

    Ishii, Takaaki; Suzuki, Hamaji; Iimura, Mitsue; Koyanagi, Taku

    1976-01-01

    Information on the quality and quantity of stable trace elements in marine environments is frequently required to analyze the radioecological behavior of radionuclides released from nuclear facilities into the sea. In the present work, special attention was concentrated in determination of stable Mn, Fe, Co, Zn, Rb and Cs in marine organisms to estimate the concentration factors for these elements and corresponding radionuclides. Marine organisms (fishes, marine invertebrates and seaweeds) were collected at the seashore of Ibaragi prefecture and provided for chemical analysis after dry-ashing and wet-ashing. Atomic absorption spectrophotometry and neutron activation analysis were applied to determine the concentration of elements. The concentration of stable elements in fish muscle was independent on species of the fishes though slightly higher trends were observed in ''Usumebaru'', Sebastes nivosus for Cs, ''Ishimochi'', Nibea mitsukurii for Zn and Fe compared with other species. The concentration of Co, Zn and Fe in muscle of marine invertebrates was one order of magnitude higher than fish muscles especially in shellfishes for Co. Seaweeds showed peculiar species specificity for the concentration of stable trace elements and remarkable differences was observed between the species even among the same genus. (auth.)

  7. Assessment of Rockfish Species in Untrawlable Habitat in the Gulf of Alaska (DY0912, EK60)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Midwater Assessment and Conservation Engineering (MACE) program of NOAA National Marine Fisheries Service (NMFS), Alaska Fisheries Science Center (AFSC)...

  8. Chronic exposure to paclobutrazol causes hepatic steatosis in male rockfish Sebastiscus marmoratus and the mechanism involved

    Energy Technology Data Exchange (ETDEWEB)

    Sun Lingbin [State Key Laboratory of Cellular Stress Biology, School of Life Sciences, Xiamen University, Xiamen (China); Li Jinshou [Department of Biological Engineering, Ningde Normal University, Ningde City, Fujian (China); Zuo Zhenghong [State Key Laboratory of Cellular Stress Biology, School of Life Sciences, Xiamen University, Xiamen (China); Chen Meng [State Key Laboratory of Marine Environmental Science, Xiamen University, Xiamen (China); Wang Chonggang, E-mail: cgwang@xmu.edu.cn [State Key Laboratory of Cellular Stress Biology, School of Life Sciences, Xiamen University, Xiamen (China); State Key Laboratory of Marine Environmental Science, Xiamen University, Xiamen (China)

    2013-01-15

    Paclobutrazol (PBZ) is a triazole-containing fungicide which is widely used in agriculture. Acute toxicity can follow its extensive use but it is generally weaker than traditional pesticides such as organochlorine and organophosphorus. However, its adverse effects on aquatic organisms need to be investigated. This study was conducted to investigate the effect of PBZ exposure on the hepatic lipid metabolism of Sebastiscus marmoratus. After PBZ exposure for 50 days, hepatic lipid droplets were enlarged and the hepatic total lipid, triglyceride, total cholesterol and free fatty acid content had increased in a dose dependent manner compared to the control. The mRNA expression of lipid metabolism associated genes such as peroxisome proliferator-activated receptors (PPARs), androgen receptor, acetyl-CoA carboxylase 1, fatty acid synthesis, fatty acid bing protein 4, liver X receptor {alpha} (LXR{alpha}) and stearoyl-CoA desaturase were up-regulated by PBZ exposure. These results indicated that triazole-containing fungicides might affect the metabolism and health of fish via the multi-signal pathways of nuclear receptors such as PPARs and LXR.

  9. [A development of Byzantine Christian charities during the 4(th)-7(th) centuries and the birth of the hospital].

    Science.gov (United States)

    Nam, Sung Hyun

    2015-04-01

    This study aims to examine the beginning and the development of Christian Charities during the 4(th)-6(th) centuries which would eventually result in the birth of the hospital in modern sense in the first half of the 7(th) century. For this purpose, I looked carefully into various primary sources concerning the early Christian institutions for the poor and the sick. Above all, it's proper to note that the first xenodocheion where hospitality was combined with a systematic caring, is concerned with the Trinitarian debate of the 4(th) century. In 356, Eustathios, one of the leaders of homoiousios group, established xenodocheion to care for the sick and the lepers in Sebaste of Armenia, whereas his opponent Aetios, doctor and leader of the heteroousios party, was reckoned to have combined the medical treatment with his clerical activities. Then, Basil of Caesarea, disciple of Eustathios of Sebaste, also founded in 372 a magnificent benevolent complex named 'Basileias' after its founder. I scrupulously analysed several contemporary materials mentioning the charitable institution of Caesarea which was called alternatively katagogia, ptochotropheion, xenodocheion. John Chrysostome also founded several nosokomeia in Constantinople at the end of the 4(th) century and the beginning of the 5(th) century. Apparently, the contemporary sources mention that doctors existed for these Charities, but there is no sufficient proof that these 'Christian Hospitals,' Basileias or nosokomeia of Constantinople were hospitals in modern sense. Imperial constitutions began to mention ptochotropheion, xenodocheion and orphanotropheion since the second half of the 5(th) century and then some Justinian laws evoked nosokomium, brephotrophia, gerontocomia. These laws reveal that 'Christian Hospitals' were well clarified and deeply rooted in Byzantine society already in these periods. And then, new benevolent institutions emerged in the 6(th) century: nosokomeia for a specific class and

  10. Using environmental isotopes in the study of the recharge-discharge mechanisms of the Yarmouk catchment area in Jordan

    Science.gov (United States)

    Salameh, Elias

    groundwater, which, from the highlands towards the Jordan Valley, shows increasing enrichment in isotopes. The highlands aquifer, with its groundwater depleted in isotopes, becomes confined towards the Jordan Valley; and, due to its confining pressure, leaks water upwards into the overlying aquifers causing their water to become less enriched in isotopes. Water depleted in its isotopic composition also seeps upward to the ground surface at the mountain foothills through faults and fissures. Les zones de recharge, les mécanismes d'écoulement et les zones de décharges des différentes masses d'eau souterraine sous le bassin versant de la rivière Yarmouk en Jordanie, étaient expliquées de manière ambiguë par les seuls outils isotopiques. Le long de la parti Jordanienne du bassin versant de la rivière Yarmouk l'eau souterraine provient de différents aquifères et se distinguent par leur type et leur composition chimique, selon que l'eau provient du même ou des différents aquifères. Les mécanismes conventionnels de recharge et de décharge, bilan hydrologique ne donnaient pas d'explications satisfaisantes concernant les variations chimiques et les différents types d'eau. En appliquant les isotopes environnementaux combinés aux effets de l'altitude sur les variations des teneurs isotopiques (l'altitude varie de 250 à 1,300 m sur une distance de 20 km.) et en prenant en considération les effets de ré-évaporation sur l'appauvrissement et l'enrichissement isotopique des eaux pluviales ont fortement contribués à une meilleure compréhension des mécanismes de recharge des différents aquifères. Les précipitations annuelles sont comprises entre 600 mm dans les zones en altitude et 350 mm dans la vallée de la Jordanie. Les écoulements de l'eau souterraine sont dirigés des zones en altitude vers la vallée de la Jordanie. Les eaux souterraines des zones en altitude sont isotopiquement appauvries (δO18 = -6, δD = -30), les eaux souterraines des zones de moyenne

  11. Extending Vulnerability Assessment to Include Life Stages Considerations.

    Science.gov (United States)

    Hodgson, Emma E; Essington, Timothy E; Kaplan, Isaac C

    2016-01-01

    Species are experiencing a suite of novel stressors from anthropogenic activities that have impacts at multiple scales. Vulnerability assessment is one tool to evaluate the likely impacts that these stressors pose to species so that high-vulnerability cases can be identified and prioritized for monitoring, protection, or mitigation. Commonly used semi-quantitative methods lack a framework to explicitly account for differences in exposure to stressors and organism responses across life stages. Here we propose a modification to commonly used spatial vulnerability assessment methods that includes such an approach, using ocean acidification in the California Current as an illustrative case study. Life stage considerations were included by assessing vulnerability of each life stage to ocean acidification and were used to estimate population vulnerability in two ways. We set population vulnerability equal to: (1) the maximum stage vulnerability and (2) a weighted mean across all stages, with weights calculated using Lefkovitch matrix models. Vulnerability was found to vary across life stages for the six species explored in this case study: two krill-Euphausia pacifica and Thysanoessa spinifera, pteropod-Limacina helicina, pink shrimp-Pandalus jordani, Dungeness crab-Metacarcinus magister and Pacific hake-Merluccius productus. The maximum vulnerability estimates ranged from larval to subadult and adult stages with no consistent stage having maximum vulnerability across species. Similarly, integrated vulnerability metrics varied greatly across species. A comparison showed that some species had vulnerabilities that were similar between the two metrics, while other species' vulnerabilities varied substantially between the two metrics. These differences primarily resulted from cases where the most vulnerable stage had a low relative weight. We compare these methods and explore circumstances where each method may be appropriate.

  12. Transferability of habitat suitability criteria for fishes in warmwater streams

    Science.gov (United States)

    Freeman, Mary C.; Bowen, Z.H.; Crance, J.H.

    1997-01-01

    We developed habitat suitability criteria and tested their transferability for nine fishes inhabiting unregulated Piedmont and Coastal Plain streams in Alabama. Cr iteria for optimal habitat were defined as ranges of depth, velocity, substrate type and cover type for which a species' suitability index (proportional abundance divided by proportional habitat availability, scaled from 0 to 1) equalled or exceeded 0.4. We evaluated the transferability of criteria between study sites by testing the null hypothesis that species occurrence in a sample was independent of whether or not the sample was taken in optimal habitat. We also tested criteria transference to a large, flow-regulated river sampled during low flow periods. Depth, velocity and most substrate criteria developed for the bronze darter Percina palmaris successfully transferred between unregulated streams and to the flow-regulated river samples. All criteria developed for a pair of closely related, allopatric darter species, Etheostoma chuckwachattee and E. jordani, transferred sucessfully when applied between species (in the unregulated sites) and to the regulated river samples. In contrast, criteria for the Alabama shiner Cyprinella callistia failed nearly all tests of transferability. Criteria for E. stigmaeum, P. nigrofasciata, an undescribed Percina species, and a pair of related, allopatric Cyprinella species transferred inconsistently. The species with good criteria transference had high suitability indices for shallow depths, fast current velocities and coarse substrates, characteristic of riffle species. We suggest that microhabitat criteria for riffle fishes are more likely to provide a transferable measure of habitat quality than criteria for fishes that, although restricted to fluvial habitats, commonly occupy a variety of pool and riffle habitats.

  13. Rockfish data - Movement and habitat use patterns of top predators and keystone species in the benthic food web

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — We have been using and continue to use acoustic telemetry methods to monitor the movement behavior and define habitat use of groundfish species in and out of Puget...

  14. Feeding Relationships among Six Seagrass-associated Fishes in the Northeastern Gwangyang Bay, Southern Korea

    Science.gov (United States)

    Park, Joo Myun; Kwak, Seok Nam; Han, In-Seong

    2018-03-01

    We conducted dietary analyses of six seagrass-associated fish species inhabiting northeastern Gwangyang Bay, Korea. These six species consumed a variety of benthic invertebrates and teleosts, but their preferences for different food resources varied. Although all species consumed crustaceans, the contributions of different crustacean taxa differed among the species' diets. Caridean shrimps and crabs were a significant part of the Hexagrammos agrammus and H. otakii diets, respectively, while amphipods were consumed mainly by Sebastes inermis. Caridean shrimps and prawns were abundant within the Lateolabrax japonicas diet, but were not common prey resources for Pseudopleuronectes yokohamae or S. schlegelii. Polychaetes and ophiurids were ingested by P. yokohamae, and the former prey taxon also made moderate contributions to the diets of H. agrammus and L. japonicus. With the exception of P. yokohamae, the diets of all species included teleosts. Teleosts contributed the largest proportion of the S. schlegelii diet, followed by the S. inermis and L. japonicas diets; however, H. agrammus and H. otakii rarely consumed teleosts. Non-metric multidimensional scaling (nMDS) ordination plots and permutational analysis of variance (PERMANOVA) revealed the variation in dietary composition among species and the contributions of each prey taxon. These interspecific differences in diet increase the range of food resources available to these fishes, thereby reducing competition for resources within the fish community in this region.

  15. Effects of benzo(a)pyrene on the skeletal development of Sebastiscus marmoratus embryos and the molecular mechanism involved

    International Nuclear Information System (INIS)

    He Chengyong; Zuo Zhenghong; Shi Xiao; Li Ruixia; Chen Donglei; Huang Xin; Chen Yixin; Wang Chonggang

    2011-01-01

    Polycyclic aromatic hydrocarbons (PAHs) are widespread environmental contaminants, which have been known to be carcinogenic and teratogenic. However, the skeletal development toxicity of PAHs and the mechanism involved remain unclear. In fishes, the neurocranial and craniofacial skeleton develop as cartilage. The signaling molecules of hedgehog (Hh) family play crucial roles in regulating skeletal development. In the present study, rockfish (Sebastiscus marmoratus) embryos were exposed to benzo(a)pyrene (BaP) for 7 days at environmental levels (0.05, 0.5 and 5 nmol/L) which resulted in craniofacial skeleton deformities. BaP exposure reduced the cell proliferation activity in the craniofacial skeleton as detected by quantitative PCR and in situ hybridization. The expression of Sonic hedgehog (Shh), rather than Indian hedgehog (Ihh), was down-regulated in the craniofacial skeleton in the 0.5 and 5 nmol/L groups. Consistent with the Shh results, the expression of Ptch1 and Gli2 was decreased by BaP exposure and BMP4 was presented on changes in the 0.5 and 5 nmol/L groups. These results suggested that BaP could impair the expression and function of Shh signaling pathway, perturbing the proliferation of chondrocytes and so disturbing craniofacial skeletal development.

  16. Effects of benzo(a)pyrene on the skeletal development of Sebastiscus marmoratus embryos and the molecular mechanism involved

    Energy Technology Data Exchange (ETDEWEB)

    He Chengyong [Key Laboratory of Ministry of Education for Subtropical Wetland Ecosystem Research, School of Life Sciences, Xiamen University, Xiamen (China); Zuo Zhenghong [Key Laboratory of Ministry of Education for Subtropical Wetland Ecosystem Research, School of Life Sciences, Xiamen University, Xiamen (China); State Key Laboratory of Marine Environmental Science, Xiamen University, Xiamen (China); Shi Xiao; Li Ruixia; Chen Donglei; Huang Xin; Chen Yixin [Key Laboratory of Ministry of Education for Subtropical Wetland Ecosystem Research, School of Life Sciences, Xiamen University, Xiamen (China); Wang Chonggang, E-mail: cgwang@xmu.edu.cn [Key Laboratory of Ministry of Education for Subtropical Wetland Ecosystem Research, School of Life Sciences, Xiamen University, Xiamen (China); State Key Laboratory of Marine Environmental Science, Xiamen University, Xiamen (China)

    2011-01-25

    Polycyclic aromatic hydrocarbons (PAHs) are widespread environmental contaminants, which have been known to be carcinogenic and teratogenic. However, the skeletal development toxicity of PAHs and the mechanism involved remain unclear. In fishes, the neurocranial and craniofacial skeleton develop as cartilage. The signaling molecules of hedgehog (Hh) family play crucial roles in regulating skeletal development. In the present study, rockfish (Sebastiscus marmoratus) embryos were exposed to benzo(a)pyrene (BaP) for 7 days at environmental levels (0.05, 0.5 and 5 nmol/L) which resulted in craniofacial skeleton deformities. BaP exposure reduced the cell proliferation activity in the craniofacial skeleton as detected by quantitative PCR and in situ hybridization. The expression of Sonic hedgehog (Shh), rather than Indian hedgehog (Ihh), was down-regulated in the craniofacial skeleton in the 0.5 and 5 nmol/L groups. Consistent with the Shh results, the expression of Ptch1 and Gli2 was decreased by BaP exposure and BMP4 was presented on changes in the 0.5 and 5 nmol/L groups. These results suggested that BaP could impair the expression and function of Shh signaling pathway, perturbing the proliferation of chondrocytes and so disturbing craniofacial skeletal development.

  17. Latte-Abdallah Stéphanie, Images aux frontières, Représentations et constructions sociales et politiques, Palestine, Jordanie 1948-2000, Publications de l’IFPO, 2005, 369 p.

    Directory of Open Access Journals (Sweden)

    Véronique Bontemps

    2008-01-01

    Full Text Available Le traitement médiatique du 11 septembre 2001, et les images, diffusées en boucle sur les chaînes de télévision, des avions s’écrasant sur les Twin Towers ont tragiquement confirmé l’immense pouvoir des images sur notre appréhension de la réalité sociale. L’ouvrage Images aux frontières s’inscrit dans cette interrogation. Il regroupe des articles de sociologues, anthropologues, historiens et politologues autour de la notion « d’image » dans la construction des identités collectives en Palesti...

  18. Multi-scale sampling to evaluate assemblage dynamics in an oceanic marine reserve.

    Science.gov (United States)

    Thompson, Andrew R; Watson, William; McClatchie, Sam; Weber, Edward D

    2012-01-01

    To resolve the capacity of Marine Protected Areas (MPA) to enhance fish productivity it is first necessary to understand how environmental conditions affect the distribution and abundance of fishes independent of potential reserve effects. Baseline fish production was examined from 2002-2004 through ichthyoplankton sampling in a large (10,878 km(2)) Southern Californian oceanic marine reserve, the Cowcod Conservation Area (CCA) that was established in 2001, and the Southern California Bight as a whole (238,000 km(2) CalCOFI sampling domain). The CCA assemblage changed through time as the importance of oceanic-pelagic species decreased between 2002 (La Niña) and 2003 (El Niño) and then increased in 2004 (El Niño), while oceanic species and rockfishes displayed the opposite pattern. By contrast, the CalCOFI assemblage was relatively stable through time. Depth, temperature, and zooplankton explained more of the variability in assemblage structure at the CalCOFI scale than they did at the CCA scale. CalCOFI sampling revealed that oceanic species impinged upon the CCA between 2002 and 2003 in association with warmer offshore waters, thus explaining the increased influence of these species in the CCA during the El Nino years. Multi-scale, spatially explicit sampling and analysis was necessary to interpret assemblage dynamics in the CCA and likely will be needed to evaluate other focal oceanic marine reserves throughout the world.

  19. Characterization of Atlantic cod spawning habitat and behavior in Icelandic coastal waters.

    Directory of Open Access Journals (Sweden)

    Timothy B Grabowski

    Full Text Available The physical habitat used during spawning may potentially be an important factor affecting reproductive output of broadcast spawning marine fishes, particularly for species with complex, substrate-oriented mating systems and behaviors, such as Atlantic cod Gadus morhua. We characterized the habitat use and behavior of spawning Atlantic cod at two locations off the coast of southwestern Iceland during a 2-d research cruise (15-16 April 2009. We simultaneously operated two different active hydroacoustic gear types, a split beam echosounder and a dual frequency imaging sonar (DIDSON, as well as a remotely operated underwater vehicle (ROV. A total of five fish species were identified through ROV surveys: including cusk Brosme brosme, Atlantic cod, haddock Melanogrammus aeglefinus, lemon sole Microstomus kitt, and Atlantic redfish Sebastes spp. Of the three habitats identified in the acoustic surveys, the transitional habitat between boulder/lava field and sand habitats was characterized by greater fish density and acoustic target strength compared to that of sand or boulder/lava field habitats independently. Atlantic cod were observed behaving in a manner consistent with published descriptions of spawning. Individuals were observed ascending 1-5 m into the water column from the bottom at an average vertical swimming speed of 0.20-0.25 m s(-1 and maintained an average spacing of 1.0-1.4 m between individuals. Our results suggest that cod do not choose spawning locations indiscriminately despite the fact that it is a broadcast spawning fish with planktonic eggs that are released well above the seafloor.

  20. Characterization of Atlantic cod spawning habitat and behavior in Icelandic coastal waters

    Science.gov (United States)

    Grabowski, Timothy B.; Boswell, Kevin M.; McAdam, Bruce J.; Wells, R. J. David; Marteinsdóttir, Gudrún

    2012-01-01

    The physical habitat used during spawning may potentially be an important factor affecting reproductive output of broadcast spawning marine fishes, particularly for species with complex, substrate-oriented mating systems and behaviors, such as Atlantic cod Gadus morhua. We characterized the habitat use and behavior of spawning Atlantic cod at two locations off the coast of southwestern Iceland during a 2-d research cruise (15–16 April 2009). We simultaneously operated two different active hydroacoustic gear types, a split beam echosounder and a dual frequency imaging sonar (DIDSON), as well as a remotely operated underwater vehicle (ROV). A total of five fish species were identified through ROV surveys: including cusk Brosme brosme, Atlantic cod, haddock Melanogrammus aeglefinus, lemon sole Microstomus kitt, and Atlantic redfish Sebastes spp. Of the three habitats identified in the acoustic surveys, the transitional habitat between boulder/lava field and sand habitats was characterized by greater fish density and acoustic target strength compared to that of sand or boulder/lava field habitats independently. Atlantic cod were observed behaving in a manner consistent with published descriptions of spawning. Individuals were observed ascending 1–5 m into the water column from the bottom at an average vertical swimming speed of 0.20–0.25 m s−1 and maintained an average spacing of 1.0–1.4 m between individuals. Our results suggest that cod do not choose spawning locations indiscriminately despite the fact that it is a broadcast spawning fish with planktonic eggs that are released well above the seafloor.

  1. The use of rockfish Sebastiscus marmoratus as a sentinel species to assess petroleum hydrocarbons pollution: A case study in Quanzhou Bay, China.

    Science.gov (United States)

    Bo, Jun; Zheng, Ronghui; Kuang, Weiming; Hong, Fukun; Xie, Qing; Zhang, Yusheng

    2017-11-30

    To monitor the biological effects of marine pollution, choosing a native fish species and establishing suitable biomarkers are required. In this study, the full-length cDNA of cyp1a1 was cloned from Sebastiscus marmoratus (SM-CYP1A1). Then the dose-response and time-course induction of hepatic CYP1A1 mRNA by the crude oil water-soluble fraction (WSF) were determined. Subsequently, SM-CYP1A1 mRNA was applied to investigate the biological effect of petroleum hydrocarbon pollution in Quanzhou Bay, China. The transcription levels of hepatic CYP1A1 were significantly elevated in fish caged in the polluted sites for 2weeks compared with those of the reference site, which were correlated with the concentrations of petroleum hydrocarbon and polycyclic aromatic hydrocarbon (PAH) in the surface seawaters. The results suggest that S. marmoratus is a potential sentinel organism to monitor marine pollutants and the hepatic CYP1A1 mRNA can serve as a sensitive biomarker to organic xenobiotics in aquatic environments. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. 50 CFR Table 1b to Part 660... - 2009, Harvest Guidelines for Minor Rockfish by Depth Sub-groups (weights in metric tons)

    Science.gov (United States)

    2010-10-01

    ... population in the California Current ecosystem, a non-quantitative assessment was conducted in 2007. The... 50 percent of the 2008 ABC and OY values. The stock is expected to remain at its current equilibrium... catcher/processors, 60.0 mt for motherships, and 105.0 mt for shore-based. r Canary rockfish—A canary...

  3. Multi-scale sampling to evaluate assemblage dynamics in an oceanic marine reserve.

    Directory of Open Access Journals (Sweden)

    Andrew R Thompson

    Full Text Available To resolve the capacity of Marine Protected Areas (MPA to enhance fish productivity it is first necessary to understand how environmental conditions affect the distribution and abundance of fishes independent of potential reserve effects. Baseline fish production was examined from 2002-2004 through ichthyoplankton sampling in a large (10,878 km(2 Southern Californian oceanic marine reserve, the Cowcod Conservation Area (CCA that was established in 2001, and the Southern California Bight as a whole (238,000 km(2 CalCOFI sampling domain. The CCA assemblage changed through time as the importance of oceanic-pelagic species decreased between 2002 (La Niña and 2003 (El Niño and then increased in 2004 (El Niño, while oceanic species and rockfishes displayed the opposite pattern. By contrast, the CalCOFI assemblage was relatively stable through time. Depth, temperature, and zooplankton explained more of the variability in assemblage structure at the CalCOFI scale than they did at the CCA scale. CalCOFI sampling revealed that oceanic species impinged upon the CCA between 2002 and 2003 in association with warmer offshore waters, thus explaining the increased influence of these species in the CCA during the El Nino years. Multi-scale, spatially explicit sampling and analysis was necessary to interpret assemblage dynamics in the CCA and likely will be needed to evaluate other focal oceanic marine reserves throughout the world.

  4. Radioecological studies in the marine environment

    International Nuclear Information System (INIS)

    Suzuki, Y.; Nakamura, K.; Nakamura, R.; Nakahara, M.; Ishii, T.; Matsuba, M.; Nagaya, Y.

    1992-01-01

    Man-made radionuclides released into the marine environment have been regarded as useful tracers in the study of natural geochemical and oceanographic processes occurring in the ocean. Quantitative collection of Cs-137 from surface seawater by copper ferrocyanide-anion exchange resin was examined and the same method was also applied to open ocean sea water. To get inherent bioconcentration coefficients of marine fish from the coastal seas of Japan, laboratory tracer experiments using some radioisotopes were carried out. Uptake, through both radioactive seawater and food, and excretion of radionuclides by marine fish were observed for about 8 weeks. The results showed that seawater and food equally contribute to accumulation of Cs-137 by fish. The adult rockfish and Japanese flounder seemed to take up Ru-103 mainly from seawater, while juvenile fish take it from seawater and food equally. Much information on concentrations, distributions and chemical forms of stable isotopes in marine organisms is important to predict the behaviour of radionuclides in the sea or to study metal metabolism in the body of marine organisms. Approximately 40 elements corresponding to important radionuclides in more than 300 species of marine organisms, collected off the coast of Japan, were analyzed with ICP-AES, ICP-MS and electron probe X-ray microanalysis. The concentrations of Mn and Zn in the dried granules of the kidney of a marine bivalve were 44,200 and 22,800 μg/g, respectively. The high accumulation of certain elements in the kidney resulted from the existence of metal containing granules. (author)

  5. Fish communities associated with cold-water corals vary with depth and substratum type

    Science.gov (United States)

    Milligan, Rosanna J.; Spence, Gemma; Roberts, J. Murray; Bailey, David M.

    2016-08-01

    Understanding the processes that drive the distribution patterns of organisms and the scales over which these processes operate are vital when considering the effective management of species with high commercial or conservation value. In the deep sea, the importance of scleractinian cold-water corals (CWCs) to fish has been the focus of several studies but their role remains unclear. We propose this may be due to the confounding effects of multiple drivers operating over multiple spatial scales. The aims of this study were to investigate the role of CWCs in shaping fish community structure and individual species-habitat associations across four spatial scales in the NE Atlantic ranging from "regions" (separated by >500 km) to "substratum types" (contiguous). Demersal fish and substratum types were quantified from three regions: Logachev Mounds, Rockall Bank and Hebrides Terrace Seamount (HTS). PERMANOVA analyses showed significant differences in community composition between all regions which were most likely caused by differences in depths. Within regions, significant variation in community composition was recorded at scales of c. 20-3500 m. CWCs supported significantly different fish communities to non-CWC substrata at Rockall Bank, Logachev and the HTS. Single-species analyses using generalised linear mixed models showed that Sebastes sp. was strongly associated with CWCs at Rockall Bank and that Neocyttus helgae was more likely to occur in CWCs at the HTS. Depth had a significant effect on several other fish species. The results of this study suggest that the importance of CWCs to fish is species-specific and depends on the broader spatial context in which the substratum is found. The precautionary approach would be to assume that CWCs are important for associated fish, but must acknowledge that CWCs in different depths will not provide redundancy or replication within spatially-managed conservation networks.

  6. Trophic interactions of the pelagic ecosystem over the Reykjanes Ridge as evaluated by fatty acid and stable isotope analyses

    Science.gov (United States)

    Petursdottir, H.; Gislason, A.; Falk-Petersen, S.; Hop, H.; Svavarsson, J.

    2008-01-01

    Trophic relationships of the important oceanic crustacean species Calanus finmarchicus, Meganyctiphanes norvegica and Sergestes arcticus, as well as the mesopelagic fishes Maurolicus muelleri, Benthosema glaciale and Sebastes mentella, were investigated over the Reykjanes Ridge in June 2003 and in June 2004. Measurements were performed of length, wet weight, dry weight, total lipid, lipid class, fatty acid and fatty alcohol profiles and stable isotopes (δ 13C and δ 15N). High amounts of the Calanus lipid markers, 20:1(n-9) and 22:1(n-11) in these species confirm the importance of Calanus spp. in this ecosystem. Comparisons of fatty acid/alcohol profiles by multivariate analysis revealed two main trophic pathways over the Reykjanes Ridge. In one pathway, Calanus spp. was an important part of the diet for the small mesopelagic fish species M. muelleri and B. glaciale and the shrimp S. arcticus, whereas in the other pathway, the euphausiid M. norvegica was the dominant food for the redfish S. mentella, and Calanus spp. were of less importance. M. muelleri and the smaller B. glaciale feed on C. finmarchicus, whereas the larger B. glaciale and S. arcticus select the larger, deeper-living C. hyperboreus. All investigated species are true pelagic species except for the shrimp S. arcticus, which seems to have a benthic feeding habit as well. The δ 15N levels show that of the species investigated, C. finmarchicus occupies the lowest trophic level (2.0) and the redfish, S. mentella, the highest (4.2). All the species were lipid rich, typical for subarctic pelagic ecosystem. Calanus finmarchicus, S. arcticus and B. glaciale store wax esters as their lipid stores, while M. norvegica, M. muelleri and S. mentella store triacylglycerols.

  7. Dioxins and dioxin-like PCBs in fish in general and in particular from Baltic Sea

    Energy Technology Data Exchange (ETDEWEB)

    Karl, H. [Federal Research Centre for Nutrition and Food, Hamburg (Germany); Ruoff, U. [Federal Research Centre For Nutrition and Food, Kiel (Germany)

    2004-09-15

    Commission Regulation No 466/2001 establishes maximum levels for dioxins in foodstuffs, foreseeing to review the maximum levels by 31 December 2006 and to include dioxin-like PCBs in the levels to be set. Fish is known to accumulate dioxins and dioxin related compounds in the lipid phase of their tissue. To collect information of the actual contamination levels in fish species on the German market, samples were taken from fishing grounds important for the supply and in particular from the Baltic Sea. Sampling concentrates on fish species with higher fat content like mackerel (Scomber scombrus), salmon (Salmo salar), trout (Oncorhynchus mykiss), red fish (Sebastes sp.) and herring (Clupea harengus), because lean fish species are known to be less contaminated. Herring is the most important fat fish species for the German fish processing industry with a market share of 19% in 2001. The annual demand is approximately 149.000 t. Herring and other fish species accumulate PCDD/Fs with increasing age and dioxin levels in the edible part of eastern Baltic herring exceeds the maximum limit of 4 ng WHOPCDD/ F-TEQ/kg wet weight (w.w.) at ages of 4 - 6 years, corresponding to sizes of approximately 17 - 18 cm and a weight of 40 g, respectively. Hence Isosaari recommended to use preferably young fish from this area for human consumption. However, the German herring industry is based on the processing of large herring with a minimum weight of > 85g up to 250g. Therefore our interest focused on herring sizes of potential interest for the German processing industry. Samples were collected in September 1999 within two weeks covering an area from the Skagerrak to the Coast of Latvia. Additionally the contamination levels in sprat (Sprattus sprattus), flounder, brown trout (Salmo trutta) and in spring spawning herring from commercial landings around the area of Ruegen have been analysed.

  8. Variability in abundance of temperate reef fishes estimated by visual census.

    Directory of Open Access Journals (Sweden)

    Alejo J Irigoyen

    Full Text Available Identifying sources of sampling variation and quantifying their magnitude is critical to the interpretation of ecological field data. Yet, most monitoring programs of reef fish populations based on underwater visual censuses (UVC consider only a few of the factors that may influence fish counts, such as the diver or census methodology. Recent studies, however, have drawn attention to a broader range of processes that introduce variability at different temporal scales. This study analyzes the magnitude of different sources of variation in UVCs of temperate reef fishes off Patagonia (Argentina. The variability associated with time-of-day, tidal state, and time elapsed between censuses (minutes, days, weeks and months was quantified for censuses conducted on the five most conspicuous and common species: Pinguipes brasilianus, Pseudopercis semifasciata, Sebastes oculatus, Acanthistius patachonicus and Nemadactylus bergi. Variance components corresponding to spatial heterogeneity and to the different temporal scales were estimated using nested random models. The levels of variability estimated for the different species were related to their life history attributes and behavior. Neither time-of-day nor tidal state had a significant effect on counts, except for the influence of tide on P. brasilianus. Spatial heterogeneity was the dominant source of variance in all but one species. Among the temporal scales, the intra-annual variation was the highest component for most species due to marked seasonal fluctuations in abundance, followed by the weekly and the instantaneous variation; the daily component was not significant. The variability between censuses conducted at different tidal levels and time-of-day was similar in magnitude to the instantaneous variation, reinforcing the conclusion that stochastic variation at very short time scales is non-negligible and should be taken into account in the design of monitoring programs and experiments. The present

  9. Early life history pelagic exposure profiles of selected commercially important fish species in the Gulf of Alaska

    Science.gov (United States)

    Doyle, Miriam J.; Mier, Kathryn L.

    2016-10-01

    A synthesis of nearly four decades of ichthyoplankton survey data from the Gulf of Alaska was undertaken to provide the most comprehensive information available on the early life history ecology of five focal species: Pacific Cod (Gadus macrocephalus), Walleye Pollock (Gadus chalcogrammus), Pacific Ocean Perch (Sebastes alutus), Sablefish (Anoplopoma fimbria), and Arrowtooth Flounder (Atheresthes stomias). This analysis of historical data, along with information from published studies, is presented here in the form of ecological reviews of the species during their planktonic phase. The reviews include descriptions of temporal and spatial patterns of exposure to the environment, and interpretation regarding associated sensitivities to environmental forcing. On a temporal scale, patterns in abundance of eggs and larvae are synthesized that characterize seasonal exposure to the pelagic environment, and interannual variation that is presumed to incorporate responses to long-term environmental forcing. Spatial patterns are synthesized to identify horizontal and vertical extent of egg and larval distributions, delineate areas of primary larval habitat, and illuminate egg and larval drift pathways. The observed patterns are discussed with respect to characterizing species early life history strategies, identifying long-term adaptations to the Gulf of Alaska environment, and associated resilience and vulnerability factors that may modulate early life responses to environmental forcing in this region. For each species, gaps in knowledge are identified and are concerned primarily with the period of transition between the larval and juvenile stage, and feeding habits and ecology across seasons, habitats and sub-intervals of early ontogeny. These early life history reviews advance our ecological understanding of the pelagic phase, and fine-tune our focus for the investigation of potential response mechanisms to environmental forcing at appropriate, species-specific temporal

  10. From sea water to marine organisms; transfer to marine organisms

    International Nuclear Information System (INIS)

    Koyanagi, Taku

    1979-01-01

    As a study on transfer of radioiodine to marine organisms, accumulation and excretion of radioiodine by five species of marine fishes were observed by the aquarium experiments using Na 131 I as the tracer. Transfer of radioiodine to the fishes was examined on three different pathways, via seawater, sediment, and food. Concentration of radioiodine in organs of tissues of sea bass, Lateolabrax japonics, yellow tail, Seriola quinqueradiata, and rock fish, Sebastes nivosus, reared in labeled seawater reached maximum within five to ten days and decreased thereafter. Concentration factors calculated at the fifth day of breeding showed the highest value in gall-bladder followed by gut-content suggesting the secretion of bile into the intestine. Loss of radioactivity from the fishes showed two components elimination patterns and biological half-lives were calculated as 2.8 days and 53.5 days, respectively, in muscle of sea bass, for example. Sediment-bound radioiodine administered to benthic fish, right-eye flounder, Kareius bicoloratus, was lost rapidly after the administration but about ten per cent of the whole-body radioactivity were retained by the fishes after the excretion of sediment and eliminated with longer half-lives comparable to those taken up from seawater. Distribution of radioiodine among organs or tissues of the flounder was different between the fishes before and after the elimination experiment showing rapid loss from gill and slower elimination from liver or muscle. Radioiodine administered to sea bream, Pagrus major, as labeled anchovy was climinated also with two components loss processes and elimination rates were little higher than the fishes administered radioiodine as solution in gelatine capsules. Higher distribution of radioiodine in gill of the sea bream suggested the dominant excretion of radioiodine through gill of the fishes. (author)

  11. Selenium's importance in regulatory issues regarding mercury

    Energy Technology Data Exchange (ETDEWEB)

    Raymond, Laura J.; Ralston, Nicholas V.C. [University of North Dakota Energy and Environmental Research Center, 15 North 23rd Street, Stop 9018, Grand Forks, ND 58202-9018 (United States)

    2009-11-15

    Current seafood safety and health risk assessment criteria use mercury concentrations as their sole basis. This unfortunate limitation omits consideration of selenium, an essential trace element that appears to be the primary molecular target of mercury toxicity. Although selenium has been recognized for decades as a means of counteracting mercury toxicity, its effects have often been overlooked or misunderstood. Experimental animal studies have demonstrated that increasing concentrations of selenium throughout the normal dietary range increasingly counteracts methylmercury toxicity. Dietary concentrations of selenium that are slightly less than the average amount present in ocean fish have been shown to completely prevent the onset of toxic symptoms of mercury toxicity, while animals fed lesser amounts of selenium rapidly sickened and died. Dietary selenium from a variety of sources including ocean fish such as tuna, swordfish, menhaden, and rockfish has been shown to counteract mercury toxicity. Since ocean fish are among the richest sources of dietary selenium, it is important to include selenium concentration measurements in future mercury risk assessments and seafood safety criteria. Mercury:selenium molar ratios in blood provide far more consistent and physiologically meaningful risk assessments. Comprehensive seafood safety criteria such as the Selenium Health Benefit Value enable clear differentiation between seafoods that are safe and those that are hazardous for human consumption. Use of parameters that integrate mercury-selenium relationships also make it easy to understand the differences between the findings of maternal mercury exposure studies that have been performed in New Zealand, the Faroes, the Seychelles, and the United Kingdom. Development of criteria for evaluating mercury-selenium interactions will enhance environmental protection and improve public safety. (author)

  12. Environmental conditions and prey-switching by a seabird predator impact juvenile salmon survival

    Science.gov (United States)

    Wells, Brian K.; Santora, Jarrod A.; Henderson, Mark J.; Warzybok, Pete; Jahncke, Jaime; Bradley, Russell W.; Huff, David D.; Schroeder, Isaac D.; Nelson, Peter; Field, John C.; Ainley, David G.

    2017-01-01

    Due to spatio-temporal variability of lower trophic-level productivity along the California Current Ecosystem (CCE), predators must be capable of switching prey or foraging areas in response to changes in environmental conditions and available forage. The Gulf of the Farallones in central California represents a biodiversity hotspot and contains the largest common murre (Uria aalge) colonies along the CCE. During spring, one of the West Coast's most important Chinook salmon (Oncorhynchus tshawytscha) populations out-migrates into the Gulf of the Farallones. We quantify the effect of predation on juvenile Chinook salmon associated with ecosystem-level variability by integrating long-term time series of environmental conditions (upwelling, river discharge), forage species abundance within central CCE, and population size, at-sea distribution, and diet of the common murre. Our results demonstrate common murres typically forage in the vicinity of their offshore breeding sites, but in years in which their primary prey, pelagic young-of-year rockfish (Sebastesspp.), are less available they forage for adult northern anchovies (Engraulis mordax) nearshore. Incidentally, while foraging inshore, common murre consumption of out-migrating juvenile Chinook salmon, which are collocated with northern anchovy, increases and population survival of the salmon is significantly reduced. Results support earlier findings that show timing and strength of upwelling, and the resultant forage fish assemblage, is related to Chinook salmon recruitment variability in the CCE, but we extend those results by demonstrating the significance of top-down impacts associated with these bottom-up dynamics. Our results demonstrate the complexity of ecosystem interactions and impacts between higher trophic-level predators and their prey, complexities necessary to quantify in order to parameterize ecosystem models and evaluate likely outcomes of ecosystem management options.

  13. Targeting Abundant Fish Stocks while Avoiding Overfished Species: Video and Fishing Surveys to Inform Management after Long-Term Fishery Closures

    Science.gov (United States)

    2016-01-01

    Historically, it has been difficult to balance conservation goals and yield objectives when managing multispecies fisheries that include stocks with various vulnerabilities to fishing. As managers try to maximize yield in mixed-stock fisheries, exploitation rates can lead to less productive stocks becoming overfished. In the late 1990s, population declines of several U.S. West Coast groundfish species caused the U.S. Pacific Fishery Management Council to create coast-wide fishery closures, known as Rockfish Conservation Areas, to rebuild overfished species. The fishery closures and other management measures successfully reduced fishing mortality of these species, but constrained fishing opportunities on abundant stocks. Restrictive regulations also caused the unintended consequence of reducing fishery-dependent data available to assess population status of fished species. As stocks rebuild, managers are faced with the challenge of increasing fishing opportunities while minimizing fishing mortality on rebuilding species. We designed a camera system to evaluate fishes in coastal habitats and used experimental gear and fishing techniques paired with video surveys to determine if abundant species could be caught in rocky habitats with minimal catches of co-occurring rebuilding species. We fished a total of 58 days and completed 741 sets with vertical hook-and-line fishing gear. We also conducted 299 video surveys in the same locations where fishing occurred. Comparison of fishing and stereo-video surveys indicated that fishermen could fish with modified hook-and-line gear to catch abundant species while limiting bycatch of rebuilding species. As populations of overfished species continue to recover along the U.S. West Coast, it is important to improve data collection, and video and fishing surveys may be key to assessing species that occur in rocky habitats. PMID:28002499

  14. Plasma biomarkers in juvenile marine fish provide evidence for endocrine modulation potential of organotin compounds.

    Science.gov (United States)

    Min, Byung Hwa; Kim, Bo-Mi; Kim, Moonkoo; Kang, Jung-Hoon; Jung, Jee-Hyun; Rhee, Jae-Sung

    2018-08-01

    Organotin compounds, such as tributyltin (TBT) and triphenyltin (TPT), have been widely used to control marine fouling. Here, we show that organotin stimulation reduces the hormone levels in the plasma of two economically important aquaculture fish. Blood plasma samples were collected from juvenile red seabream and black rockfish exposed to environmentally realistic concentrations of TBT and TPT for 14 days. The levels of two plasma biomarkers, namely the yolk protein precursor vitellogenin (VTG) and the sex steroid 17β-estradiol (E2), were measured to determine the endocrine disrupting potential of the organotin compounds. Both organotin compounds were dose-dependently accumulated in the blood of two fish. Exposure to waterborne TBT and TBT significantly decreased the plasma VTG levels in both the juvenile fish in a dose-dependent manner. In contrast, the treatment with E2, a well-known VTG inducer, significantly increased the plasma VTG levels in both the fish. In addition, the mRNA levels of vtg were also downregulated in the liver tissues of both the fish at 100 and/or 1000 ng L -1 of TBT or TPT exposure. The plasma E2 titers were significantly suppressed at 100 and/or 1000 ng L -1 of TBT or TPT exposure for 14 days compared to their titer in the control. Since estrogen directly regulates vtg gene expression and VTG synthesis, our results reveal the endocrine disrupting potential of organotin compounds, and subsequently the endocrine modulation at early stage of fish can trigger further fluctuations in sexual differentiation, maturation, sex ration or egg production. In addition, the results demonstrate their effects on non-target organisms, particularly on animals reared in aquaculture and fisheries. Copyright © 2018 Elsevier Inc. All rights reserved.

  15. Participatory groundwater management in Jordan: Development and analysis of options

    Science.gov (United States)

    Chebaane, Mohamed; El-Naser, Hazim; Fitch, Jim; Hijazi, Amal; Jabbarin, Amer

    groundwater basins in Jordan. This participatory management approach would also be useful in other parts of the world that are experiencing similar groundwater over-exploitation problems. La surexploitation des eaux souterraines prend de l'importance en Jordanie. Les demandes en concurrence ont augmenté face à des déficits permanents d'eau, situation qui a été exacerbée par la sécheresse de la dernière décennie. Cet article rend compte de l'aboutissement d'un projet dans lequel des options de gestion portant sur la surexploitation ont été développées pour l'un des principaux systèmes aquifères de Jordanie, le bassin d'Amman Zarqa. Des options pour aborder cette situation ont été développées grâce à une approche participative qui implique des fonctionnaires du gouvernement et des groupes d'intérêts variés des secteurs public et privé. Des efforts particuliers ont été faits pour impliquer les irrigants utilisant des puits, qui sont probablement ceux qui ont le plus fort impact sur les changements attendus permettant de remettre le système en équilibre. À partir des informations obtenues de campagnes rapides d'évaluation, telles que des réunions de communautés et des entrevues avec des experts techniques du gouvernement, un large jeu d'options a été identifié pour l'évaluation. Basées sur une analyse hydrogéologique, sociale et économique, cinq options complémentaires de gestion ont été recommandées pour la réalisation. Ce sont la création d'un Service Consultatif d'Irrigation, achetant les puits agricoles, fixant des limites fermes aux prélèvements des puits et aux zones irriguées, échangeant les eaux usées traitées avec des eaux souterraines, et la mise en place de mesures pour accroître l'efficacité des usages collectifs et industriels. Des combinaisons et des niveaux variés de ces options ont été regroupés en scénarios, présentant les stratégies possibles de mise en œuvre. Les scénarios ont été mis au point

  16. Il dilemma di Gerusalemme. Il problema dello sviluppo urbano tra politica e integrazione delle comunità / Le dilemme de Jérusalem. Le problème du développement urbain entre politique et intégration des communautés / The dilemma of Jerusalem: the question of urban development between politics and integration of the communities

    Directory of Open Access Journals (Sweden)

    Succi Marco

    2012-10-01

    Full Text Available Malgré l’espoir de résoudre de manière équitable la question de la souveraineté de Jérusalem liée à la fin de l’administration britannique et aux plans de partage de la Palestine proposés par l’ONU à la fin de la Seconde Guerre Mondiale, la Ville Sainte a été divisée entre Israël et la Jordanie après la Guerre israélo-arabe de 1948. Elle restera fractionnée jusqu’à la Guerre des Six Jours (1967 quand Israël conquiert la Ville Sainte et étend sa souveraineté sur les terres habitées par les populations arabes, en les annexant quelques années après. Depuis lors, le développement urbain de Jérusalem a subi une expansion sans précédent, soulevant les critiques de la communauté internationale et de l’opinion publique.L’article analyse les politiques relatives à l’expansion urbaine de Jérusalem et la question du rééquilibre démographique entre Arabes et Juifs résultant de décennies de décisions politiques contestées.Quel est le poids des exigences de sécurité et des objectifs politiques liés au conflit israélo-palestinien dans les plans d’urbanisme visant à l’extension de Jérusalem ?Despite the hope to settle the issue of the sovereignty of Jerusalem triggered by the announcement of the end of the British Mandate and the 1947 UN Partition Plan, the Holy City was divided between Israel and Jordan after the first Israeli-Arab war in 1948. No change would alter the status of the city until 1967 (Six-Day War when Israel conquered the whole city and extended its own sovereignty on lands inhabited by Palestinians, proceeding with formal annexation some years later. Since then the Jerusalem development has undergone an unprecedented era of urban expansion, attracting criticism from the whole international community and public opinion. The article analyses the policies underlying the Jerusalem urban development and the demographic balance between Jews and Arabs resulting from controversial political

  17. Raw ready-to-eat seafood safety: microbiological quality of the various seafood species available in fishery, hyper and online markets.

    Science.gov (United States)

    Kim, H W; Hong, Y J; Jo, J I; Ha, S D; Kim, S H; Lee, H J; Rhee, M S

    2017-01-01

    Microbiological quality of 206 raw ready-to-eat seafood samples was investigated according to species (gizzard shad, halibut, rockfish, tuna, oyster and squid) and distribution channels (fishery, hyper and online market). Enumeration of aerobic plate count and total coliforms (TC) and pathogenic bacteria (Bacillus cereus, Staphylococcus aureus and Vibrio parahaemolyticus) was performed, and level of microbiological quality was classified into four groups: satisfactory, acceptable, unsatisfactory and unacceptable. Qualitative analysis was also performed for Escherichia coli and eight foodborne pathogens (B. cereus, E. coli O157:H7, Listeria monocytogenes, Salmonella spp., S. aureus, Vibrio cholerae, V. parahaemolyticus, and Vibrio vulnificus). Raw ready-to-eat seafood products revealed 0·5% at an unsatisfactory level and 4·9% at an unacceptable level due to ≥4 log CFU g -1 of TC in squid and ≥3 log CFU g -1 of V. parahaemolyticus in gizzard shad respectively. Gizzard shad was shown to be potentially hazardous, as its sashimi is eaten with its skin attached. Bacillus cereus, E. coli, S. aureus, V. parahaemolyticus and V. vulnificus were qualitatively detected. Samples from the fishery market showed higher detection rate especially in V. parahaemolyticus (21·6%) and V. vulnificus (1·7%) which indicates the need to improve microbiological safety of raw ready-to-eat seafood products in fishery market. Raw ready-to-eat seafood products like sashimi can be easily contaminated with various bacteria from aquatic environments and human reservoirs, which subsequently bring about a risk in food poisoning due to no heating process before consumption. The results of this study provide comprehensive microbiological data on various species of raw ready-to-eat seafood from various distribution channels. It may contribute to establish reasonable standard and effective strategies to ensure a good microbiological quality of raw ready-to-eat seafood for the

  18. Seasonal monitoring of deep-sea megabenthos in Barkley Canyon cold seep by internet operated vehicle (IOV.

    Directory of Open Access Journals (Sweden)

    Carolina Doya

    Full Text Available Knowledge of the processes shaping deep-sea benthic communities at seasonal scales in cold-seep environments is incomplete. Cold seeps within highly dynamic regions, such as submarine canyons, where variable current regimes may occur, are particularly understudied. Novel Internet Operated Vehicles (IOVs, such as tracked crawlers, provide new techniques for investigating these ecosystems over prolonged periods. In this study a benthic crawler connected to the NEPTUNE cabled infrastructure operated by Ocean Networks Canada was used to monitor community changes across 60 m2 of a cold-seep area of the Barkley Canyon, North East Pacific, at ~890 m depth within an Oxygen Minimum Zone (OMZ. Short video-transects were run at 4-h intervals during the first week of successive calendar months, over a 14 month period (February 14th 2013 to April 14th 2014. Within each recorded transect video megafauna abundances were computed and changes in environmental conditions concurrently measured. The responses of fauna to environmental conditions as a proxy of seasonality were assessed through analysis of abundances in a total of 438 video-transects (over 92 h of total footage. 7698 fauna individuals from 6 phyla (Cnidaria, Ctenophora, Arthropoda, Echinodermata, Mollusca, and Chordata were logged and patterns in abundances of the 7 most abundant taxa (i.e. rockfish Sebastidae, sablefish Anoplopoma fimbria, hagfish Eptatretus stoutii, buccinids (Buccinoidea, undefined small crabs, ctenophores Bolinopsis infundibulum, and Scyphomedusa Poralia rufescens were identified. Patterns in the reproductive behaviour of the grooved tanner crab (Chionnecetes tanneri were also indicated. Temporal variations in biodiversity and abundance in megabenthic fauna was significantly influenced by variabilities in flow velocity flow direction (up or down canyon, dissolved oxygen concentration and month of study. Also reported here for the first time are transient mass aggregations of

  19. Pamięć o granicach. Demarkacyjna produktywność Wodzic w mijackich wsiach Bituše i Ehloec

    Directory of Open Access Journals (Sweden)

    Joanna Rękas

    2016-10-01

    Full Text Available Memory of the borders: The demarcation productivity of Vodici in the Mijaci - inhabited Macedonian villages of Bituše and Ehloec The main aim of this article is to present ways of expressing the inner (religious and exter­nal (ethnic social boundaries of Mijaks, as they appear during the celebration of the festival of Epiphany (Revelation of Lord / Baptism of Christ in the Jordan / Vodici in the villages of Bituše and Ehloec (Western Macedonia. The realization of this goal is based on the notion of the demarcation productivity of Vodici, developed based on Nikita Ilyich Tolstoy’s theory of ritual codes, with its semiotic foundations of Yuri Lotman’s signifying elements; insights concerning the relationship between rituals and social boundaries made by Anthony Cohen and Macin Lubaś; Clifford Geertz’s observations on the ritual ignorance of newly-created urban social patterns; the notions of collective memory of religious groups of Maurice Halbwachs; Paul Connerton’s commemorative ceremonies and the concept of media of memory, developed by Jan Assmann, Astrid Erll and others. The sources of analysis are the results of my fieldwork, i.e. participant observation and in-depth interviews (primary sources, 2012–2014, carried out in the mentioned villages, as well as secondary sources: printed materials, manuscripts, as well as audio and video recordings.   Pamięć o granicach. Demarkacyjna produktywność Wodzic w mijackich wsiach Bituše i Ehloec Podstawowym celem artykułu jest przedstawienie sposobów ekspresji wewnętrznych (różnowierczych i zewnętrznych (etnicznych granic społecznych Mijaków, ujawniających się podczas obchodów święta Epifanii (Objawienie Pańskie/Chrzest Chrystusa w Jordanie/ Wodzice we wsiach Bituše i Ehloec (zachodnia Macedonia. Realizację tego zamierzenia autorka opiera na demarkacyjnej produktywności Wodzic, wypracowanej w oparciu o teorie: kodów obrzędowych Nikity Ilicza Tołstoja z jej

  20. Franz Josef Land: extreme northern outpost for Arctic fishes

    Directory of Open Access Journals (Sweden)

    Natalia V. Chernova

    2014-12-01

    Full Text Available The remote Franz Josef Land (FJL Archipelago is the most northerly land in Eurasia and its fish fauna, particularly in nearshore habitats, has been poorly studied. An interdisciplinary expedition to FJL in summer 2013 used scuba, seines, and plankton nets to comprehensively study the nearshore fish fauna of the archipelago. We present some of the first underwater images for many of these species in their natural habitats. In addition, deep water drop cameras were deployed between 32 and 392 m to document the fish fauna and their associated habitats at deeper depths. Due to its high latitude (79°–82°N, extensive ice cover, and low water temperatures (<0 °C much of the year, the fish diversity at FJL is low compared to other areas of the Barents Sea. Sixteen species of fishes from seven families were documented on the expedition, including two species previously unknown to the region. One Greenland shark, Somniosus microcephalus (Somniosidae, ca. 2 m in length, was recorded by drop camera near Hayes Island at 211 m, and Esipov’s pout, Gymnelus esipovi (Zoarcidae, was collected at Wilton Island at 15 m in a kelp forest. Including the tape-body pout, Gymnelus taeniatus, described earlier from the sub-littoral zone of Kuhn Island, 17 fish species are now known from FJL’s nearshore waters. Species endemic to the Arctic accounted for 75% of the nearshore species observed, followed by species with wider ranges. A total of 43 species from 15 families are known from FJL with the majority of the records from offshore trawl surveys between 110 and 620 m. Resident species have mainly high Arctic distributions, while transient species visit the archipelago to feed (e.g., Greenland shark, and others are brought by currents as larvae and later migrate to spawn grounds in the south (e.g., Atlantic cod Gadus morhua, Capelin Mallotus villosus, Beaked redfish Sebastes mentella. Another species group includes warmer-water fishes that are rare waifs (e

  1. The parasite assemblage in the spiral intestine of the shark Mustelus canis.

    Science.gov (United States)

    Cislo, P R; Caira, J N

    1993-12-01

    no evidence that the 4 species do not occur independently among host individuals. The number of species and number of individuals in M. canis were low when compared to the marine fish Sebastes nebulosus. These values for M. canis more closely resemble values for freshwater fishes. The comparatively much greater host specificity of these tapeworms may at least partially account for this difference. We propose that site specificity may have a phylogenetic component, in a manner similar to that of host specificity.

  2. A Bayesian-Based Approach to Marine Spatial Planning: Evaluating Spatial and Temporal Variance in the Provision of Ecosystem Services Before and After the Establishment Oregon's Marine Protected Areas

    Science.gov (United States)

    Black, B.; Harte, M.; Goldfinger, C.

    2017-12-01

    Participating in a ten-year monitoring project to assess the ecological, social, and socioeconomic impacts of Oregon's Marine Protected Areas (MPAs), we have worked in partnership with the Oregon Department of Fish and Wildlife (ODFW) to develop a Bayesian geospatial method to evaluate the spatial and temporal variance in the provision of ecosystem services produced by Oregon's MPAs. Probabilistic (Bayesian) approaches to Marine Spatial Planning (MSP) show considerable potential for addressing issues such as uncertainty, cumulative effects, and the need to integrate stakeholder-held information and preferences into decision making processes. To that end, we have created a Bayesian-based geospatial approach to MSP capable of modelling the evolution of the provision of ecosystem services before and after the establishment of Oregon's MPAs. Our approach permits both planners and stakeholders to view expected impacts of differing policies, behaviors, or choices made concerning Oregon's MPAs and surrounding areas in a geospatial (map) format while simultaneously considering multiple parties' beliefs on the policies or uses in question. We quantify the influence of the MPAs as the shift in the spatial distribution of ecosystem services, both inside and outside the protected areas, over time. Once the MPAs' influence on the provision of coastal ecosystem services has been evaluated, it is possible to view these impacts through geovisualization techniques. As a specific example of model use and output, a user could investigate the effects of altering the habitat preferences of a rockfish species over a prescribed period of time (5, 10, 20 years post-harvesting restrictions, etc.) on the relative intensity of spillover from nearby reserves (please see submitted figure). Particular strengths of our Bayesian-based approach include its ability to integrate highly disparate input types (qualitative or quantitative), to accommodate data gaps, address uncertainty, and to

  3. Benthic assemblages of mega epifauna on the Oregon continental margin

    Science.gov (United States)

    Hemery, Lenaïg G.; Henkel, Sarah K.; Cochrane, Guy R.

    2018-01-01

    Environmental assessment studies are usually required by a country's administration before issuing permits for any industrial activities. One of the goals of such environmental assessment studies is to highlight species assemblages and habitat composition that could make the targeted area unique. A section of the Oregon continental slope that had not been previously explored was targeted for the deployment of floating wind turbines. We carried out an underwater video survey, using a towed camera sled, to describe its benthic assemblages. Organisms were identified to the lowest taxonomic level possible and assemblages described related to the nature of the seafloor and the depth. We highlighted six invertebrate assemblages and three fish assemblages. For the invertebrates within flat soft sediments areas we defined three different assemblages based on primarily depth: a broad mid-depth (98–315 m) assemblage dominated by red octopus, sea pens and pink shrimps; a narrower mid-depth (250–270 m) assemblage dominated by box crabs and various other invertebrates; and a deeper (310–600 m) assemblage dominated by sea urchins, sea anemones, various snails and zoroasterid sea stars. The invertebrates on mixed sediments also were divided into three different assemblages: a shallow (~100 m deep) assemblage dominated by plumose sea anemones, broad mid-depth (170–370 m) assemblage dominated by sea cucumbers and various other invertebrates; and, again, a narrower mid-depth (230–270 m) assemblage, dominated by crinoids and encrusting invertebrates. For the fish, we identified a rockfish assemblage on coarse mixed sediments at 170–370 m and another fish assemblage on smaller mixed sediments within that depth range (250–370 m) dominated by thornyheads, poachers and flatfishes; and we identified a wide depth-range (98–600 m) fish assemblage on flat soft sediments dominated by flatfishes, eelpouts and thornyheads. Three of these assemblages (the two

  4. Benthic assemblages of mega epifauna on the Oregon continental margin

    Science.gov (United States)

    Hemery, Lenaïg G.; Henkel, Sarah K.; Cochrane, Guy R.

    2018-05-01

    Environmental assessment studies are usually required by a country's administration before issuing permits for any industrial activities. One of the goals of such environmental assessment studies is to highlight species assemblages and habitat composition that could make the targeted area unique. A section of the Oregon continental slope that had not been previously explored was targeted for the deployment of floating wind turbines. We carried out an underwater video survey, using a towed camera sled, to describe its benthic assemblages. Organisms were identified to the lowest taxonomic level possible and assemblages described related to the nature of the seafloor and the depth. We highlighted six invertebrate assemblages and three fish assemblages. For the invertebrates within flat soft sediments areas we defined three different assemblages based on primarily depth: a broad mid-depth (98-315 m) assemblage dominated by red octopus, sea pens and pink shrimps; a narrower mid-depth (250-270 m) assemblage dominated by box crabs and various other invertebrates; and a deeper (310-600 m) assemblage dominated by sea urchins, sea anemones, various snails and zoroasterid sea stars. The invertebrates on mixed sediments also were divided into three different assemblages: a shallow ( 100 m deep) assemblage dominated by plumose sea anemones, broad mid-depth (170-370 m) assemblage dominated by sea cucumbers and various other invertebrates; and, again, a narrower mid-depth (230-270 m) assemblage, dominated by crinoids and encrusting invertebrates. For the fish, we identified a rockfish assemblage on coarse mixed sediments at 170-370 m and another fish assemblage on smaller mixed sediments within that depth range (250-370 m) dominated by thornyheads, poachers and flatfishes; and we identified a wide depth-range (98-600 m) fish assemblage on flat soft sediments dominated by flatfishes, eelpouts and thornyheads. Three of these assemblages (the two broad fish assemblages and the deep

  5. California State Waters Map Series — Offshore of Point Conception, California

    Science.gov (United States)

    Johnson, Samuel Y.; Dartnell, Peter; Cochrane, Guy R.; Hartwell, Stephen R.; Golden, Nadine E.; Kvitek, Rikk G.; Davenport, Clifton W.; Johnson, Samuel Y.; Cochran, Susan A.

    2018-04-20

    about 298° to 241° azimuth. Shelf width ranges from about 5 km south of Point Conception to about 11 km northwest of it; the slope ranges from about 1.0° to 1.2° to about 0.7° south and northwest of Point Conception, respectively. Southwest of Point Conception, the shelf break and upper slope are incised by a 600-m-wide, 20- to 30-m-deep, south-facing trough, one of five heads of the informally named Arguello submarine canyon.The map area is located at a major biogeographic transition zone between the east-west-trending Santa Barbara Channel region of the Southern California Bight and the northwest-trending central California coast. North of Point Conception, the coast is subjected to high wave exposure from the north, west, and south, as well as consistently strong upwelling that brings cold, nutrient-rich waters to the surface. Southeast of Point Conception, the Santa Barbara Channel is largely protected from strong north swells by Point Conception and from south swells by the Channel Islands; surface waters are warmer, and upwelling is weak and seasonal.Seafloor habitats in the broad Santa Barbara Channel region consist of significant amounts of soft, unconsolidated sediment interspersed with isolated areas of rocky habitat that support kelp-forest communities in the nearshore and rocky-reef communities in deeper water. The potential marine benthic habitat types mapped in the Offshore of Point Conception map area are directly related to its Quaternary geologic history, geomorphology, and active sedimentary processes. These potential habitats lie primarily within the Shelf (continental shelf) but also partly within the Flank (basin flank or continental slope) megahabitats. The fairly homogeneous seafloor of sediment and low-relief bedrock provides characteristic habitat for rockfish, groundfish, crabs, shrimp, and other marine benthic organisms. Several areas of smooth sediment form nearshore terraces that have relatively steep, smooth fronts, which are

  6. Mercury in Sediment, Water, and Biota of Sinclair Inlet, Puget Sound, Washington, 1989-2007

    Science.gov (United States)

    Paulson, Anthony J.; Keys, Morgan E.; Scholting, Kelly L.

    2010-01-01

    specimens, and caged mussels. Total mercury concentrations in muscle and liver of English sole from Sinclair Inlet ranked in the upper quarter and third, respectively, of Puget Sound locations. For other species, concentrations from Sinclair Inlet were within the mid-range of locations (for example, Chinook salmon). Total mercury concentrations of the long-lived and higher trophic rockfish in composites and individual specimens from Sinclair Inlet tended to be the highest in Puget Sound. For a given size, sand sole, graceful crab, staghorn sculpin, surf perch, and sea cucumber individuals collected from Sinclair Inlet had higher total mercury concentrations than individuals collected from non-urban estuaries. Total mercury concentrations in individual English sole and ratfish were not significantly different than in individuals of various sizes collected from either urban or non-urban estuaries in Puget Sound. Total mercury concentrations in English sole collected from Sinclair Inlet after the 2000-2001 dredging appear to have lower total mercury concentrations than those collected before (1996) the dredging project. The highest total mercury concentrations of mussels caged in 2002 were not within the Bremerton naval complex, but within the Port Orchard Marina and inner Sinclair Inlet.

  7. California State Waters Map Series—Offshore of Gaviota, California

    Science.gov (United States)

    Johnson, Samuel Y.; Dartnell, Peter; Cochrane, Guy R.; Hartwell, Stephen R.; Golden, Nadine E.; Kvitek, Rikk G.; Davenport, Clifton W.; Johnson, Samuel Y.; Cochran, Susan A.

    2018-04-20

    or continental slope) megahabitats. The fairly homogeneous seafloor of sediment and low-relief bedrock provides characteristic habitat for rockfish, groundfish, crabs, shrimp, and other marine benthic organisms. Several areas of smooth sediment form nearshore terraces that have relatively steep, smooth fronts, which may be attractive to groundfish. Below the steep shelf break, soft, unconsolidated sediment is interrupted by the heads of several submarine canyons and rills, some bedrock exposures, and small carbonate mounds associated with asphalt mounds and pockmarks, also good potential habitat for rockfish. The map area includes the relatively small (5.2 km2) Kashtayit State Marine Conservation Area, which largely occupies the inner part of the Gaviota sediment bar.

  8. Environmental Impact of a Submarine Cable: Case Study of the Acoustic Thermometry of Ocean Climate (ATOC)/ Pioneer Seamount Cable

    Science.gov (United States)

    Kogan, I.; Paull, C. K.; Kuhnz, L.; von Thun, S.; Burton, E.; Greene, H. G.; Barry, J. P.

    2003-12-01

    substrates on the continental shelf whereas much of the cable remains exposed in sediments at deeper depths. The cable is exposed in rocky environments of the nearshore region and on all of Pioneer Seamount. The main biological features associated with the cable were organisms utilizing the cable as substrate and occasionally as shelter. Considerable care was taken to count megafauna in video transects and macrofauna from the top 5 cm of push cores. Few differences were found between cable and control sites at the 95% confidence level. Anemones Metridium farcimen and Stomphia sp. colonized the cable and were more abundant in cable transects at most soft sediment sites. Coarse extrapolation of the transect data suggest that more than 5,000 M. farcimen may live on the continental shelf portion of the cable. Several other species of anemones living on the cable are common along deeper sections of the cable route. Where the cable was buried, the presence of linear rows of sea anemones proved to be a reliable indicator of the cable's position. Flatfish and rockfish apparently congregate near the cable and were as much as 1 order of magnitude more abundant near the cable at some sites.

  9. California State Waters Map Series: offshore of Santa Barbara, California

    Science.gov (United States)

    Johnson, Samuel Y.; Dartnell, Peter; Cochrane, Guy R.; Golden, Nadine E.; Phillips, Eleyne L.; Ritchie, Andrew C.; Greene, H. Gary; Krigsman, Lisa M.; Kvitek, Rikk G.; Dieter, Bryan E.; Endris, Charles A.; Seitz, Gordon G.; Sliter, Ray W.; Erdey, Mercedes D.; Gutierrez, Carlos I.; Wong, Florence L.; Yoklavich, Mary M.; Draut, Amy E.; Hart, Patrick E.; Conrad, James E.; Cochran, Susan A.; Johnson, Samuel Y.; Cochran, Susan A.

    2013-01-01

    and northwest by Point Conception and from the south and southwest by offshore islands and banks. The shelf is underlain by variable amounts of upper Quaternary shelf, estuarine, and fluvial sediments deposited as sea level fluctuated in the late Pleistocene. Seafloor habitats in the broad Santa Barbara Channel region consist of significant amounts of soft sediment and isolated areas of rocky habitat that support kelp-forest communities nearshore and rocky-reef communities in deep water. The potential marine benthic habitat types mapped in the Offshore of Santa Barbara map area are directly related to its Quaternary geologic history, geomorphology, and active sedimentary processes. These potential habitats, which lie within the Shelf (continental shelf) megahabitat, range from soft, unconsolidated sediment to hard sedimentary bedrock. This heterogeneous seafloor provides promising habitat for rockfish, groundfish, crabs, shrimp, and other marine benthic organisms.

  10. California State Waters Map Series--Offshore of Ventura, California

    Science.gov (United States)

    Johnson, Samuel Y.; Dartnell, Peter; Cochrane, Guy R.; Golden, Nadine E.; Phillips, Eleyne L.; Ritchie, Andrew C.; Kvitek, Rikk G.; Greene, H. Gary; Krigsman, Lisa M.; Endris, Charles A.; Seitz, Gordon G.; Gutierrez, Carlos I.; Sliter, Ray W.; Erdey, Mercedes D.; Wong, Florence L.; Yoklavich, Mary M.; Draut, Amy E.; Hart, Patrick E.; Johnson, Samuel Y.; Cochran, Susan A.

    2013-01-01

    Barbara Channel region consist of significant amounts of soft sediment and isolated areas of rocky habitat that support kelp-forest communities nearshore and rocky-reef communities in deep water. The potential marine benthic habitat types mapped in the Offshore of Ventura map area are directly related to its Quaternary geologic history, geomorphology, and active sedimentary processes. These potential habitats lie within the Shelf (continental shelf) megahabitat, dominated by a flat seafloor and substrates formed from deposition of fluvial and marine sediment during sea-level rise. This flat, fairly homogeneous seafloor, composed primarily of unconsolidated sand and mud and local deposits of gravel, cobbles, and pebbles, provides promising habitat for groundfish, crabs, shrimp, and other marine benthic organisms. The only significant interruptions to this homogeneous habitat type are exposures of hard, irregular sedimentary bedrock and coarse-grained sediment where potential habitats for rockfish and related species exist.

  11. California State Waters Map Series: offshore of San Gregorio, California

    Science.gov (United States)

    Cochrane, Guy R.; Dartnell, Peter; Greene, H. Gary; Watt, Janet T.; Golden, Nadine E.; Endris, Charles A.; Phillips, Eleyne L.; Hartwell, Stephen R.; Johnson, Samuel Y.; Kvitek, Rikk G.; Erdey, Mercedes D.; Bretz, Carrie K.; Manson, Michael W.; Sliter, Ray W.; Ross, Stephanie L.; Dieter, Bryan E.; Chin, John L.; Cochran, Susan A.; Cochrane, Guy R.; Cochran, Susan A.

    2014-01-01

    over the last 50 years that is driving an ecosystem shift away from the productive subarctic regime towards a depopulated subtropical environment. Seafloor habitats in the Offshore of San Gregorio map area, which lies within the Shelf (continental shelf) megahabitat, range from significant rocky outcrops that support kelp-forest communities nearshore to rocky-reef communities in deep water. Biological productivity resulting from coastal upwelling supports diverse populations of sea birds such as Sooty Shearwater, Western Gull, Common Murre, Cassin's Auklet, and many other less populous bird species. In addition, an observable recovery of Humpback and Blue Whales has occurred in the area; both species are dependent on coastal upwelling to provide nutrients. The large extent of exposed inner shelf bedrock supports large forests of "bull kelp," which is well adapted for high wave-energy environments. Common fish species found in the kelp beds and rocky reefs include lingcod and various species of rockfish and greenling.

  12. California State Waters Map Series—Offshore of Santa Cruz, California

    Science.gov (United States)

    Cochrane, Guy R.; Dartnell, Peter; Johnson, Samuel Y.; Erdey, Mercedes D.; Golden, Nadine E.; Greene, H. Gary; Dieter, Bryan E.; Hartwell, Stephen R.; Ritchie, Andrew C.; Finlayson, David P.; Endris, Charles A.; Watt, Janet T.; Davenport, Clifton W.; Sliter, Ray W.; Maier, Katherine L.; Krigsman, Lisa M.; Cochrane, Guy R.; Cochran, Susan A.

    2016-03-24

    phylogeographic group of marine fauna may extend beyond to the area offshore of Los Angeles in southern California. The ocean off of central California has experienced a warming over the last 50 years that is driving an ecosystem shift away from the productive subarctic regime towards a depopulated subtropical environment.Biological productivity resulting from coastal upwelling supports populations of Sooty Shearwater, Western Gull, Common Murre, Cassin’s Auklet, and many other less populous bird species. In addition, an observable recovery of Humpback and Blue Whales has occurred in the area; both species are dependent on coastal upwelling to provide nutrients. The large extent of exposed inner shelf bedrock supports large forests of “bull kelp,” which is well adapted for high-wave-energy environments. The kelp beds are the northernmost known habitat for the population of southern sea otters. Common fish species found in the kelp beds and rocky reefs include lingcod and various species of rockfish and greenling.

  13. California State Waters Map Series: offshore of Carpinteria, California

    Science.gov (United States)

    Johnson, Samuel Y.; Dartnell, Peter; Cochrane, Guy R.; Golden, Nadine E.; Phillips, Eleyne L.; Ritchie, Andrew C.; Kvitek, Rikk G.; Greene, H. Gary; Endris, Charles A.; Seitz, Gordon G.; Sliter, Ray W.; Erdey, Mercedes D.; Wong, Florence L.; Gutierrez, Carlos I.; Krigsman, Lisa M.; Draut, Amy E.; Hart, Patrick E.; Johnson, Samuel Y.; Cochran, Susan A.

    2013-01-01

    area probably are remobilized on an annual basis. The shelf is underlain by variable amounts of upper Quaternary shelf, estuarine, and fluvial sediments that thicken to the south. Seafloor habitats in the broad Santa Barbara Channel region consist of significant amounts of soft sediment and isolated areas of rocky habitat that support kelp-forest communities nearshore and rocky-reef communities in deep water. The potential marine benthic habitat types mapped in the Offshore of Carpinteria map area are directly related to its Quaternary geologic history, geomorphology, and active sedimentary processes. These potential habitats lie within the Shelf (continental shelf) megahabitat, dominated by a flat seafloor and substrates formed from deposition of fluvial and marine sediment during sea-level rise. This fairly homogeneous seafloor provides promising habitat for groundfish, crabs, shrimp, and other marine benthic organisms. The only significant interruptions to this homogeneous habitat type are the exposures of hard, irregular, and hummocky sedimentary bedrock and coarse-grained sediment where potential habitats for rockfish and related species exist.

  14. California State Waters Map Series: offshore of Half Moon Bay, California

    Science.gov (United States)

    Cochrane, Guy R.; Dartnell, Peter; Greene, H. Gary; Johnson, Samuel Y.; Golden, Nadine E.; Hartwell, Stephen R.; Dieter, Bryan E.; Manson, Michael W.; Sliter, Ray W.; Ross, Stephanie L.; Watt, Janet T.; Endris, Charles A.; Kvitek, Rikk G.; Phillips, Eleyne L.; Erdey, Mercedes D.; Chin, John L.; Bretz, Carrie K.

    2014-01-01

    area), although its associated phylogeographic group of marine fauna may extend beyond to the area offshore of Los Angeles in southern California. The ocean off central California has experienced a warming over the last 50 years that is driving an ecosystem shift away from the productive subarctic regime towards a depopulated subtropical environment. Seafloor habitats in the Offshore of Half Moon Bay map area, which lies within the Shelf (continental shelf) megahabitat, range from significant rocky outcrops that support kelp-forest communities nearshore to rocky-reef communities in deep water. Biological productivity resulting from coastal upwelling supports populations of sea birds such as Sooty Shearwater, Western Gull, Common Murre, Cassin’s Auklet, and many other less populous bird species. In addition, an observable recovery of Humpback and Blue Whales has occurred in the area; both species are dependent on coastal upwelling to provide nutrients. The large extent of exposed inner shelf bedrock supports large forests of “bull kelp,” which is well adapted for high wave-energy environments. Common fish species found in the kelp beds and rocky reefs include lingcod and various species of rockfish and greenling.

  15. California State Waters Map Series: offshore of Coal Oil Point, California

    Science.gov (United States)

    Johnson, Samuel Y.; Dartnell, Peter; Cochrane, Guy R.; Golden, Nadine E.; Phillips, Eleyne L.; Ritchie, Andrew C.; Kvitek, Rikk G.; Dieter, Bryan E.; Conrad, James E.; Lorenson, T.D.; Krigsman, Lisa M.; Greene, H. Gary; Endris, Charles A.; Seitz, Gordon G.; Finlayson, David P.; Sliter, Ray W.; Wong, Florence L.; Erdey, Mercedes D.; Gutierrez, Carlos I.; Leifer, Ira; Yoklavich, Mary M.; Draut, Amy E.; Hart, Patrick E.; Hostettler, Frances D.; Peters, Kenneth E.; Kvenvolden, Keith A.; Rosenbauer, Robert J.; Fong, Grace; Johnson, Samuel Y.; Cochran, Susan A.

    2014-01-01

    processes. These potential habitats, which lie primarily within the Shelf (continental shelf) but also partly within the Flank (basin flank or continental slope) megahabitats, range from soft, unconsolidated sediment to hard sedimentary bedrock. This heterogeneous seafloor provides promising habitat for rockfish, groundfish, crabs, shrimp, and other marine benthic organisms.

  16. California State Waters Map Series—Offshore of Monterey, California

    Science.gov (United States)

    Johnson, Samuel Y.; Dartnell, Peter; Hartwell, Stephen R.; Cochrane, Guy R.; Golden, Nadine E.; Watt, Janet T.; Davenport, Clifton W.; Kvitek, Rikk G.; Erdey, Mercedes D.; Krigsman, Lisa M.; Sliter, Ray W.; Maier, Katherine L.; Johnson, Samuel Y.; Cochran, Susan A.

    2016-08-18

    swells from the northwest throughout the year. Wave heights range from 2 to 10 m, the larger swells occurring from October to May. During El Niño–Southern Oscillation (ENSO) events, winter storms track farther south than they do in normal (non-ENSO) years, thereby impacting the map area more frequently and with waves of larger heights.Benthic species observed in the map area are natives of the cold-temperate biogeographic zone that is called either the “Oregonian province” or the “northern California ecoregion.” This biogeographic province is maintained by the long-term stability of the southward-flowing California Current, the eastern limb of the North Pacific subtropical gyre that flows from southern British Columbia to Baja California.Biological productivity resulting from coastal upwelling supports populations of Sooty Shearwater, Western Gull, Common Murre, Cassin’s Auklet, and many other less populous bird species. An observable recovery of Humpback and Blue Whales has occurred in the area; both species are dependent on coastal upwelling to provide nutrients. The large extent of exposed inner shelf bedrock supports large forests of “bull kelp,” which is well adapted for high-wave-energy environments. The kelp beds are well-known habitat for the population of southern sea otters. Common fish species found in the kelp beds and rocky reefs include lingcod and various species of rockfish and greenling.