C and C* among intermediate rings
Sack, J.; Watson, S.
2014-01-01
Given a completely regular Hausdorff space X, an intermediate ring A(X) is a ring of real valued continuous functions between C*(X) and C(X). We discuss two correspondences between ideals in A(X) and z-filters on X, both reviewing old results and introducing new results. One correspondence, ZA,
Recent Advances in Ring-Opening Functionalization of Cycloalkanols by C-C σ-Bond Cleavage.
Wu, Xinxin; Zhu, Chen
2018-06-01
Cycloalkanols prove to be privileged precursors for the synthesis of distally substituted alkyl ketones and polycyclic aromatic hydrocarbons (PAHs) by virtue of cleavage of their cyclic C-C bonds. Direct functionalization of cyclobutanols to build up other chemical bonds (e. g., C-F, C-Cl, C-Br, C-N, C-S, C-Se, C-C, etc.) has been achieved by using the ring-opening strategy. Mechanistically, the C-C cleavage of cyclobutanols can be involved in two pathways: (a) transition-metal catalyzed β-carbon elimination; (b) radical-mediated 'radical clock'-type ring opening. The recent advances of our group for the ring-opening functionalization of tertiary cycloalkanols are described in this account. © 2018 The Chemical Society of Japan & Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Bollini, C G; Giambiagi, M
2001-01-01
Through the graphical method proposed it is possible to set a link between an MO multicenter bond index and VB structures. The value of the index depends on the order of the atoms involved if they are more than three. For 5-c rings three basic structures are required; the eventually different values are 12. Unlike the 6-c case it may happen that different pairs of basic structures are used to build the same polygon. For the 6-c rings including heteroatoms the original degeneracy of benzene splits leading eventually to 60 different I sub r sub i sub n sub g values.
AMS 14C measurements for tree-ring samples from Japanese woods from 4c AD to 8c AD
International Nuclear Information System (INIS)
Ozaki, Hiromasa; Sakamoto, Minoru; Imamura, Mineo; Mitsutani, Takumi
2010-01-01
Regional offsets of atmospheric 14 C concentration, as represented by differences from IntCal calibration datasets, are discussed at times in relation to universal use of international radiocarbon calibration curve. In the construction of IntCal, 14 C contents of contemporaneous tree-ring samples from different regions in the northern hemisphere have been used, because the regional differences were indistinguishable from errors of measurements. Nowadays, high-precision 14 C results can be obtained much more easily than before, so more attention should be paid to the possible regional offsets. Most parts of IntCal has been constructed by using 14 C contents of tree-ring samples from woods in high latitude of Europe and North America, which are farthest from Japan in the northern hemisphere. So far, we have measured 14 C contents of tree-ring samples from Japanese wood samples dendrochronologically dated from 11th century BC to 4th century AD in order to investigate regional offset in Japan. Although the obtained results agreed well with IntCal in general, there were some periods when the 14 C contents differ significantly from IntCal. In this paper, we report the new results of AMS 14 C measurement for Japanese tree-ring samples ranging from 4th century AD to 8th century AD. The results show a significant disagreement with IntCal at around 630 AD. Similar difference was indicated by 14 C contents of tree-ring samples from other Japanese woods (Imamura et al., 2007). So it is certain that the regional offset in Japan exists at around 630 AD. (author)
International Nuclear Information System (INIS)
Bollini, Carlos Guido; Giambiagi, Mario; Giambiagi, Myriam Segre de; Figueiredo, Aloysio Paiva de
2001-02-01
Through the graphical method proposed it is possible to set a link between an MO multicenter bond index and VB structures. The value of the index depends on the order of the atoms involved if they are more than three. For 5-c rings three basic structures are required; the eventually different values are 12. Unlike the 6-c case it may happen that different pairs of basic structures are used to build the same polygon. For the 6-c rings including heteroatoms the original degeneracy of benzene splits leading eventually to 60 different I ring values. (author)
C59N+ and C69N+: isoelectronic heteroanalogues of C60 and C70
International Nuclear Information System (INIS)
Lamparth, I.; Nuber, B.; Schick, G.; Skiebe, A.; Groesser, T.; Hirsch, A.
1995-01-01
Fragmentation reactions in the mass spectrometer were used to generate the first characterized nitrogen heterofullerene ions C 59 N + and C 69 N + from regioselectively synthesized oligoiminofullerenes. During this process one carbon atom in the fullerene core is removed and replaced with a nitrogen atom. C 59 N + has almost the same structure as the isoelectronic C 60 . (orig.)
Absence of torsion for NK_1(R) over associative rings
Basu, Rabeya
2010-01-01
When R is a commutative ring with identity, and if k is a natural number with kR = R, then C. Weibel proved that SK_1(R[X]) has no k-torsion. We reprove his result for any associative ring R with identity in which kR = R.
Synthesis of ring-13C-labelled and ring-demethylated retinals
International Nuclear Information System (INIS)
Courtin, J.M.L.
1988-01-01
Efficient synthetic schemes are described for the preparation of the required mono- and di- 13 C labelled retinals based on simple 13 C labelled starting materials. Results from solid-state 13 C-NMR spectroscopic studies of the various ring- 13 C labelled bacteriorhodopsins and rhodopsins are discussed. 404 refs.; 74 figs.; 16 tabs
Energy Technology Data Exchange (ETDEWEB)
Steenkamp, J A
1986-06-01
This thesis comprises besides the characterisation of new oligomeric flavenoids from the core wood of the indigeneous Colophosphermum mopane, an investigation into the C/sub 4/-functionalisation of flavan-3-ol analogues. The first peltogynoid biflavenoid and prototypes of a new series C-ring isomerised condensed tannins, namely the phlobatannins, were isolated. Besides /sup 1/H- nmr-parameters for structure analysis, the natural phlobatannins were characterised and the unique ring isomerisation was investigated.
International Nuclear Information System (INIS)
Narayan, R.; Chang, C-j.
1982-01-01
[2- 13 C, 2- 14 C]2-Aminoethanol hydrochloride was prepared in good yield from Na*CN in a two step sequence by first converting the Na*CN to OHCH 2 *CN and then reducing the nitrile directly with a solution of borane-tetrahydrofuran complex. The reaction procedure was simple and the pure product could be obtained readily. Using this specifically labelled precursor, the synthesis of [1- 13 C, 1- 14 C]2-chloroethylamine hydrochloride, N-([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(CNU) and N,N'-bis([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(BCNU) in good yield without isotope scrambling was also reported. (author)
International Nuclear Information System (INIS)
Long, A.; Leavitt, S.W.
1982-07-01
Analysis of delta 13 C in tree rings offers the potential for reconstructing changes in delta 13 C of atmospheric CO 2 , which combined with 14 C trends will be important in evaluating the past and present role of the biosphere as a net carbon dioxide source or sink. One problem with such tree-ring delta 13 C records is that in addition to changes in atmospheric delta 13 C, climatic factors may influence the isotopic composition of the rings. This study examines delta 13 C in cellulose of five-year intervals of juniper tree rings. The sampling sites were near weather stations for which climate data are readily available. delta 13 C vs winter climate relationships were derived from those sites not under the influence of local pollution sources. These relationships facilitated development of a delta 13 C record from which climate effects have been factored out. The resulting 1930-1979 delta 13 C reconstruction shows a pronounced delta 13 C decrease from 1930 to 1960 and then a post-1960 flattening of the curve. We interpret this trend as representing an increasing role of biospheric CO 2 sinks relative to sources, although other interpretations may be possible within the limits of precision of data analysis. Research with this technique is continuing with pinyon pine and dendroclimatological reconstructions to verify these results and to develop a climate-free delta 13 C chronology back to pre-industrial time
Energy Technology Data Exchange (ETDEWEB)
Brumovska, Eva [University of South Bohemia and Biology Centre AS CR v.v.i., Faculty of Science (Czech Republic); Sychrovsky, Vladimir; Vokacova, Zuzana [Institute of Organic Chemistry and Biochemistry, AS CR v.v.i. (Czech Republic); Sponer, Jiri [Institute of Biophysics, AS CR v.v.i. (Czech Republic); Schneider, Bohdan [Biotechnological Institute AS CR (Czech Republic); Trantirek, Lukas [University of South Bohemia and Biology Centre AS CR v.v.i., Faculty of Science (Czech Republic)], E-mail: trant@paru.cas.cz
2008-11-15
Density functional theory was employed to study the dependence of {sup 13}C and {sup 15}N magnetic shielding tensors on the glycosidic torsion angle ({chi}) and conformation of the sugar ring in 2'-deoxyadenosine, 2'-deoxyguanosine, 2'-deoxycytidine, and 2'-deoxythymidine. In general, the magnetic shielding of the glycosidic nitrogens and the sugar carbons was found to depend on both the conformation of the sugar ring and {chi}. Our calculations indicate that the magnetic shielding anisotropy of the C6 atom in pyrimidine and the C8 atom in purine bases depends strongly on {chi}. The remaining base carbons were found to be insensitive to both sugar pucker and {chi} re-orientation. These results call into question the underlying assumptions of currently established methods for interpreting residual chemical shift anisotropies and {sup 13}C and {sup 15}N auto- and cross-correlated relaxation rates and highlight possible limitations of DNA applications of these methods.
Directory of Open Access Journals (Sweden)
H. Hernández Herrera
2004-09-01
Full Text Available En el presente trabajo se aplica la Teoría de la Torsión de Perfiles de Paredes Delgadas para el cálculo de las tensiones enlas uniones soldadas con costuras de filete en perfiles de configuración geométrica compleja sometidas a torsión. Seobtienen nuevas expresiones para el cálculo de las tensiones cuyos resultados se aproximan mejor que las expresionesclásicas con relación a los resultados obtenidos por el Método de los Elementos Finitos.Palabras claves: Torsión, uniones soldadas, soldadura de filete._______________________________________________________________________________Abstract.In this paper, the Thin Walled profiles Torsion Theory is applied to calculation of torsional shear stresses of complex geometryprofiles welded joints fillets. New calculation expressions are obtained that allowed to obtain a better aproach than the classicexpressions in relation to the values obtained by the Finite Elements Method.Key words: Torsion, welded joints, welding fillets.
Aromatization of n-octane over Pd/C catalysts
Yin, Mengchen; Natelson, Robert H.; Campos, Andrew A.; Kolar, Praveen; Roberts, William L.
2013-01-01
Gas-phase aromatization of n-octane was investigated using Pd/C catalyst. The objectives were to: (1) determine the effects of temperature (400-600 °C), weight hourly space velocity (WHSV) (0.8-∞), and hydrogen to hydrocarbon molar ratio (MR) (0-6) on conversion, selectivity, and yield (2) compare the activity of Pd/C with Pt/C and Pt/KL catalysts and (3) test the suitability of Pd/C for aromatization of different alkanes including n-hexane, n-heptane, and n-octane. Pd/C exhibited the best aromatization performance, including 54.4% conversion and 31.5% aromatics yield at 500 °C, WHSV = 2 h-1, and a MR of 2. The Pd/C catalyst had higher selectivity towards the preferred aromatics including ethylbenzene and xylenes, whereas Pt/KL had higher selectivity towards benzene and toluene. The results were somewhat consistent with adsorbed n-octane cyclization proceeding mainly through the six-membered ring closure mechanism. In addition, Pd/C was also capable of catalyzing aromatization of n-hexane and n-heptane. © 2012 Elsevier Ltd. All rights reserved.
Hernán-Gómez, Alberto; Kennedy, Alan R; Hevia, Eva
2017-06-01
Combining alkali-metal-mediated metalation (AMMM) and N-heterocyclic carbene (NHC) chemistry, a novel C-N bond activation and ring-opening process is described for these increasingly important NHC molecules, which are generally considered robust ancillary ligands. Here, mechanistic investigations on reactions of saturated NHC SIMes (SIMes=[:C{N(2,4,6-Me 3 C 6 H 2 )CH 2 } 2 ]) with Group 1 alkyl bases suggest this destructive process is triggered by lateral metalation of the carbene. Exploiting co-complexation and trans-metal-trapping strategies with lower polarity organometallic reagents (Mg(CH 2 SiMe 3 ) 2 and Al(TMP)iBu 2 ), key intermediates in this process have been isolated and structurally defined. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Challenges in Switching SiC MOSFET without Ringing
DEFF Research Database (Denmark)
Li, Helong; Munk-Nielsen, Stig
2014-01-01
Switching SiC MOSFET without ringing in high frequency applications is important for meeting the EMI (ElectroMagnetic Interference) standard. Achieving a clean switching waveform of SiC MOSFET without additional components is becoming a challenge. In this paper, the switching oscillation mechanis...
Development of stress relaxation measurement by a small size C-ring specimen method
International Nuclear Information System (INIS)
Shimanuki, Shizuka; Nakata, Kiyotomo; Kasahara, Shigeki; Kuniya, Jiro
2002-01-01
A stress relaxation measurement method has been developed by using C-ring specimens, and a specimen size effect has been evaluated taking radiation-induced stress relaxation into consideration. C-ring specimens were stressed by forcing a wedge in the gap. Giving an appropriate eccentric configuration in the half of the ring opposite the gap, the stress gradient along the circumference was eliminated in the section and the stress level could be varied by changing the gap spacing. The validity of the C-ring test method was confirmed by thermally stress relaxation experiments at annealing temperatures from 300 to 600degC for 1 min to 200 h in carbon steel: considerable stress relaxation could be measured for all levels of applied stress even at relatively low annealing temperatures. The relaxation results obtained from the C-ring test were in good agreement with those from a uniaxial tensile stress relaxation test. The smaller C-ring specimen with about 40 mm diameter, which is required for radiation-induced stress relaxation test, also showed adequate accuracy on stress relaxation at 600 to 830degC in stainless steel, compared with the large size C-ring specimen test. (author)
CESR-c Performance of a Wiggler-Dominated Storage Ring
Temnykh, Alexander
2005-01-01
CESR-c operates now as a Wiggler-Dominated Storage Ring extending the lowest operating energy to 1.5GeV/beam. To improve beam stability at low energy, 12 super-ferric wiggler magnets with total length of 15m and 2.1T maximum field were installed in the ring. They cause ~90% of total beam radiation lost and increase radiation damping rate by factor 10 from ~3 to 40 Hz. However, the field of the wiggler magnets not only initiates the radiation, but potentially affects beam dynamics. The latter was an issue of a great concern from the planning the CESR-c project. In this paper we describe general performance of CESR-c and report the results of an experimental study on some aspects of beam dynamics. Comparisons are made between the experimental data and the model prediction. We find that all parameters, which are critically dependent on wigglers, such as beam properties and ring nonlinearity, are in good agreement with those calculated from the model. This validates the ring and wiggler models and justifies our d...
Atmospheric 14C variations derived from tree rings during the early Younger Dryas
Hua, Quan; Barbetti, Mike; Fink, David; Kaiser, Klaus Felix; Friedrich, Michael; Kromer, Bernd; Levchenko, Vladimir A.; Zoppi, Ugo; Smith, Andrew M.; Bertuch, Fiona
2009-12-01
Atmospheric radiocarbon variations over the Younger Dryas interval, from ˜13,000 to 11,600 cal yr BP, are of immense scientific interest because they reveal crucial information about the linkages between climate, ocean circulation and the carbon cycle. However, no direct and reliable atmospheric 14C records based on tree rings for the entire Younger Dryas have been available. In this paper, we present (1) high-precision 14C measurements on the extension of absolute tree-ring chronology from 12,400 to 12,560 cal yr BP and (2) high-precision, high-resolution atmospheric 14C record derived from a 617-yr-long tree-ring chronology of Huon pine from Tasmania, Australia, spanning the early Younger Dryas. The new tree-ring 14C records bridge the current gap in European tree-ring radiocarbon chronologies during the early Younger Dryas, linking the floating Lateglacial Pine record to the absolute tree-ring timescale. A continuous and reliable atmospheric 14C record for the past 14,000 cal yr BP including the Younger Dryas is now available. The new records indicate that the abrupt rise in atmospheric Δ 14C associated with the Younger Dryas onset occurs at ˜12,760 cal yr BP, ˜240 yrs later than that recorded in Cariaco varves, with a smaller magnitude of ˜40‰ followed by several centennial Δ 14C variations of 20-25‰. Comparing the tree-ring Δ 14C to marine-derived Δ 14C and modelled Δ 14C based on ice-core 10Be fluxes, we conclude that changes in ocean circulation were mainly responsible for the Younger Dryas onset, while a combination of changes in ocean circulation and 14C production rate were responsible for atmospheric Δ 14C variations for the remainder of the Younger Dryas.
Trends of 13C/12C ratios in pinyon tree rings of the American Southwest and the global carbon cycle
International Nuclear Information System (INIS)
Leavitt, S.W.; Long, A.
1986-01-01
An accurate atmospheric 13 C/ 12 C chronology can provide important constraints to models of the global carbon cycle. Trees accumulate carbon from atmospheric CO 2 into growth rings and offer potential for 13 C/ 12 C reconstructions, but results have not been reproducible. This paper presents δ 13 C curves from 5 sites, representing 20 pinyon (Pinus edulis) trees, where cores of 4 trees from each site have been pooled into a composite sample. Isotopic analysis of cellulose in 5-yr ring groups produces curves with a general trend of decreasing δ 13 C after 1800, but with pronounced short-term fluctuations superimposed upon the trend. Evidence indicates the fluctuations are strongly related to moisture availability (drought). A mean curve of the 5 δ 13 C chronologies from which the fossil-fuel component is subtracted suggests a substantial biospheric CO 2 contribution to the atmosphere since 1800
Complete fusion of the 12C+12O, 14N+12C and 15N+12C systems
International Nuclear Information System (INIS)
Conjeaud, M.; Gary, S.; Harar, S.; Wieleczko, J.P.
1978-01-01
Cross sections for evaporation residues following the complete fusion of the 12 C+ 12 C, 14 N+ 12 C and 15 N+ 12 C systems have been measured with a E-ΔE counter telescope in a wide range of incident energies. They are fairly well reproduced by evaporation calculations based on the statistical theory. The total fusion excitation function of the 12 C+ 12 C system shows strong structure, which is compared to the predictions of the reaction cross sections derived from coupled channel calculations and to the integrated inelastic cross sections. Critical angular momenta have been obtained from the fusion cross-section data and these values are discussed in the framework of compound nucleus and entrance channel effects. A striking difference is observed between the fusion cross sections of the 14 N+ 12 C and 15 N+ 12 C systems and shows the importance of the valence nucleons of colliding ions in the fusion process. A possible interpretation might be the influence of the yrast line of the compound nuclei. (Auth.)
Tomlinson, G; Siegwolf, R T W; Buchmann, N; Schleppi, P; Waldner, P; Weber, P
2014-06-15
The use of stable nitrogen (N) isotope ratios (δ(15)N values) in dendroecological studies is often preceded by an extraction procedure using organic solvents to remove mobile N compounds from tree-rings. Although these mobile N compounds may be capable of distorting potential environmental signals in the tree-ring δ(15)N values, recent investigations question the necessity of such an extraction. We used an on-going experiment with simulated elevated N deposition previously labelled with (15)N, in conjunction with control trees, to investigate the necessity of extracting mobile N compounds (using a rapid extraction procedure) for tree-ring δ(15)N and δ(13)C studies, as well as N and C concentration analyses. In addition, we examined the magnitude of radial redistribution of N across tree-rings of Norway spruce (Picea abies). The (15)N label, applied in 1995/96, was found in tree-rings as far back as 1951, although the increased N availability did not cause any significant relative increase in tree growth. The rapid extraction procedure had no significant effect on tree-ring δ(15)N or δ(13)C values in either labelled or control trees, or on N concentration. The C concentrations, however, were significantly higher after extraction in control samples, with the opposite effect observed in labelled samples. Our results indicate that the extraction of mobile N compounds through the rapid extraction procedure is not necessary prior to the determination of Norway spruce δ(15)N or δ(13)C values in dendrochemical studies. δ(15)N values, however, must be interpreted with great care, particularly when used as a proxy for the N status of trees, due to the very high mobility of N within the tree stem sapwood of Norway spruce over several decades. Copyright © 2014 John Wiley & Sons, Ltd.
Continuous recrystallization and mechanical properties of a C45 steel after high pressure torsion
Energy Technology Data Exchange (ETDEWEB)
Haddad, Mike; Fecht, Hans [Institute of Micro and Nanomaterials, University of Ulm, Ulm, Gemany (Germany); Institute of Nanotechnology, Karlsruhe Institut of Technology, Karlsruhe (Germany); Ning, Jiang Li; Ivanisenko, Yulia [Institute of Nanotechnology, Karlsruhe Institut of Technology, Karlsruhe (Germany); Hoermann, Ute [Central Facility for Electron Microscopy, University of Ulm, Ulm (Germany); Murashkin, Maxim [IPAM, Ufa State Aviation Technical University, Ufa (Russian Federation)
2011-07-01
An initial microstructure of C45 steel (Fe, 0.42-0.5% C, 0.5-0.8% Mn, <0.4% Si, <0.045% S, 0.045% P * All in wt%) was modified from ferritic-pearlitic to bainitic through heating at 900 C for 1 hour and quenching in a lead bath at 500 C for 30 min. The steel was processed by High Pressure Torsion (HPT) at room temperature for 3 and 5 rotations, which led to an ultrafine or nano-scale grained structure. Then the material was annealed at 400 C and 450 C for two hours, respectively. TEM observation showed that continuous recrystallization occurred during the annealing. The yield strength and elongation after annealing at 400 C and 450 C were 1277 MPa, 3%, and 1100 MPa, 11%, respectively. Compared with the mechanical properties before annealing, it was revealed that the continuous recrystallization during annealing led to an enhancement of the ductility, but without sacrificing much of the strength. Funding by the Deutsche Forschungsgemeinschaft and Russian Foundation for basic research is gratefully aknowledged.
Positron Options for the Linac-Ring LHeC
Zimmermann, F; Papaphilippou, Y; Schulte, D; Sievers, P; Rinolfi, L; Variola, A; Zomer, F; Braun, H H; Yakimenko, V; Bulyak, E V; Klein, M
2012-01-01
The full physics program of a future Large Hadron electron Collider (LHeC) [1] requires both pe+ and pe− collisions. For a pulsed 140-GeV or an ERL-based 60-GeV Linac-Ring LHeC this implies a challenging rate of, respectively, about 1.8 × 1015 or 4.4 × 1016 e+/s at the collision point, which is about 300 or 7000 times the rate previously obtained, at the SLAC Linear Collider (SLC). We consider providing this e+ rate through a combination of measures: (1) Reducing the required production rate from the e+ target through colliding e+ (and the LHC protons) several times before deceleration, by reusing the e+ over several acceleration/deceleration cycles, and by cooling them, e.g., with a compact tri-ring scheme or a conventional damping ring in the SPS tunnel. (2) Using an advanced target, e.g., W-granules, rotating wheel, slicedrod converter, or liquid metal jet, for converting gamma rays to e+. (3) Selecting the most powerful of several proposed gamma sources, namely Compton ERL, Compton storage ring, coher...
The synthesis of 2-14C-N-nitrosothiazolidine
International Nuclear Information System (INIS)
Cragin, D.W.; Shibamoto, Takayuki
1989-01-01
2- 14 C-N-Nitrosothiazolidine was synthesized with a chemical purity of 99.6%, a radio chemical purity of 99.4%, and an overall yield of 30.7%. Unlabelled N-nitrosothiazolidine, synthesized using the same method, resulted in a purity of 99.85% by capillary GC and 99.7% by HPLC. Analysis of N-nitrosothiazolidine by GC was found to require a low injection port temperature of 160 0 C to prevent denitrosation in the injection port. During the nitrosation of thiazolidine, if the pH was reduced below 4 with hydrochloric acid, ring hydrolysis occurred, and chlorinated disulfide compounds formed. (author)
''C-ring'' stress corrosion cracking scoping experiment for Zircaloy spent fuel cladding
International Nuclear Information System (INIS)
Smith, H.D.
1986-03-01
This document describes the purpose and execution of the stress corrosion cracking scoping experiment using ''C-ring'' cladding specimens. The design and operation of the ''C-ring'' stressing apparatus is described and discussed. The experimental procedures and post-experiment sample evaluation are described
Interaction Region Design for a Ring-Ring LHeC
Thompson, L N S; Bernard, N R; Fitterer, M; Holzer, B; Klein, M; Kostka, P
2011-01-01
tively low energy and moderately high intensity provides high luminosity TeV-scale e-p collisions at one of the LHC interaction points, running simultaneously with existing experiments. Two designs are studied; an electron ring situated in the LHC tunnel, and an electron linac. The focus of this paper is on the ring design. Designing an e-p machine presents interesting accelerator physics and design challenges, particularly when considering the interaction region. These include coupled optics, beam separation and unconventional mini-beta focusing schemes. Designs are constrained by an array of interdependent factors, including beam-beam interaction, detector dimensions and acceptance, luminosity and synchrotron radiation. Methods of addressing these complex issues are discussed. The current designs for the LHeC Ring-Ring interaction region and long straight section are presented and discussed, in the context of the project goals and design challenges encountered. Future developments and work are also discusse...
International Nuclear Information System (INIS)
Chair, N.; Dobrev, V.K.; Kanno, H.
1992-01-01
We consider BRST quantized 2D gravity coupled to conformal matter with arbitrary central change c M = c(p,q) M = 1 chiral ground ring. We show that the ring structure generated by the (relative BRST cohomology) discrete states in the (matter x Liouville x ghosts) Fock module may be obtained by this rotation. We give also explicit formulae for the discrete states. For some of them we use new formulae for c<1 Fock modules singular vectors which we present in terms of Schur polynomials generalizing the c = 1 expressions of Goldstone, while the rest of the discrete states we obtain by finding the proper SO(2,C) rotation. Our formulae give the extra physical states (arising from the relative BRST cohomology) on the boundaries of the p x q rectangles of the conformal lattice and thus all such states in (1,q) or (p,1) models. (author). 24 refs
Tsumoto, Kouhei; Yokota, Akiko; Tanaka, Yoshikazu; Ui, Mihoko; Tsumuraya, Takeshi; Fujii, Ikuo; Kumagai, Izumi; Nagumo, Yoko; Oguri, Hiroki; Inoue, Masayuki; Hirama, Masahiro
2008-05-02
To address how proteins recognize polyether toxin compounds, we focused on the interaction between the ABC ring compound of ciguatoxin 3C and its specific antibody, 1C49. Surface plasmon resonance analyses indicated that Escherichia coli-expressed variable domain fragments (Fv) of 1C49 had the high affinity constants and slow dissociation constants typical of antigen-antibody interactions. Linear van't Hoff analyses suggested that the interaction is enthalpy-driven. We resolved the crystal structure of 1C49 Fv bound to ABC ring compound of ciguatoxin 3C at a resolution of 1.7A. The binding pocket of the antibody had many aromatic rings and bound the antigen by shape complementarity typical of hapten-antibody interactions. Three hydrogen bonds and many van der Waals interactions were present. We mutated several residues of the antibody to Ala, and we used surface plasmon resonance to analyze the interactions between the mutated antibodies and the antigen. This analysis identified Tyr-91 and Trp-96 in the light chain as hot spots for the interaction, and other residues made incremental contributions by conferring enthalpic advantages and reducing the dissociation rate constant. Systematic mutation of Tyr-91 indicated that CH-pi and pi-pi interactions between the aromatic ring at this site and the antigen made substantial contributions to the association, and van der Waals interactions inhibited dissociation, suggesting that aromaticity and bulkiness are critical for the specific recognition of polyether compounds by proteins.
C(α) torsion angles as a flexible criterion to extract secrets from a molecular dynamics simulation.
Victor Paul Raj, Fredrick Robin Devadoss; Exner, Thomas E
2014-04-01
Given the increasing complexity of simulated molecular systems, and the fact that simulation times have now reached milliseconds to seconds, immense amounts of data (in the gigabyte to terabyte range) are produced in current molecular dynamics simulations. Manual analysis of these data is a very time-consuming task, and important events that lead from one intermediate structure to another can become occluded in the noise resulting from random thermal fluctuations. To overcome these problems and facilitate a semi-automated data analysis, we introduce in this work a measure based on C(α) torsion angles: torsion angles formed by four consecutive C(α) atoms. This measure describes changes in the backbones of large systems on a residual length scale (i.e., a small number of residues at a time). Cluster analysis of individual C(α) torsion angles and its fuzzification led to continuous time patches representing (meta)stable conformations and to the identification of events acting as transitions between these conformations. The importance of a change in torsion angle to structural integrity is assessed by comparing this change to the average fluctuations in the same torsion angle over the complete simulation. Using this novel measure in combination with other measures such as the root mean square deviation (RMSD) and time series of distance measures, we performed an in-depth analysis of a simulation of the open form of DNA polymerase I. The times at which major conformational changes occur and the most important parts of the molecule and their interrelations were pinpointed in this analysis. The simultaneous determination of the time points and localizations of major events is a significant advantage of the new bottom-up approach presented here, as compared to many other (top-down) approaches in which only the similarity of the complete structure is analyzed.
International Nuclear Information System (INIS)
Steenkamp, J.A.
1986-06-01
This thesis comprises besides the characterisation of new oligomeric flavenoids from the core wood of the indigeneous Colophosphermum mopane, an investigation into the C 4 -functionalisation of flavan-3-ol analogues. The first peltogynoid biflavenoid and prototypes of a new series C-ring isomerised condensed tannins, namely the phlobatannins, were isolated. Besides 1 H- nmr-parameters for structure analysis, the natural phlobatannins were characterised and the unique ring isomerisation was investigated
Dipole Magnets for the LHeC Ring-Ring Option
Tommasini, D; Chritin, R
2012-01-01
The Ring-Ring option of a Large Hadron electron Collider (LHeC) requires 3080 bending magnets, 5.35-meter-long each providing a magnetic field ranging from 0.0127 T at 10 GeV to 0.0763 T at 60 GeV. Main issues in the design of these magnets are the very low injection field, constituting a challenge in achieving a satisfactory field reproducibility from cycle to cycle, and the required compactness to fit in the existing LHC tunnel. This paper describes and discusses a design meeting these requirements, together with its experimental validation by the manufacture and measurement of a 400-mm-long magnet model.
Kleinian singularities and the ground ring of c=1 string theory
International Nuclear Information System (INIS)
Ghoshal, D.; Jatkar, D.P.; Mukhi, S.
1993-01-01
We investigate the nature of the ground ring of c=1 string theory at the special ADE points in the c=1 moduli space associated to discrete subgroups of SU(2). The chiral ground rings at these points are shown to define the ADE series of singular varieties introduced by Klein. The non-chiral ground rings relevant to closed-string theory are 3 real dimensional singular varieties obtained as U(1) quotients of the kleinian varieties. The unbroken symmetries of the theory at these points are the volume-preserving diffeomorphisms of these varieties. The theory of kleinian singularities has a close relation to that of complex hyperKaehler surfaces, or gravitational instantons. We speculate on the relevance of these instantons and of self-dual gravity in c=1 string theory. (orig.)
A study on the sealing performance of metallic C-rings in reactor pressure vessel
Energy Technology Data Exchange (ETDEWEB)
Jia, Xiaohong, E-mail: jiaxh@mail.tsinghua.edu.cn [State Key Laboratory of Tribology, Tsinghua University, Beijing 100084 (China); Chen, Huaming [State Key Laboratory of Tribology, Tsinghua University, Beijing 100084 (China); Li, Xinggen [Ningbo Tiansheng Sealing Packing Co., Ltd, Ningbo 315302 (China); Wang, Yuming [State Key Laboratory of Tribology, Tsinghua University, Beijing 100084 (China); Wang, Longke [Eaton Corporation, MN (United States)
2014-10-15
Highlights: • FE analysis on compression–resilience of metallic C-ring is performed and validated by experiments. • Model of RPV sealing system including the C-rings is developed. • Deformation data from factory hydraulic test of the RPV are used to verify the model. • C-rings’ behavior under designing condition is analyzed. • The model provides a reliable evaluation on the sealing performance of RPV. - Abstract: Double metallic C-rings are used in pressure vessel of pressurized water reactor (PWR) to seal the bolt-connected flanges. To evaluate the sealing performance, it is necessary to study both the C-rings’ intrinsic properties and their behavior in reactor pressure vessel (RPV) under various loading conditions. The compression–resilience property and linear load are the basic information to evaluate the performance of a well-designed C-ring's. An equivalent model of C-ring is constructed by means of ANSYS to analyze its intrinsic properties, and is also validated by experiments on scaled samples. This model is applied to develop a 2D-axisymmetric FE model of sealing system including RPV and C-rings with the consideration of nonlinear material, contacting problem and multiple coupled effects. The simulation results of RPV deformation under the hydraulic test condition agree well with the data of factory hydraulic test. With the verified model, an analysis under the designing condition is performed to study C-rings’ behavior in the RPV, and then provides a reliable evaluation on the sealing performance of RPV.
The c-Ring of the F1FO-ATP Synthase: Facts and Perspectives.
Nesci, Salvatore; Trombetti, Fabiana; Ventrella, Vittoria; Pagliarani, Alessandra
2016-04-01
The F1FO-ATP synthase is the only enzyme in nature endowed with bi-functional catalytic mechanism of synthesis and hydrolysis of ATP. The enzyme functions, not only confined to energy transduction, are tied to three intrinsic features of the annular arrangement of c subunits which constitutes the so-called c-ring, the core of the membrane-embedded FO domain: (i) the c-ring constitution is linked to the number of ions (H(+) or Na(+)) channeled across the membrane during the dissipation of the transmembrane electrochemical gradient, which in turn determines the species-specific bioenergetic cost of ATP, the "molecular currency unit" of energy transfer in all living beings; (ii) the c-ring is increasingly involved in the mitochondrial permeability transition, an event linked to cell death and to most mitochondrial dysfunctions; (iii) the c subunit species-specific amino acid sequence and susceptibility to post-translational modifications can address antibacterial drug design according to the model of enzyme inhibitors which target the c subunits. Therefore, the simple c-ring structure not only allows the F1FO-ATP synthase to perform the two opposite tasks of molecular machine of cell life and death, but it also amplifies the enzyme's potential role as a drug target.
International Nuclear Information System (INIS)
Mokhracheva, L.P.; Gel'd, P.V.; Tskhaj, V.A.
1983-01-01
The results of ZrC zone structure calculation conducted using the strong bond method in the three-centre variant are given. Essentially higher degree of M-C chemical bond ionicity than in TiC is shown to take place for it. Solid solution formation in TiC-ZrC, TiN-ZrC and ZrC-ZrN systems differing from TiC-TiN, TiN-ZrN and TiC-TiN is stated to be followed by essential deformation of component zone structures that, obviously, should prevent formation of solid solutions without vacancies in sublatices in these systems
International Nuclear Information System (INIS)
Kurdali, F.
2007-06-01
A field experiment on dhaincha C 3 (Sesbania aculeata Pers), sunflower C 3 (Helianthus annuus L.) and sorghum C 4 (Sorghum bicolor L.) plants grown in monocropping and intercropping systems was conducted to evaluate seed yield, dry matter production, total N yield, land equivalent ratio (LER), intraspecific competition for soil N uptake, water use efficiency (WUE) and N 2 -fixation using the 15 N natural abundance technique (δ 15 N ). Moreover, carbon isotope discrimination (Δ13 C ) was determined to assess factors responsible for crop performance variability in the different cropping systems. Intercropping of sesbania/sorghum showed greater efficiency over monocropping in producing dry matter, during the entire growth period, as indicated by the LERs (>1); whereas, the efficiency of producing dry matter in the sesbania /sunflower intercropping was similar to that in the monocropping system (LER=1). Moreover, sorghum plants (C 4 ) was more competitive than sesbania (C 3 ) for soil N uptake; whereas, sesbania seemed to be more competitive than its associated sunflower (C 3 ). N uptake in the mixed stand of sesbania/sorghum was improved due to the increase in soil N uptake by the component sorghum and the higher root nodule activity of component sesbania without affecting the amount of N 2 fixed. In both cropping systems, sesbania plants fixed almost the same amount of N 2 (an average of 105 kg N/ha) although the number of rows in the mixed stand was 2/3 of that in the pure stand. This gives an advantage of the intercropping over sole cropping system with regards to N 2 -fixation. 13 C discrimination in plant materials was found to be affected by plant species and the cropping system. Factors affected Δ13 C in plants grown in the mixed stand relative to solely grown crops are discussed.(author)
Deconvolution of the tree ring based delta13C record
International Nuclear Information System (INIS)
Peng, T.; Broecker, W.S.; Freyer, H.D.; Trumbore, S.
1983-01-01
We assumed that the tree-ring based 13 C/ 12 C record constructed by Freyer and Belacy (1983) to be representative of the fossil fuel and forest-soil induced 13 C/ 12 C change for atmospheric CO 2 . Through the use of a modification of the Oeschger et al. ocean model, we have computed the contribution of the combustion of coal, oil, and natural gas to this observed 13 C/ 12 C change. A large residual remains when the tree-ring-based record is corrected for the contribution of fossil fuel CO 2 . A deconvolution was performed on this residual to determine the time history and magnitude of the forest-soil reservoir changes over the past 150 years. Several important conclusions were reached. (1) The magnitude of the integrated CO 2 input from these sources was about 1.6 times that from fossil fuels. (2) The forest-soil contribution reached a broad maximum centered at about 1900. (3) Over the 2 decade period covered by the Mauna Loa atmospheric CO 2 content record, the input from forests and soils was about 30% that from fossil fuels. (4) The 13 C/ 12 C trend over the last 20 years was dominated by the input of fossil fuel CO 2 . (5) The forest-soil release did not contribute significantly to the secular increase in atmospheric CO 2 observed over the last 20 years. (6) The pre-1850 atmospheric p2 values must have been in the range 245 to 270 x 10 -6 atmospheres
15C-15F Charge Symmetry and the 14C(n,γ)15C Reaction Puzzle
International Nuclear Information System (INIS)
Timofeyuk, N.K.; Thompson, I.J.; Baye, D.; Descouvemont, P.; Kamouni, R.
2006-01-01
The low-energy reaction 14 C(n,γ) 15 C provides a rare opportunity to test indirect methods for the determination of neutron capture cross sections by radioactive isotopes versus direct measurements. It is also important for various astrophysical scenarios. Currently, puzzling disagreements exist between the 14 C(n,γ) 15 C cross sections measured directly, determined indirectly, and calculated theoretically. To solve this puzzle, we offer a strong test based on a novel idea that the amplitudes for the virtual 15 C→ 14 C+n and the real 15 F→ 14 O+p decays are related. Our study of this relation, performed in a microscopic model, shows that existing direct and some indirect measurements strongly contradict charge symmetry in the 15 C and 15 F mirror pair. This brings into question the experimental determinations of the astrophysically important (n,γ) cross sections for short-lived radioactive targets
Qi, Zisong; Yu, Songjie; Li, Xingwei
2016-02-19
The synthesis of N-unprotected indoles has been realized via Rh(III)-catalyzed C-H activation/annulation of imidamides with α-diazo β-ketoesters. The reaction occurs with the release of an amide coproduct, which originates from both the imidamide and the diazo as a result of C═N cleavage of the imidamide and C-C(acyl) cleavage of the diazo. A rhodacyclic intermediate has been isolated and a plausible mechanism has been proposed.
Mathiselvam, Manoharan; Loganathan, Duraikkannu; Varghese, Babu
2013-10-18
The torsion angle around the N-glycoprotein linkage region (GlcNAc-Asn) is an important factor for presenting sugar on the cell surface which is crucial for many biological processes. Earlier studies using model and analogs showed that this important torsion angle is greatly influenced by substitutions in the sugar part. In the present work, uronic acid alkanamides and triazole derivatives have been designed and synthesized as newer analogs of N-glycoprotein linkage region to understand the influence of the carboxylic group on linkage region torsion as well as on molecular packing. Crystal structure of N-(β-D-galacturonopyranosyl)acetamide is solved with the space group of P22121. Comparison of the torsion angle and molecular packing of this compound with N-(β-D-galactopyranosyl)acetamide showed that changing the C6-hydoxymethyl group to the carboxylic acid group has minimum influence on the N-glycosidic torsion angle, ΦN and significant influence on the molecular packing. Copyright © 2013 Elsevier Ltd. All rights reserved.
Remarks on surfaces with $c_1^2 =2\\chi -1$ having non-trivial 2-torsion
MURAKAMI, Masaaki
2013-01-01
We shall show that any complex minimal surface of general type with $c_1^2 = 2\\chi -1$ having non-trivial 2-torsion divisors, where $c_1^2$ and $\\chi$ are the first Chern number of a surface and the Euler characteristic of the structure sheaf respectively, has the Euler characteristic $\\chi$ not exceeding 4. Moreover, we shall give a complete description for the surfaces of the case $\\chi =4$, and prove that the coarse moduli space for surfaces of this case is a unirational variety of dimensi...
Energy Technology Data Exchange (ETDEWEB)
Ramaswami, Varadarajan (Carnegie-Mellon Univ., Pittsburgh, PA (USA). Dept. of Chemistry); Tirrell, D.A. (Massachusetts Univ., Amherst, MA (USA). Dept. of Polymer Science and Engineering)
1989-08-01
An efficient synthesis of ring-labelled 3-((4-azidophenyl)dithio)propionic acid-{sup 14}C is described. Chlorosulfonation of uniformly ring-labelled acetanilide-{sup 14}C followed by reductive dimerization of the sulfonyl chloride with HI afforded 4-acetamidophenyl disulfide. Hydrolysis and diazotization then gave 4-azidophenyl disulfide, which was converted to the title compound via the sulfur transfer reagent N-(4-azidophenylthio)phthalimide. The overall yield of 3-((4-azidophenyl)dithio)propionic acid-{sup 14}C was 22%. 3-((4-Azidophenyl)dithio)propionic acid-{sup 14}C is a cleavable heterobifunctional photolabelling reagent of potential utility in studies of biomembrane structure and intermacromolecular interaction. (author).
Synthesis of {sup 14}C-labeled levamisole and {sup 13}C-labeled tetramisole
Energy Technology Data Exchange (ETDEWEB)
Feil, V.J. [US Department of Agriculture, Agricultural Research Service, Biosciences Research Lab., Fargo, ND (United States)
1996-12-01
The syntheses of {sup 14}C-ring labeled levamisole ([-]-2,3,5,6-tetrahydro-6-phenyl [{sup 14}C]-UL imidazo[2,1-b]thiazole) from acetophenone-ring-UL-{sup 14}C in 5 steps plus resolution with a 7.5% overall yield, and {sup 13}C{sub 6}-ring labeled tetramisole ([{+-}]-2,3,5,6-tetrahydro-6-phenyl [{sup 13}C{sub 6}]imidazo[2,1-b]thiazole) from benzene-{sup 13}C{sub 6} in 6 steps with a 9.0% overall yield are described. (author).
Direct growth of freestanding GaN on C-face SiC by HVPE.
Tian, Yuan; Shao, Yongliang; Wu, Yongzhong; Hao, Xiaopeng; Zhang, Lei; Dai, Yuanbin; Huo, Qin
2015-06-02
In this work, high quality GaN crystal was successfully grown on C-face 6H-SiC by HVPE using a two steps growth process. Due to the small interaction stress between the GaN and the SiC substrate, the GaN was self-separated from the SiC substrate even with a small thickness of about 100 μm. Moreover, the SiC substrate was excellent without damage after the whole process so that it can be repeatedly used in the GaN growth. Hot phosphoric acid etching (at 240 °C for 30 min) was employed to identify the polarity of the GaN layer. According to the etching results, the obtained layer was Ga-polar GaN. High-resolution X-ray diffraction (HRXRD) and electron backscatter diffraction (EBSD) were done to characterize the quality of the freestanding GaN. The Raman measurements showed that the freestanding GaN film grown on the C-face 6H-SiC was stress-free. The optical properties of the freestanding GaN layer were determined by photoluminescence (PL) spectra.
C=C bond cleavage on neutral VO3(V2O5)n clusters.
Dong, Feng; Heinbuch, Scott; Xie, Yan; Bernstein, Elliot R; Rocca, Jorge J; Wang, Zhe-Chen; Ding, Xun-Lei; He, Sheng-Gui
2009-01-28
The reactions of neutral vanadium oxide clusters with alkenes (ethylene, propylene, 1-butene, and 1,3-butadiene) are investigated by experiments and density function theory (DFT) calculations. Single photon ionization through extreme ultraviolet radiation (EUV, 46.9 nm, 26.5 eV) is used to detect neutral cluster distributions and reaction products. In the experiments, we observe products (V(2)O(5))(n)VO(2)CH(2), (V(2)O(5))(n)VO(2)C(2)H(4), (V(2)O(5))(n)VO(2)C(3)H(4), and (V(2)O(5))(n)VO(2)C(3)H(6), for neural V(m)O(n) clusters in reactions with C(2)H(4), C(3)H(6), C(4)H(6), and C(4)H(8), respectively. The observation of these products indicates that the C=C bonds of alkenes can be broken on neutral oxygen rich vanadium oxide clusters with the general structure VO(3)(V(2)O(5))(n=0,1,2...). DFT calculations demonstrate that the reaction VO(3) + C(3)H(6) --> VO(2)C(2)H(4) + H(2)CO is thermodynamically favorable and overall barrierless at room temperature. They also provide a mechanistic explanation for the general reaction in which the C=C double bond of alkenes is broken on VO(3)(V(2)O(5))(n=0,1,2...) clusters. A catalytic cycle for alkene oxidation on vanadium oxide is suggested based on our experimental and theoretical investigations. The reactions of V(m)O(n) with C(6)H(6) and C(2)F(4) are also investigated by experiments. The products VO(2)(V(2)O(5))(n)C(6)H(4) are observed for dehydration reactions between V(m)O(n) clusters and C(6)H(6). No product is detected for V(m)O(n) clusters reacting with C(2)F(4). The mechanisms of the reactions between VO(3) and C(2)F(4)/C(6)H(6) are also investigated by calculations at the B3LYP/TZVP level.
Inference of past atmospheric delta13C and P/sub CO2/ from 13C/12C measurements in tree rings
International Nuclear Information System (INIS)
Leavitt, S.W.
1982-01-01
Carbon dioxide release from fossil-fuel burning is significant enough that we may soon experience perceptible changes in climate with important human consequences. An accurate reconstruction of past 13 C/ 12 C ratios of atmospheric CO 2 may provide key constraints on the historical activity of the biosphere as CO 2 source or sink. Tree rings appear to be a repository of this information but there is much noise in the collection of previous reconstructions, presumably associated with site selection, radial variability, choice of representative wood chemical constituent, and subtle effects of climate on fractionation. This study attempts to avoid these pitfalls and develop a 50-yr delta 13 C/sub ATM/ record from juniper trees (genus Juniperus), in fact, by taking advantage of the influence of climate on fractionation. Trees were harvested from suitable sites in close proximity to weather stations with monthly records of temperature and precipitation. The most useful relationships for at most 7 of the 10 sites were delta 13 C with December temperature or precipitation, because the coefficients were nearly constant from one interval to the next and the intercepts differed. Local pollution effects are believed responsible for the three anomalous sites. The separation of these regression lines of different intervals is interpreted as the response of the trees to the changing delta 13 C of atmospheric CO 2 so that delta 13 C/sub ATM/ curves are constructed from this spacing. The shape of the best-fit reconstruction suggests the biosphere has acted as CO 2 source to about 1965 and may now be a net sink
Wieloch, Thomas; Ehlers, Ina; Yu, Jun; Frank, David; Grabner, Michael; Gessler, Arthur; Schleucher, Jürgen
2018-03-22
Measurements of carbon isotope contents of plant organic matter provide important information in diverse fields such as plant breeding, ecophysiology, biogeochemistry and paleoclimatology. They are currently based on 13 C/ 12 C ratios of specific, whole metabolites, but we show here that intramolecular ratios provide higher resolution information. In the glucose units of tree-ring cellulose of 12 tree species, we detected large differences in 13 C/ 12 C ratios (>10‰) among carbon atoms, which provide isotopically distinct inputs to major global C pools, including wood and soil organic matter. Thus, considering position-specific differences can improve characterisation of soil-to-atmosphere carbon fluxes and soil metabolism. In a Pinus nigra tree-ring archive formed from 1961 to 1995, we found novel 13 C signals, and show that intramolecular analysis enables more comprehensive and precise signal extraction from tree rings, and thus higher resolution reconstruction of plants' responses to climate change. Moreover, we propose an ecophysiological mechanism for the introduction of a 13 C signal, which links an environmental shift to the triggered metabolic shift and its intramolecular 13 C signature. In conclusion, intramolecular 13 C analyses can provide valuable new information about long-term metabolic dynamics for numerous applications.
Diodes of nanocrystalline SiC on n-/n+-type epitaxial crystalline 6H-SiC
Zheng, Junding; Wei, Wensheng; Zhang, Chunxi; He, Mingchang; Li, Chang
2018-03-01
The diodes of nanocrystalline SiC on epitaxial crystalline (n-/n+)6H-SiC wafers were investigated, where the (n+)6H-SiC layer was treated as cathode. For the first unit, a heavily boron doped SiC film as anode was directly deposited by plasma enhanced chemical vapor deposition method on the wafer. As to the second one, an intrinsic SiC film was fabricated to insert between the wafer and the SiC anode. The third one included the SiC anode, an intrinsic SiC layer and a lightly phosphorus doped SiC film besides the wafer. Nanocrystallization in the yielded films was illustrated by means of X-ray diffraction, transmission electronic microscope and Raman spectrum respectively. Current vs. voltage traces of the obtained devices were checked to show as rectifying behaviors of semiconductor diodes, the conduction mechanisms were studied. Reverse recovery current waveforms were detected to analyze the recovery performance. The nanocrystalline SiC films in base region of the fabricated diodes are demonstrated as local regions for lifetime control of minority carriers to improve the reverse recovery properties.
Goto, Akiyoshi; Fujiwara, Kenshu; Kawai, Ayako; Kawai, Hidetoshi; Suzuki, Takanori
2007-12-20
The EF-ring segment of ciguatoxin 3C, a causative toxin of ciguatera fish poisoning, was synthesized in three major steps: 1,4-addition for the C20O-C27 bond connection, chirality transferring anti selective [2,3]-Wittig rearrangement for the construction of the anti-2-hydroxyalkyl ether part, and ring-closing olefin metathesis for the F-ring formation.
Walpole, Thomas B; Palmer, David N; Jiang, Huibing; Ding, Shujing; Fearnley, Ian M; Walker, John E
2015-04-01
The rotors of ATP synthases turn about 100 times every second. One essential component of the rotor is a ring of hydrophobic c-subunits in the membrane domain of the enzyme. The rotation of these c-rings is driven by a transmembrane proton-motive force, and they turn against a surface provided by another membrane protein, known as subunit a. Together, the rotating c-ring and the static subunit a provide a pathway for protons through the membrane in which the c-ring and subunit a are embedded. Vertebrate and invertebrate c-subunits are well conserved. In the structure of the bovine F1-ATPase-c-ring subcomplex, the 75 amino acid c-subunit is folded into two transmembrane α-helices linked by a short loop. Each bovine rotor-ring consists of eight c-subunits with the N- and C-terminal α-helices forming concentric inner and outer rings, with the loop regions exposed to the phospholipid head-group region on the matrix side of the inner membrane. Lysine-43 is in the loop region and its ε-amino group is completely trimethylated. The role of this modification is unknown. If the trimethylated lysine-43 plays some important role in the functioning, assembly or degradation of the c-ring, it would be expected to persist throughout vertebrates and possibly invertebrates also. Therefore, we have carried out a proteomic analysis of c-subunits across representative species from different classes of vertebrates and from invertebrate phyla. In the twenty-nine metazoan species that have been examined, the complete methylation of lysine-43 is conserved, and it is likely to be conserved throughout the more than two million extant metazoan species. In unicellular eukaryotes and prokaryotes, when the lysine is conserved it is unmethylated, and the stoichiometries of c-subunits vary from 9-15. One possible role for the trimethylated residue is to provide a site for the specific binding of cardiolipin, an essential component of ATP synthases in mitochondria. © 2015 by The American
(4-Chloroacetanilido-κ2N,Obis[2-(pyridin-2-ylphenyl-κ2C1,N]iridium(III
Directory of Open Access Journals (Sweden)
Lijun Sun
2013-02-01
Full Text Available In the neutral mononuclear iridium(III title compound, [Ir(C8H7ClNO(C11H8N2], the IrIII atom adopts an octahedral geometry, and is coordinated by two 2-phenylpyridyl ligands and one anionic 4-chloroacetanilide ligand. The 2-phenylpyridyl ligands are arranged in a cis-C,C′ and cis-N,N′ fashion. Each 2-phenylpyridyl ligand forms a five-membered ring with the IrIII atom. The 2-phenylpyridyl planes are perpendicular to each other [dihedral angle = 89.9 (1°]. The Ir—C and Ir—N bond lengths are comparable to those reported for related iridium(III 2-phenylpyridyl complexes. The remaining two coordination sites are occupied by the amidate N and O atoms, which form a four-membered ring with the iridium atom (Ir—N—C—O. The amidate plane is nearly perpendicular to both 2-phenylpyridyl ligands [dihedral angles = 87.8 (2 and 88.3 (2°].
Measurement of 2J(H,C)- and 3J(H,C)-coupling constants by α/β selective HC(C)H-TOCSY
International Nuclear Information System (INIS)
Duchardt, Elke; Richter, Christian; Reif, Bernd; Glaser, Steffen J.; Engels, Joachim W.; Griesinger, Christian; Schwalbe, Harald
2001-01-01
A new heteronuclear NMR pulse sequence for the measurement of n J(C,H) coupling constants, the α/βselective HC(C)H-TOCSY, is described. It is shown that the S 3 E element (Meissner et al., 1997a,b) can be used to obtain spin state selective coherence transfer in molecules, in which adjacent CH moieties are labeled with 13 C. Application of the α/β selective HC(C)H-TOCSY to a 10nt RNA tetraloop 5'-CGCUUUUGCG-3', in which the four uridine residues are 13 C labeled in the sugar moiety, allowed measurement of two bond and three bond J(C,H) coupling constants, which provide additional restraints to characterize the sugar ring conformation of RNA in cases of conformational averaging
International Nuclear Information System (INIS)
Li Zheng; Han Ailiang; Zhang Yanfei; Li Juying; Wang Yue; Wang Haiyan; Ye Qingfu; Lu Long
2009-01-01
ZJ0273, propyl 4-(2-(4, 6-dimethoxypyrimidin-2-yloxy) benzylamino) benzoate, is a novel ALS-inhibited herbicide development for pre-and post-emergence weed control in field of oilseed rape. The comparative uptake, translocation and distribution of root-applied [C ring-U- 14 C] ZJ0273 in the plants of susceptible rice and tolerant oilseed rape were investigated under laboratory conditions. The results showed that the uptake of [C ring-U- 14 C]-ZJ0273 in both rice (Oryza sativa L.) and oilseed rape (Brassica napus L.) increased with time. Larger percentage of the applied ZJ0273 was uptaken by rice than oilseed rape at any sampling time. At 384 hours after treatment, the uptake of [C ring-U- 14 C]-ZJ0273 reached 24.1% of the applied amount in rice, while only 4.1% of the applied in oilseed rape. The majority of the absorbed ZJ0273 remained in the root of the tested plants, which indicated the weak mobility of ZJ0273 and/or its metabolites in both the plants of susceptible rice and tolerant oilseed rape. The radioactivity per unit of dry weight in the roots and leaves of rice was 9.470 Bq/mg and 0.910 Bq/mg, respectively, which was significantly higher than that in oilseed rape (3.870 Bq/mg and 0.390 Bq/mg). Therefore, the difference in the total uptake of ZJ0273 and the accumulation of ZJ0273 and/or its metabolites perunit of dry weight between rice and oilseed rape, which revealed in this study, might be one of the reasons for the different susceptibility of rice and oilseed rape on ZJ0273. (authors)
Directory of Open Access Journals (Sweden)
Alan M. Jones
2016-01-01
Full Text Available The crystal structures of three cyclopenta[c]furans with various substituents at the 4-, 5- and 6-positions of the ring system are reported, namely, (±-(3aR,4S,5S,6aS-4-methyl-5-phenylhexahydro-1H-cyclopenta[c]furan-4,5-diol, C14H18O3, (I, (±-(3aR,4S,5S,6aS-4-benzyloxy-4-methyl-5-phenylhexahydro-1H-cyclopenta[c]furan-5-ol, C21H24O3, (II, and (±-(1aR,1bS,4aR,5S,5aR-5-benzyloxy-5-methyl-5a-phenylhexahydro-2H-oxireno[2′,3′:3,4]cyclopenta[1,2-c]furan, C21H22O3, (III. The dominant interaction in (I and (II is an O—H...O hydrogen bond across the bicyclic 5,5-ring system between the non-functionalized hydroxy group and the tetrahydrofuran O atom, which appears to influence the envelope conformations of the fused five-membered rings, whereas in (III, the rings have different conformations. A weak intramolecular C—H...O interaction appears to influence the degree of tilt of the phenyl ring attached to the 5-position and is different in (I compared to (II and (III.
Tree-ring C-H-O isotope variability and sampling
International Nuclear Information System (INIS)
Leavitt, Steven W.
2010-01-01
In light of the proliferation of tree-ring isotope studies, the magnitude and cause of variability of tree-ring δ 13 C, δ 18 O and δ 2 H within individual trees (circumferential) and among trees at a site is examined in reference to field and laboratory sampling requirements and strategies. Within this framework, this paper provides a state-of-knowledge summary of the influence of 'juvenile' isotope effects, ageing effects, and genetic effects, as well as the interchangeability of species, choice of ring segment to analyze (whole ring, earlywood or latewood), and the option of sample pooling. The range of isotopic composition of the same ring among trees at a site is ca. 1-3 per mille for δ 13 C, 1-4 per mille δ 18 O, and 5-30 per mille for δ 2 H, whereas the circumferential variability within a tree is lower. A standard prescription for sampling and analysis does not exist because of differences in field environmental circumstances and mixed findings represented in relevant published literature. Decisions in this regard will usually be tightly constrained by goals of the study and project resources. Sampling 4-6 trees at a site while avoiding juvenile effects in rings near the pith seems to be the most commonly used methodology, and although there are some reasoned arguments for analyzing only latewood and developing separate isotope records from each tree, the existence of some contradictory findings together with efforts to reduce cost and effort have prompted alternate strategies (e.g., most years pooled with occasional analysis of rings in the sequence separately for each tree) that have produced useful results in many studies.
properties of Cr(C,N) hard coatings deposited in Ar-C2H2-N2 plasma
International Nuclear Information System (INIS)
Macek, M.; Cekada, M.; Kek, D.; Panjan, P.
2002-01-01
Mechanical properties, microstructure and the average chemical composition of Cr(C,N) hard coatings deposited in Ar-C 2 H 2 -N 2 plasma strongly depends on the partial pressure of the reactive gases (N 2 , C 2 H 2 ) and on the type of the deposition equipment. In this study we report on the properties of Cr(C,N) hard coatings deposited by means of the triode ion plating in the BAI 730 apparatus and those prepared by sputter deposition in Balzers Sputron in the pressure range from 0.12 Pa (pure Ar) up to 0.35 Pa with different ratios (0-100%) between C 2 H 2 and N 2 . At first mechanical properties (microhardness and adhesion) of coatings were analyzed on the common way. Internal stress was measured by the radius of substrate curvature. Chemical composition of coatings was analyzed by means of AES while the Raman and XPS spectroscopy was used to determined the nature of carbon bonding in the Cr(C,N) films. Microstructure was determined by XRD as well as by means of TEM and TED. Chemical state of various elements in the coating has been studied by XPS. The ratio of the carbide bond (C-Cr) against the C-C and C-H bonds was calculated. The existence of the graphite phase in some Cr(C,N) coatings was confirmed by Raman spectroscopy. (Authors)
Structure of small TiC n clusters: A theoretical study
International Nuclear Information System (INIS)
Largo, Laura; Cimas, Alvaro; Redondo, Pilar; Rayon, Victor M.; Barrientos, Carmen
2006-01-01
A theoretical study of the TiC n (n = 1-8) clusters has been carried out at the B3LYP/6-311+G(d) level. Molecular properties for three different isomers, namely linear, cyclic, and fan species, have been determined. The fan isomers, where the titanium atom is essentially side-bonded to the entire C n unit, are predicted to be more stable than both linear and cyclic isomers. Only for the largest studied species, TiC 8 , the cyclic isomer is located lower in energy. An even-odd parity effect in the incremental binding energies is observed for the three isomers, n-even species being in general more stable for linear and fan isomers, whereas for the cyclic species n-odd clusters are favoured. A topological analysis of the electronic charge density shows that all cyclic isomers correspond to true monocyclic rings, whereas for the fan species a variety of different connectivities has been observed
Quantification of Applied Stresses of C-Ring Specimens for Stress Corrosion Cracking Tests
International Nuclear Information System (INIS)
Kim, Woo Gon; Kim, Sun Jae; Rhee, Chang Kyu; Kuk, Il Hiun; Choi, Jong Ho
1997-01-01
For comparing their resistances for stress-corrosion cracking(SCC) in the K600-MA, K690-MA, and K600-TT tubes, C-ring specimens were fabricated with the various thermal-treatments to control the distributions of the precipitates like Cr-carbides. The bending stresses were analyzed to determine the amounts to make the stress quantitatively to all the C-ring samples, and then the stresses were calculated with the relation to the outer diameter(O.D) deflection(δ) of the C-rings. To measure accurately the bending strains of the C-ring specimens, the strain gauges were used and the compression test was also carried out. In the elastic region, the stresses in both the transverse and the circumferential directions were different with the locations of the strain gauges as attached at α= 30 .deg., 45 .deg., and 90 .deg. to the principal stress direction, but those in the longitudinal direction were independent of their attached locations. Calculated stresses from the strains obtained using the strain gauges were well agreed with the theoretical. In the plastic region over δ=1.0mm, the stresses for the TT tubes showed lower values of about 400MPa than those for the MA tubes. However, the stresses among the TT tubes showed almost the similar values in this region. Therefore, the states of the stresses applied to the C-ring specimens would be different with the material conditions, i.e, the chemical compositions, the thermal treatments such as MA and TT
Adams, Richard D; Dhull, Poonam; Tedder, Jonathan D
2018-06-14
The reaction of Re 2 (CO) 8 (μ-C 6 H 5 )(μ-H) (1) with thiophene in CH 2 Cl 2 at 40 °C yielded the new compound Re 2 (CO) 8 (μ-η 2 -SC 4 H 3 )(μ-H) (2), which contains a bridging σ-π-coordinated thienyl ligand formed by the activation of the C-H bond at the 2 position of the thiophene. Compound 2 exhibits dynamical activity on the NMR time scale involving rearrangements of the bridging thienyl ligand. The reaction of compound 2 with a second 1 equiv of 1 at 45 °C yielded the doubly metalated product [Re 2 (CO) 8 (μ-H)] 2 (μ-η 2 -2,3-μ-η 2 -4,5-C 4 H 2 S) (3), formed by the activation of the C-H bond at the 5 position of the thienyl ligand in 2. Heating 3 in a hexane solvent to reflux transformed it into the ring-opened compound Re(CO) 4 [μ-η 5 -η 2 -SCC(H)C(H)C(H)][Re(CO) 3 ][Re 2 (CO) 8 (μ-H)] (4) by the loss of one CO ligand. Compound 4 contains a doubly metalated 1-thiapentadienyl ligand formed by the cleavage of one of the C-S bonds. When heated to reflux (125 °C) in an octane solvent in the presence of H 2 O, the new compound Re(CO) 4 [η 5 -μ-η 2 -SC(H)C(H)C(H)C(H)]Re(CO) 3 (5) was obtained by cleavage of the Re 2 (CO) 8 (μ-H) group from 4 with formation of the known coproduct [Re(CO) 3 (μ 3 -OH)] 4 . All new products were characterized by single-crystal X-ray diffraction analyses.
Linear ketenimines. Variable structures of C,C-dicyanoketenimines and C,C-bis-sulfonylketenimines.
Finnerty, Justin; Mitschke, Ullrich; Wentrup, Curt
2002-02-22
C,C-dicyanoketenimines 10a-c were generated by flash vacuum thermolysis of ketene N,S-acetals 9a-c or by thermal or photochemical decomposition of alpha-azido-beta-cyanocinnamonitrile 11. In the latter reaction, 3,3-dicyano-2-phenyl-1-azirine 12 is also formed. IR spectroscopy of the keteniminines isolated in Ar matrixes or as neat films, NMR spectroscopy of 10c, and theoretical calculations (B3LYP/6-31G) demonstrate that these ketenimines have variable geometry, being essentially linear along the CCN-R framework in polar media (neat films and solution), but in the gas phase or Ar matrix they are bent, as is usual for ketenimines. Experiments and calculations agree that a single CN substituent as in 13 is not enough to enforce linearity, and sulfonyl groups are less effective that cyano groups in causing linearity. C,C-bis(methylsulfonyl)ketenimines 4-5 and a C-cyano-C-(methylsulfonyl)ketenimine 15 are not linear. The compound p-O2NC6H4N=C=C(COOMe)2 previously reported in the literature is probably somewhat linearized along the CCNR moiety. A computational survey (B3LYP/6-31G) of the inversion barrier at nitrogen indicates that electronegative C-substituents dramatically lower the barrier; this is also true of N-acyl substituents. Increasing polarity causes lower barriers. Although N-alkylbis(methylsulfonyl)ketenimines are not calculated to be linear, the barriers are so low that crystal lattice forces can induce planarity in N-methylbis(methylsulfonyl)ketenimine 3.
CVD of SiC and AlN using cyclic organometallic precursors
Interrante, L. V.; Larkin, D. J.; Amato, C.
1992-01-01
The use of cyclic organometallic molecules as single-source MOCVD precursors is illustrated by means of examples taken from our recent work on AlN and SiC deposition, with particular focus on SiC. Molecules containing (AlN)3 and (SiC)2 rings as the 'core structure' were employed as the source materials for these studies. The organoaluminum amide, (Me2AlNH2)3, was used as the AlN source and has been studied in a molecular beam sampling apparatus in order to determine the gas phase species present in a hot-wall CVD reactor environment. In the case of SiC CVD, a series of disilacyclobutanes (Si(XX')CH2)2 (with X and X' = H, CH3, and CH2SiH2CH3), were examined in a cold-wall, hot-stage CVD reactor in order to compare their relative reactivities and prospective utility as single-source CVD precursors. The parent compound, disilacyclobutane, (SiH2CH2)2, was found to exhibit the lowest deposition temperature (ca. 670 C) and to yield the highest purity SiC films. This precursor gave a highly textured, polycrystalline film on the Si(100) substrates.
Dicty_cDB: Contig-U11598-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available EF534375 |pid:none) Thinopyrum intermedium SGT1 cDNA, ... 49 2e-04 AY365188_1( AY365188 |pid:none) Nicotiana...hqi*nn*lnn*fkkk--- ---skry**yapiyilqlhmvidh*h*n*ln*dqm*mlqqmmaqpplhiatdaedieick sliekgailkmdsdgltpl... Ear... 50 0.13 1 ( EK177296 ) 1095458104244 Global-Ocean-Sampling_GS-31-01-01-1....7 (Q9D4H7) RecName: Full=LON peptidase N-terminal domain and RING ... 57 5e-07 AE014188_398( AE014188 |pid:n... homolog B; Short=... 53 1e-05 (Q496Y0) RecName: Full=LON peptidase N-terminal domain and RING ... 53 1e-05
International Nuclear Information System (INIS)
Popelis, Yu.Yu.; Liepin'sh, E.E.; Lukevits, E.Ya.
1986-01-01
The 1 H, 13 C, and 15 N NMR spectra of 15 N-enriched 5-substituted furfural oximes were investigated. It was shown that the chemical shifts of the ring atoms and the oxime group correlate satisfactorily with the F and R substituent constants, whereas their sensitivity to the effect of the substituents is lower than in monosubstituted furan derivatives. The constants of spin-spin coupling between the ring protons and the oxime group were determined. An analysis of the 1 H- 1 H spin-spin coupling constants (SSCC) on the basis of their stereospecificity indicates that the E isomers have primarily an s-trans conformation in polar dimethyl sulfoxide, whereas the Z isomers, on the other hand, have an s-cis conformation. The signs of the direct and geminal 13 C- 15 N SSCC were determined for 5-trimethylsilylfurfural oxime
Measurement of surface-induced microplasticity in Alloy 600 C-rings
International Nuclear Information System (INIS)
Lo, C.F.; Kamide, H.; Mayo, W.E.; Weissmann, S.
1990-03-01
The level of microplasticity in Alloy 600 specimens used for accelerated SCC tests was measured with the aid of a novel x-ray rocking curve technique developed at Rutgers University. With this tool, it was possible to measure quantitatively the strain level at any point along the circumference of a C-ring. Combined with selective etching, the method was used to obtain a depth profile of the strain. A detailed study of the deformation state in C-rings was performed with a particular emphasis on how material parameters influence localization of the strain. These studies included the role of grain boundary carbides, grain size and mill anneal temperatures. The studies led to the development of a numerical model for calculation of the strain distribution along a C-ring which is superior to that currently in use. An additional result of these studies was a simple indirect method that can be used to determine the amount of grain boundary carbides present in tubes of Alloy 600. The final phase of this project was to measure the strain relaxation kinetics in this alloy. From this work, the activation energy for relaxation and the atomistic process responsible were identified. Based on this work, calculations were performed to indicate the degree of relaxation that can be expected during normal steam generator operation and accelerated SCC testing. These calculations suggest that relaxation may be significant in the temperature range of 280--360 degree C which is typical for such tests and highlights the fact that during these tests significant changes in the microstructure that can be detected by x-rays are taking place. These results will provide a more accurate basis for extrapolating tests to actual steam generator corrosion experience. 6 figs., 2 tabs
International Nuclear Information System (INIS)
Imanishi, B.; Denisov, V.; Motobayashi, T.
1996-10-01
The charge-symmetric scattering systems, 12 C+ 13 N and 12 C+ 13 C have been investigated by using the orthogonalized coupled-reaction-channel (OCRC) method with the basis functions of the elastic, inelastic and transfer channels defined by the single-particle states, 1p1/2, 2s1/2, 1d5/2 and 1d3/2 of the valence nucleon in 13 N or 13 C. The data of the elastic scattering of 13 N on 12 C measured by Lienard et al. have been explained consistently with the data of the elastic and inelastic scattering of the 12 C+ 13 C system. The CRC effects both on the above systems are very strong, although those on the 12 C+ 13 N system are fairly weaker than the 12 C+ 13 C system. The role of the highly excited single-particle states 1d3/2 is particularly important in the formation of a specific CRC scheme, i.e., the formation of the covalent molecules due to the hybridization caused by the mixing of the different parity single-particle states. The fusion cross sections of the 12 C+ 13 C system at energies below the Coulomb barrier are strongly enhanced as a result of the strong CRC effects as compared with those of the 12 C+ 12 C system, while in 12 C+ 13 N system the enhancement of the sub-barrier fusion has not been observed. The above absorption mechanism for the 12 C+ 13 C system explains the lack of the molecular-resonance phenomena observed in the 12 C+ 12 C system. We check the effects of the dipole (E1) transition of the valence nucleon in 13 N (and also in 13 C) due to the core-core Coulomb interaction in the scattering at sub-barrier energies. The effects are not appreciable. (author)
Anafcheh, Maryam; Naderi, Fereshteh; Khodadadi, Zahra; Ektefa, Fatemeh; Ghafouri, Reza; Zahedi, Mansour
2017-03-01
We applied density functional calculations to study the circular redox reaction mechanism of N 2 O with CO catalyzed by fullerometallic cations C 60 Fe + and C 70 Fe + . The on-top sites of six-membered rings (η 6 ) of fullerene cages are the most preferred binding sites for Fe + cation, and the hexagon to pentagon migration of Fe + is unlikely under ambient thermodynamic conditions. The initial ion/molecule reaction, N 2 O rearrangement and N 2 abstraction on the considered fullerometallic cations are easier than those on the bare Fe + cation in the gas phase. Generally, our results indicate that fullerometallic ions, C 60 Fe + and C 70 Fe + , are more favorable substrates for redox reaction of N 2 O with CO in comparison to the other previously studied carbon nanostructures such as graphene and nanotubes. Copyright © 2016 Elsevier Inc. All rights reserved.
Convergent synthesis of the HIJKLM ring system of ciguatoxin CTX3C.
Takamura, Hiroyoshi; Nishiuma, Naoki; Abe, Takashi; Kadota, Isao
2011-09-02
The HIJKLM ring system of ciguatoxin CTX3C was synthesized in a convergent manner. The key steps were a conjugate addition/alkylation sequence, spiroacetalization, intramolecular allylation, ring-closing metathesis, and hydrogenation to form the 36-α-methyl substituent.
Zhou, Tian
Computational chemistry has achieved vast progress in the last decades in the field, which was considered to be only experimental before. DFT (density functional theory) calculations have been proven to be able to be applied to large systems, while maintaining high accuracy. One of the most important achievements of DFT calculations is in exploring the mechanism of bond activation reactions catalyzed by organometallic complexes. In this dissertation, we discuss DFT studies of several catalytic systems explored in the lab of Professor Alan S. Goldman. Headlines in the work are: (1) (R4PCP)Ir alkane dehydrogenation catalysts are highly selective and different from ( R4POCOP)Ir catalysts, predicting different rate-/selectivity-determining steps; (2) The study of the mechanism for double C-H addition/cyclometalation of phenanthrene or biphenyl by (tBu4PCP)Ir(I) and ( iPr4PCP)Ir illustrates that neutral Ir(III) C-H addition products can undergo a very facile second C-H addition, particularly in the case of sterically less-crowded Ir(I) complexes; (3) (iPr4PCP)Ir pure solid phase catalyst is highly effective in producing high yields of alpha-olefin products, since the activation enthalpy for dehydrogenation is higher than that for isomerization via an allyl pathway; higher temperatures favor the dehydrogenation/isomerization ratio; (4) (PCP)Ir(H)2(N2H4) complex follows a hydrogen transfer mechanism to undergo both dehydrogenation to form N 2 and H2, as well as hydrogen transfer followed by N-N bond cleavage to form NH3, N2, and H2; (5) The key for the catalytic effect of solvent molecule in CO insertion reaction for RMn(CO)5 is hydrogen bond assisted interaction. The basicity of the solvent determines the strength of the hydrogen bond interaction during the catalytic path and determines the catalytic power of the solvent; and (6) Dehydrogenative coupling of unactivated C-H bonds (intermolecular vinyl-vinyl, intramolecular vinyl-benzyl) is catalyzed by precursors of the
Verification of annual growth rings in Egyptian trees by C-14 method
International Nuclear Information System (INIS)
Belacy, N.; Abou El-Nour, F.; Jacoby, G.C.
1990-01-01
Annual growth rings in trees were thought to be due to sharp seasonal variations in the precipitation rates during the year. Accordingly temperature zone trees such as Egyptian trees were supposed to be away from this phenomenon. The temperature zones which are meant here are those of no sharp seasonal variations in the precipitation rates. The present study applied carbon-14 dating to prove that the growth rings in some Egyptian trees are annual. The method was based on the tropospheric measurements of C-14 during the period 1954-1981. C-14 exhibited a sharp peak resulting from the ever greater series of nuclear tests during 1963-1965. The presence of this peak for Egyptian trees proved that they form annual growth rings. (orig.) [de
Stable Sheave Moduli of Rank 2 with Chern Classes c 1 = -1; c2 = 2; c3 = 0 on Q3
Directory of Open Access Journals (Sweden)
A. D. Uvarov
2012-01-01
Full Text Available In this paper we consider the scheme MQ( 2;¡1; 2; 0 of stable torsion free sheaves of rank 2 with Chern classes c1 = -1, c2 = 2, c3 = 0 on a smooth 3-dimensional projective quadric Q. The manifold MQ(-1; 2 of moduli bundles of rank 2 with Chern classes c1 = -1, c2 = 2 on Q was studied by Ottaviani and Szurek in 1994. In 2007 the author described the closure MQ (-1; 2 in the scheme MQ(2;¡1; 2; 0. In this paper we prove that in MQ(2;¡1; 2; 0 there exists a unique irreducible component diferent from MQ (¡1; 2 which is a rational variety of dimension 10.
Growing GaN LEDs on amorphous SiC buffer with variable C/Si compositions
Cheng, Chih-Hsien; Tzou, An-Jye; Chang, Jung-Hung; Chi, Yu-Chieh; Lin, Yung-Hsiang; Shih, Min-Hsiung; Lee, Chao-Kuei; Wu, Chih-I; Kuo, Hao-Chung; Chang, Chun-Yen; Lin, Gong-Ru
2016-01-01
The epitaxy of high-power gallium nitride (GaN) light-emitting diode (LED) on amorphous silicon carbide (a-SixC1−x) buffer is demonstrated. The a-SixC1−x buffers with different nonstoichiometric C/Si composition ratios are synthesized on SiO2/Si substrate by using a low-temperature plasma enhanced chemical vapor deposition. The GaN LEDs on different SixC1−x buffers exhibit different EL and C-V characteristics because of the extended strain induced interfacial defects. The EL power decays when increasing the Si content of SixC1−x buffer. The C-rich SixC1−x favors the GaN epitaxy and enables the strain relaxation to suppress the probability of Auger recombination. When the SixC1−x buffer changes from Si-rich to C-rich condition, the EL peak wavelengh shifts from 446 nm to 450 nm. Moreover, the uniform distribution contour of EL intensity spreads between the anode and the cathode because the traping density of the interfacial defect gradually reduces. In comparison with the GaN LED grown on Si-rich SixC1−x buffer, the device deposited on C-rich SixC1−x buffer shows a lower turn-on voltage, a higher output power, an external quantum efficiency, and an efficiency droop of 2.48 V, 106 mW, 42.3%, and 7%, respectively. PMID:26794268
Dual RING E3 Architectures Regulate Multiubiquitination and Ubiquitin Chain Elongation by APC/C.
Brown, Nicholas G; VanderLinden, Ryan; Watson, Edmond R; Weissmann, Florian; Ordureau, Alban; Wu, Kuen-Phon; Zhang, Wei; Yu, Shanshan; Mercredi, Peter Y; Harrison, Joseph S; Davidson, Iain F; Qiao, Renping; Lu, Ying; Dube, Prakash; Brunner, Michael R; Grace, Christy R R; Miller, Darcie J; Haselbach, David; Jarvis, Marc A; Yamaguchi, Masaya; Yanishevski, David; Petzold, Georg; Sidhu, Sachdev S; Kuhlman, Brian; Kirschner, Marc W; Harper, J Wade; Peters, Jan-Michael; Stark, Holger; Schulman, Brenda A
2016-06-02
Protein ubiquitination involves E1, E2, and E3 trienzyme cascades. E2 and RING E3 enzymes often collaborate to first prime a substrate with a single ubiquitin (UB) and then achieve different forms of polyubiquitination: multiubiquitination of several sites and elongation of linkage-specific UB chains. Here, cryo-EM and biochemistry show that the human E3 anaphase-promoting complex/cyclosome (APC/C) and its two partner E2s, UBE2C (aka UBCH10) and UBE2S, adopt specialized catalytic architectures for these two distinct forms of polyubiquitination. The APC/C RING constrains UBE2C proximal to a substrate and simultaneously binds a substrate-linked UB to drive processive multiubiquitination. Alternatively, during UB chain elongation, the RING does not bind UBE2S but rather lures an evolving substrate-linked UB to UBE2S positioned through a cullin interaction to generate a Lys11-linked chain. Our findings define mechanisms of APC/C regulation, and establish principles by which specialized E3-E2-substrate-UB architectures control different forms of polyubiquitination. Copyright © 2016 Elsevier Inc. All rights reserved.
Entsymaattisen Abbott Architect c8000 HbA1c -menetelmän validointi
Karjalainen, Laura
2013-01-01
Opinnäytetyö suoritettiin THL:n Tautiriskiyksikön analyyttisen biokemian laboratoriossa (TLAB). Työssä validoitiin uusi entsymaattinen Abbott Architect c8000 HbA1c -menetelmä, jota käytetään diabetekseen liittyvissä tutkimuksissa. Validoinnilla haluttiin varmistaa uuden mittaustekniikaltaan erilaisen menetelmän toimivuus. Menetelmävertailussa komparatiivisena menetelmänä oli laboratoriossa rutiinikäytössä ollut Abbottin immunoturbidimetrinen HbA1c-menetelmä. Uusi entsymaattinen menetelmä peru...
Oxidative electrochemical aryl C-C coupling of spiropyrans
Ivashenko, Oleksii; van Herpt, Jochem T.; Rudolf, Petra; Feringa, Ben L.; Browne, Wesley R.
2013-01-01
The isolation and definitive assignment of the species formed upon electrochemical oxidation of nitro-spiropyran (SP) is reported. The oxidative aryl C-C coupling at the indoline moiety of the SP radical cation to form covalent dimers of the ring-closed SP form is demonstrated. The coupling is
Rates and energetics of tyrosine ring flips in yeast iso-2-cytochrome c
International Nuclear Information System (INIS)
Nall, B.T.; Zuniga, E.H.
1990-01-01
Isotope-edited nuclear magnetic resonance spectroscopy is used to monitor ring flip motion of the five tyrosine side chains in the oxidized and reduced forms of yeast iso-2-cytochrome c. With specifically labeled protein purified from yeast grown on media containing [3,5- 13 C]tyrosine, isotope-edited one-dimensional proton spectra have been collected over a 5-55 degree C temperature range. The spectra allow selective observation of the 10 3,5 tyrosine ring proton resonances and, using a two-site exchange model, allow estimation of the temperature dependence of ring flip rates from motion-induced changes in proton line shapes. For the reduced protein, tyrosines II and IV are in fast exchange throughout the temperature range investigated, or lack resolvable differences in static chemical shifts for the 3,5 ring protons. Tyrosines I, III, and V are in sloe exchange at low temperatures and in fast exchange at high temperatures. Spectral simulations give flip rates for individual tyrosines in a range of one flip per second at low temperatures to thousands of flips per second at high temperatures. Eyring plots show that two of the tyrosines (I and III) have essentially the same activation parameters. Tentative sequence-specific assignments for the tyrosines in reduced iso-2 are suggested by comparison to horse cytochrome c. For oxidized iso-2, five resonances are observed at high temperatures, suggesting flip rates for all five tyrosines sufficient to average static chemical shift differences. At lower temperatures, there is evidence of intermediate and slow flipping for some of the rings
International Nuclear Information System (INIS)
Trowbridge, L.D.
2000-01-01
As part of a program intended to replace the present evaporative coolant at the gaseous diffusion plants (GDPs) with a non-ozone-depleting alternate, a series of investigations of the suitability of candidate substitutes is under way. This report summarizes studies directed at estimating the chemical and thermal stability of three candidate coolants, c-C 4 F 8 O, n-C 4 F 10 and c-C 4 4F 8 , in a few specific environments to be found in gaseous diffusion plant operations
International Nuclear Information System (INIS)
Liu Hanwei; Huang Kunpeng; Zhu Minhao; Zhou Zhongrong
2005-01-01
Tic/Ti(C,N)/TiN multi-layer coatings are prepared on the 1Cr13 stainless steel substrate by the technique of Chemical Vapour Deposition, and the fretting wear behaviour of 1Cr13 stainless steel and TiC/Ti(C,N)/TiN coatings are investigated and studied controversially from 25 degree C to 400 degree C in the gross slip regime. It shows that the temperature has great influence on the fretting wear in the gross slip regime for the 1Cr13 stainless steel but little for Ti/C/Ti(C,N)/TiN multi-layer coatings. With the temperature increasing, the friction coefficient and the wear volume of the 1Cr13 alloy decreases and the wear volume of TiC/Ti(C, N)/TiN multi-layer coatings is invariant. TiC/Ti(C,N)/TiN multi-layer coatings have better wear-resistant capability than the 1Cr13 stainless steel, but the wear volume of the substrate increases greatly because of the grain-abrasion resulted from hard debris when TiC/Ti(C,N)/TiN multi-layer coatings are ground off. (authors)
Growth of high-quality hexagonal InN on 3C-SiC (001) by molecular beam epitaxy
International Nuclear Information System (INIS)
Yaguchi, Hiroyuki; Hijikata, Yasuto; Yoshida, Sadafumi; Kitamura, Yoshihiro; Nishida, Kenji; Iwahashi, Yohei
2005-01-01
We have grown hexagonal InN (h-InN) films on 3C-SiC (001) substrates by RF-N 2 plasma molecular beam epitaxy taking account of small lattice mismatch between h-InN (10-10) and 3C-SiC (110). It was found from X-ray diffraction (XRD) measurements that h-InN grows with h-InN (0001) vertical stroke vertical stroke 3C-SiC (001) and h-InN (1-100) vertical stroke vertical stroke 3C-SiC (110). XRD measurements also revealed that the h-InN epitaxial layers grown on 3C-SiC (001) are composed of single domain. Strong and sharp photoluminescence from the h-InN was clearly observed at around 0.69 eV. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Characterization of a n+3C/n−4H SiC heterojunction diode
Energy Technology Data Exchange (ETDEWEB)
Minamisawa, R. A.; Mihaila, A. [Department of Power Electronics, ABB Corporate Research Center, CH-5405 Baden-Dättwil (Switzerland); Farkas, I.; Hsu, C.-W.; Janzén, E. [Semiconductor Materials, IFM, Linköping University, SE-58183 Linköping (Sweden); Teodorescu, V. S. [National Institute of Material Physics, R-077125 Bucharest-Măgurele (Romania); Afanas' ev, V. V. [Semiconductor Physics Laboratory, KU Leuven, 3001 Leuven (Belgium); Rahimo, M. [ABB Semiconductors, Fabrikstrasse 3, CH-5600 Lenzburg (Switzerland)
2016-04-04
We report on the fabrication of n + 3C/n-4H SiC heterojunction diodes (HJDs) potentially promising the ultimate thermal stability of the junction. The diodes were systematically analyzed by TEM, X-ray diffraction, AFM, and secondary ion mass spectroscopy, indicating the formation of epitaxial 3C-SiC crystal on top of 4H-SiC substrate with continuous interface, low surface roughness, and up to ∼7 × 10{sup 17 }cm{sup −3} dopant impurity concentration. The conduction band off-set is about 1 V as extracted from CV measurements, while the valence bands of both SiC polytypes are aligned. The HJDs feature opening voltage of 1.65 V, consistent with the barrier height of about 1.5 eV extracted from CV measurement. We finally compare the electrical results of the n + 3C/n-4H SiC heterojunction diodes with those featuring Si and Ge doped anodes in order to evaluate current challenges involved in the fabrication of such devices.
Fourier spectroscopy of the 12C2, 13C2, and 12C13C (0-0) swan bands
International Nuclear Information System (INIS)
Amiot, C.
1983-01-01
The (0-0) band of the C 2 Swan electronic system d 3 Pi/sub g/→a 3 Pi/sub u/ has been recorded by Fourier spectroscopy. The three isotopes species 12 C 2 , 13 C 2 , and 12 C 13 C were investigated. The observed wavenumbers were reduced to molecular parameters using a nonlinear least-square fitting procedure. Well-known perturbations at N' = 47 and N' = 51 again observed in the e 12 C 2 d 3 Pi/sub g/ (v = 0) level. Perturbations of the same kind are present in the 13 C 2 spectrum at N' = 34 and N' = 44,48,52. The 12 C 13 C spectrum exhibits in the observed spectral range a unique perturbation for N' = 41
Indian Academy of Sciences (India)
Fascinating Organic Molecules from Nature - Colours in Flight - Pigments from Bird Feathers and Butterfly Wings · N R Krishnaswamy C N Sundaresan · More Details Fulltext PDF. Volume 18 Issue 3 March 2013 pp 218-225 Series Article. Fascinating Organic Molecules from Nature - Hunting with Poisoned Arrows: Story of ...
International Nuclear Information System (INIS)
Hao, Liang; Wang, Zhenwei; Zheng, Yaoqing; Li, Qianqian; Guan, Sujun; Zhao, Qian; Cheng, Lijun; Lu, Yun; Liu, Jizi
2017-01-01
Highlights: • TiO_2/TiC_0_._7N_0_._3 coatings were prepared by ball milling followed by oxidation. • In situ co-doping of C and N with simultaneous TiO_2 formation was observed. • Improved photocatalytic activity under UV/visible light was noticed. • Synergism in co-doping and heterojunction formation promoted carrier separation. - Abstract: Ball milling followed by heat oxidation was used to prepared C, N co-doped TiO_2 coatings on the surfaces of Al_2O_3 balls from TiC_0_._7N_0_._3 powder. The as-prepared coatings were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), X-ray photoelectron spectroscopy (XPS) and ultraviolet-visible spectrophotometer (UV–vis). The results show that continuous TiC_0_._7N_0_._3 coatings were formed after ball milling. C, N co-doped TiO_2/TiC_0_._7N_0_._3 composite coatings were prepared after the direct oxidization of TiC_0_._7N_0_._3 coatings in the atmosphere. However, TiO_2 was hardly formed in the surface layer of TiC_0_._7N_0_._3 coatings within a depth less than 10 nm during the heat oxidation of TiC_0_._7N_0_._3 coatings in carbon powder. Meanwhile, the photocatalytic activity evaluation of these coatings was conducted under the irradiation of UV and visible light. All the coatings showed photocatalytic activity in the degradation of MB no matter under the irradiation of UV or visible light. The C, N co-doped TiO_2/TiC_0_._7N_0_._3 composite coatings showed the most excellent performance. The enhancement under visible light irradiation should attribute to the co-doping of carbon and nitrogen, which enhances the absorption of visible light. The improvement of photocatalytic activity under UV irradiation should attribute to the synergistic effect of C, N co-doping, the formation of rutile-anatase mixed phases and the TiO_2/TiC_0_._7N_0_._3 composite microstructure.
2013-02-08
..., L.L.C.--Acquisition of Property--Golden Ring Travel & Transportation, Inc. AGENCY: Surface... authority under 49 U.S.C. 14303 to acquire the property of Golden Ring Travel & Transportation, Inc. (Golden... approximately 400 motor coaches and more than 500 drivers. Academy is indirectly controlled by the Tedesco...
Synthesis of nanostructured multiphase Ti(C,N)/a-C films by a plasma focus device
International Nuclear Information System (INIS)
Ghareshabani, E.; Rawat, R.S.; Sobhanian, S.; Verma, R.; Karamat, S.; Pan, Z.Y.
2010-01-01
Nanostructured multiphase Ti(C,N)/a-C films were deposited using a 3.3 kJ pulsed plasma focus device onto silicon (1 0 0) substrates at room temperature. The plasma focus device, fitted with solid titanium anode instead of usual hollow copper anode, was operated with nitrogen and Ar/CH 4 as the filling gas. Films were deposited with different number of shots, at 80 mm from top of the anode and at zero angular position with respect to anode axis. X-ray diffraction results show the diffraction peaks related to different compounds such as TiC 2 , TiN, Ti 2 CN, Ti and TiC 0.62 confirming the deposition of multiphase titanium carbo-nitride composite films on silicon. X-ray photoelectron spectroscopy confirms the formation of Ti-C, C-N, Ti-N, Ti-O and C-C bonds in the films. Scanning electron microscopy reveals that the nanostructure grains are agglomerates of smaller nanoparticles about 10-20 nm in size. Raman studies verify the formation of multiphase Ti(C,N) and also of amorphous graphite in the films. The maximum microhardness value of the composite film is 14.8 ± 1.3 GPa for 30 shots.
Directory of Open Access Journals (Sweden)
William G Miller
2012-04-01
Full Text Available Multilocus sequence typing (MLST systems have been reported previously for multiple food- and food animal-associated Campylobacter species (e.g. C. jejuni, C. coli, C. lari and C. fetus to both differentiate strains and identify clonal lineages. These MLST methods focused primarily on campylobacters of human clinical (e.g. C. jejuni or veterinary (e.g. C. fetus relevance. However, other, emerging, Campylobacter species have been isolated increasingly from environmental, food animal or human clinical samples. We describe herein MLST methods for five emerging Campylobacter species: C. hyointestinalis, C. lanienae, C. sputorum, C. concisus and C. curvus. The concisus/curvus method uses the loci aspA, atpA, glnA, gltA, glyA, ilvD and pgm, whereas the other methods use the seven loci defined for C. jejuni (i.e., aspA, atpA, glnA, gltA, glyA, pgm, and tkt. Multiple food animal and human clinical C. hyointestinalis (n=48, C. lanienae (n=34 and C. sputorum (n=24 isolates were typed, along with 86 human clinical C. concisus and C. curvus isolates. A large number of sequence types (STs were identified using all four MLST methods. Similar to Campylobacter MLST methods described previously, these novel MLST methods identified mixed isolates containing two or more strains of the same species. Additionally, these methods speciated unequivocally isolates that had been typed ambiguously using other molecular-based speciation methods, such as 16S rDNA sequencing. Finally, the design of degenerate primer pairs for some methods permitted the typing of related species; for example, the C. hyointestinalis primer pairs could be used to type C. fetus strains. Therefore, these novel Campylobacter MLST methods will prove useful in speciating and differentiating strains of multiple, emerging Campylobacter species.
The comparison of 18C(n; γ)19C and 18C(α; n)21O reaction rates: consequences for the r-process
International Nuclear Information System (INIS)
Dan, M.; Singh, G.; Chatterjee, R.; Shubhchintak
2017-01-01
Neutron rich light and medium mass nuclei play a major role in determining the reaction flow towards the r-process seed nuclei production. In this text, we calculate the neutron capture rate of 18 C and compare it with that of α-capture by the same nucleus in the temperature range T 9 = 0:1 - 10. This temperature range roughly equals to an energy range of 1 keV to 1 MeV in centre of mass frame, where it is very difficult to perform direct reaction experiments. Further, the theoretical construction of 18 C-n continuum state for the 18 C(n; γ) 19 C direct reaction is a tedious job
High Temperature Capacitive Pressure Sensor Employing a SiC Based Ring Oscillator
Meredith, Roger D.; Neudeck, Philip G.; Ponchak, George E.; Beheim, Glenn M.; Scardelletti, Maximilian; Jordan, Jennifer L.; Chen, Liang-Yu; Spry, David J.; Krawowski, Michael J.; Hunter, Gary W.
2011-01-01
In an effort to develop harsh environment electronic and sensor technologies for aircraft engine safety and monitoring, we have used capacitive-based pressure sensors to shift the frequency of a SiC-electronics-based oscillator to produce a pressure-indicating signal that can be readily transmitted, e.g. wirelessly, to a receiver located in a more benign environment. Our efforts target 500 C, a temperature well above normal operating conditions of commercial circuits but within areas of interest in aerospace engines, deep mining applications and for future missions to the Venus atmosphere. This paper reports for the first time a ring oscillator circuit integrated with a capacitive pressure sensor, both operating at 500 C. This demonstration represents a significant step towards a wireless pressure sensor that can operate at 500 C and confirms the viability of 500 C electronic sensor systems.
Energy Technology Data Exchange (ETDEWEB)
Mejia, I.S.; Escobar A, L.; Camps, E.; Romero, S. [ININ, 52045 Ocoyoacac, Estado de mexico (Mexico); Muhl, S. [IIM, UNAM, A.P. 364, 01000 Mexico D.F. (Mexico)
2006-07-01
Thin films of titanium nitride (TiN), amorphous carbon (a-C), as well as bilayers of Ti/TiN/a-C were deposited by means of the laser ablation technique. It was investigated the effect that it has the laser fluence used to ablation the targets in the structure and mechanical properties of the TiN deposited films. The TiN obtained films have a preferential orientation in the direction (200). The results show that the hardness of this material is influenced by the laser fluence. It is observed that the hardness is increased in an approximately lineal way with the increment of the fluence up to 19 J/cm{sup 2}. The films of amorphous carbon present hardness of the order of 11.2 GPa. Likewise it was found that the multilayers of Ti/TiN/aC presented a bigger hardness that of its individual components. (Author)
International Nuclear Information System (INIS)
Surber, B.W.; Baker, W.R.; Seif, L.
1991-01-01
The synthesis of [ 14 C]A-62514, 11-deoxy-11[carboxy(2-dimethylamino-[1- 14 C]ethyl)amino]-6-0-methyl-e rythromycin A 11,12-(cyclic ester), was performed in five steps. The key intermediate, [2- 14 C]N,N-dimethylethyl-enediamine, was obtained in 80% yield by reacting Eschenmoser's salt with K 14 CN and reducing the resulting [1- 14 C]N,N-dimethylglycinonitrile with H 2 and Raney Ni in methanol and ammonium hydroxide. The final product was obtained 97% radiochemically pure in an overall radiochemical yield of 14%, with a specific activity of 39 mCi/mmol. (author)
Koten, G. van; Meijer, M.D.; Wolf, E. de; Lutz, M.H.; Spek, A.L.; Klink, G.P.M. van
2001-01-01
The application of platinum(II) complexes based on the N,N-dimethylbenzylamine ligand (abbreviated as H-C,N) in macromolecular synthesis was demonstrated. Two cationic C,N-platinum moieties were linked with a 4,4'-bipyridine bridge, giving [{C6H4(CH2NMe2)-2-Pt(PPh3)}2(4,4'-bpy)](BF4)2 (2), the
Lee, Arum; Park, Eun-Byeol; Lee, Janghyun; Choi, Byong-Seok; Kang, Suk-Jo
2017-03-01
Cyclic GMP-AMP synthase (cGAS) is a DNA-sensing enzyme in the innate immune system. Recent studies using core-cGAS lacking the N terminus investigated the mechanism for binding of double-stranded (ds) DNA and synthesis of 2',3'-cyclic GMP-AMP (cGAMP), a secondary messenger that ultimately induces type I interferons. However, the function of the N terminus of cGAS remains largely unknown. Here, we found that the N terminus enhanced the activity of core-cGAS in vivo. Importantly, the catalytic activity of core-cGAS decreased as the length of double-stranded DNA (dsDNA) increased, but the diminished activity was restored by addition of the N terminus. Furthermore, the N terminus de-oligomerized the 2 : 2 complex of core-cGAS and dsDNA into a 1 : 1 complex, suggesting that the N terminus enhanced the activity of core-cGAS by facilitating formation of a monomeric complex of cGAS and DNA. © 2017 Federation of European Biochemical Societies.
Circadian clock protein KaiC forms ATP-dependent hexameric rings and binds DNA.
Mori, Tetsuya; Saveliev, Sergei V; Xu, Yao; Stafford, Walter F; Cox, Michael M; Inman, Ross B; Johnson, Carl H
2002-12-24
KaiC from Synechococcus elongatus PCC 7942 (KaiC) is an essential circadian clock protein in cyanobacteria. Previous sequence analyses suggested its inclusion in the RecADnaB superfamily. A characteristic of the proteins of this superfamily is that they form homohexameric complexes that bind DNA. We show here that KaiC also forms ring complexes with a central pore that can be visualized by electron microscopy. A combination of analytical ultracentrifugation and chromatographic analyses demonstrates that these complexes are hexameric. The association of KaiC molecules into hexamers depends on the presence of ATP. The KaiC sequence does not include the obvious DNA-binding motifs found in RecA or DnaB. Nevertheless, KaiC binds forked DNA substrates. These data support the inclusion of KaiC into the RecADnaB superfamily and have important implications for enzymatic activity of KaiC in the circadian clock mechanism that regulates global changes in gene expression patterns.
Semenov, K. N.; Ivanova, N. M.; Charykov, N. A.; Keskinov, V. A.; Kalacheva, S. S.; Duryagina, N. N.; Garamova, P. V.; Kulenova, N. A.; Nabieva, A.
2017-02-01
Concentration dependences of the density of aqueous solutions of bisadducts of light fullerene C60 and essential amino acids are studied by pycnometry. Concentration dependences of the average molar volumes and partial volumes of components (H2O and corresponding bisadducts) are calculated for C60(C6H13N2O2)2-H2O, C60(C4H8NO3)2-H2O, and C60(C5H9NO2)2-H2O binary systems at 25°C. Concentration dependences of the indices of refraction of C60(C6H13N2O2)2-H2O, C60(C4H8NO3)2-H2O, and C60(C5H9NO2)2-H2O binary systems are determined at 25°C. The concentration dependences of specific refraction and molar refraction of bisadducts and aqueous solutions of them are calculated.
Measurements of Ay(θ) for 12C(n,n)12C from En=2.2 to 8.5 MeV
International Nuclear Information System (INIS)
Roper, C.D.; Tornow, W.; Braun, R.T.; Chen, Q.; Crowell, A.; Trotter, D. Gonzalez; Howell, C.R.; Salinas, F.; Setze, R.; Walter, R.L.; Chen Zemin; Tang Hongqing; Zhou Zuying
2005-01-01
The analyzing power A y (θ) for neutron elastic scattering from 12 C has been measured for 33 neutron energies between E n =2.2 and 8.5 MeV in the angular range from 25 deg. to 145 deg. in the laboratory system. The primary motivation for these measurements is the need for an accurate knowledge of A y (θ) for 12 C(n,n) 12 C elastic scattering to enable corrections to high-precision neutron-proton and neutron-deuteron A y (θ) data in the neutron-energy range below E n =30 MeV. In their own right, 12 C(n,n) 12 C A y (θ) data are of crucial importance for improving both the parametrization of n- 12 C scattering and our knowledge of the level scheme of 13 C. The present A y (θ) data are compared with published data and previous phase-shift-analysis results
C59N Peapods Sensing the Temperature
Directory of Open Access Journals (Sweden)
Toshiro Kaneko
2013-01-01
Full Text Available We report the novel photoresponse of nanodevices made from azafullerene (C59N-encapsulated single-walled carbon nanotubes (C59N@SWNTs, so called peapods. The photoconducting properties of a C59N@SWNT are measured over a temperature range of 10 to 300 K under a field-effect transistor configuration. It is found that the photosensitivity of C59N@SWNTs depends very sensitively on the temperature, making them an attractive candidate as a component of nanothermometers covering a wide temperature range. Our results indicate that it is possible to read the temperature by monitoring the optoelectronics signal of C59N@SWNTs. In particular, sensing low temperatures would become more convenient and easy by giving a simple light pulse.
Measurement of 14C time scale of the rings of a tree by accelerator mass spectrometry
International Nuclear Information System (INIS)
Oda, Hirotaka; Furukawa, Michiaki; Yonenobu, Hitoshi; Ikeda, Akiko; Nakamura, Toshio.
1996-01-01
14 C time scale is different from a histrical data in order that it is calculated by assuming that the concentration of 14 C in the sample has not been changed by age. The object of this work is to make clear the errors in measurement of 14 C time scale of the ring of a tree known the tree age. The every year ring of a Hinoki in Kiso, 950 years old, was used as a sample. The most external ring is determined as 1923 years old on the basis of the dendrochronology. The rings after 1120 years were used as the samples. α-cellulose, the most stable component in the structural components of cell of tree, was prepared from each ring. About 8 mg of α-cellulose was reduced to graphite to be measured by the tandem thoron analytic meter. The results obtained showed that 14 C time scale was older than that of the histrical data in the twelfth and thirteenth century, but it was more new than that of the histrical data from the late seventeenth to the middle of eighteenth century. The results were agreement with that of Stuiver and Pearson (1933). (S.Y.)
Continuously tunable S and C+L bands ultra wideband erbium-doped fiber ring laser
International Nuclear Information System (INIS)
Wang, Q; Yu, Q X
2009-01-01
This paper presents an ultra wideband tunable silica-based erbium doped fiber ring laser (EDFRL) that can be continuously tuned in S and C+L bands from 1475 to 1619 nm. It is the first time that a fiber ring laser's tuning range reaches 144 nm using a standard silica-based C-band erbium-doped fiber as gain media. In the laser configuration two isolators are used in the fiber loop for suppressing the ASE in C-band and elevating the lasing gain in S-band. As a result the available lasing wavelength is extended toward the shorter wavelength of the gain bandwidth. The optimized erbium-doped fiber length, output coupling ratio and pumping laser power have been obtained through experimental study. This ring fiber laser has simple configuration, low threshold, flat laser spectral distribution and high signal-to-ASE-noise ratio. The laser will have many potential applications in fiber sensor wavelength interrogation, high-resolution spectroscopy and fiber optic communications
Directory of Open Access Journals (Sweden)
Kee-Rong Wu
2012-01-01
Full Text Available This study reports the effect of N,C-ITO (indium tin oxide layer on composite N,C-TiO2/N,C-ITO/ITO (Ti/TO electrode used for efficient photoelectrocatalytic (PEC degradation of aqueous pollutant with simultaneous hydrogen production. The structural properties of the composite Ti/TO electrode that determined by X-ray diffraction and Raman scattering, show primarily the crystallized anatase TiO2 phase and distinct diffraction patterns of polycrystalline In2O3 phase. Under solar light illumination, the composite Ti/TO electrode yields simultaneously a hydrogen production rate of 12.0 μmol cm−2 h−1 and degradation rate constant of cm−2 h−1 in organic pollutant. It implies that the overlaid N,C-TiO2 layer enhances not only the photocurrent response of the composite Ti/TO electrode at entire applied potentials, but also the flat band potential; a shift of about 0.1 V toward cathode, which is desperately beneficial in the PEC process. In light of the X-ray photoelectron spectroscopy findings, these results are attributable partly to the synergetic effect of N,C-codoping into the TiO2 and ITO lattices on their band gap narrowing and photosensitizing as well. Thus, the Ti/TO electrode can potentially serve an efficient PEC electrode for simultaneous pollutant degradation and hydrogen production.
Contribution to the study of the (U,Pu)C,N system; Contribution a l'etude du systeme (U,Pu)C,N
Energy Technology Data Exchange (ETDEWEB)
Lorenzelli, R [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires
1968-07-01
The reactions of UC, PuC, (U,Pu)C, UC{sub 2} and U(C{sub 1-x}O{sub x}) with nitrogen at moderate temperatures (room temperature to 400 C) are described. The influence of the uptake of nitrogen by the powders necessary to sinter the carbides upon the nature of the final product has been investigated; it has been shown that the sintered carbides are hyper-stoichiometric. The reactions of carbon with UN, PuN and (U,Pu)N has also been studied. Under vacuum, carbon reacts on the nitrides at temperatures as low as 1100 C; nitrogen is replaced by carbon and the final product is a carbonitride. The reaction is: MN + x C {yields} MN{sub 1-x}C{sub x} + x/2N{sub 2}. The reaction is limited and the carbonitrides have a fixed composition in presence of M{sub 2}C{sub 3} or MC{sub 2}; hence it is impossible to produce pure MC using the reaction. The ternary diagram U-C-N, Pu-C-N and (U,Pu)C-N have been drawn. They show clearly that it is possible to obtain single phase carbonitrides in a wide domain of compositions. (author) [French] On decrit les reactions avec l'azote de UC, PuC,(U,Pu)C,UC{sub 2} et U(C{sub 1-x}O{sub x}), par action directe de l'azote a temperature moderee (de l'ambiante a 450 C). On a etudie l'influence de la contamination par l'azote des poudres de carbures necessaires au frittage sur la nature des produits frittes; on a montre que les carbures frittes obtenus sont hyperstoechiometriques. On a etudie parallelement les reactions du carbone avec UN, PuN et (U,Pu)N. Sous vide le carbone reagit sur les nitrures des 1100 C: le carbone se substitue a l'azote; l'azote libere est elimine et le produit final est un carbonitrure. La reaction s'ecrit: MN + x C {yields} MN{sub 1-x}C{sub x} + x/2N{sub 2}. La reaction est limitee et les carbonitrures obtenus ont une composition limite fixe en presence des carbures superieurs M{sub 2}C{sub 3} et MC{sub 2}; il est donc impossible d'obtenir MC pur par cette reaction. Les diagrammes d'equilibre U-C-N, Pu-C-N et (U,Pu) C-N, ont
AMS measurement of C-14 concentration in a single-year ring of a 2500-yr-old tree
International Nuclear Information System (INIS)
Sakurai, H.; Gandou, T.; Kato, W.; Sawaki, Y.; Matsumoto, T.; Aoki, T.; Matsuzaki, H.; Gunji, S.; Tokanai, F.
2004-01-01
The 14 C concentration in rings of an old tree that date back approximately 2500 yr has been measured at single-year intervals with a highly accurate liquid scintillation counter (LSC) (0.2%) to investigate the 11-yr periodicity of solar activity. To investigate the applicability of AMS to accurate 14 C measurement, 16 graphite samples produced from the cellulose of a single-year tree ring of a 2500-yr-old cedar were measured with the micro analysis laboratory tandem (MALT) accelerator, at The University of Tokyo, and the results were compared with the 14 C age determined using LSC. The average 14 C age of the single-year tree ring calculated from 16 measurements was 2496 ± 23 yr BP, corresponding to the statistical accuracy of 0.26%. This was consistent with the age of 2514 ± 23 yr BP determined using LSC within the acceptable error range, which indicates that accelerator mass spectrometry (AMS) is applicable for accurate 14 C measurement using multi-graphite for the same single-year tree ring
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false 1-Propanaminium, N-(3-aminopropyl)-2... 1-Propanaminium, N-(3-aminopropyl)-2-hydroxy-N,N-dimethyl-3-sulfo-, N-(C12-18 and C18-unsatd. acyl... chemical substance identified as 1-Propanaminium, N-(3-aminopropyl)-2-hydroxy-N,N-dimethyl-3-sulfo-, N-(C12...
Theoretical investigation on structural stability of InN thin films on 3C-SiC(0 0 1)
International Nuclear Information System (INIS)
Ito, Takumi; Akiyama, Toru; Nakamura, Kohji; Ito, Tomonori
2008-01-01
The structural stability of InN thin films on 3C-SiC(0 0 1) substrate is systematically investigated based on an empirical interatomic potential, which incorporates electrostatic energy due to covalent bond charges and ionic charges. The calculated energy differences among coherently grown 3C-InN(0 0 1), 3C-InN(0 0 1) with misfit dislocations (MDs), and 2H-InN(0 0 0 1) imply that the coherently grown 3C-InN(0 0 1) is stable when the film thickness is less than 7 monolayers (MLs) while 2H-InN(0 0 0 1) is stabilized for the thickness beyond 8 MLs. This is because InN layers in 2H-InN(0 0 0 1) are fully relaxed by one MD. The analysis of atomic configuration at the 3C-InN(0 0 1)/3C-SiC(0 0 1) interfaces reveals that the coordination number of interfacial atoms is quite different from that in the bulk region. Thus, 3C-InN(0 0 1) with MDs on 3C-SiC(0 0 1) is always metastable over entire range of film thickness, consistent with the successful fabrication of 2H-InN(0 0 0 1) on 3C-SiC(0 0 1) by the molecular beam epitaxy. These results suggest that the mismatch in atomic arrangements at the interface crucially affects the structural stability of InN thin films on 3C-SiC(0 0 1) substrate
t-3-Benzyl-r-2,c-6-diphenylpiperidin-4-one oxime
Directory of Open Access Journals (Sweden)
R. Arulraj
2016-12-01
Full Text Available In the title compound, C24H24N2O [systematic name: (E-3-benzyl-2,6-diphenylpiperidin-4-one oxime], the piperidine ring adopts a slightly distorted chair conformation and the phenyl rings and the benzyl group substituents are attached equatorially. The oxime group makes a dihedral angle of 42.88 (12° with the piperidine ring. The dihedral angle between the phenyl rings is 71.96 (8°. The benzyl ring makes dihedral angles of 63.01 (8 and 59.35 (8° with the two phenyl rings. In the crystal, molecules are linked by O—H...N hydrogen bonds, forming C(7 chains along the c axis. The chains are linked by C—H...π interactions, forming slabs lying parallel to the bc plane.
Directory of Open Access Journals (Sweden)
C. Jorge Gutiérrez, Dr.
2010-09-01
Full Text Available Se estima que por lo menos el 50% de los cánceres pueden ser prevenidos. Una medida fundamental es la eliminación de factores ambientales como la exposición a la luz ultravioleta y substancias químicas carcinogenéticas. Otro punto fundamental es las modificaciones en el estilo de vida. La medida más importante es desde luego la suspensión del tabaco, pero también evitar la obesidad y la vida sedentaria. El descubrimiento de factores infecciosos ha abierto otro camino de prevención como es la adquisición de la vacuna para virus papilomas involucrados en el cáncer cervicouterino. Por otro lado varios tipos de cáncer presentan una evolución larga, muchas veces con lesiones pre malignas, lo que permite un programa de pesquisa para un diagnóstico precoz. Ejemplos de éxito en este sentido han sido las campañas del cáncer cervicouterino, mama y colon. Se ha podido disminuir la aparición de cáncer en poblaciones de mayor riesgo recurriendo a medidas de quimioprevención como, por ejemplo, el uso de moduladores selectivos del receptor de estrógeno en cáncer de mama. Finalmente, el conocimiento de genes alterados como causa de la aparición de cáncer ha permitido implementar medidas especiales para ese sector de alto riesgo.
METER-SIZED MOONLET POPULATION IN SATURN'S C RING AND CASSINI DIVISION
International Nuclear Information System (INIS)
Baillié, Kévin; Colwell, Joshua E.; Esposito, Larry W.; Lewis, Mark C.
2013-01-01
Stellar occultations observed by the Cassini Ultraviolet Imaging Spectrograph reveal the presence of transparent holes a few meters to a few tens of meters in radial extent in otherwise optically thick regions of the C ring and the Cassini Division. We attribute the holes to gravitational disturbances generated by a population of ∼10 m boulders in the rings that is intermediate in size between the background ring particle size distribution and the previously observed ∼100 m propeller moonlets in the A ring. The size distribution of these boulders is described by a shallower power-law than the one that describes the ring particle size distribution. The number and size distribution of these boulders could be explained by limited accretion processes deep within Saturn's Roche zone.
12C(n , 2 n )11C cross section from threshold to 26.5 MeV
Yuly, M.; Eckert, T.; Hartshaw, G.; Padalino, S. J.; Polsin, D. N.; Russ, M.; Simone, A. T.; Brune, C. R.; Massey, T. N.; Parker, C. E.; Fitzgerald, R.; Sangster, T. C.; Regan, S. P.
2018-02-01
The 12C(n ,2 n )11C cross section was measured from just below threshold to 26.5 MeV using the Pelletron accelerator at Ohio University. Monoenergetic neutrons, produced via the 3H(d ,n )4He reaction, were allowed to strike targets of polyethylene and graphite. Activation of both targets was measured by counting positron annihilations resulting from the β+ decay of 11C. Annihilation gamma rays were detected, both in coincidence and singly, using back-to-back NaI detectors. The incident neutron flux was determined indirectly via 1H(n ,p ) protons elastically scattered from the polyethylene target. Previous measurements fall into upper and lower bands; the results of the present measurement are consistent with the upper band.
Directory of Open Access Journals (Sweden)
Aparicio, M.
2001-12-01
Full Text Available The factor which currently precludes the use of carbon fibre reinforced silicon carbide (C/SiC in high temperature structural applications is the oxidation of carbon fibres at temperatures greater than 450ºC (1. For this reason, it is necessary to develop coatings capable of protecting C/SiC components from oxidation for extended periods at 1600ºC. Conventional coatings consist of multilayers of different materials with complementary antioxidant properties. The objective of this work was to develop a multilayer coating consisted by a bonding layer of SiC, a intermediate layer of yttrium silicates: Y2Si2O7 and Y2SiO5, and an external layer of SiO2. Different techniques have been used to prepare the layers: painting with policarbosilane solutions, slip-coating and sol-gel, respectively. The behaviour against oxidation of coated composite material has been evaluated, and the samples before and after oxidation has been characterised by SEM. The cracking of SiC coating leads to a very low oxidation resistance at low temperatures. Only when the substrate is protected by the trilayer coating the reduction of the oxidation rate is considerable, and the weight loss is reduced from 50% (with a SiC coating to 15%.
El principal inconveniente para la utilización de los materiales compuestos C/SiC en aplicaciones estructurales de alta temperatura es la elevada velocidad de oxidación de la fibra de carbono por encima de 450°C (1. Por esta razón, es necesario el desarrollo de recubrimientos capaces de proteger de la oxidación a estos materiales durante periodos prolongados a temperaturas de hasta 1600°C. Habitualmente, los recubrimientos están formados por multicapas con características antioxidantes complementarias. El objetivo de este trabajo ha sido el desarrollo de un recubrimiento multicapa formado por una capa interior de SiC, una intermedia de silicatos de itrio: Y2Si2O7 y Y2SiO5, y una exterior de SiO2. En su procesamiento se han
ΛcN interaction from lattice QCD and its application to Λc hypernuclei
Miyamoto, Takaya; Aoki, Sinya; Doi, Takumi; Gongyo, Shinya; Hatsuda, Tetsuo; Ikeda, Yoichi; Inoue, Takashi; Iritani, Takumi; Ishii, Noriyoshi; Kawai, Daisuke; Murano, Keiko; Nemura, Hidekatsu; Sasaki, Kenji
2018-03-01
The interaction between Λc and a nucleon (N) is investigated by employing the HAL QCD method in the (2 + 1)-flavor lattice QCD on a (2.9fm) 3 volume at mπ ≃ 410 , 570 , 700 MeV. We study the central potential in S10 channel as well as central and tensor potentials in S31-3D1 channel, and find that the tensor potential for Λc N is negligibly weak and central potentials in both S10 and S31-3D1 channels are almost identical with each other except at short distances. Phase shifts and scattering lengths calculated with these potentials show that the interaction of Λc N system is attractive and has a similar strength in S10 and S31 channels at low energies (i.e. the kinetic energy less than about 40 MeV). While the attractions are not strong enough to form two-body bound states, our results lead to a possibility to form Λc hypernuclei for sufficiently large atomic numbers (A). To demonstrate this, we derive a single-folding potential for Λc hypernuclei from the Λc-nucleon potential obtained in lattice QCD, and find that Λc hypernuclei can exist for A ≥ 12 with the binding energies of a few MeV. We also estimate the Coulomb effect for the Λc hypernuclei.
Electron paramagnetic resonance study on n-type electron-irradiated 3C-SiC
Energy Technology Data Exchange (ETDEWEB)
Carlsson, P; Rabia, K; Son, N T; Janzen, E [Department of Physics, Chemistry and Biology, Linkoeping University, SE-581 83 Linkoeping (Sweden); Ohshima, T; Morishita, N; Itoh, H [Japan Atomic Energy Research Institute, Takasaki 370-1292 (Japan); Isoya, J [University of Tsukuba, Tsukuba 305-8550 (Japan)], E-mail: paca@ifm.liu.se
2008-03-15
Electron Paramagnetic Resonance (EPR) was used to study defects in n-type 3C-SiC films irradiated by 3-MeV electrons at room temperature with a dose of 2x10{sup 18} cm{sup -2}. After electron irradiation, two new EPR spectra with an effective spin S = 1, labeled L5 and L6, were observed. The L5 center has C{sub 3v} symmetry with g = 2.004 and a fine-structure parameter D = 436.5x10{sup -4} cm{sup -1}. The L5 spectrum was only detected under light illumination and it could not be detected after annealing at {approx}550{sup 0}C. The principal z-axis of the D tensor is parallel to the <111>-directions, indicating the location of spins along the Si-C bonds. Judging from the symmetry and the fact that the signal was detected under illumination in n-type material, the L5 center may be related to the divacancy in the neutral charge state. The L6 center has a C{sub 2v}-symmetry with an isotropic g-value of g = 2.003 and the fine structure parameters D = 547.7x10{sup -4} cm{sup -1} and E = 56.2x10{sup -4} cm{sup -1}. The L6 center disappeared after annealing at a rather low temperature ({approx}200 deg. C), which is substantially lower than the known annealing temperatures for vacancy-related defects in 3C-SiC. This highly mobile defect may be related to carbon interstitials.
Synthesis of [methyl-[sup 14]C]-N-methylputrescine
Energy Technology Data Exchange (ETDEWEB)
Secor, H.V.; Izac, R.R.; Hassam, S.B.; Frisch, A.F. (Philip Morris Research Center, Richmond, VA (United States))
1994-05-01
[Methyl-[sup 14]C]-N-methylputrescine was prepared from [[sup 14]C]methylamine hydrochloride in five steps. Reaction of benzaldehyde and [[sup 14]C]methylamine (10 mCi) followed by catalytic hydrogenation yielded [methyl-[sup 14]C]-N-methylbenzylamine. The key step in this process is the alkylation of [methyl-[sup 14]C]-N-methylbenzylamine in aqueous medium with 4-bromobutyronitrile. The radiochemical purity of the final product after two successive catalytic hydrogenations was in excess of 97%. The radiochemical yields in two successive runs were 26 and 38%, based on starting [[sup 14]C]methylamine, with specific activities of 22 and 23 mCi/mmol, respectively. This sequence provides a convenient and efficient regioselective radiosynthesis of [methyl-[sup 14]C]-N-methylputrescine. (author).
Mo, Jiayu; Müller, Thomas; Oliveira, João C A; Ackermann, Lutz
2018-06-25
C-H activation bears great potential for enabling sustainable molecular syntheses in a step- and atom-economical manner, with major advances having been realized with precious 4d and 5d transition metals. In contrast, we employed earth abundant, nontoxic iron catalysts for versatile allene annulations through a unique C-H/N-H/C-O/C-H functionalization sequence. The powerful iron catalysis occurred under external-oxidant-free conditions even at room temperature, while detailed mechanistic studies revealed an unprecedented 1,4-iron migration regime for facile C-H activations. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Contribution to the study of the (U,Pu)C,N system; Contribution a l'etude du systeme (U,Pu)C,N
Energy Technology Data Exchange (ETDEWEB)
Lorenzelli, R. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires
1968-07-01
The reactions of UC, PuC, (U,Pu)C, UC{sub 2} and U(C{sub 1-x}O{sub x}) with nitrogen at moderate temperatures (room temperature to 400 C) are described. The influence of the uptake of nitrogen by the powders necessary to sinter the carbides upon the nature of the final product has been investigated; it has been shown that the sintered carbides are hyper-stoichiometric. The reactions of carbon with UN, PuN and (U,Pu)N has also been studied. Under vacuum, carbon reacts on the nitrides at temperatures as low as 1100 C; nitrogen is replaced by carbon and the final product is a carbonitride. The reaction is: MN + x C {yields} MN{sub 1-x}C{sub x} + x/2N{sub 2}. The reaction is limited and the carbonitrides have a fixed composition in presence of M{sub 2}C{sub 3} or MC{sub 2}; hence it is impossible to produce pure MC using the reaction. The ternary diagram U-C-N, Pu-C-N and (U,Pu)C-N have been drawn. They show clearly that it is possible to obtain single phase carbonitrides in a wide domain of compositions. (author) [French] On decrit les reactions avec l'azote de UC, PuC,(U,Pu)C,UC{sub 2} et U(C{sub 1-x}O{sub x}), par action directe de l'azote a temperature moderee (de l'ambiante a 450 C). On a etudie l'influence de la contamination par l'azote des poudres de carbures necessaires au frittage sur la nature des produits frittes; on a montre que les carbures frittes obtenus sont hyperstoechiometriques. On a etudie parallelement les reactions du carbone avec UN, PuN et (U,Pu)N. Sous vide le carbone reagit sur les nitrures des 1100 C: le carbone se substitue a l'azote; l'azote libere est elimine et le produit final est un carbonitrure. La reaction s'ecrit: MN + x C {yields} MN{sub 1-x}C{sub x} + x/2N{sub 2}. La reaction est limitee et les carbonitrures obtenus ont une composition limite fixe en presence des carbures superieurs M{sub 2}C{sub 3} et MC{sub 2}; il est donc impossible d'obtenir MC pur par cette reaction. Les diagrammes
Energy Technology Data Exchange (ETDEWEB)
Pichat, L; Audinot, M [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1961-07-01
The sodium derivative of 5-3-4 dibenzyl oxyphenyl 2-oxazolidinone reacted with methyl iodide {sup 14}C, in stoichiometric quantity, gives rise to the corresponding N-methyl {sup 14}C derivative. The oxazolidinone ring is opened by concentrated hydrochloric acid and the benzyl groups removed by catalytic hydrogenolysis. Adrenaline methyl {sup 14}C is then purified on Dowex 50 X-12 exchange resin. Overall-yield is 45 per cent based upon methyl iodide {sup 14}C. (author) [French] Le derive sode de la (dibenzyloxy-3-4-phenyl)-5 oxazolidinone-2 traite par l'iodure de methyle {sup 14}C, en proportion stoechiometrique, fournit le derive N-methyle {sup 14}C correspondant. Apres ouverture du cycle oxazolidinone par HCL concentre et debenzylation par hydrogenation catalytique, on purifie l'adrenaline (methyle {sup 14}C) par chromatographie sur resine echangeuse Dowex 50 X-12. Le rendement est de 45 pour cent par rapport a l'iodure de methyle {sup 14}C. (auteurs)
Energy Technology Data Exchange (ETDEWEB)
Pichat, L.; Audinot, M. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1961-07-01
The sodium derivative of 5-3-4 dibenzyl oxyphenyl 2-oxazolidinone reacted with methyl iodide {sup 14}C, in stoichiometric quantity, gives rise to the corresponding N-methyl {sup 14}C derivative. The oxazolidinone ring is opened by concentrated hydrochloric acid and the benzyl groups removed by catalytic hydrogenolysis. Adrenaline methyl {sup 14}C is then purified on Dowex 50 X-12 exchange resin. Overall-yield is 45 per cent based upon methyl iodide {sup 14}C. (author) [French] Le derive sode de la (dibenzyloxy-3-4-phenyl)-5 oxazolidinone-2 traite par l'iodure de methyle {sup 14}C, en proportion stoechiometrique, fournit le derive N-methyle {sup 14}C correspondant. Apres ouverture du cycle oxazolidinone par HCL concentre et debenzylation par hydrogenation catalytique, on purifie l'adrenaline (methyle {sup 14}C) par chromatographie sur resine echangeuse Dowex 50 X-12. Le rendement est de 45 pour cent par rapport a l'iodure de methyle {sup 14}C. (auteurs)
Directory of Open Access Journals (Sweden)
Kaijun Luo
2011-11-01
Full Text Available The title compound, [Ir(C11H8N2(C17H19O2], has an octahedral coordination geometry around the IrIII atom, retaining the cis-C,C,trans–N,N chelate disposition of the two 2-phenylpyridine ligands. The chelate rings are nearly mutually perpendicular [the interplanar angles range from 85.48 (17 to 89.17 (19°]. The two 2-(2-pyridylphenyl ligands are approximately planar, with the plane of the phenyl ring being inclined to that of the pyridine ring by 2.3 (3 and 5.1 (3° in the two ligands. The interplanar angle between the phenyl ring in 3-benzoyl-camphor and the IrO2C3 chelate ring is 35.5 (2°.
International Nuclear Information System (INIS)
Hawke, D.J.; Clark, J.M.
2010-01-01
Seabird burrows provide a soil environment for processing discards such as feathers and guano, hence constituting a primary interface between the sea and the land. This study involved collection and culturing of soil invertebrates from three blue penguin (Eudyptula minor) burrows, and examined their 13 C/ 12 C and 15 N/ 14 N isotopic composition in relation to potential burrow resources (terrestrial plant litter, burrow soil, guano, blue penguin feathers). Two taxa (cerylonid beetles and small tineid moth larvae) had a depleted 13 C/ 12 C indicative of a level of dependence on C from terrestrial soil. Tineid moth larvae (Monopis crocicapitella and (or) M. ethelella) substantially increased their 13 C/ 12 C enrichment during development, implying increasing dependence on marine C. Remaining taxa, both decomposers and predators, had 13 C/ 12 C intermediate between guano and feathers. Larval and emergent fleas had the most enriched 13 C/ 12 C , indicative of a greater dependence on feather C and the likelihood of co-processing with guano. Pseudoscorpions and histerid beetles had overlapping isotopic enrichments implying competition for prey, but were spatially separated in burrow soil. With their highly enriched 15 N/ 14 N and marine 13 C/ 12 C, larvae and protonymphs of the histiostomatid mite Myianoetus antipodus stood alone. Blue penguin burrows therefore support a diverse invertebrate fauna that incorporates terrestrial soil as well as varying proportions of the various blue penguin discards. (author). 45 refs., 1 fig., 1 tab.
Zang, Hongjun; Chen, Eugene Y. X.
2015-01-01
There is increasing interest in the upgrading of C5 furfural (FF) and C6 5-hydroxymethyl furfural (HMF) into C10 and C12 furoins as higher energy-density intermediates for renewable chemicals, materials, and biofuels. This work utilizes the organocatalytic approach, using the in situ generated N,S-heterocyclic carbene catalyst derived from thiazolium ionic liquids (ILs), to achieve highly efficient self-coupling reactions of FF and HMF. Specifically, variations of the thiazolium IL structure have led to the most active and efficient catalyst system of the current series, which is derived from a new thiazolium IL carrying the electron-donating acetate group at the 5-ring position. For FF coupling by this IL (0.1 mol %, 60 °C, 1 h), when combined with Et3N, furoin was obtained in >99% yield. A 97% yield of the C12 furoin was also achieved from the HMF coupling by this catalyst system (10 mol % loading, 120 °C, 3 h). On the other hand, the thiazolium IL bearing the electron-withdrawing group at the 5-ring position is the least active and efficient catalyst. The mechanistic aspects of the coupling reaction by the thiazolium catalyst system have also been examined and a mechanism has been proposed. PMID:25830482
Directory of Open Access Journals (Sweden)
Hongjun Zang
2015-03-01
Full Text Available There is increasing interest in the upgrading of C5 furfural (FF and C6 5-hydroxymethyl furfural (HMF into C10 and C12 furoins as higher energy-density intermediates for renewable chemicals, materials, and biofuels. This work utilizes the organocatalytic approach, using the in situ generated N,S-heterocyclic carbene catalyst derived from thiazolium ionic liquids (ILs, to achieve highly efficient self-coupling reactions of FF and HMF. Specifically, variations of the thiazolium IL structure have led to the most active and efficient catalyst system of the current series, which is derived from a new thiazolium IL carrying the electron-donating acetate group at the 5-ring position. For FF coupling by this IL (0.1 mol %, 60 °C, 1 h, when combined with Et3N, furoin was obtained in >99% yield. A 97% yield of the C12 furoin was also achieved from the HMF coupling by this catalyst system (10 mol % loading, 120 °C, 3 h. On the other hand, the thiazolium IL bearing the electron-withdrawing group at the 5-ring position is the least active and efficient catalyst. The mechanistic aspects of the coupling reaction by the thiazolium catalyst system have also been examined and a mechanism has been proposed.
MIL-100-Fe derived N-doped Fe/Fe3C@C electrocatalysts for efficient oxygen reduction reaction
Guo, Dakai; Han, Sancan; Wang, Jiacheng; Zhu, Yufang
2018-03-01
N-doped porous Fe/Fe3C@C electrocatalysts were prepared by the pyrolysis of the hexamethylenetetramine (HMT)-incorporated MIL-100-Fe at different temperatures (700-1000 °C) under N2 atmosphere. Rotary evaporation of MIL-100-Fe and HMT solution could make more N-enriched HMT molecules enter into the pores of MIL-100-Fe, thus improving nitrogen contents of the final pyrolyzed samples. All pyrolyzed samples show porous textures with middle specific surface areas. The X-ray photoelectron spectroscopy (XPS) results demonstrate the successful introduction of N atoms into carbon framework. Sample Fe-N2-800 prepared by annealing the precursors with the HMT/MIL-100-Fe weight ratio of 2 at 800 °C exhibits the best electrocatalytic activity towards the oxygen reduction reaction (ORR) in terms of onset potential and current density because of high graphitic N and pyridinic N content. The enwrapped Fe/Fe3C nanoparticles and Fe-Nx active sites in these samples could also boost the ORR activity synergistically. Moreover, sample Fe-N2-800 demonstrates a dominant four electron reduction process, as well as excellent long-term operation stability and methanol crossover resistance. Thus, the N-doped Fe/Fe3C@C composites derived from the HMT-incorporated MIL-100-Fe are promising electrocatalysts to replace Pt/C for ORR in practical applications.
International Nuclear Information System (INIS)
Rana, J.; Robins, D.J.
1985-01-01
The labelling patterns in (+)-lupanine, (+)-13-hydroxylupanine, and (+)-angustifoline derived biosynthetically from [1-amino- 15 N,1- 13 C]-1,5-diaminopentane (cadaverine) have been established by 13 C n.m.r. spectroscopy. Three cadaverine units are incorporated to about the same extent into each of these three alkaloids. The presence of two doublets due to 13 C- 15 N coupling in the 13 C brace 1 H brace n.m.r. spectra associated with C-2 and C-15 of lupanine and 13-hydroxylupanine, and one 13 C- 15 N doublet at C-2 of angustifoline, indicate that two of the cadaverine units are converted into the outer rings of the tetracyclic quinolizidine alkaloids in a specific fashion. (author)
Preliminary study on the relationship between trends of tree-ring δ 13C series and site conditions
International Nuclear Information System (INIS)
Chen Tuo; Qin Dahe; Liu Xiaohong; Ren Jiawen
2001-01-01
The long-term trends of tree-ring δ 13 C series, taken respectively from Qilian of Qinghai and Zhaosu and Aleitai of xinjiang were compared. The results showed that a similar trend existed between Qilian series and Zhaosu series, while there was a significant difference between them and Aleitai series. The authors' analysis indicated that the site difference of the trends of tree-ring δ 13 C series was mainly associated with 'canopy effects' of tree growth. It is suggested that tree samples should be selected from sparse forests or the sampled tree foliage high above the whole canopy when the history of δ 13 C of atmospheric CO 2 was reconstructed by tree-ring series
The 12C(n, 2n)11C cross section from threshold to 26.5 MeV.
Yuly, M; Eckert, T; Hartshaw, G; Padalino, S J; Polsin, D N; Russ, M; Simone, A T; Brune, C R; Massey, T N; Parker, C E; Fitzgerald, R; Sangster, T C; Regan, S P
2018-02-01
The 12 C(n, 2n) 11 C cross section was measured from just below threshold to 26.5 MeV using the Pelletron accelerator at Ohio University. Monoenergetic neutrons, produced via the 3 H(d,n) 4 He reaction, were allowed to strike targets of polyethylene and graphite. Activation of both targets was measured by counting positron annihilations resulting from the β + decay of 11 C. Annihilation gamma rays were detected, both in coincidence and singly, using back-to-back NaI detectors. The incident neutron flux was determined indirectly via 1 H(n,p) protons elastically scattered from the polyethylene target. Previous measurements fall into upper and lower bands; the results of the present measurement are consistent with the upper band.
Initial report on stress-corrosion-cracking experiments using Zircaloy-4 spent fuel cladding C-rings
International Nuclear Information System (INIS)
Smith, H.D.
1988-09-01
The Nevada Nuclear Waste Storage Investigations (NNWSI) Project is sponsoring C-ring stress corrosion cracking scoping experiments as a first step in evaluating the potential for stress corrosion cracking of spent fuel cladding in a potential tuff repository environment. The objective is to scope the approximate behavior so that more precise pressurized tube testing can be performed over an appropriate range of stress, without expanding the long-term effort needlessly. The experiment consists of stressing, by compression with a dead weight load, C-rings fabricated from spent fuel cladding exposed to an environment of Well J-13 water held at 90/degree/C. The results indicate that stress corrosion cracking occurs at the high stress levels employed in the experiments. The cladding C-rings, tested at 90% of the stress at which elastic behavior is obtained in these specimens, broke in 25 to 64 d when tested in water. This was about one third of the time required for control tests to break in air. This is apparently the first observation of stress corrosion under the test conditions of relatively low temperature, benign environment but very high stress. The 150 ksi test stress could be applied as a result of the particular specimen geometry. By comparison, the uniaxial tensile yield stress is about 100 to 120 ksi and the ultimate stress is about 150 ksi. When a general model that fits the high stress results is extrapolated to lower stress levels, it indicates that the C-rings in experiments now running at /approximately/80% of the yield strength should take 200 to 225 d to break. 21 refs., 24 figs., 5 tabs
Infrared Fixed Point Physics in ${\\rm SO}(N_c)$ and ${\\rm Sp}(N_c)$ Gauge Theories
DEFF Research Database (Denmark)
Ryttov, Thomas A.; Shrock, Robert
2017-01-01
We study properties of asymptotically free vectorial gauge theories with gauge groups $G={\\rm SO}(N_c)$ and $G={\\rm Sp}(N_c)$ and $N_f$ fermions in a representation $R$ of $G$, at an infrared (IR) zero of the beta function, $\\alpha_{IR}$, in the non-Abelian Coulomb phase. The fundamental, adjoint......_{\\bar\\psi\\psi,IR}$ increases monotonically with decreasing $N_f$ in the non-Abelian Coulomb phase. Using this property, we give a new estimate of the lower end of this phase for some specific realizations of these theories....
Aziridines in the synthesis of 11C- and 18F-labelled compounds
International Nuclear Information System (INIS)
Gillings, N.M.
1998-01-01
Racemic [4- 11 C]aspartic acid, [4- 11 C]asparagine and 2,4-diamino[4- 11 C]butyric acid were synthesised by the ring-opening of an N-activated aziridine-2-carboxylate with 11 C]cyanide, followed by preparative HPLC and hydrolysis/reduction. These labelled amino acids arise from nucleophilic attack at the β-carbon of the aziridine ring. A radioactive by-product of ca. 25% was attributed to the product of α-attack. Several N-activated 2-aryl aziridines were synthesised for the attempted synthesis of β-[ 18 F] fluorophenylalanine and β-[ 18 F]fluorodopa. Ring-opening with [ 18 F]fluoride showed no evidence of β-fluorinated products and it is proposed that attack occurs exclusively at the α-carbon, giving the corresponding α-[ 18 F]fluoro-β-amino acids. Further evidence for this was the reaction of the β-unsubstituted N-activated aziridine-2-carboxylate with [ 18 F]fluoride. This reaction was totally regiospecific and afforded exclusively the α-substituted product, α-[ 18 F]fluoro-β-alanine. Aziridine precursors were resolved by chiral HPLC. On labelling the chiral aziridines, however, racemic 11 C- and 18 F-labelled amino acids were obtained. This was attributed to racemisation of the initially formed ring-opened products. The use of [ 11 C]methyl lithium as a nucleophile for aziridine ring-opening was investigated. Reaction was expected to occur at low temperature, thus potentially avoiding racemisation. No products corresponding to aziridine ring-opening with [ 11 C]methyl lithium were, however, observed. A difluorinated analogue of amphetamine was synthesised by fluorination of an azirine (via an aziridine). This racemic compound was resolved as its chiral tartarate salts and subsequently labelled by methylation with [ 11 C]methyl iodide, giving the novel compound β, β-difluoro[N-methyl- 11 C]methamphetamine in high specific activity for in vivo binding studies using positron emission tomography. The non-radioactive reference compound was also
International Nuclear Information System (INIS)
Xu, Qingzhong; Zhao, Jun; Ai, Xing; Qin, Wenzhen; Wang, Dawei; Huang, Weimin
2015-01-01
To optimize the Mo 2 C content in Ti(C,N)-based cermet tool materials used for cutting the high-strength steel of 42CrMo (AISI 4140/4142 steel), the cermets with different Mo 2 C/(Mo 2 C + WC) weight ratios were prepared. And the microstructure and mechanical properties of cermets were investigated by scanning electron microscope (SEM), X-ray diffraction (XRD) and measurements of transverse rupture strength (TRS), Vickers hardness (HV) and fracture toughness (K IC ). The results indicate that the Mo 2 C/(Mo 2 C + WC) ratios have great influences on the microstructure features and mechanical properties of Ti(C,N)-based cermets. When the Mo 2 C/(Mo 2 C + WC) ratio increases, the Ti(C,N) grains become finer with smaller black cores surrounded by thinner rims, and the structure of cermets tends to be more compact with smaller binder mean free path. Owing to the medium grains and moderate rims, the cermets with a Mo 2 C/(Mo 2 C + WC) ratio of 0.4 exhibit better mechanical properties, and can be chosen as the tool material for machining 42CrMo steel due to the lower Mo content. - Highlights: • Mo 2 C/(Mo 2 C + WC) ratios affect microstructure and mechanical properties of cermets. • Grains become fine and structure of cermets tends to be compact with raised Mo 2 C. • The cermets with a Mo 2 C/(Mo 2 C + WC) ratio of 0.4 can be used to machine 42CrMo steel
Harris, Samantha P; Belknap, Betty; Van Sciver, Robert E; White, Howard D; Galkin, Vitold E
2016-02-09
Mutations in genes encoding myosin, the molecular motor that powers cardiac muscle contraction, and its accessory protein, cardiac myosin binding protein C (cMyBP-C), are the two most common causes of hypertrophic cardiomyopathy (HCM). Recent studies established that the N-terminal domains (NTDs) of cMyBP-C (e.g., C0, C1, M, and C2) can bind to and activate or inhibit the thin filament (TF). However, the molecular mechanism(s) by which NTDs modulate interaction of myosin with the TF remains unknown and the contribution of each individual NTD to TF activation/inhibition is unclear. Here we used an integrated structure-function approach using cryoelectron microscopy, biochemical kinetics, and force measurements to reveal how the first two Ig-like domains of cMyPB-C (C0 and C1) interact with the TF. Results demonstrate that despite being structural homologs, C0 and C1 exhibit different patterns of binding on the surface of F-actin. Importantly, C1 but not C0 binds in a position to activate the TF by shifting tropomyosin (Tm) to the "open" structural state. We further show that C1 directly interacts with Tm and traps Tm in the open position on the surface of F-actin. Both C0 and C1 compete with myosin subfragment 1 for binding to F-actin and effectively inhibit actomyosin interactions when present at high ratios of NTDs to F-actin. Finally, we show that in contracting sarcomeres, the activating effect of C1 is apparent only once low levels of Ca(2+) have been achieved. We suggest that Ca(2+) modulates the interaction of cMyBP-C with the TF in the sarcomere.
Micron-scale intra-ring analyses of δ13C in early Eocene Arctic wood from Ellesmere Island
Schubert, B.; Jahren, H.; Eberle, J.; Sternberg, L.
2009-12-01
Early Eocene (ca. 53 Ma) fossil assemblages on Ellesmere Island (75 oN paleolatitude), provide rich information about the plant and animal life of the lush polar ecosystems of the time. Fossil wood recovered from Ellesmere Island is abundant and not permineralized; however, morphological features such as growth rings and resin canals have been obliterated by compression. We report on exceptionally high-resolution intra-ring analyses of δ13C within fossil wood, sampled at ~30 micron intervals across several centimeters of wood sample. Clear patterns in systematic seasonal increases and decreases in wood δ13C allowed us to identify at least 5 annual cycles in the wood. The patterns of increase and decrease in δ13C were consistent with patterns observed for evergreen wood, and distinct from the deciduous patterns we have observed for Metasequoia fossil wood from the middle Eocene (ca. 45 Ma) Arctic site on Axel Heiberg Island. We believe that the high point in the δ13C value of wood seen in each cycle corresponds to the highest environmental temperatures during the annual cycle, as has been seen for modern evergreens (e.g., Barbour et al., 2002). Modern studies have also noted that high temperature periods are correlated with the highest vapor-pressure and soil-water deficits of the annual cycle; these environmental factors would cause the plant to change its discrimination during photosynthesis. We will discuss the relatively low amplitude of δ13C fluctuations (0.5-1.0 ‰) clearly defined by Ellesmere fossil wood, in comparison to observations on modern common evergreens (2.0-4.0 ‰), and speculate that this difference implies greatly dampened seasonal temperature fluctuations in Eocene polar environments, relative to today. Barbour M.M., Walcroft A.S., Farquhar G.D., 2002, Seasonal variation in δ13C and δ18O of cellulose from growth rings of Pinus radiata. Plant, Cell and Environment: v. 25, p. 1483-1499.
Phase diagrams for pseudo-binary carbide systems TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC and HfC-TaC
International Nuclear Information System (INIS)
Gusev, A.I.
1985-01-01
Parameters of interaction and energy of mutual exchange in the liquid and solid phases of pseudobinary TiC-NbC, TiC-TaC, ZrC-NbC, ZrC-TaC, HfC-TaC systems are calculated with account of dependence on composition and temperature. Positions of liquidus-solidus phase boundaries on the phase diagrams of the mentioned systems are calculated on the basis of the determined mutual exchange energies in approximati.on of subregular solutions. The existance of latent decomposition ranges in the solid phase on the phase diagrams of the investgated systems is established
Semi-automated preparation of a 11C-labelled antibiotic - [N-methyl-11C]erythromycin A lactobionate
International Nuclear Information System (INIS)
Pike, V.W.; Palmer, A.J.; Horlock, P.L.; Liss, R.H.
1984-01-01
A fast semi-automated method is described for labelling the antibiotic, erythromycin A (1), with the short-lived positron-emitting radionuclide, 11 C(tsub(1/2)=20.4 min), in order to permit the non-invasive study of its tissue uptake in vivo. Labelling was achieved by the fast reductive methylation of N-demethylerythromycin A (2) with [ 11 C]formaldehyde, itself prepared from cyclotron-produced [ 11 C]-carbon dioxide. Rapid chemical and radiochemical purification of the [N-methyl- 11 C]erythromycin A (3) were achieved by HPLC and verified by TLC with autoradiography. The purified material was formulated for human i.v. injection as a sterile apyrogenic solution of the lactobionate salt. The preparation takes 42 min from the end of radionuclide production and from [ 11 C]carbon dioxide produces [N-methyl- 11 C]erythromycin A lactobionate in 4-12% radiochemical yield, corrected for radioactive decay. (author)
Measurement of {sup 14}C time scale of the rings of a tree by accelerator mass spectrometry
Energy Technology Data Exchange (ETDEWEB)
Oda, Hirotaka; Furukawa, Michiaki [Nagoya Univ. (Japan). School of Science; Yonenobu, Hitoshi; Ikeda, Akiko; Nakamura, Toshio
1996-12-01
{sup 14}C time scale is different from a histrical data in order that it is calculated by assuming that the concentration of {sup 14}C in the sample has not been changed by age. The object of this work is to make clear the errors in measurement of {sup 14}C time scale of the ring of a tree known the tree age. The every year ring of a Hinoki in Kiso, 950 years old, was used as a sample. The most external ring is determined as 1923 years old on the basis of the dendrochronology. The rings after 1120 years were used as the samples. {alpha}-cellulose, the most stable component in the structural components of cell of tree, was prepared from each ring. About 8 mg of {alpha}-cellulose was reduced to graphite to be measured by the tandem thoron analytic meter. The results obtained showed that {sup 14}C time scale was older than that of the histrical data in the twelfth and thirteenth century, but it was more new than that of the histrical data from the late seventeenth to the middle of eighteenth century. The results were agreement with that of Stuiver and Pearson (1933). (S.Y.)
Directory of Open Access Journals (Sweden)
Bárbara Padilla-Docal
2007-09-01
Full Text Available INTRODUCTION: Multiple sclerosis (MS is a chronic, inflammatory and progressive disease of the central nervous system in which local inflammatory injuries of the brain white matter appears, being the most outstanding feature the myeline loss (demyelination. OBJECTIVE: To determine if the complement system might be involved in the MS immunopathogeny favouring the mechanism intervening in the myelin destruction. METHOD: Samples of sera and CSF from twelve patients with a diagnosis of MS obtained at the moment of the admission to the hospital at the beginning of the break out, were collected. Levels of C3c and albumin in sera and in CSF were quantified using radial immunodiffusion plates. RESULTS: High values over 80% of intrathecal synthesis were obtained except in one of the patients. CONCLUSION: Intrathecal synthesis of C3c and its liberation to the CSF means that the activation of the complement system in any of the two ways has taken place, and that once performed its biological functions, has suffered a degradation process.INTRODUCCIÓN: La esclerosis múltiple (EM es una enfermedad crónica, inflamatoria y progresiva del sistema nervioso central que cursa con la aparición de lesiones inflamatorias focales en la sustancia blanca cerebral, en las que lo más llamativo es la pérdida de mielina (desmielinización. OBJETIVO: Conocer si el sistema de complemento puede estar involucrado en la inmunopatogenia de la EM favoreciendo los mecanismos que median la destrucción de la mielina. MÉTODO: Se colectaron muestras de suero y LCR de doce pacientes con diagnóstico de EM obtenidas en el momento del ingreso al inicio del brote. Se cuantificaron los niveles de C3c y albúmina en suero y en LCR en placas de inmunodifusión radial. RESULTADOS: Se obtuvieron altos valores que superan el 80% de síntesis intratecal, menos en uno de los pacientes. CONCLUSION: La síntesis intratecal de C3c y su liberación al LCR significa que ha sucedido la activación
Synthesis of racemic [3-11C]phenylalanine and [3-11C] DOPA
International Nuclear Information System (INIS)
Halldin, C.; Laangstroem, B.
1984-01-01
The synthesis of racemic [3- 11 C]phenylalanine and [3- 11 C]DOPA is reported. The [ 11 C]benzaldehyde and [ 11 C]veratraldehyde prepared in a two-step reaction from the corresponding [ 11 C]acid salt and [ 11 C]alcohol, by means of selective oxidation with tetrabutylammonium hydrogen chromate, were reacted with 2-phenyl-5-oxazolone or 2-(4-chloro)phenyl-5-oxazolone in the presence of a tertiary amine to give the corresponding [α- 11 C]-4-arylene-2-aryl-5-oxazolones. Ring opening of these olefins, hydrogenation, and removal of protecting groups was carried out in one step using hydroiodic cid/phosphorus, with the production of the racemic [3- 11 C]amino acids in 8-30% radiochemical yield (starting with 11 CO 2 ) within 52-60 min (including LC separation). (author)
Deposit of thin films of TiN, a-C, Ti/TiN/a-C by laser ablation
International Nuclear Information System (INIS)
Mejia, I.S.; Escobar A, L.; Camps, E.; Romero, S.; Muhl, S.
2006-01-01
Thin films of titanium nitride (TiN), amorphous carbon (a-C), as well as bilayers of Ti/TiN/a-C were deposited by means of the laser ablation technique. It was investigated the effect that it has the laser fluence used to ablation the targets in the structure and mechanical properties of the TiN deposited films. The TiN obtained films have a preferential orientation in the direction (200). The results show that the hardness of this material is influenced by the laser fluence. It is observed that the hardness is increased in an approximately lineal way with the increment of the fluence up to 19 J/cm 2 . The films of amorphous carbon present hardness of the order of 11.2 GPa. Likewise it was found that the multilayers of Ti/TiN/aC presented a bigger hardness that of its individual components. (Author)
Directory of Open Access Journals (Sweden)
Cesar Salge Ghilardi
2012-01-01
Full Text Available OBJETIVO: Análise retrospectiva de prontuários de pacientes com instabilidade C1-C2 de causas traumáticas e não-traumáticas, submetidos à artrodese C1-C2. MÉTODOS: Foi realizada análise retrospectiva de prontuários de 20 pacientes do ambulatório de coluna do IOT-HCFMUSP com idades entre 7 e 83 anos (média de 43 anos, de ambos os sexos. Os parâmetros radiográficos para instabilidade foram baseados na medida do intervalo atlanto-axial superior a 3 mm em adultos e a 5 mm em crianças, utilizando-se medidas obtidas através de radiografia simples analisada no perfil. RESULTADOS: Foram operados 20 pacientes com instabilidade cervical alta, a maioria de origem traumática. A técnica cirúrgica mais utilizada foi a artrodese descrita por Magerl. Não foram observadas lesões vasculares. Foi registrada complicação infecciosa em dois pacientes. Obteve-se uma taxa de consolidação da artrodese de 85% e não foram necessárias cirurgias de revisão. CONCLUSÃO: Todas as técnicas utilizadas produziram a consolidação óssea satisfatória e foram excelentes para controlar a instabilidade atlanto-axial.OBJETIVO: Estudio retrospectivo de fichas depacientes con inestabilidad C1-C2, de causas traumáticas y no traumáticas, quienes se sometieron a artrodesis C1-C2. MÉTODOS: Se realizó un análisis retrospectivo de los historiales clínicos de 20 pacientes externos de la columna en el IOT-HC.FM.USP de edades comprendidas entre 07 y 83 años (promedio de 43 años de ambos sexos. Los parámetros radiológicos de inestabilidad se basaron en la medición del intervalo atlantoaxial superior a 3 mm en adultos y a 5 mm en niños, utilizándose medidas obtenidas a partir de radiografías simples analizadas en el perfil. RESULTADOS: Se operaron 20 pacientes con inestabilidad cervical alta, la mayoría con inestabilidad de origen traumático. La técnica quirúrgica más utilizada fue la artrodesis descrita por Magerl. No se observaron lesiones
N-Benzoyl-2-nitrobenzenesulfonamide
Directory of Open Access Journals (Sweden)
P. A. Suchetan
2012-02-01
Full Text Available In the title compound, C13H10N2O5S, the N—C bond in the C—SO2—NH—C segment has gauche torsion angles with respect to the S=O bonds. The conformation between the N—H bond and the ortho-nitro group in the sulfonyl benzene ring is syn. The molecule is twisted at the S—N bond with a torsion angle of −63.4 (2°. The sulfonyl benzene ring is tilted by 77.1 (1° relative to the —SO2—NH—C—O segment. The dihedral angle between the sulfonyl and the benzoyl benzene rings is 88.6 (1°. In the crystal, pairs of N—H...O(S hydrogen bonds link the molecules into inversion dimers, which are linked by weak C—H...O and C—H...π interactions along the b axis.
International Nuclear Information System (INIS)
Ishiwata, Kiichi; Sasaki, Toru; Ishii, Shin-ichi; Senda, Michio; Seki, Hiroyuki; Kitasato Univ.; Nozaki, Tadashi
1993-01-01
N-[ 11 C]Methyl-1-deoxynojirimycin ([ 11 C]MDNM) and N-[ 11 C]methyl-1-deoxymannojirimycin ([ 11 C]MDMM) were prepared by 11 C-methylation of 1-deoxynojirimycin (DNM) and 1-deoxymannojirimycin (DMM), which are specific inhibitors of glucosidase and mannosidase, respectively. In mice bearing Ehrich ascitic tumor, the highest uptake of the [ 11 C]MDNM was observed in the kidney, followed by the liver and small intestine, while the tumour uptake was moderate. By MDNM loading, saturable uptake was observed in these tissues. In homogenates of the kidney and tumor tissues, a considerable amount of radioactivity was detected in a high-molecular weight fraction. These results demonstrate that the [ 11 C]MDNM has a potential for imaging the glucosidase activity by positron emission tomography. On the other hand, [ 11 C]MDMM showed lower uptake than [ 11 C]MDNM in the kidney, liver and small intestine and no effect of carrier DMM, suggesting that the [ 11 C]MDMM would not reflect mannosidase activity. (Author)
Institute of Scientific and Technical Information of China (English)
Walid M. DAOUSH; Hee S. PARK; Soon H. HONG
2014-01-01
Cubic boron nitride particles coated by titanium nitride (TiN/cBN) as well as diamond particles coated by titanium carbide (TiC/diamond) were prepared by Ti molten salt deposition followed by heat-treatment process. cBN or diamond particles were mixed separately with Ti powders and molten salts (KCl, NaCl and K2TiF6). The mixture was heated at 900 °C under argon atmosphere. The produced particles were heat-treated under hydrogen at 1000 °C. The morphologies and chemical compositions of the produced particles were investigated by scanning electron microscopy (SEM), X-ray diffraction (XRD) and focused ion beam (FIB). The results show that the cBN and the diamond particles are coated by nano-sized Ti layers. By heat-treatment of the Ti/cBN and TiC/diamond coated particles under hydrogen atmosphere, the deposited Ti layers were interacted by the in-situ transformation reaction with the surfaces of cBN and diamond particles and converted to titanium compounds (TiN and TiC), respectively.%用钛熔盐沉积及热处理工艺分别制备碳化钛涂覆的立方碳化硼颗粒(TiN/cBN)及碳化钛涂覆的金刚石颗粒(TiC/金刚石)。将cBN或金刚石颗粒分别与钛粉和KCl、NaCl和K2TiF6熔盐混合。将所得混合物在Ar气氛中加热至900°C,然后在H2气氛中于1000°C进行热处理。采用扫描电镜、X射线衍射和聚焦离子束技术对所制得颗粒进行表征。结果表明:cBN和金刚石颗粒表面已覆盖了纳米钛层。对Ti/cBN和TiC/金刚石涂层颗粒进行热处理后,颗粒表面沉积的Ti层与cBN和金刚石颗粒发生了原位化学反应,分别转化为钛化合物TiN和TiC。
Energy Technology Data Exchange (ETDEWEB)
Antinolo, A.; Fajardo, M.; Lopez Mardomingo, C.; Otero, A. (Univ. de Alcala de Henares (Spain)); Mourad, Y.; Mugnier, Y. (Centre National de la Recherche Scientifique, Dijon (France)); Sanz-Aparicio, J.; Fonseca, I.; Florencio, F. (CSIC, Madrid (Spain))
1990-11-01
The reaction of Nb({eta}{sup 5}-C{sub 5}H{sub 4}SiMe{sub 3}){sub 2}X (X = Cl, Br) with 1 equiv of various ketenimines, R{sup 1}N{double bond}C{double bond}CR{sup 2}R{sup 3}, leads to the niobium derivatives Nb({eta}{sup 5}-C{sub 5}H{sub 4}SiMe{sub 3}){sub 2}X({eta}{sup 2}(C,N)-R{sup 1}N{double bond}C{double bond}CR{sup 2}R{sup 3}) (1, X = Cl, R{sup 1} = R{sup 2} = R{sup 3} = C{sub 6}H{sub 5}; 2, X = Cl, R{sup 1} = p-CH{sub 3}-C{sub 6}H{sub 4}, R{sup 2} = R{sup 3} = C{sub 6}H{sub 5}; 3, X = Br, R{sup 1} = R{sup 2} = R{sup 3} = C{sub 6}H{sub 5}; 4, X = Br, R{sup 1} = p-CH{sub 3}-C{sub 6}H{sub 4}, R{sup 2} = R{sup 3} = C{sub 6}H{sub 5}; 5, X = Cl, R{sup 1} = R{sup 2} = C{sub 6}H{sub 5}, R{sup 3} = CH{sub 3}; 6, X = Br, R{sup 1} = R{sup 2} = C{sub 6}H{sub 5}, R{sup 3} = CH{sub 3}) with the expected ketenimine C{double bond}N bonding mode. Reduction of 1 with 1 equiv of Na/Hg gives the complex Nb({eta}{sup 5}-C{sub 5}H{sub 4}SiMe{sub 3}){sub 2}({eta}{sup 2}(C,N)-PhN{double bond}C{double bond}CPh{sub 2}) (9) as a paramagnetic compound. The reduction of 9 with 1 equiv of Na/Hg and the subsequent addition of a proton source (ethanol) leads to the iminoacyl compound Nb({eta}{sup 5}-C{sub 5}H{sub 4}SiMe{sub 3}){sub 2}(CRNR{sup 1}) (10, R = CH(Ph{sub 2}), R{sup 1} = Ph). The one- and two-electron reductions of 1 have been studied by cyclic voltammetry experiments. The structure of 1 was determined by single-crystal X-ray diffractometry: a = 24.4904 (14) {angstrom}, b = 11.0435 (04) {angstrom}, c = 26.6130 (15) {angstrom}, {beta} = 109.890 (5){degree}, monoclinic, space group C2/c, Z = 8, V = 6,768.4 (5) {angstrom}{sup 3}, {rho}{sub calcd} = 1.3194 g/mL, R = 0.048, R{sub w} = 0.060 based on 4,806 observed reflections. The structure contains a niobium atom bonded to two cyclopentadienyl rings in a {eta}{sup 5} fashion; the coordination of the metal is completed by a Cl atom and a {eta}{sup 2}(C,N)-bonded ketenimine ligand.
Influence of the control bars on the fuel temperature instrumented in the C and D rings
International Nuclear Information System (INIS)
Paredes G, L.C
1991-12-01
It was demonstrated that the influence on the fuel temperature to the movement of the control bars, this in direct relationship with the value in negative reactivity of each control bar for the different positions of the ring C. Consequently the influence of bigger to smaller, is given by the regulator bar, fine, of safety and transitory for the configuration of fuel No. 16. It was proven that the ring is the one that presents the biggest generation of power for ring of the reactor, for that in it is registered the fuel temperatures but high. Those were obtained response of different positions in the rings C and D in function of the route of the four control bars and safety of the reactor. (Author)
Introducción al cálculo integral
Soler Basauri, Vicente; Defez Candel, Emilio
2013-01-01
El objetivo del presente libro es introducir en el estudio del cálculo integral para su posterior aplicación, mediante el uso de métodos básicos del cálculo integral. La intención principal es disponer de herramientas que permitan abordar el cálculo de integralse que aparecen en diferentes aplicaciones Soler Basauri, V.; Defez Candel, E. (2013). Introducción al cálculo integral. Editorial Universitat Politècnica de València. http://hdl.handle.net/10251/28101
Detection of interstellar (C-13)N toward Zeta Ophiuchi
International Nuclear Information System (INIS)
Crane, P.; Hegyi, D.J.
1988-01-01
Observations of a diffuse interstellar cloud toward Zeta Oph, obtained with resolution 100,000-150,000 near the 3874.608-A R(0) line of (C-12)N using a coude echelle spectrograph on the 1.4-m telescope at ESO during 1984 and 1985, are reported. Data from 54 20-min runs were fitted to Gaussian line shapes using the line center, depth, and width of the R(0) and R(1) lines of (C-12)N and the line center and depth of the R(0) line of (C-13)N as fitting parameters. The (C-13)N R(0) line, with equivalent width 0.190 + or - 0.020 mA, was detected 173.7 + or - 0.8 mA to the red of (C-12)N R(0); the corresponding isotope abundance ratio, (C-12)N/(C-13)N = 47.3 + 5.5 or -4.4, is shown to be in good agreement with previous measurements for CH(+) (Hawkins et al., 1985). 13 references
14C emission from Swedish nuclear power plants and its effect on the 14C levels in the environment
International Nuclear Information System (INIS)
Stenstroem, K.; Erlandsson, Bengt; Hellborg, R.; Kiisk, M.; Persson, Per; Mattsson, Soeren; Thornberg, C.; Skog, G.
2000-02-01
The radionuclide 14 C is produced in all types of nuclear reactors mainly by neutron induced reactions in oxygen ( 17 O), nitrogen ( 14 N) and carbon ( 13 C). Part of the 14 C created is continuously released during normal operation as airborne effluents in various chemical forms (such as CO 2 , CO and hydrocarbons) to the surroundings. Because of the biological importance of carbon and the long physical half-life of 14 C, it is of interest to measure the releases and their incorporation into living material. The 14 C activity concentrations in annual tree rings and air around two Swedish nuclear power plants (Barsebaeck and Forsmark) as well as the background 14 C activity levels from two reference sites in southern Sweden during 1973-1996 are presented in this report. In order to verify the reliability of the method some investigations have been conducted at two foreign nuclear sites, Sellafield fuel reprocessing plant in England, and Pickering nuclear generating station in Canada, where the releases of 14 C are known to be substantial. Furthermore, results from some measurements in the vicinity of Paldiski submarine training centre in Estonia are presented. The results of the 14 C measurements of air, vegetation and annual tree rings around the two Swedish nuclear power plants show very low enhancements of 14 C, if at all above the uncertainty of the measurements. Even if the accuracy of the measurements of the annual tree rings is rather good (1-2%) the contribution of 14 C from the reactors to the environment is so small that it is difficult to separate it from the prevailing background levels of 14 C . This is the case for all sampling procedures: in air and vegetation as well as in annual tree rings. Only on a few occasions an actual increase is observed. However, although the calculations suffer from rather large uncertainties, the calculated release rate from Barsebaeck is in fair agreement with reported release data. The results of this investigation show
Zheng, Yanping; Li, Huanhuan; Yuan, Haiyan; Fan, Honghong; Li, Wenliang; Zhang, Jingping
2018-03-01
Recently, Li-S batteries with a high theoretical specific energy have attracted significant attention. However, their practical application is still seriously hindered by the shuttling effect of lithium polysulfides (LiPSs) in the Li-S batteries system. Introducing anchoring materials into the cathode or separator, which can strongly attract LiPSs because of advisable binding energies, has been demonstrated as an effective strategy to alleviate the shuttling effect for achieving the excellent cycling performance of Li-S batteries. In this work, the complete mechanistic understanding of the interaction between non-metallic monolayer materials (N-MMLMs, including Graphene, BN, C2N and C3N4) and LiPSs is given in detail with the aid of density functional theory. The calculation results show that N-MMLM can combine the chemical interaction and the physical entrapment of sulfur species to suppress the shuttling effect. C3N4 and C2N are predicted to trap LiPSs via stronger interfacial interaction and alleviate the interactions between LiPSs and solvents as well as the consequent dissolution. The strong anchoring effect of C3N4/C2N comes from the bonding of Li-N/C-S and charge transfer. Further charge transfer study reveals that the C3N4/C2N can serve as an electrocatalyst, which effectively accelerates the kinetics of LiPSs redox reactions.
Energy Technology Data Exchange (ETDEWEB)
Hao, Liang, E-mail: haoliang@tust.edu.cn [Tianjin Key Lab of Integrated Design and On-line Monitoring for Light Industry & Food Machinery and Equipment, Tianjin (China); College of Mechanical Engineering, Tianjin University of Science & Technology, No. 1038 Dagu Nanlu, Hexi District, Tianjin 300222 (China); Wang, Zhenwei, E-mail: 1004329228@qq.com [School of Naval Architecture and Ocean Engineering, Harbin Institute of Technology, Weihai, No. 2, Wenhua West Road, Weihai 264209 (China); Zheng, Yaoqing, E-mail: 13612177268@163.com [College of Mechanical Engineering, Tianjin University of Science & Technology, No. 1038 Dagu Nanlu, Hexi District, Tianjin 300222 (China); Li, Qianqian, E-mail: 1482471595@qq.com [College of Mechanical Engineering, Tianjin University of Science & Technology, No. 1038 Dagu Nanlu, Hexi District, Tianjin 300222 (China); Guan, Sujun, E-mail: sujunguan1221@gmail.com [College of Mechanical Engineering & Graduate School, Chiba University, 1-33, Yayoi-cho, Inage-ku, Chiba 263-8522 (Japan); Zhao, Qian, E-mail: zhaoqian@tust.edu.cn [Tianjin Key Lab of Integrated Design and On-line Monitoring for Light Industry & Food Machinery and Equipment, Tianjin (China); College of Mechanical Engineering, Tianjin University of Science & Technology, No. 1038 Dagu Nanlu, Hexi District, Tianjin 300222 (China); Cheng, Lijun, E-mail: chenglijun@tust.edu.cn [Tianjin Key Lab of Integrated Design and On-line Monitoring for Light Industry & Food Machinery and Equipment, Tianjin (China); College of Mechanical Engineering, Tianjin University of Science & Technology, No. 1038 Dagu Nanlu, Hexi District, Tianjin 300222 (China); Lu, Yun, E-mail: luyun@faculty.chiba-u.jp [College of Mechanical Engineering & Graduate School, Chiba University, 1-33, Yayoi-cho, Inage-ku, Chiba 263-8522 (Japan); Liu, Jizi, E-mail: jzliu@njust.edu.cn [Herbert Gleiter Institute of Nanoscience, Nanjing University of Science and Technology, No. 200, Xiaolingwei Street, Nanjing 210094 (China)
2017-01-01
Highlights: • TiO{sub 2}/TiC{sub 0.7}N{sub 0.3} coatings were prepared by ball milling followed by oxidation. • In situ co-doping of C and N with simultaneous TiO{sub 2} formation was observed. • Improved photocatalytic activity under UV/visible light was noticed. • Synergism in co-doping and heterojunction formation promoted carrier separation. - Abstract: Ball milling followed by heat oxidation was used to prepared C, N co-doped TiO{sub 2} coatings on the surfaces of Al{sub 2}O{sub 3} balls from TiC{sub 0.7}N{sub 0.3} powder. The as-prepared coatings were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), X-ray photoelectron spectroscopy (XPS) and ultraviolet-visible spectrophotometer (UV–vis). The results show that continuous TiC{sub 0.7}N{sub 0.3} coatings were formed after ball milling. C, N co-doped TiO{sub 2}/TiC{sub 0.7}N{sub 0.3} composite coatings were prepared after the direct oxidization of TiC{sub 0.7}N{sub 0.3} coatings in the atmosphere. However, TiO{sub 2} was hardly formed in the surface layer of TiC{sub 0.7}N{sub 0.3} coatings within a depth less than 10 nm during the heat oxidation of TiC{sub 0.7}N{sub 0.3} coatings in carbon powder. Meanwhile, the photocatalytic activity evaluation of these coatings was conducted under the irradiation of UV and visible light. All the coatings showed photocatalytic activity in the degradation of MB no matter under the irradiation of UV or visible light. The C, N co-doped TiO{sub 2}/TiC{sub 0.7}N{sub 0.3} composite coatings showed the most excellent performance. The enhancement under visible light irradiation should attribute to the co-doping of carbon and nitrogen, which enhances the absorption of visible light. The improvement of photocatalytic activity under UV irradiation should attribute to the synergistic effect of C, N co-doping, the formation of rutile-anatase mixed phases and the TiO{sub 2}/TiC{sub 0.7}N{sub 0.3} composite microstructure.
DeBlase, Catherine R; Finke, Ryan T; Porras, Jonathan A; Tanski, Joseph M; Nadeau, Jocelyn M
2014-05-16
Synthesis and characterization of two diastereomeric C-shaped molecules containing cofacial thiophene-substituted quinoxaline rings are described. A previously known bis-α-diketone was condensed with an excess of 4-bromo-1,2-diaminobenzene in the presence of zinc acetate to give a mixture of two C-shaped diastereomers with cofacial bromine-substituted quinoxaline rings. After chromatographic separation, thiophene rings were installed by a microwave-assisted Suzuki coupling reaction, resulting in highly emissive diastereomeric compounds that were studied by UV-vis, fluorescence, and NMR spectroscopy, as well as X-ray crystallography. The unique symmetry of each diastereomer was confirmed by NMR spectroscopy. NMR data indicated that the syn isomer has restricted rotation about the bond connecting the thiophene and quinoxaline rings, which was also observed in the solid state. The spectroscopic properties of the C-shaped diastereomers were compared to a model compound containing only a single thiophene-substituted quinoxaline ring. Ground state intramolecular π-π interactions in solution were detected by NMR and UV-vis spectroscopy. Red-shifted emission bands, band broadening, and large Stokes shifts were observed, which collectively suggest excited state π-π interactions that produce excimer-like emissions, as well as a remarkable positive emission solvatochromism, indicating charge-transfer character in the excited state.
Synthesis of n.c.a. PET-radiotracers with carbon-11
International Nuclear Information System (INIS)
Schirbel, A.
1998-11-01
Carbon-11 offers the unique possibility of authentic labelling of molecules as radioindicators for non invasive and quantitative determination of physiological functions via positron emission tomography (PET). Therefore, the goal of this thesis was to synthesize of different n.c.a. 11 C-labelled pharmaceuticals for in vivo distribution studies with PET. For the determination of the pharmacokinetics of [1- 11 C]acetate in porcine myocardium during prolonged ischemia, n.c.a. [1- 11 C]acetate was synthesized via carboxylation of methylmagnesium bromide with in target produced n.c.a. [ 11 C]CO 2 with a radiochemical yield (RCY) of 68 ± 7%. The fast (18 min) and reliable radiosynthesis allowed for repeated tracer administration at short intervals ( R c) in humans, [1- 11 C]acetylsalicylic acid, acetyl-[carboxy- 11 C]salicylic acid and [carboxy- 11 C]salicylic acid were prepared. N.c.a. [1- 11 C]acetylsalicylic acid was synthesized via the reaction of [1- 11 C]acetylchloride with salicylic acid salts. The use of the silver salt proved to be superior to the sodium salt and resulted in radiochemical yields of 32 ± 5%. Base-line (clean) separation of the labelled product was achieved using radio-HPLC. With regard to the preparation of n.c.a. [carboxy- 11 C]salicylic acid, several protected and unprotected phenol derivates were metallated and subsequently carboxylated using n.c.a. [ 11 C]CO 2 . Best results (87 ± 3% RCY) could be achieved with 2-(methoxymethoxy)-phenylmagnesium iodide as a precursor and subsequent quantitative cleavage of the MOM-group. Acetylation of n.c.a. [carboxy- 11 C]salicylic acid to acetyl-[carboxy- 11 C]salicylic acid was performed using acetylchloride in CH 2 Cl 2 with a radiochemical yield of 65 ± 4%. (orig.)
DFT study of small fullerene dimer complexes C_2_0-N_m@C_n (m = 1-6 and n = 24, 28, 32, 36 and 40)
International Nuclear Information System (INIS)
Kaur, Sandeep; Sharma, Amrish; Mudahar, Isha
2016-01-01
First principle calculations based on density functional theory were performed to calculate the structural and electronic properties of C_2_0-N_m@C_n dimer complexes. The calculated binding energies of the complexes formed are comparable to C_6_0 dimer which ensures their stability. The bond lengths of these dimer complexes were found to be nearly same as pure complexes C_2_0-C_n. Further, nitrogen (N) atoms were encapsulated inside the secondary cage (C_n) of dimer complexes and the number of N atoms depends on diameter of the cage. The HOMO-LUMO gaps of new proposed complexes indicate the increase in gap as compared to pure complexes. Mulliken charge analysis of these complexes has been studied which shows the significant charge transfer from the N atoms to the secondary cage of these complexes. The study propose the formation of the new dimer complexes which are stable and are able to encapsulate atoms which are otherwise reactive in free space.
Farhat, Raëd; Puissesseau, Géraldine; El-Seedy, Ayman; Pasquet, Marie-Claude; Adolphe, Catherine; Corbani, Sandra; Megarbané, André; Kitzis, Alain; Ladeveze, Véronique
2015-01-01
Cystic Fibrosis is the most common recessive autosomal rare disease found in Caucasians. It is caused by mutations on the Cystic Fibrosis Transmembrane Conductance Regulator gene (CFTR) that encodes a protein located on the apical membrane of epithelial cells. c.3909C>G (p.Asn1303Lys, old nomenclature: N1303K) is one of the most common worldwide mutations. This mutation has been found at high frequencies in the Mediterranean countries with the highest frequency in the Lebanese population. Therefore, on the genetic level, we conducted a complete CFTR gene screening on c.3909C>G Lebanese patients. The complex allele c.[744-33GATT(6); 869+11C>T] was always associated with the c.3909C>G mutation in cis in the Lebanese population. In cellulo splicing studies, realized by hybrid minigene constructs, revealed no impact of the c.3909C>G mutation on the splicing process, whereas the associated complex allele induces minor exon skipping. PMID:26075213
Eberhart, Charles G; Kratz, John; Wang, Yunyue; Summers, Krista; Stearns, Duncan; Cohen, Kenneth; Dang, Chi V; Burger, Peter C
2004-05-01
Several molecular and histopathological prognostic markers have been proposed for the therapeutic stratification of medulloblastoma patients. Amplification of the c-myc oncogene, elevated levels of c-myc mRNA, or tumor anaplasia have been associated with worse clinical outcomes. In contrast, high TrkC mRNA expression generally presages longer survival. The goal of this study was to evaluate the prognostic value of c-myc, N-myc and TrkC expression in medulloblastomas and compare them to histopathological classification. We used in situ hybridization to measure expression of these molecular markers. c-myc mRNA was detected in 18 of 59 (31%) cases, and was significantly associated with shorter patient survival times on both univariate and multivariate analyses (p = 0.04). The presence of c-myc mRNA was also significantly associated with tumor anaplasia. While survival rates were higher for patients with low N-myc or high TrkC expression, these differences were not statistically significant. The group of patients with either moderate or severely anaplastic tumors showed only a trend towards shorter survival (p = 0.11). However, severe anaplasia alone was significantly prognostic (p = 0.002). Given the prognostic import of c-myc, we investigated 2 potential mechanisms by which its expression might be regulated: Wnt signaling and Mxi-1 mutation. Nuclear translocation of beta-catenin, a marker of Wnt pathway activation, was more common in medulloblastomas with high c-myc than in tumors overall, but the difference was not statistically significant. No Mxi-1 mutations were detected in the 22 cases examined. The association we describe between c-myc expression, tumor anaplasia, and worse clinical outcomes provides further evidence for the importance of this oncogene in medulloblastoma pathobiology.
International Nuclear Information System (INIS)
Carson, D.; Cass, M.W.; Crombie, L.; Holden, I.; Whiting, D.A.
1982-01-01
A reconstructive circuit for 13 C- and 14 C-labelling of the 7'-methylene group of (-)-rotenone is described. It involves blocking the enolisable 12a-site with a trimethylsilyloxy-group, followed by removal and reintroduction of the methylene, and elision of the blocking group: the radiochemical yield is 19%. Consequences of failure to block the 12a-site in reactions with ylides are illustrated by reactions of (-)-isorotenone, (-)-rotenone, and (-)-rotenone 7'-norketone (1f) with dimethyloxosulphonium methylide, which leads to C-seco-cyclopropyl ketones. A new rotenoid synthesis from 2,2'-dihydroxydeoxybenzoins which produces the B/C-ring system directly at the correct oxidation level is described. This involves blocking of the two unwanted nucleophilic sites by ring formation. The O-methylene aldehyde is concealed as an allyl group for introduction purposes, and after removal of the blocking ring, development of the aldehyde, and base-catalysed cyclisation, (+-)-isorotenone (used as the model rotenoid) was obtained. Since 2,2'-dihydroxydeoxybenzoins are readily made by degradation of natural rotenoids, the method can be used for reconstructive isotopic labelling at C-6 and C-6a. (author)
Preparation and sintering of Zr(C,N,O) phases
International Nuclear Information System (INIS)
Tamborenea, S.; Mazzoni, A.D.; Aglietti, E.F.
2003-01-01
The Zr(C,O,N) compounds form a great mono-phase zone belonging to the pseudoternary ZrO-ZrN-ZrC system.Theses phases have cubic crystalline structure with a o parameter depending on the C, O 2 and N 2 content.These phases have many potential applications in the manufacture of ceramic pieces utilizable as electronic conductors.The Zr (C,O,N) phases can be obtained from ZrO 2 by carbonitriding reactions: that is carbothermal reduction and simultaneous nitriding.In this work a series of experiences of carbonitriding of zirconia under different conditions (temperatures between 1400 and 1600degC, times of 120 min, carbon content between 20 and 40%) in order to obtain suitable powders to be sintered.The XRD analysis shows the Zr(C,O,N) as the main products and β -ZrON as the only secondary product in proportions depending on the obtaining conditions.The variables employed were the C content and the reaction temperature.The Zr(C,O,N) content varies between 40 and 90% and tends to increase with the temperature and the carbon content whereas the β -ZrON phase varies between the 40 and 10 % decreasing its proportion with temperature and the carbon content.The oxidation resistance of these phases was studied by DTA-TG tests in air.Results show complete oxidation reaction at ∼500degC in air.The sintering of these materials was made on disks obtained by pressing of powders of Zr(C,N,O) contents higher than 90%.Sintering was performed in nitrogen atmosphere and temperatures between 1450 and 1620degC.Disks were characterized by pycnometry and Hg volumeter.The densities obtained were between 5 and 6,6g/cm 3 with a tendency to increase with the Zr(C,N,O) phase content, the temperature and the sintering time.Sintered disks were characterized by dilatometry in N 2
Characteristics of high-purity Teflon vial for 14C measurement in old tree rings
International Nuclear Information System (INIS)
Sakurai, H.; Saswaki, Y.; Matsumoto, T.; Aoki, T.; Kato, W.; Gandou, T.; Gunji, S.; Tokanai, F.
2003-01-01
14 C concentration in single-year tree rings of an old cedar of ca. 2500 years ago is measured to investigate the 11-yr periodicity of solar activity. Our highly accurate 14 C measuring system is composed of a benzene synthesizer capable of producing a large quantity (10 g) of benzene and a Quantulus 1220 TM liquid scintillation counting system. The accuracy is less than 0.2% for measurements of 14 C concentration. The benzene sample is contained in a high-purity Teflon/copper-counting vial (20 ml) manufactured by Wallac Oy Company. We found a vial with an irregular copper cap for the measurements of 11 tree rings. The behavior of the vial with the irregular cap was investigated. The Teflon sheet inside the cap plays an important role in achieving stable measurement. The rate of volatilization of the benzene was less than 0.35 mg/day for vials with ordinary caps. This results in the volatilization rate of 0.003% for 10.5 g of benzene and hence guarantees measurement at an accuracy of 0.2% for 70 days
Energy Technology Data Exchange (ETDEWEB)
Shang, Xiaohong [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); College of Chemistry and Life Science, Changchun University of Technology, Changchun 130024 (China); Liu, Yuqi; Qu, Xiaochun [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Wu, Zhijian, E-mail: zjwu@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)
2013-11-15
We report a quantum-chemical study on the electronic structures and optical properties of two series of heteroleptic iridium(III) complexes [(dfb-pz){sub 2}Ir(N{sup ∧}N+sub)], [dfb-pz=2,4-difluorobenzyl-N-pyrazole, sub indicates substituent group, N{sup ∧}N+sub=tphppz=4-tert-butyl-2-(5-phenyl-[1,2,4]triazol-3-yl)-pyridine (1a), tmppz=4-tert-butyl-2-(5-methyl-[1,2,4]triazol-3-yl)-pyridine (1b), fphppz=4-fluoro-phenyl-5-(2-pyridyl)pyrazole (1c), and fmphppz=4-trifluoromehtyl-phenyl-5-(2-pyridyl)pyrazole (1d)]; with [(C{sup ∧}N+sub){sub 2}Ir(fppz)], [C{sup ∧}N=b-pz=benzyl-N-pyrazole, fppz=3-trifluoromethyl-5-(2-pyridyl)pyrazole, C{sup ∧}N+sub=dfb-pz=2,4-difluorobenzyl-N-pyrazole (2a), tfmfb-pz=2-trifluoromethyl-5-fluorobenzyl-N-pyrazole (2b), phb-pz=3-phenyl-benzyl-N-pyrazole (2c), and dfphb-pz=3-phenyl-2,4-difluorobenzyl-N-pyrazole (2d)]. The calculated results shed light on the reasons of the remarkably manipulated excited-state and electroluminescent properties through substitution effect. The phenyl ring on main ligands can enhance the π-conjugation of the main ligands moiety and increase the metal-ligand bond strength for 2c and 2d, then enhancing the transition strength. From 1c, 1d, 2c, and 2d, it can also be seen that substituents on the terminal phenyl ring have a slight effect on the excited energy because the distance between the substituents and the ancillary (or main) ligand is interrupted by the phenyl moiety. The calculated absorption and luminescence properties of the four complexes 1a, 1b, 2a, and 2b are compared with the available experimental data and a good agreement is obtained. Furthermore, the assumed complex 1c, 2c, and 2d possess better charge transfer abilities and more balanced charge transfer rates. The designed complexes 2c and 2d are potential candidates for blue phosphorescent materials. -- Highlights: • Two series of electroluminescent iridium(III) complexes have been studied. • The charge transfer properties are affected
Correlation between the 12C+12C, 12C+13C, and 13C+13C fusion cross sections
Notani, M.; Esbensen, H.; Fang, X.; Bucher, B.; Davies, P.; Jiang, C. L.; Lamm, L.; Lin, C. J.; Ma, C.; Martin, E.; Rehm, K. E.; Tan, W. P.; Thomas, S.; Tang, X. D.; Brown, E.
2012-01-01
The fusion cross section for 12C+13C has been measured down to Ec.m.=2.6 MeV, at which the cross section is of the order of 20 nb. By comparing the cross sections for the three carbon isotope systems, 12C+12C, 12C+13C, and 13C+13C, it is found that the cross sections for 12C+13C and 13C+13C provide an upper limit for the fusion cross section of 12C+12C over a wide energy range. After calibrating the effective nuclear potential for 12C+12C using the 12C+13C and 13C+13C fusion cross sections, it is found that a coupled-channels calculation with the ingoing wave boundary condition (IWBC) is capable of predicting the major peak cross sections in 12C+12C. A qualitative explanation for this upper limit is provided by the Nogami-Imanishi model and by level density differences among the compound nuclei. It is found that the strong resonance found at 2.14 MeV in 12C+12C exceeds this upper limit by a factor of more than 20. The preliminary result from the most recent measurement shows a much smaller cross section at this energy, which agrees with our predicted upper limit.
13C/12C ratio variations in Pinus longaeva (bristlecone pine) cellulose during the last millennium
International Nuclear Information System (INIS)
Grinsted, M.J.; Wilson, A.T.; Ferguson, C.W.
1979-01-01
Delta 13 C values are presented for cellulose samples prepared from two dendrochronologically dated Pinus longaeva (bristlecone pine) trees which grew during the last 1000 years. Delta 13 C variations for these forest border trees are similar to upper tree line ring-width variations for the same species and English high summer temperature variations for the same time period. However, the delta 13 C variations appear to be unrelated to lower forest border ring-width variations and cellulose deltaD variations for the same specimens. (Auth.)
Energy Technology Data Exchange (ETDEWEB)
Wang, Biao, E-mail: wangbiao@fjirsm.ac.cn [Key Laboratory of Optoelectronic Materials Chemistry and Physics, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou, Fujian 350002 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China); Zhang, Jingtao, E-mail: zhangjtao@mail.sysu.edu.cn [State Key Laboratory of Optoelectronic Materials and Technologies, School of Materials Science and Engineering, Sun Yat-sen University, Guangzhou 510006 (China); Huang, Feng, E-mail: huangfeng@mail.sysu.edu.cn [Key Laboratory of Optoelectronic Materials Chemistry and Physics, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou, Fujian 350002 (China); State Key Laboratory of Optoelectronic Materials and Technologies, School of Materials Science and Engineering, Sun Yat-sen University, Guangzhou 510006 (China)
2017-01-01
Highlights: • Novel g-C{sub 3}N{sub 4}/SiC composite was prepared by synthesizing g-C{sub 3}N{sub 4} on the surface of SiC. • g-C{sub 3}N{sub 4}/SiC composites exhibit much higher H{sub 2} production activity than pure g-C{sub 3}N{sub 4}. • The g-C{sub 3}N{sub 4}/SiC heterojunction mainly accounts for improved photocatalytic activity. - Abstract: g-C{sub 3}N{sub 4} has been attracting much attention for application in visible light photocatalytic water splitting due to its suitable band structure, and high thermal and chemical stability. However, the rapid recombination of photogenerated carriers has inhibited its wide use. For this reason, novel g-C{sub 3}N{sub 4}/SiC composites were prepared via in situ synthesis of g-C{sub 3}N{sub 4} on the surface of SiC, with which g-C{sub 3}N{sub 4} shows tight interaction (chemical bonding). The g-C{sub 3}N{sub 4}/SiC composites exhibit high stability in H{sub 2} production under irradiation with visible light (λ ≥ 420 nm), demonstrating a maximum of 182 μmol g{sup −1} h{sup −1}, being 3.4 times higher than that of pure g-C{sub 3}N{sub 4}. The enhanced photocatalytic H{sub 2} production ability for g-C{sub 3}N{sub 4}/SiC photocatalysts is primarily ascribed to the combined effects of enhanced separation of photogenerated carriers through efficient migration of electron and enlarged surface areas, in addition to the possible contributions of increased hydrophilicity of SiC and polymerization degree of g-C{sub 3}N{sub 4}. This study may provide new insights into the development of g-C{sub 3}N{sub 4}-based composites as stable and efficient photocatalysts for H{sub 2} production from water splitting.
Density functional theoretical study on the C-F and C-O oxidative addition reaction at an AI center
Energy Technology Data Exchange (ETDEWEB)
Kim, Yong Seong [Dept. of Science Education, Kyungnam University, Masan (Korea, Republic of); Cho, Hyun; Hwang, Sungu [Dept. of Nanomechatronics Engineering, Pusan National University, Miryang (Korea, Republic of)
2017-02-15
In this study, B3LYP/LACVP** level calculations were chosen because the level of theory was applied successfully to calculations of the thermodynamic and kinetic features of the oxidative addition reactions of alkyl and aryl halides to pincer-type complexes. This study examined the effects of the substituents on the phenyl rings of the Al(I) center. Isopropyl side chains in the phenyl rings attached to N atoms of the pincer ligand were replaced with a methyl (Me) (2) or tertiary butyl ( t Bu) group. The oxidative addition of C[BOND]F and C[BOND]O bonds to an Al (I) center was investigated computationally by DFT calculations. The geometries, thermodynamic, and kinetic features were in good agreement with the experimental data, as in previous studies on the transition metal complexes. The computational results showed that the DFT calculations could provide qualitative insight into the reactivity and thermodynamics of the oxidative addition reactions of C[BOND]F bonds.
Energy Technology Data Exchange (ETDEWEB)
Xu, Qingzhong; Zhao, Jun, E-mail: zhaojun@sdu.edu.cn; Ai, Xing; Qin, Wenzhen; Wang, Dawei; Huang, Weimin
2015-11-15
To optimize the Mo{sub 2}C content in Ti(C,N)-based cermet tool materials used for cutting the high-strength steel of 42CrMo (AISI 4140/4142 steel), the cermets with different Mo{sub 2}C/(Mo{sub 2}C + WC) weight ratios were prepared. And the microstructure and mechanical properties of cermets were investigated by scanning electron microscope (SEM), X-ray diffraction (XRD) and measurements of transverse rupture strength (TRS), Vickers hardness (HV) and fracture toughness (K{sub IC}). The results indicate that the Mo{sub 2}C/(Mo{sub 2}C + WC) ratios have great influences on the microstructure features and mechanical properties of Ti(C,N)-based cermets. When the Mo{sub 2}C/(Mo{sub 2}C + WC) ratio increases, the Ti(C,N) grains become finer with smaller black cores surrounded by thinner rims, and the structure of cermets tends to be more compact with smaller binder mean free path. Owing to the medium grains and moderate rims, the cermets with a Mo{sub 2}C/(Mo{sub 2}C + WC) ratio of 0.4 exhibit better mechanical properties, and can be chosen as the tool material for machining 42CrMo steel due to the lower Mo content. - Highlights: • Mo{sub 2}C/(Mo{sub 2}C + WC) ratios affect microstructure and mechanical properties of cermets. • Grains become fine and structure of cermets tends to be compact with raised Mo{sub 2}C. • The cermets with a Mo{sub 2}C/(Mo{sub 2}C + WC) ratio of 0.4 can be used to machine 42CrMo steel.
Nagavciuc, Viorica; Popa, Ionel; Kern, Zoltán; Persoiu, Aurel
2016-04-01
For a better understanding of how the climate is changing and how the environment responds to these changes, it is necessary to understand how the climate has varied in the past. Romania's virgin forests have a great potential to obtain long tree-ring chronologies with annual resolution; but so far, only a few studies resulted in quantitative paleoclimatic reconstructions. In this context, the aim of this study is 1) to calibrate the relationship between the stable isotopes of oxygen and carbon in tree rings and the main climatic parameters and determine the potential of Pinus cembra (Cǎlimani Mts., N Romania, Eastern Europe) for paleoclimatic reconstructions; 2) to provide the first palaeoclimatic reconstitution in Romania based on the isotopic composition of oxygen and carbon in tree ring cellulose, and 3) to test the hypothesis that nearby sulphur mines have not altered the climatic signal recorded by the stable isotopic composition of tree rings, contrary to the similar signal recorded by TRW. For this study, we have analysed wood samples of Swiss stone pine (Pinus cembra L.) from living and dead trees from Cǎlimani Mts., NE Romania, aged between 1600 and 2012 AD. The isotopic composition of oxygen and carbon from the cellulose was analysed at the Institute for Geological and Geochemical Research, Budapest, Hungary, using a high-temperature pyrolysis system (Thermo Quest TC-EA) coupled to an isotope ratio mass spectrometer (Thermo Finningan Delta V) following a ring by ring (i.e., non-pooled) approach. The average level of δ18O and δ13C in cellulose for the period 1600-2012 was 28.83‰ and -22.63 ‰. The tree ring cellulose δ18O and δ13C values showed a strong positive correlation with maximum air temperature (r = 0.6 for δ18O and r = 0.5 for δ13C), mean temperature (r = 0.6 for δ18O and r = 0.45 for δ13C), and sunshine duration (r = 0.69 for δ18O) and negatively correlated with precipitation amount (r = -0.5 for δ18O and r = 0.3 for δ13C) and
Preparation and characterization of B-C-N hybrid thin films
International Nuclear Information System (INIS)
Uddin, Md. Nizam; Shimoyama, Iwao; Sekiguchi, Tetsuhiro; Baba, Yuji; Nath, Krishna G.; Nagano, Masamitsu
2006-06-01
Two dimensional thin films composed of boron, carbon and nitrogen (B-C-N hybrid) were synthesized by ion beam deposition, and their electronic and geometrical structures were characterized by core-level spectroscopy using synchrotron radiation. B-C-N hybrid thin films were grown from ion beam plasma of borazine on highly oriented pyrolitic graphite (HOPG) at various temperatures. The films were characterized in-situ by X-ray photoelectron spectroscopy (XPS) and near edge X-ray absorption fine structure (NEXAFS). XPS study suggested that B, N and C atoms in the deposited films were in a wide variety of chemical bonds e.g., B-C, B-N, N-C, and B-C-N. It was found that B-C-N hybrid formation was enhanced at high temperature, and that the B-C-N component was dominantly synthesized at low boron content. In the NEXAFS spectra, the resonance peaks from B 1s to unoccupied π * -like orbitals were clearly observed. The polarization dependence of the B 1s → π * resonance peaks confirmed that the highly oriented graphite-like B-C-N hybrids surely exist at low boron content. (author)
Directory of Open Access Journals (Sweden)
Ikuhide Fujisawa
2013-04-01
Full Text Available The glycine betaine (betaine, interacts with several types of proteins with diverse structures in vivo, and in the contact regions, the aromatic rings of protein residues are frequently found beside the trimethylammonium group of betaine, implying the importance of the cation−π interactions in recognition of this molecule. The crystal structures determined by X-ray crystallography of the complexes of betaine and C-ethyl-pyrogallol[4]arene (pyrogallol cyclic tetramer: PCT and betaine and C-ethyl-resorcin[4]arene (resorcinol cyclic tetramer: RCT mimic the conformations of betaine and protein complexes and show that the clathrate conformations are retained by the cation−π interactions. The difference of the conformation feature of betaine in the Protein Data Bank and in the Cambridge Structural Database was found by chance during the research and analyzed with the torsion angles.
Aziridines in the synthesis of {sup 11}C- and {sup 18}F-labelled compounds
Energy Technology Data Exchange (ETDEWEB)
Gillings, N.M
1998-07-01
Racemic [4-{sup 11}C]aspartic acid, [4-{sup 11}C]asparagine and 2,4-diamino[4-{sup 11}C]butyric acid were synthesised by the ring-opening of an N-activated aziridine-2-carboxylate with [{sup 11}C]cyanide, followed by preparative HPLC and hydrolysis/reduction. These labelled amino acids arise from nucleophilic attack at the {beta}-carbon of the aziridine ring. A radioactive by-product of ca. 25% was attributed to the product of {alpha}-attack. Several N-activated 2-aryl aziridines were synthesised for the attempted synthesis of {beta}-[{sup 18}F] fluorophenylalanine and {beta}-[{sup 18}F]fluorodopa. Ring-opening with [{sup 18}F]fluoride showed no evidence of {beta}-fluorinated products and it is proposed that attack occurs exclusively at the {alpha}-carbon, giving the corresponding {alpha}-[{sup 18}F]fluoro-{beta}-amino acids. Further evidence for this was the reaction of the {beta}-unsubstituted N-activated aziridine-2-carboxylate with [{sup 18}F]fluoride. This reaction was totally regiospecific and afforded exclusively the {alpha}-substituted product, {alpha}-[{sup 18}F]fluoro-{beta}-alanine. Aziridine precursors were resolved by chiral HPLC. On labelling the chiral aziridines, however, racemic {sup 11}C- and {sup 18}F-labelled amino acids were obtained. This was attributed to racemisation of the initially formed ring-opened products. The use of [{sup 11}C]methyl lithium as a nucleophile for aziridine ring-opening was investigated. Reaction was expected to occur at low temperature, thus potentially avoiding racemisation. No products corresponding to aziridine ring-opening with [{sup 11}C]methyl lithium were, however, observed. A difluorinated analogue of amphetamine was synthesised by fluorination of an azirine (via an aziridine). This racemic compound was resolved as its chiral tartarate salts and subsequently labelled by methylation with [{sup 11}C]methyl iodide, giving the novel compound {beta}, {beta}-difluoro[N-methyl-{sup 11}C]methamphetamine in high
Stability of tritium permeation prevention barrier with TiC and TiN + TiC coating
International Nuclear Information System (INIS)
Shan Changqi; Chen Qingwang; Dai Shaoxia; Jiang Weisheng
1999-01-01
The stability of tritium permeation prevention barrier of 316L stainless steel with coating TiC and TiN + TiC under the conditions of very large thermal gradient, thermal cycling and plasma irradiation is researched. The research includes two aspects: one is the study on the stability resisting H + plasma irradiation; another is on the ability of two coating materials when they are used in long term under the condition of very large thermal gradient and cycling. The results show that TiC and TiN + TiC composite coating materials, after chemical heat treatment and forming tritium permeation prevention barrier, can resist H + ion irradiation, and also can resist very large thermal gradient and thermal cycling. The long time experiments show that tritium permeation prevention barrier of those coating materials is stable when they are used in long term
SiC substrate defects and III-N heteroepitaxy
Energy Technology Data Exchange (ETDEWEB)
Poust, B D [Department of Materials Science and Engineering, University of California, Los Angeles, CA 90095 (United States); Koga, T S [Department of Materials Science and Engineering, University of California, Los Angeles, CA 90095 (United States); Sandhu, R [Department of Materials Science and Engineering, University of California, Los Angeles, CA 90095 (United States); Heying, B [Northrop Grumman Space Technology, Space and Electronics Group, Redondo Beach, CA 90278 (United States); Hsing, R [Northrop Grumman Space Technology, Space and Electronics Group, Redondo Beach, CA 90278 (United States); Wojtowicz, M [Northrop Grumman Space Technology, Space and Electronics Group, Redondo Beach, CA 90278 (United States); Khan, A [Department of Electrical Engineering, University of South Carolina, Columbia, SC (United States); Goorsky, M S [Department of Materials Science and Engineering, University of California, Los Angeles, CA 90095 (United States)
2003-05-21
This study addressed how defects in SiC substrates influence the crystallographic properties of AlGaN/GaN layers deposited by metallorganic vapour phase epitaxy and by molecular beam epitaxy. We employed double crystal reflection x-ray topography using symmetric (0008) and (00012) reflections with CuK{alpha} radiation ({lambda} = 1.54 A) to image dislocations, micropipes, and low angle boundaries in SiC substrates. Lattice strain near the core of a micropipe defect was estimated to be of the order of 10{sup -7}. The substrates investigated exhibited radial patterns of strain and, primarily, of tilt of the order of tens of arcsec. After deposition of the AlGaN and GaN layers, DCXRT images were generated from the substrate (0008) or (00012) and GaN epitaxial layer (0004) reflections. Full-width at half-maximum values ranging from {approx}100 to 300 arcsec were typical of the GaN reflections, while those of the 4H-SiC reflections were {approx}20-70 arcsec. Micropipes, tilt boundaries, and inclusions in the SiC were shown to produce structural defects in the GaN layers. A clear correlation between SiC substrate defects and GaN defects has been established.
SiC substrate defects and III-N heteroepitaxy
International Nuclear Information System (INIS)
Poust, B D; Koga, T S; Sandhu, R; Heying, B; Hsing, R; Wojtowicz, M; Khan, A; Goorsky, M S
2003-01-01
This study addressed how defects in SiC substrates influence the crystallographic properties of AlGaN/GaN layers deposited by metallorganic vapour phase epitaxy and by molecular beam epitaxy. We employed double crystal reflection x-ray topography using symmetric (0008) and (00012) reflections with CuKα radiation (λ = 1.54 A) to image dislocations, micropipes, and low angle boundaries in SiC substrates. Lattice strain near the core of a micropipe defect was estimated to be of the order of 10 -7 . The substrates investigated exhibited radial patterns of strain and, primarily, of tilt of the order of tens of arcsec. After deposition of the AlGaN and GaN layers, DCXRT images were generated from the substrate (0008) or (00012) and GaN epitaxial layer (0004) reflections. Full-width at half-maximum values ranging from ∼100 to 300 arcsec were typical of the GaN reflections, while those of the 4H-SiC reflections were ∼20-70 arcsec. Micropipes, tilt boundaries, and inclusions in the SiC were shown to produce structural defects in the GaN layers. A clear correlation between SiC substrate defects and GaN defects has been established
Carbonitrides in the system Ta-TaC-TaN
International Nuclear Information System (INIS)
Ritzhaupt-Kleissl, H.J.
1975-04-01
Specimens have been prepared in the binary section TaC-TaN and the carbon-rich region of the Ta-TaC-TaN system by hot pressing and subsequent homogenisation. It was possible to prepare nitrogen-rich carbonitrides by homogenizing them at 1,800 0 C under a nitrogen-pressure of 50 at up to the composition of 70 mol% TaN/30 mol% TaC. Those carbonitrides containing less than 25 at% nitrogen could be prepared by homogenisation at 2,000 0 C under a nitrogen-pressure of 600 Torr. Subsequent ageing at temperatures of 1,200, 1,300 and 1,400 0 C in high vacuum as well as at 1 at nitrogen resulted in the appearance of precipitations of epsilon-TaN, β-Ta 2 (C,N) and of the zeta-phase. The type amount and shape of the precipitated phases are dependent on the ageing conditions and on the composition the specimens. Single phase specimens with compositions close to the non-metal deficient phase boundary as well as multi-phase carbonitrides with high nitrogen contents and very fine precipitates showed values of the Vickers-hardness up to 3,000 kp/mm 2 at room temperature. With regard to the hot hardness up to a temperature of 1,300 0 C specimens aged in high vacuum were superior to those which were only homogenized as well as to those aged under a nitrogen-pressure of 1 at. On an average the best hardness-values have been found at room temperature as well as at temperatures up to 1,300 0 C for carbonitrides consisting of 50 mol% TaC/50 mol% TaN after homogenisation and subsequent ageing for 40 h at 1,300 0 C. (orig.) [de
Energy Technology Data Exchange (ETDEWEB)
Liua, S.; Lia, Y.; Chena, P.; Lia, W.; Gaoa, S.; Zhang, B.; Yeb, F.
2017-11-01
The effect of residual stresses on the strength, toughness and work of fracture of Si3N4/SiC multilayered composites with different SiC layers has been investigated. It may be an effective way to design and optimize the mechanical properties of Si3N4/SiC multilayered composites by controlling the properties of SiC layers. Si3N4/SiC multilayered composites with different SiC layers were fabricated by aqueous tape casting and pressureless sintering. Residual stresses were calculated by using ANSYS simulation, the maximum values of tensile and compressive stresses were 553.2MPa and −552.1MPa, respectively. Step-like fracture was observed from the fracture surfaces. Fraction of delamination layers increased with the residual stress, which can improve the reliability of the materials. Tensile residual stress was benefit to improving toughness and work of fracture, but the strength of the composites decreased. [Spanish] Se ha investigado el efecto de las tensiones residuales en la resistencia, dureza y trabajo de fractura de los compuestos multicapa de Si3N4/SiC con diferentes capas de SiC. Puede ser una manera eficaz de diseñar y optimizar las propiedades mecánicas de los compuestos multicapa de Si3N4/SiC mediante el control de las propiedades de las capas de SiC. Los compuestos multicapa de Si3N4/SiC con diferentes capas de SiC se fabricaron por medio de colado en cinta en medio acuoso y sinterización sin presión. Las tensiones residuales se calcularon mediante el uso de la simulación ANSYS, los valores máximos de las fuerzas de tracción y compresión fueron 553,2 MPa y −552,1 MPa, respectivamente. Se observó una fractura escalonada a partir de las superficies de fractura. La fracción de capas de deslaminación aumenta con la tensión residual, lo que puede mejorar la fiabilidad de los materiales. La fuerza de tracción residual era beneficiosa para la mejora de la dureza y el trabajo de fractura, pero la resistencia de los compuestos disminuyó.
High-pressure pyrolysis study of C sub 3 N sub 6 H sub 6 : a route to preparing bulk C sub 3 N sub 4
Ma, H A; Chen, L X; Zhu, P W; Guo, W L; Guo, X B; Wang, Y D; Li, S Q; Zou Guang Tian; Zhang, G; Bex, P
2002-01-01
In order to prepare bulk C sub 3 N sub 4 , high-pressure pyrolysis of melamine (C sub 3 N sub 6 H sub 6) at different temperatures was carried out. The products were characterized by C, N, H element analysis, Fourier transform infrared spectroscopy, x-ray photoelectron spectroscopy, and x-ray diffractometry. The results of the analysis reveal that graphitic phase C sub 3 N sub 4 has been synthesized. It provides a novel route to synthesis of the theoretical superhard cubic C sub 3 N sub 4 and other C sub 3 N sub 4 phases from organic compounds by a high-pressure and high-temperature method.
International Nuclear Information System (INIS)
Guziewicz, M; Kaminska, E; Piotrowska, A; Golaszewska, K; Domagala, J Z; Poisson, M-A; Lahreche, H; Langer, R; Bove, P
2008-01-01
The stresses in GaN-based HEMT structures grown on both single crystal 6H SiC(0001) and Si(111) have been compared to these in the HEMT structures grown on new composite substrates engendered as a thin monocrystalline film attached to polycrystalline 3C-SiC substrate. By using HRXRD technique and wafer curvature method we show that stress of monocrystalline layer in composite substrates of the type mono-Si/poly-SiC is lower than 100 MPa and residual stress of epitaxial GaN buffer grown on the composite substrate does not exceed 0.31 GPa, but in the cases of single crystal SiC or Si substrates the GaN buffer stress is compressive in the range of -0.5 to -0.75 GPa. The total stress of the HEMT structure calculated from strains is consistent with the averaged stress of the multilayers stack measured by wafer curvature method. The averaged stress of HEMT structure grown on single crystals is higher than those in structures grown on composites substrates
Investigation into solubility and diffusion in SiC-NbC, SiC-TiC, SiC-ZrC systems
International Nuclear Information System (INIS)
Safaraliev, G.K.; Tairov, Yu.M.; Tsvetkov, V.F.; Shabanov, Sh.Sh.
1991-01-01
An investigation is carried out which demonstrates solid-phase interaction between SiC and NbC, TiC and ZrC monocrystals. The monocrystals are subjected to hot pressing in SiC powder with dispersity of 5x10 -6 m. The pressing temperature is 2270-2570 K and pressure is varied in the range of 20-40 MPa. Element composition and the distribution profile in a thin layer near the boundary of SiC-NbC, SiC-TiC and SiC-ZrC are investigated by the Anger spectroscopy method. The obtained results permit to make the conclusion in the possibility of solid solution formation in investigated systems
Study of the decays Λc+→Ξ0K+, Λc+→Σ+K+K-, and Λc+→Ξ-K+π+
International Nuclear Information System (INIS)
Avery, P.; Freyberger, A.; Rodriguez, J.; Stephens, R.; Yelton, J.; Cinabro, D.; Henderson, S.; Kinoshita, K.; Liu, T.; Saulnier, M.; Wilson, R.; Yamamoto, H.; Ong, B.; Selen, M.; Sadoff, A.J.; Ammar, R.; Ball, S.; Baringer, P.; Coppage, D.; Copty, N.; Davis, R.; Hancock, N.; Kelly, M.; Kwak, N.; Lam, H.; Kubota, Y.; Lattery, M.; Nelson, J.K.; Patton, S.; Perticone, D.; Poling, R.; Savinov, V.; Schrenk, S.; Wang, R.; Alam, M.S.; Kim, I.J.; Nemati, B.; O'Neill, J.J.; Romero, V.; Severini, H.; Sun, C.R.; Zoeller, M.M.; Crawford, G.; Daubenmier, C.M.; Fulton, R.; Fujino, D.; Gan, K.K.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Malchow, R.; Morrow, F.; Skovpen, Y.; Sung, M.; White, C.; Whitmore, J.; Wilson, P.; Butler, F.; Fu, X.; Kalbfleisch, G.; Lambrecht, M.; Ross, W.R.; Skubic, P.; Snow, J.; Wang, P.L.; Wood, M.; Bortoletto, D.; Brown, D.N.; Fast, J.; McIlwain, R.L.; Miao, T.; Miller, D.H.; Modesitt, M.; Schaffner, S.F.; Shibata, E.I.; Shipsey, I.P.J.; Wang, P.N.; Battle, M.; Ernst, J.; Kroha, H.; Roberts, S.; Sparks, K.; Thorndike, E.H.; Wang, C.H.; Dominick, J.; Sanghera, S.; Skwarnicki, T.; Stroynowski, R.; Artuso, M.; He, D.; Goldberg, M.; Horwitz, N.; Kennett, R.; Moneti, G.C.; Muheim, F.; Mukhin, Y.; Playfer, S.; Rozen, Y.; Stone, S.; Thulasidas, M.; Vasseur, G.; Zhu, G.; Bartelt, J.; Csorna, S.E.; Egyed, Z.; Jain, V.; Sheldon, P.; Akerib, D.S.; Barish, B.; Chadha, M.; Chan, S.; Cowen, D.F.; Eigen, G.; Miller, J.S.; Urheim, J.; Weinstein, A.J.; Acosta, D.; Athanas, M.; Masek, G.; Paar, H.; Sivertz, M.; Bean, A.; Gronberg, J.; Kutschke, R.; Menary, S.; Morrison, R.J.; Nakanishi, S.; Nelson, H.N.; Nelson, T.K.; Richman, J.D.; Ryd, A.; Tajima, H.; Schmidt, D.; Sperka, D.; Witherell, M.S.; Procario, M.; Yang, S.; Balest, R.; Cho, K.; Daoudi, M.; Ford, W.T.; Johnson, D.R.; Lingel, K.; Lohner, M.; Rankin, P.; Smith, J.G.; Alexander, J.P.; Bebek, C.; Berkelman, K.; Besson, D.; Browder, T.E.; Cassel, D.G.; Cho, H.A.; Coffman, D.M.; Drell, P.S.
1993-01-01
We report the measurement of new modes of the charmed baryon Λ c + using data recorded by the CLEO II detector at the Cornell Electron Storage Ring. We find branching ratios, relative to Λ c + →pK - π + , of 0.070±0.011±0.011 for Λ c + →Σ + K+K-, 0.069±0.023±0.016 for Λ c + →Σφ, 0.078±0.013±0.013 for Λ c + →Ξ 0 K+, and 0.053±0.016±0.010 for Λ c + →Ξ *0 K+. These measurements indicate that W-exchange diagrams contribute to Λ c + decay. We have also made a new measurement of the previously found mode Λ c + →Ξ - K+π +
12C(3He,3He n)11C cross section at 910 MeV
International Nuclear Information System (INIS)
Aslanides, E.; Fassnacht, P.; Dellacasa, G.; Gallio, M.; Tuyn, J.W.N.
1981-01-01
The 12 C( 3 He, 3 He n) 11 C cross section at 910 MeV was measured by using a Ge(Li) gamma spectrometer to determine the disintegration rate and measuring the incident flux by means of a scintillator telescope. Cross sections for the production of 7 Be in C and Al and for the production of 24 Na in Al are then determined using the measured cross section as a monitor
Experimental Durability Testing of 4H SiC JFET Integrated Circuit Technology at 727 C
Spry, David; Neudeck, Phil; Chen, Liangyu; Chang, Carl; Lukco, Dorothy; Beheim, Glenn M
2016-01-01
We have reported SiC integrated circuits (IC's) with two levels of metal interconnect that have demonstrated prolonged operation for thousands of hours at their intended peak ambient operational temperature of 500 C [1, 2]. However, it is recognized that testing of semiconductor microelectronics at temperatures above their designed operating envelope is vital to qualification. Towards this end, we previously reported operation of a 4H-SiC JFET IC ring oscillator on an initial fast thermal ramp test through 727 C [3]. However, this thermal ramp was not ended until a peak temperature of 880 C (well beyond failure) was attained. Further experiments are necessary to better understand failure mechanisms and upper temperature limit of this extreme-temperature capable 4H-SiC IC technology. Here we report on additional experimental testing of custom-packaged 4H-SiC JFET IC devices at temperatures above 500 C. In one test, the temperature was ramped and then held at 727 C, and the devices were periodically measured until electrical failure was observed. A 4H-SiC JFET on this chip electrically functioned with little change for around 25 hours at 727 C before rapid increases in device resistance caused failure. In a second test, devices from our next generation 4H-SiC JFET ICs were ramped up and then held at 700 C (which is below the maximum deposition temperature of the dielectrics). Three ring oscillators functioned for 8 hours at this temperature before degradation. In a third experiment, an alternative die attach of gold paste and package lid was used, and logic circuit operation was demonstrated for 143.5 hours at 700 C.
On-line measurement of 13C/12C and 15N/14N ratios by E/A-diluter-IRMS
International Nuclear Information System (INIS)
Foerstel, H.; Boner, M.; Prast, H.
2001-01-01
Efficient food control requires rapid procedures for testing source authenticity. Food is produced inside a closed 'isotopic environment' from where it inherits a specific isotopic composition or fingerprint. Isotope ratio mass spectrometry (IRMS) measures isotopic compositions using simple gases like CO 2 or N 2 exclusively. From food samples these gases may be produced by combustion in a commercial CHN analyser (Elemental Analyser, EA). Following GC separation of the combustion gases the elemental content is determined using a thermal conductivity detector (TCD) . The effluent of the EA is coupled to the mass spectrometer via an open split. Because the relative amounts of the bio-elements vary significantly, (often C/N is 25/1 or larger), the amount of analyte gas produced from a single sample must be adjusted e.g. using a diluter. Our diluter configuration can be adjusted to measure repeatedly the 13 C/ 12 C ratio of carbon dioxide in mineral waters, as well as to measure 15 N/ 14 N and 13 C/ 12 C ratios from biological or soil samples simultaneously. In the first application different types of carbon dioxide, produced naturally (well) or technically (process), can be distinguished. The second application offers the possibility to trace the fate of a fertilizer in vineyards by determining the isotopic variation of nitrogen and carbon in soil and vines. (author)
Photochemical reactivity of aqueous fullerene clusters: C{sub 60} versus C{sub 70}
Energy Technology Data Exchange (ETDEWEB)
Hou, Wen-Che, E-mail: whou@mail.ncku.edu.tw; Huang, Shih-Hong
2017-01-15
Highlights: • Aqueous C{sub 60} and C{sub 70} clusters (nC{sub 60} and nC{sub 70}) formed through direct mixing with water adopted a face-centered cubic crystal structure. • The AQYs of nC{sub 60} were greater than those of nC{sub 70}. • Both nC{sub 60} and nC{sub 70} lost considerable organic carbon contents (>80%) after ∼8 months of outdoor sunlight irradiation. • The intermediate photoproducts of nC{sub 60} and nC{sub 70} exhibited an increased content of oxygen-containing functionalities. - Abstract: Over the past few years, there has been a strong interest in exploring the potential impact of fullerenes in the environment. Despite that both C{sub 60} and C{sub 70} have been detected in environmental matrices, the research on the impact of higher fullerenes, such as C{sub 70,} has been largely missing. This study evaluated and compared the phototransformation of aqueous C{sub 60} and C{sub 70} clusters (nC{sub 60} and nC{sub 70}) and their {sup 1}O{sub 2} production under sunlight and lamp light irradiation (315 nm, 360 nm and 420 nm). The nC{sub 60} and nC{sub 70} samples formed by direct mixing with water adopted a face-centered cubic (FCC) crystal structure. The apparent quantum yields (AQYs) of fullerene phototransformed were relatively constant over the examined wavelengths, while {sup 1}O{sub 2} production AQYs decreased with increased wavelengths. The long-term fate studies with outdoor sunlight indicated that both nC{sub 60} and nC{sub 70} lost considerable organic carbon contents (>80%) in water after ∼8 months of irradiation and that the intermediate photoproducts of nC{sub 60} and nC{sub 70} exhibited a progressively increased level of oxygen-containing functionalities. Overall, the study indicates that nC{sub 70} can be photochemically removed under sunlight conditions and that the photoreactivity of nC{sub 60} based on AQYs is greater than that of nC{sub 70}.
Energy Technology Data Exchange (ETDEWEB)
Michelin, S.E. [Departamento de Fisica, Universidade Federal de Santa Catarina, 88040-900 Florianopolis, SC (Brazil)], E-mail: fsc1sem@fsc.ufsc.br; Mazon, K.T.; Arretche, F.; Tenfen, W.; Oliveira, H.L.; Falck, A.S.; Scopel, M.A.; Silva, L.S.S. da [Departamento de Fisica, Universidade Federal de Santa Catarina, 88040-900 Florianopolis, SC (Brazil); Fujimoto, M.M. [Departamento de Fisica, Universidade Federal do Parana, 81531-990 Curitiba, PR (Brazil); Iga, I.; Lee, M.-T. [Departamento de Quimica, Universidade Federal de Sao Carlos, 13565-905, Sao Carlos, SP (Brazil)
2009-04-15
Distorted-wave approximation (DWA) is applied to study core-orbital excitations in C{sub 2}and C{sub 2}N{sub 2} molecules by electron impact. More specifically, we report calculated integral cross sections (ICS) for the X{sup 1}{sigma}{sub g}{sup +}{yields}{sup 1,3}{pi}{sub u}(1s{sigma}{sub u}{yields}1p{pi}{sub g}) and X{sup 1}{sigma}{sub g}{sup +}{yields}{sup 1,3}{pi}{sub g}(1s{sigma}{sub g}{yields}1p{pi}{sub g}) transitions in the C{sub 2}, and X{sup 1}{sigma}{sub g}{sup +}{yields}{sup 1,3}{pi}{sub g}(2s{sigma}{sub g}{yields}2p{pi}{sub g}) and X{sup 1}{sigma}{sub g}{sup +}{yields}{sup 1,3}{pi}{sub u}(2s{sigma}{sub u}{yields}2p{pi}{sub g}) transitions in the C{sub 2}N{sub 2} molecules in the 300-800 eV incident energy range. The comparison of the calculated ICS of these targets with the corresponding data for C{sub 2}H{sub 2} presented. Comparison is also made for the theoretical RI(3:1) ratios of these targets which are calculated by dividing the ICS for triplet transitions by the corresponding results for singlet transitions. The similarities and differences of these results, particularly the presence of the shape resonances at near excitation thresholds, are discussed. The influence of the atomic (localized) and molecular (delocalized) characters of the core orbitals on the core-excitation processes is also investigated. In addition, generalized oscillator strengths for the singlet core-orbital transitions are calculated at incident energy of 1290 eV for C{sub 2} and C{sub 2}N{sub 2}. A comparison with the existing theoretical and experimental data for C{sub 2}H{sub 2} is also presented.
Energy Technology Data Exchange (ETDEWEB)
Stenstroem, K.; Erlandsson, Bengt; Hellborg, R.; Kiisk, M.; Persson, Per [Lund Univ. (Sweden). Dept. of Nuclear Physics; Mattsson, Soeren; Thornberg, C. [Lund Univ., Malmoe (Sweden). Dept. of Radiation Physics; Skog, G. [Lund Univ. (Sweden). Dept. of Quaternary Geology
2000-02-15
The radionuclide {sup 14}C is produced in all types of nuclear reactors mainly by neutron induced reactions in oxygen ({sup 17}O), nitrogen ({sup 14}N) and carbon ({sup 13}C). Part of the {sup 14}C created is continuously released during normal operation as airborne effluents in various chemical forms (such as CO{sub 2}, CO and hydrocarbons) to the surroundings. Because of the biological importance of carbon and the long physical half-life of {sup 14}C, it is of interest to measure the releases and their incorporation into living material. The {sup 14}C activity concentrations in annual tree rings and air around two Swedish nuclear power plants (Barsebaeck and Forsmark) as well as the background {sup 14}C activity levels from two reference sites in southern Sweden during 1973-1996 are presented in this report. In order to verify the reliability of the method some investigations have been conducted at two foreign nuclear sites, Sellafield fuel reprocessing plant in England, and Pickering nuclear generating station in Canada, where the releases of {sup 14}C are known to be substantial. Furthermore, results from some measurements in the vicinity of Paldiski submarine training centre in Estonia are presented. The results of the {sup 14}C measurements of air, vegetation and annual tree rings around the two Swedish nuclear power plants show very low enhancements of {sup 14}C, if at all above the uncertainty of the measurements. Even if the accuracy of the measurements of the annual tree rings is rather good (1-2%) the contribution of {sup 14}C from the reactors to the environment is so small that it is difficult to separate it from the prevailing background levels of {sup 14}C . This is the case for all sampling procedures: in air and vegetation as well as in annual tree rings. Only on a few occasions an actual increase is observed. However, although the calculations suffer from rather large uncertainties, the calculated release rate from Barsebaeck is in fair agreement
Neudeck, Philip G.; Krasowski, Michael J.; Chen, Liang-Yu; Prokop, Norman F.
2009-01-01
The NASA Glenn Research Center has previously reported prolonged stable operation of simple prototype 6H-SiC JFET integrated circuits (logic gates and amplifier stages) for thousands of hours at +500 C. This paper experimentally investigates the ability of these 6H-SiC JFET devices and integrated circuits to also function at cold temperatures expected to arise in some envisioned applications. Prototype logic gate ICs experimentally demonstrated good functionality down to -125 C without changing circuit input voltages. Cascaded operation of gates at cold temperatures was verified by externally wiring gates together to form a 3-stage ring oscillator. While logic gate output voltages exhibited little change across the broad temperature range from -125 C to +500 C, the change in operating frequency and power consumption of these non-optimized logic gates as a function of temperature was much larger and tracked JFET channel conduction properties.
Synthesis, extraction and electronic structure of Ce@C2n
Liu, Bing-Bing; Zou, Guang-Tian; Yang, Hai-Bin; Yu, San; Lu, Jin-Shan; Liu, Zi-Yang; Liu, Shu-Ying; Xu, Wen-Guo
1997-11-01
In view of the growing interest in endohedral lanthanide fullerenes, Ce, as a typical+ 4 oxidation state lanthanide element, has been systematically studied. The synthesis, extraction and electronic structure of Ce @ C2n are investigated. Soot containing Ce@C2n was synthesized in high yield by carbonizing CeO2-containing graphite rods and are back-burning the CeC2-enriched cathode deposit in a DC arc plasma apparatus. Ce@C2n dominated by Ce@C82, can be efficiently extracted from the insoluble part of the soot after toluene Soxhlet extraction by pyridine at high temperature and high pressure in a closed vessel. About 60% Ce@C2n(2n = 82, 80, 78, 76) and 35% Ce@C82 can be enriched in the pyridine extract. This fact is identified by desorption electron impact mass spectrometry (DEI MS). The electronic structure of Ce@C2n is analyzed by using X-ray photoemission spectroscopy (XPS) of pyridine-free film. It is suggested that the encapsulated Ce atom is in a charge state close to+ 3 and was effectively protected from reaction with water and oxygen by the enclosing fullerene cage. Unlike theoretical expectation, the electronic state of Ce@C82 is formally described as Ce+3@C3-82.
International Nuclear Information System (INIS)
Oona, H.
1979-01-01
A proportional counter was constructed from plastic scintillator for measuring the C-14 contents in dendrochronologically dated tree ringas. The tree rings were individually converted to methane which, at one atmosphere pressure, was used as the counter gas. The wall, being a scintillator, serves as the 4π anti-coincidence shell for rejection of natural radioactivity in the material housing the proportional counter and penetrating cosmic ray muons. The output of the proportional counter, which is in anti-coincidence with the scintillation is recorded with a pulse height analyzer. After background subtraction, it yields the beta-decay spectrum of C-14 in the methane-filled proportional counter. The count rate obtained from the 5.5 liter effective volume counter for each year's sample is then referenced to a standard traceable to the National Bureau of Standards, and after corrections due to isotopic fracionation are applied, the ΔC-14 for each sample is determined. The fluctuations in the ΔC-14 are inspected, and used as an estimate for the energy content in the γ-ray burst of the Crab Nebula in 1054 A.D. Fluctuations due possibly to solar flares, neutron flux, cosmic ray muons, and sample preparation restrict the energy estimate to an upper limit of less than or equal to 10 50 ergs
International Nuclear Information System (INIS)
Di Stefano, Marco; Rosi, Marzio; Sgamellotti, Antonio; Ascenzi, Daniela; Bassi, Davide; Franceschi, Pietro; Tosi, Paolo
2003-01-01
In the last few years, astronomical spectra have revealed the presence of aromatic and polyaromatic molecules in extraterrestrial environments, near carbon stars, in molecular clouds and meteorites. Moreover, the recent observation of benzene in interstellar space has noticeably increased the interest in the entire class of molecules and in their chemical behavior. In this work, we have investigated the reaction between the benzene molecule and the atomic nitrogen cation and, in particular, the mechanisms by which the reactants are converted into cationic products containing at least one C-N bond, according to the general scheme C 6 H 6 +N + →H m C n N + +C x H y . We have measured the energy dependence of the cross section in a guided ion beam tandem mass spectrometer. Relevant stationary points of the potential energy surface have been studied by using the density functional theory hybrid functional B3LYP with the 6-31G* basis set. Thermochemical calculations, and the comparison with experimental results, allow us to distinguish between exoergic and endoergic processes and to obtain a detailed description of the reaction mechanisms. We show that aromatic hydrocarbons may be converted into organic-nitrogen compounds via the insertion of N + into the benzene ring and the formation of C-N bonds from C-C ring reactants
International Nuclear Information System (INIS)
Kang, G.J.; Getahun, Z.; Muzaffar, A.; Brossi, A.; Hamel, E.
1990-01-01
Two colchicine analogs with modifications only in the C ring are better inhibitors than colchicine of cell growth and tubulin polymerization. Radiolabeled thiocolchicine (with a thiomethyl instead of a methoxy group at position C-10) and N-acetylcolchinol O-methyl ether (NCME) (with a methoxy-substituted benzenoid instead of the methoxy-substituted tropone C ring) were prepared for comparison with colchicine. Scatchard analysis indicated a single binding site with KD values of 1.0-2.3 microM. Thiocolchicine was bound 2-4 times as rapidly as colchicine, but the activation energies of the reactions were nearly identical (18 kcal/mol for colchicine, 20 kcal/mol for thiocolchicine). NCME bound to tubulin in a biphasic reaction. The faster phase was 60 times as fast as colchicine binding at 37 degrees C, and a substantial reaction occurred at 0 degrees C. The rate of the faster phase of NCME binding changed relatively little as a function of temperature, so the activation energy was only 7.0 kcal/mol. Dissociation reactions were also evaluated, and at 37 degrees C the half-lives of the tubulin-drug complexes were 11 min for NCME, 24 h for thiocolchicine, and 27 h for colchicine. Relative dissociation rates as a function of temperature varied little among the drug complexes. Activation energies for the dissociation reactions were 30 kcal/mol for thiocolchicine, 27 kcal/mol for NCME, and 24 kcal/mol for colchicine. Comparison of the activation energies of association and dissociation yielded free energies for the binding reactions of -20 kcal/mol for NCME, -10 kcal/mol for thiocolchicine, and -6 kcal/mol for colchicine. The greater effectiveness of NCME and thiocolchicine as compared with colchicine in biological assays probably derives from their more rapid binding to tubulin and the lower free energies of their binding reactions
Electronic structure, stability and non-linear optical properties of aza-fullerenes C60-2nN2n(n=1–12
Directory of Open Access Journals (Sweden)
K. Srinivasu
2012-12-01
Full Text Available Through ab initio based density functional theory calculations, we have investigated the electronic structure, stability and non-linear optical properties of a series of nitrogen substituted fullerenes (azafullerenes with the general formula C60-2nN2n (n=1–12. For each system, we have considered different possible isomers and the minimum energy isomer is subjected to further detailed investigations. We have calculated different properties such as HOMO-LUMO gaps, vertical ionization potentials, vertical electron affinities, etc. to verify the stability of the considered fullerenes. From the Hessian calculations, it is observed that all the fullerenes are not only associated with real vibrational frequencies, but the minimum frequencies are also found to be considerably large which further confirms the stability of the considered fullerenes. We find that the presence of unperturbed C6 rings enhances the stability of the fullerene whereas, the -N-C-N- fragments are found to destabilize the structure. At lower doping concentration, the stabilization due to C6 is more predominant and as the doping concentration is increased, the destabilization due to nitrogen-nitrogen repulsion plays a more important role. Our calculated polarizability and hyperpolarizability parameters of C60 are found to be in good agreement with the earlier reported results. On nitrogen doping, considerable variation is observed in the non-linear optical coefficients, which can be helpful in designing new photonic devices.
Junghans, Katrin; Ghiassi, Kamran B; Samoylova, Nataliya A; Deng, Qingming; Rosenkranz, Marco; Olmstead, Marilyn M; Balch, Alan L; Popov, Alexey A
2016-09-05
The formation of endohedral metallofullerenes (EMFs) in an electric arc is reported for the mixed-metal Sc-Ti system utilizing methane as a reactive gas. Comparison of these results with those from the Sc/CH4 and Ti/CH4 systems as well as syntheses without methane revealed a strong mutual influence of all key components on the product distribution. Whereas a methane atmosphere alone suppresses the formation of empty cage fullerenes, the Ti/CH4 system forms mainly empty cage fullerenes. In contrast, the main fullerene products in the Sc/CH4 system are Sc4 C2 @C80 (the most abundant EMF from this synthesis), Sc3 C2 @C80 , isomers of Sc2 C2 @C82 , and the family Sc2 C2 n (2 n=74, 76, 82, 86, 90, etc.), as well as Sc3 CH@C80 . The Sc-Ti/CH4 system produces the mixed-metal Sc2 TiC@C2 n (2 n=68, 78, 80) and Sc2 TiC2 @C2 n (2 n=80) clusterfullerene families. The molecular structures of the new, transition-metal-containing endohedral fullerenes, Sc2 TiC@Ih -C80 , Sc2 TiC@D5h -C80 , and Sc2 TiC2 @Ih -C80 , were characterized by NMR spectroscopy. The structure of Sc2 TiC@Ih -C80 was also determined by single-crystal X-ray diffraction, which demonstrated the presence of a short Ti=C double bond. Both Sc2 TiC- and Sc2 TiC2 -containing clusterfullerenes have Ti-localized LUMOs. Encapsulation of the redox-active Ti ion inside the fullerene cage enables analysis of the cluster-cage strain in the endohedral fullerenes through electrochemical measurements. © 2016 The Authors. Published by Wiley-VCH Verlag GmbH & Co. KGaA.
Wen, Qingbo; Xu, Yeping; Xu, Binbin; Fasel, Claudia; Guillon, Olivier; Buntkowsky, Gerd; Yu, Zhaoju; Riedel, Ralf; Ionescu, Emanuel
2014-11-21
A novel single-source precursor was synthesized by the reaction of an allyl hydrido polycarbosilane (SMP10) and tetrakis(dimethylamido)hafnium(iv) (TDMAH) for the purpose of preparing dense monolithic SiC/HfC(x)N(1-x)-based ultrahigh temperature ceramic nanocomposites. The materials obtained at different stages of the synthesis process were characterized via Fourier transform infrared (FT-IR) as well as nuclear magnetic resonance (NMR) spectroscopy. The polymer-to-ceramic transformation was investigated by means of MAS NMR and FT-IR spectroscopy as well as thermogravimetric analysis (TGA) coupled with in situ mass spectrometry. Moreover, the microstructural evolution of the synthesized SiHfCN-based ceramics annealed at different temperatures ranging from 1300 °C to 1800 °C was characterized by elemental analysis, X-ray diffraction, Raman spectroscopy and transmission electron microscopy (TEM). Based on its high temperature behavior, the amorphous SiHfCN-based ceramic powder was used to prepare monolithic SiC/HfC(x)N(1-x)-based nanocomposites using the spark plasma sintering (SPS) technique. The results showed that dense monolithic SiC/HfC(x)N(1-x)-based nanocomposites with low open porosity (0.74 vol%) can be prepared successfully from single-source precursors. The average grain size of both HfC0.83N0.17 and SiC phases was found to be less than 100 nm after SPS processing owing to a unique microstructure: HfC0.83N0.17 grains were embedded homogeneously in a β-SiC matrix and encapsulated by in situ formed carbon layers which acted as a diffusion barrier to suppress grain growth. The segregated Hf-carbonitride grains significantly influenced the electrical conductivity of the SPS processed monolithic samples. While Hf-free polymer-derived SiC showed an electrical conductivity of ca. 1.8 S cm(-1), the electrical conductivity of the Hf-containing material was analyzed to be ca. 136.2 S cm(-1).
Energy Technology Data Exchange (ETDEWEB)
Negre, Christian Francisco Andres [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Gonzales, Ivana [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2018-01-20
Catalysts inhibition studies were performed to indisputably confirm the role of various metal, carbon, and nitrogen moieties in the individual steps of oxygen reduction reaction (ORR) on M-N-C catalysts. ORR activity was studied at University of New Mexico by rotating ring disk electrode method in the acidic electrolyte with the addition of Tris (tris(hydroxymethyl)-aminomethane) as inhibiting agent. To understand the interaction of Tris with different defects that exist in Fe-N-C materials and provide the support for the experimental data, we used density functional theory (DFT) and modeled the interaction of protonated Tris (TrisH) with Fe containingcenters (Fe-N4 and Fe-N2C2), pyridinic nitrogen, graphitic nitrogen, and pyrrolic nitrogen both as in plane and edge defects.
Simulación con hojas de cálculo de código abierto: OpenOffice.org y Gnumeric
Directory of Open Access Journals (Sweden)
Sánchez Garcia, Juan Fco.
2008-01-01
Full Text Available Una de las posibles alternativas para realizar técnicas de simulación dentro del ámbito de la investigación es utilizar una aplicación de hoja de cálculo, y hacer uso de las funciones propias de las que dispone dicha aplicación. Evidentemente, existen muchas otras aplicaciones especializadas en tareas de simulación pero la hoja de cálculo presenta la característica de su fácil disposición en cualquier organización (ya sea ésta la administración pública o una empresa unido a su bajo coste que en algunos casos concretos puede llegar a ser nulo por existir aplicaciones de tipo gratuito y de código abierto.En este trabajo se va a realizar la validación de las funciones que las hojas de cálculo incorporan para la generación de números pseudoaleatorios, parte vital de cualquier técnica de simulación, y se hará prestando especial atención a las hojas de cálculo de ``código abierto'', tomando como exponente de este tipo de software las dos más difundidas para el sistema operativo Windows: OpenOffice.org y Gnumeric.
Directory of Open Access Journals (Sweden)
Aparicio, M.
2001-02-01
Full Text Available The fact which currently excludes the use of C/SiC composites in high temperature structural applications is the high oxidation rate of carbon fibres at temperatures higher than 450ºC. In this second part of the paper, a review of the different oxidation protection systems, including inhibitors, surface modification of composites, coatings and previous infiltration of the substrates, has been carried out. The addition of inhibitors reduces the oxidation rate, but only up to 850ºC, while the surface modification of composites leads to thin coatings with poor thermal shock resistance. On the other hand, the external layers are the most usual method employed because allows combining different compositions and thicknesses. The multilayer coatings are especially interesting in applications with wide temperature range and thermal shocks requirements. The infiltration of substrate porosity improves slightly the oxidation resistance of C/SiC composites reducing the oxygen accessibility to carbon fibres. However, the infiltration complements very well the oxidation protection performance of a coating system at low temperature, since these normally present open cracks due to mismatch between coating and substrate thermal expansion coefficients.
La utilización de los materiales compuestos C/SiC en aplicaciones estructurales a alta temperatura está limitada por la elevada velocidad de oxidación de la fibra de carbono a temperaturas superiores de 450ºC. En esta segunda parte del trabajo se realiza una revisión de las posibilidades de protección contra la oxidación de estos materiales, incluyendo inhibidores, modificación superficial del material compuesto, recubrimientos e infiltración previa del sustrato. La eficacia de los inhibidores de la reacción de oxidación esta restringida a temperaturas de hasta 850ºC, mientras que la modificación superficial del material compuesto da lugar a capas delgadas y poco resistentes a los ciclos t
International Nuclear Information System (INIS)
Hemmann, A.G.
1993-08-01
From two groups of trees, 15 damaged ones and 15 healthy ones, tree slices were taken and in these the tree-ring widths, ratios of δ 13 C isotopes in cellulose and trace element concentrations were determined. Healthy trees have wider tree-rings over their entire period of life from 1891 to 1986 than the group of trees of damage category 3 (severely damaged). The pattern of tree-ring width development, however, is similar. From eight synchronous δ 13 C traces of non-damaged pines a normal chronology was derived. The ontogenesis of some damaged individuals does not correspond to this normal course. In this way the onset of damage can be reconstructed by means of the δ 13 C values. A link between the δ 13 C values curves and anthropogenously induced changes of atmospheric CO 2 concentration could not be established. The yearly variations of the δ 13 C values of the normal chronology are climate-sensitive. The established trace element concentrations of the wood samples are neither in the toxic nor in the deficiency range. Their magnitude is abour equal in all radial sections, independently of the damage category. (UWA) [de
compounds with N=N, C≡C or conjugated double-bonded systems
Indian Academy of Sciences (India)
Unusual products in the reactions of phosphorus(III) compounds with. N=N, C≡C or conjugated double-bonded systems. K C KUMARA SWAMY,* E BALARAMAN, M PHANI PAVAN, N N BHUVAN KUMAR,. K PRAVEEN KUMAR and N SATISH KUMAR. School of Chemistry, University of Hyderabad, Hyderabad 500 046.
Espichán Palante, Luis
2017-01-01
En la investigación titulada “Clima organizacional y satisfacción laboral de los trabajadores de la empresa E. & C. Contadores S.A.C., 2016”, tuvo el propósito de determinar la relación entre clima organizacional y satisfacción laboral en trabajadores de una empresa de servicios contables. El tipo de investigación fue básica, el diseño no experimental, transversal y correlacional. La muestra estuvo compuesta por 80 trabajadores de la Empresa E. & C. Contadores S.A.C. La técn...
International Nuclear Information System (INIS)
Dochev, D; Desmaris, V; Pavolotsky, A; Meledin, D; Belitsky, V; Lai, Z; Henry, A; Janzen, E; Pippel, E; Woltersdorf, J
2011-01-01
We report on electrical properties and microstructure of epitaxial thin NbN films grown on 3C-SiC/Si substrates by means of reactive magnetron sputtering. A complete epitaxial growth at the NbN/3C-SiC interface has been confirmed by means of high resolution transmission electron microscopy (HRTEM) along with x-ray diffractometry (XRD). Resistivity measurements of the films have shown that the superconducting transition onset temperature (T C ) for the best specimen is 11.8 K. Using these epitaxial NbN films, we have fabricated submicron-size hot-electron bolometer (HEB) devices on 3C-SiC/Si substrate and performed their complete DC characterization. The observed critical temperature T C = 11.3 K and critical current density of about 2.5 MA cm -2 at 4.2 K of the submicron-size bridges were uniform across the sample. This suggests that the deposited NbN films possess the necessary homogeneity to sustain reliable hot-electron bolometer device fabrication for THz mixer applications.
Energy Technology Data Exchange (ETDEWEB)
Dochev, D; Desmaris, V; Pavolotsky, A; Meledin, D; Belitsky, V [Group for Advanced Receiver Development, Department of Earth and Space Sciences, Chalmers University of Technology, SE-412 96 Gothenburg (Sweden); Lai, Z [Nanofabrication Laboratory, Department of Microtechnology and Nanoscience, Chalmers University of Technology, SE-412 96 Gothenburg (Sweden); Henry, A; Janzen, E [Department of Physics, Chemistry and Biology, Linkoeping University, SE-581 83 Linkoeping (Sweden); Pippel, E; Woltersdorf, J, E-mail: dimitar.dochev@chalmers.se [Max-Planck-Institute of Microstructure Physics, Weinberg 2, D-06120 Halle (Germany)
2011-03-15
We report on electrical properties and microstructure of epitaxial thin NbN films grown on 3C-SiC/Si substrates by means of reactive magnetron sputtering. A complete epitaxial growth at the NbN/3C-SiC interface has been confirmed by means of high resolution transmission electron microscopy (HRTEM) along with x-ray diffractometry (XRD). Resistivity measurements of the films have shown that the superconducting transition onset temperature (T{sub C}) for the best specimen is 11.8 K. Using these epitaxial NbN films, we have fabricated submicron-size hot-electron bolometer (HEB) devices on 3C-SiC/Si substrate and performed their complete DC characterization. The observed critical temperature T{sub C} = 11.3 K and critical current density of about 2.5 MA cm{sup -2} at 4.2 K of the submicron-size bridges were uniform across the sample. This suggests that the deposited NbN films possess the necessary homogeneity to sustain reliable hot-electron bolometer device fabrication for THz mixer applications.
Study of 4H-SiC junction barrier Schottky diode using field guard ring termination
International Nuclear Information System (INIS)
Feng-Ping, Chen; Yu-Ming, Zhang; Hong-Liang, Lü; Yi-Men, Zhang; Jian-Hua, Huang
2010-01-01
This paper reports that the 4H-SiC Schottky barrier diode, PiN diode and junction barrier Schottky diode terminated by field guard rings are designed, fabricated and characterised. The measurements for forward and reverse characteristics have been done, and by comparison with each other, it shows that junction barrier Schottky diode has a lower reverse current density than that of the Schottky barrier diode and a higher forward drop than that of the PiN diode. High-temperature annealing is presented in this paper as well to figure out an optimised processing. The barrier height of 0.79 eV is formed with Ti in this work, the forward drop for the Schottky diode is 2.1 V, with an ideality factor of 3.2, and junction barrier Schottky diode with blocking voltage higher than 400 V was achieved by using field guard ring termination. (condensed matter: electronic structure, electrical, magnetic, and optical properties)
International Nuclear Information System (INIS)
Boyter, H.A. Jr.; Grimes, R.N.
1988-01-01
The preparation and chemistry of nido-2,3-R 2 C 2 C 2 B 4 H 6 carboranes in which R is n-butyl, isopentyl, n-hexyl, and phenyl was investigated in order to further assess the steric and electronic influence of the R groups on the properties of the nido-C 2 B 4 cage, especially with respect to metal complexation at the C 2 B 3 face and metal-promoted oxidative fusion. The three dialkyl derivatives were prepared from the corresponding dialkylacetylenes via reaction with B 5 H 9 and triethylamine, but the diphenyl compound could not be prepared in this manner and was obtained instead in a thermal reaction of B 5 H 9 with diphenylacetylene in the absence of amine. All four carboranes are readily bridge-deprotonated by NaH in THF, and the anions of the dialkyl species, on treatment with FeCl 2 and air oxidation, generate the respective R 4 C 4 B 8 H 8 carborane fusion products were R = n-C 4 H 9 , i-C 5 H 11 or n-C 6 H 13 . The diphenylcarborane anion Ph 2 C 2 B 4 H 5 - did not form detectable metal complexes with Fe 2+ , Co 2+ , or Ni 2+ , and no evidence of a Ph 4 C 4 B 8 H 8 fusion product has been found. Treatment of Ph 2 C 2 B 4 H 6 with Cr(CO) 6 did not lead to metal coordination of the phenyl rings, unlike (PhCH 2 ) 2 C 2 B 4 H 6 , which had previously been shown to form mono- and bis(tricarbonylchromium) complexes. However, the reaction of Ph 2 C 2 B 4 H 5 - , CoCl 2 , and (PhPCH 2 ) 2 did give 1,1-(Ph 2 PCH 2 ) 2 -1-Cl-1,2,3-Co(Ph 2 C 2 B 4 H 4 ), the only case in which metal complexation of the diphenylcarborane was observed. 14 references, 3 figures, 3 tables
Synthesis of [3-14C]- and [phenyl-U-14C] olaquindox
International Nuclear Information System (INIS)
Maul, W.; Scherling, D.; Seng, F.
1981-01-01
Olaquindox is a new feed additive. [ 14 C]Olaquindox, labelled in different positions, was needed for tracer-studies of pharmacokinetics, biotransformation and residues in several species of animals. 2-[N-(2-hydroxethyl)-carbamoyl]-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide([3- 14 C]Olaquindox) was synthesized from barium[ 14 C]carbonate (22 mmoles; 1.15 Ci) via [1- 14 C]acetic acid, sodium[1- 14 C]acetate, [1- 14 C]acetylchloride, ethyl[3- 14 C]acetoacetate and 2-carbethoxy-3-methyl-[3- 14 C]quinoxaline-1,4-dioxide with an overall yield of 10%, based on barium[ 14 C]carbonate. The radiochemical purity was better than 98% (tlc). The specific activities of three preparations were 10.5, 8.4 and 5.45 μCi/mg respectively. [phenyl-U- 14 C]Olaquindox was synthesized starting from [U- 14 C]aniline (19.8 mmoles; 284.4 mCi). Intermediate products were N-acetyl[U- 14 C]aniline, 2-nitro-N-acetyl[U- 14 C]aniline, 2-nitro[U- 14 C]aniline and [U- 14 C]benzofurazanoxide. The total yield was 50% as calculated for [U- 14 C]aniline. At calibration samples of two preparations showed specific activities of 49.5 and 11.1 μCi/mg respectively. The radiochemical purity was checked by tlc and exceeded 98%. (author)
Observations of Λc+ semileptonic decay
International Nuclear Information System (INIS)
Albrecht, H.; Ehrlichmann, H.; Hamacher, T.; Krueger, A.; Nau, A.; Nippe, A.; Reidenbach, M.; Schaefer, M.; Schroeder, H.; Schulz, H.D.; Sefkow, F.; Wurth, R.; Appuhn, R.D.; Hast, C.; Herrera, G.; Kolanoski, H.; Lange, A.; Lindner, A.; Mankel, R.; Schieber, M.; Siegmund, T.; Spaan, B.; Thurn, H.; Toepfer, D.; Walther, A.; Wegener, D.; Britton, D.I.; Charlesworth, C.E.K.; Edwards, K.W.; Kapitza, H.; Krieger, P.; Kutschke, R.; MacFarlane, D.B.; Orr, R.S.; Patel, P.M.; Prentice, J.D.; Seidel, S.C.; Tsipolitis, G.; Tzamariudaki, K.; Van de Water, R.G.; Yoon, T.S.; Ressing, D.; Schael, S.; Schubert, K.R.; Strahl, K.; Waldi, R.; Weseler, S.; Childers, R.; Darden, C.W.
1991-06-01
Direct observations of the semileptonic decay of Λ c + in the decay channels Λ c + →Λe + Χ and Λ c + →Λμ + Χ have been made using the ARGUS detector at the DORIS II e + e - storage ring. The cross section times branching ratio were found to be, σ(e + e - →Λ c + Χ).BR(Λ c + →Λe + Χ)=4.20±1.28±0.71 pb and σ(e + e - →Λ c + Χ).BR(Λ c + →Λμ + Χ)=3.91±2.02±0.90 pb. (orig.)
Trost, Barry M.; Frontier, Alison J.; Thiel, Oliver R.; Yang, Hanbiao; Dong, Guangbin
2012-01-01
Bryostatins, a family of structurally complicated macrolides, exhibit an exceptional range of biological activities. The limited availability and structural complexity of these molecules makes development of an efficient total synthesis particularly important. This article describes our initial efforts towards the total synthesis of bryostatins, in which chemoselective and atom-economical methods for stereoselective assembly of the C-ring subunit were developed. A Pd-catalyzed tandem alkyne-alkyne coupling/6-endo-dig cyclization sequence was explored and successfully pursued in the synthesis of a dihydropyran ring system. Elaboration of this methodology ultimately led to a concise synthesis of the C-ring subunit of bryostatins. PMID:21793057
Contribution to the study of the (U,Pu)C,N system
International Nuclear Information System (INIS)
Lorenzelli, R.
1968-01-01
The reactions of UC, PuC, (U,Pu)C, UC 2 and U(C 1-x O x ) with nitrogen at moderate temperatures (room temperature to 400 C) are described. The influence of the uptake of nitrogen by the powders necessary to sinter the carbides upon the nature of the final product has been investigated; it has been shown that the sintered carbides are hyper-stoichiometric. The reactions of carbon with UN, PuN and (U,Pu)N has also been studied. Under vacuum, carbon reacts on the nitrides at temperatures as low as 1100 C; nitrogen is replaced by carbon and the final product is a carbonitride. The reaction is: MN + x C → MN 1-x C x + x/2N 2 . The reaction is limited and the carbonitrides have a fixed composition in presence of M 2 C 3 or MC 2 ; hence it is impossible to produce pure MC using the reaction. The ternary diagram U-C-N, Pu-C-N and (U,Pu)C-N have been drawn. They show clearly that it is possible to obtain single phase carbonitrides in a wide domain of compositions. (author) [fr
Modelling of phase equilibria in CH4–C2H6–C3H8–nC4H10–NaCl–H2O systems
International Nuclear Information System (INIS)
Li, Jun; Zhang, Zhigang; Luo, Xiaorong; Li, Xiaochun
2015-01-01
Highlights: • A new model was established for the phase equilibria of C1–C2–C3–nC4–brine systems. • The model can reproduce of hydrocarbon–brine equilibria to high T&P and salinity. • The model can well predict H 2 O solubility in light hydrocarbon rich phases. - Abstract: A thermodynamic model is presented for the mutual solubility of CH 4 –C 2 H 6 –C 3 H 8 –nC 4 H 10 –brine systems up to high temperature, pressure and salinity. The Peng–Robinson model is used for non-aqueous phase fugacity calculations, and the Pitzer model is used for aqueous phase activity calculations. The model can accurately reproduce the experimental solubilities of CH 4 , C 2 H 6 , C 3 H 8 and nC 4 H 10 in water or NaCl solutions and H 2 O solubility in the non-aqueous phase. The experimental data of mutual solubility for the CH 4 –brine subsystem are sufficient for temperatures exceeding 250 °C, pressures exceeding 1000 bar and NaCl molalities greater than 6 molal. Compared to the CH 4 –brine system, the mutual solubility data of C 2 H 6 –brine, C 3 H 8 –brine and nC 4 H 10 –brine are not sufficient. Based on the comparison with the experimental data of H 2 O solubility in C 2 H 6 -, C 3 H 8 - or nC 4 H 10 -rich phases, the model has an excellent capability for the prediction of H 2 O solubility in hydrocarbon-rich phases, as these experimental data were not used in the modelling. Predictions of hydrocarbon solubility (at temperatures up to 200 °C, pressures up to 1000 bar and NaCl molalities greater than 6 molal) were made for the C 2 H 6 –brine, C 3 H 8 –brine and nC 4 H 10 –brine systems. The predictions suggest that increasing pressure generally increases the hydrocarbon solubility in water or brine, especially in the lower-pressure region. Increasing temperature usually decreases the hydrocarbon solubility at lower temperatures but increases the hydrocarbon solubility at higher temperatures. Increasing water salinity dramatically decreases
Liu, Baodan; Yang, Bing; Yuan, Fang; Liu, Qingyun; Shi, Dan; Jiang, Chunhai; Zhang, Jinsong; Staedler, Thorsten; Jiang, Xin
2015-12-09
In this work, we demonstrate a new strategy to create WZ-GaN/3C-SiC heterostructure nanowires, which feature controllable morphologies. The latter is realized by exploiting the stacking faults in 3C-SiC as preferential nucleation sites for the growth of WZ-GaN. Initially, cubic SiC nanowires with an average diameter of ∼100 nm, which display periodic stacking fault sections, are synthesized in a chemical vapor deposition (CVD) process to serve as the core of the heterostructure. Subsequently, hexagonal wurtzite-type GaN shells with different shapes are grown on the surface of 3C-SiC wire core. In this context, it is possible to obtain two types of WZ-GaN/3C-SiC heterostructure nanowires by means of carefully controlling the corresponding CVD reactions. Here, the stacking faults, initially formed in 3C-SiC nanowires, play a key role in guiding the epitaxial growth of WZ-GaN as they represent surface areas of the 3C-SiC nanowires that feature a higher surface energy. A dedicated structural analysis of the interfacial region by means of high-resolution transmission electron microscopy (HRTEM) revealed that the disordering of the atom arrangements in the SiC defect area promotes a lattice-matching with respect to the WZ-GaN phase, which results in a preferential nucleation. All WZ-GaN crystal domains exhibit an epitaxial growth on 3C-SiC featuring a crystallographic relationship of [12̅10](WZ-GaN) //[011̅](3C-SiC), (0001)(WZ-GaN)//(111)(3C-SiC), and d(WZ-GaN(0001)) ≈ 2d(3C-SiC(111)). The approach to utilize structural defects of a nanowire core to induce a preferential nucleation of foreign shells generally opens up a number of opportunities for the epitaxial growth of a wide range of semiconductor nanostructures which are otherwise impossible to acquire. Consequently, this concept possesses tremendous potential for the applications of semiconductor heterostructures in various fields such as optics, electrics, electronics, and photocatalysis for energy harvesting
Crystal structure of 4-meth-oxy-N-(piperidine-1-carbono-thio-yl)benzamide.
Suhud, Khairi; Hasbullah, Siti Aishah; Ahmad, Musa; Heng, Lee Yook; Kassim, Mohammad B
2017-10-01
In the title compound, C 14 H 18 N 2 O 2 S, the piperidine ring has a chair conformation. Its mean plane is twisted with respect to the 4-meth-oxy-benzoyl ring, with a dihedral angle of 63.0 (3)°. The central N-C(=S)-N(H)-C(=O) bridge is twisted with an N-C-N-C torsion angle of 74.8 (6)°. In the crystal, mol-ecules are linked by N-H⋯O and C-H⋯O hydrogen bonds, forming chains along the c -axis direction. Adjacent chains are linked by C-H⋯π inter-actions, forming layers parallel to the ac plane. The layers are linked by offset π-π inter-actions [inter-centroid distance = 3.927 (3) Å], forming a supra-molecular three-dimensional structure.
Energy Technology Data Exchange (ETDEWEB)
Zhang Xinjian [School of Chemical Engineering and Technology, Tianjin University, 92 Weijin Road, Tianjin 300072 (China); Huang Lu [Department of Materials Science and Engineering, University of Tennessee, TN 37996 (United States); Key Laboratory of Aerospace Materials and Performance (Ministry of Education), School of Materials Science and Engineering, Beijing University of Aeronautics and Astronautics, Beijing 100191 (China); Chen Xu, E-mail: xchen@tju.edu.cn [School of Chemical Engineering and Technology, Tianjin University, 92 Weijin Road, Tianjin 300072 (China); Liaw, Peter K. [Department of Materials Science and Engineering, University of Tennessee, TN 37996 (United States); An Ke [Neutron Scattering Sciences Division, Oak Ridge National Laboratory, TN 37831 (United States); Zhang Tao [Key Laboratory of Aerospace Materials and Performance (Ministry of Education), School of Materials Science and Engineering, Beijing University of Aeronautics and Astronautics, Beijing 100191 (China); Wang Gongyao [Department of Materials Science and Engineering, University of Tennessee, TN 37996 (United States)
2010-11-15
Research highlights: {yields} Fe{sub 75}Mo{sub 5}P{sub 10}C{sub 7.5}B{sub 2.5} bulk-metallic glass exhibits a brittle characteristic under torsional loading. {yields} The BMG occurs in a tensile mode failure under torsional loading. {yields} A slight cyclic-hardening behavior was observed in the initial loading cycles during torsional-fatigue tests. {yields} The torsional fatigue-fracture surface consists of three main regions. - Abstract: Pure- and cyclic-torsional studies were conducted on a Fe{sub 75}Mo{sub 5}P{sub 10}C{sub 7.5}B{sub 2.5} (atomic percent, at.%) bulk-metallic glass at room temperature for an understanding of its damage and fracture mechanisms. Under pure-torsional loading, the metallic glass exhibited very little plastic strain before fracture. The fracture initiated along the maximum tensile-stress plane, which is about 45{sup o} to the axial direction. The shear-fracture strength ({approx}510 MPa) is much lower than the compressive-fracture strength ({approx}3280 MPa), which suggests that different deformation mechanisms be present under various loading modes. Instead of an apparent vein-type structure, the fracture morphologies revealed a crack-initiation site, a mirror region, a mist region, and a hackle region. Under cyclic-torsional loading, fatigue cracks initiated from casting defects, and propagate generally along the maximum tensile-stress plane. A slight cyclic-hardening behavior was observed in initial loading steps. The fatigue-fracture surface consists of three main regions: the fatigue crack-initiation, crack-propagation, and final-fast-fracture areas. The striations resulting from the blunting and re-sharpening of the fatigue crack tip were observed in the crack-propagation region. Based on these results, the damage and fracture mechanisms of the metallic glass induced by torsional loadings are elucidated.
Scardelletti, M.; Neudeck, P.; Spry, D.; Meredith, R.; Jordan, J.; Prokop, N.; Krasowski, M.; Beheim, G.; Hunter, G.
2017-01-01
This paper describes initial development and testing of a novel high temperature capacitive pressure sensor system. The pressure sensor system consists of two 4H-SiC 11-stage ring oscillators and a SiCN capacitive pressure sensor. One oscillator has the capacitive pressure sensor fixed at one node in its feedback loop and varies as a function of pressure and temperature while the other provides a pressure-independent reference frequency which can be used to temperature compensate the output of the first oscillator. A two-day repeatability test was performed up to 500C on the oscillators and the oscillator fundamental frequency changed by only 1. The SiCN capacitive pressure sensor was characterized at room temperature from 0 to 300 psi. The sensor had an initial capacitance of 3.76 pF at 0 psi and 1.75 pF at 300 psi corresponding to a 54 change in capacitance. The integrated pressure sensor system was characterized from 0 to 300 psi in steps of 50 psi over a temperature range of 25 to 500C. The pressure sensor system sensitivity was 0.113 kHzpsi at 25C and 0.026 kHzpsi at 500C.
Inhibitor scaffold for the histone lysine demethylase KDM4C (JMJD2C)
DEFF Research Database (Denmark)
Leurs, Ulrike; Clausen, Rasmus P; Kristensen, Jesper L
2012-01-01
The human histone demethylases of the KDM4 (JMJD2) family have been associated to diseases such as prostate and breast cancer, as well as X-linked mental retardation. Therefore, these enzymes are considered oncogenes and their selective inhibition might be a possible therapeutic approach to treat...... cancer. Here we describe a heterocyclic ring system library screened against the histone demethylase KDM4C (JMJD2C) in the search for novel inhibitory scaffolds. A 4-hydroxypyrazole scaffold was identified as an inhibitor of KDM4C; this scaffold could be employed in the further development of novel...... therapeutics, as well as for the elucidation of the biological roles of KDM4C on epigenetic regulation....
International Nuclear Information System (INIS)
Liua, S.; Lia, Y.; Chena, P.; Lia, W.; Gaoa, S.; Zhang, B.; Yeb, F.
2017-01-01
The effect of residual stresses on the strength, toughness and work of fracture of Si3N4/SiC multilayered composites with different SiC layers has been investigated. It may be an effective way to design and optimize the mechanical properties of Si3N4/SiC multilayered composites by controlling the properties of SiC layers. Si3N4/SiC multilayered composites with different SiC layers were fabricated by aqueous tape casting and pressureless sintering. Residual stresses were calculated by using ANSYS simulation, the maximum values of tensile and compressive stresses were 553.2MPa and −552.1MPa, respectively. Step-like fracture was observed from the fracture surfaces. Fraction of delamination layers increased with the residual stress, which can improve the reliability of the materials. Tensile residual stress was benefit to improving toughness and work of fracture, but the strength of the composites decreased. [es
Energy Technology Data Exchange (ETDEWEB)
Kalabin, G.A. (Siberian Branch of the Academy of Sciences of the USSR); Krivdin, L.B.; Trofimov, B.A.
1982-07-20
In order to elucidate the /sup 13/C-/sup 13/-C SSCC (spin-spin coupling constants) segment with the electronic excitations induced by the R group, a series of phenyl alkyl ethers, PhOAlk, where Alk = Me(I), Et(II), i-Pr(III), and t-Bu(IV), were studied. This series was chosen because in studying the /sup 13/C CS in monosubstituted benzenes it was observed that the intensity of the ..pi..-electron interaction of the unshared electron pairs of oxygen with the ..pi.. system of the benzene ring was practically the same in some compounds, but increased by 30% in others. This is related to the fact that the latter is characterized by an average noncoplanar conformation, with a dihedral angle between the benzene-ring plane and the C-O-C bond of approx. 45/sup 0/, whereas some compounds have an angle < 20/sup 0/. The reason for the difference is significant steric interaction of the alkyl hydrogens with the o-position of the ring. Thus, consideration of the /sup 13/C-/sup 13/C SSCC of a series of quite similar compounds, especially when compared to the whole set of such SSCC for other monosubstituted benzenes, shows that their relationship to the structure of the substituent R is extremely complex.
14C-labeling of isomeric perfluoroalkyl carboxanilide mixtures via electrofluorination
International Nuclear Information System (INIS)
Gajewski, R.P.; Terando, N.H.; Berard, D.F.
1988-01-01
Electrofluorination of benzoyl chloride-ring-UL- 14 C produced an isomer mixture of cyclic C 6 F 11 carbonyl fluorides, principally 1,2,2,3,3,4,4,5,5,6,6-undecafluorocyclohexane-ring-UL- 14 C carbonyl fluoride, which was derivatized with 2-bromo-4-nitroaniline and triethyl amine. The resultant carboxanilide mixture is designated as EL-499 labeled with 14 C in the perfluoro alkyl ring for use in metabolic studies. (author)
Multilayer TiC/TiN diffusion barrier films for copper
International Nuclear Information System (INIS)
Yoganand, S.N.; Raghuveer, M.S.; Jagannadham, K.; Wu, L.; Karoui, A.; Rozgonyi, G.
2002-01-01
TiC/TiN thin films deposited by reactive magnetron sputtering on Si (100) substrates were investigated by transmission electron microscopy for microstructure and by deep level transient spectroscopy (DLTS) for diffusion barrier against copper. TiN thin films deposited on Si substrates at a substrate temperature of 600 deg. C were textured, and TiC thin films deposited at the same temperature were polycrystalline. TiC/TiN multilayer films also showed the same characteristics with the formation of an additional interaction layer. The diffusion barrier characteristics of the TiC/TiN/Si were determined by DLTS and the results showed that the films completely prevented diffusion of copper into Si
Some Congruence Properties of a Restricted Bipartition Function cN(n
Directory of Open Access Journals (Sweden)
Nipen Saikia
2016-01-01
Full Text Available Let cN(n denote the number of bipartitions (λ,μ of a positive integer n subject to the restriction that each part of μ is divisible by N. In this paper, we prove some congruence properties of the function cN(n for N=7, 11, and 5l, for any integer l≥1, by employing Ramanujan’s theta-function identities.
Effect of TaC addition on the microstructures and mechanical properties of Ti(C, N)-based cermets
International Nuclear Information System (INIS)
Wu, Peng; Zheng, Yong; Zhao, Yongle; Yu, Haizhou
2010-01-01
The microstructures of the prepared Ti(C, N)-based cermets with various TaC additions were studied using X-ray diffractometry (XRD) and scanning electron microscopy (SEM). Mechanical properties such as transverse rupture strength (TRS), fracture toughness (K 1C ) and hardness (HRA) were also measured. The results showed that the grain size of the cermets decreased with increasing TaC addition, but too high TaC addition resulted in agglomeration of the grains. An increasing TaC addition increased the dissolution of tungsten, titanium, molybdenum and tantalum in the binder phase. The hardness of the cermets decreased slightly with increasing TaC addition. The transverse rupture strength was the highest for the cermets with 5 wt.% TaC addition, which was characterized by fine grains, homogeneous microstructure and the moderate thickness of rim phase in the binder. The fracture toughness of the cermets with TaC addition from 0 to 5 wt.% decreased obviously, which resulting from decreased grain size. The further decreasing of fracture toughness for the cermets with 7 wt.% TaC addition was due to increased porosity and interfacial tensile stress.
Lifescience Database Archive (English)
Full Text Available XYMGGVFDFPCGQTLDHGILIVGYGAQ DTIVGKNTPYWIIKNSWGADWGEAGYLKV Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxwxxx...xxxxxhhqkxryxnxsylsixcc*wrm*i*lcxswc*n fifhygstk*nsncflliqqwsisycs*c*rmaixygrcfrfpm...IIKNSWGADWGEAGYLKV Frame C: ---xxxxxxxxxxxxxxvvxxxmxxxtsskxxvxkxklpihtxllmenvnltlxklvlkf hlslwfhkmklkllptyst
Preparation of 15N-13C-fulminic acid
International Nuclear Information System (INIS)
Wilmes, R.; Winnewisser, M.
1993-01-01
The precursor for the title compound was prepared in a three-step synthesis. The 13 C-label was incorporated in the first step employing 2- 13 C-ethyl acetate and the 15 N-label in the last step, using 15 N-sodium nitrite. Upon pyrolysis the precursor forms three fragments, one of them being the title compound. (Author)
c-C5H5 on a Ni(1 1 1) surface: Theoretical study of the adsorption, electronic structure and bonding
International Nuclear Information System (INIS)
German, E.; Simonetti, S.; Pronsato, E.; Juan, A.; Brizuela, G.
2008-01-01
In the present work the ASED-MO method is applied to study the adsorption of cyclopentadienyl anion on a Ni(1 1 1) surface. The adsorption with the centre of the aromatic ring placed above the hollow position has been identified to be energetically the most favourable. The aromatic ring remains almost flat, the H atoms are tilted 17 deg. away from the metal surface. We modelled the metal surface by a two-dimensional slab of finite thickness, with an overlayer of c-C 5 H 5 - , one c-C 5 H 5 - per nine surface Ni atoms. The c-C 5 H 5 - molecule is attached to the surface with its five C atoms bonding mainly with three Ni atoms. The Ni-Ni bond in the underlying surface and the C-C bonds of c-C 5 H 5 - are weakened upon adsorption. We found that the band of Ni 5d z 2 orbitals plays an important role in the bonding between c-C 5 H 5 - and the surface, as do the Ni 6s and 6p z bands
A review on g-C3N4-based photocatalysts
International Nuclear Information System (INIS)
Wen, Jiuqing; Xie, Jun; Chen, Xiaobo; Li, Xin
2017-01-01
Graphical abstract: The photocatalytic fundamentals, versatile properties, design strategies and potential applications of g-C 3 N 4 -based photocatalysts were systematically summarized and addressed. - Highlights: • The photocatalytic fundamentals of g-C 3 N 4 were systematically summarized. • The versatile properties of g-C 3 N 4 photocatalysts were highlighted. • The different design strategies of g-C 3 N 4 photocatalysts were reviewed. • The important photocatalytic applications of g-C 3 N 4 were also addressed. - Abstract: As one of the most appealing and attractive technologies, heterogeneous photocatalysis has been utilized to directly harvest, convert and store renewable solar energy for producing sustainable and green solar fuels and a broad range of environmental applications. Due to their unique physicochemical, optical and electrical properties, a wide variety of g-C 3 N 4 -based photocatalysts have been designed to drive various reduction and oxidation reactions under light irradiation with suitable wavelengths. In this review, we have systematically summarized the photocatalytic fundamentals of g-C 3 N 4 -based photocatalysts, including fundamental mechanism of heterogeneous photocatalysis, advantages, challenges and the design considerations of g-C 3 N 4 -based photocatalysts. The versatile properties of g-C 3 N 4 -based photocatalysts are highlighted, including their crystal structural, surface phisicochemical, stability, optical, adsorption, electrochemical, photoelectrochemical and electronic properties. Various design strategies are also thoroughly reviewed, including band-gap engineering, defect control, dimensionality tuning, pore texture tailoring, surface sensitization, heterojunction construction, co-catalyst and nanocarbon loading. Many important applications are also addressed, such as photocatalytic water splitting (H 2 evolution and overall water splitting), degradation of pollutants, carbon dioxide reduction, selective organic
Variations of Leaf Cuticular Waxes Among C3 and C4 Gramineae Herbs.
He, Yuji; Gao, Jianhua; Guo, Na; Guo, Yanjun
2016-11-01
Modern C4 plants are commonly distributed in hot and dry environments whereas C3 plants predominate in cool and shade areas. At the outmost of plant surface, the deposition and chemical composition of cuticular waxes vary under different environmental conditions. However, whether such variation of cuticular wax is related to the distribution of C3 and C4 under different environmental conditions is still not clear. In this study, leaves of six C3 Gramineae herbs distributed in spring, Roegneria kamoji, Polypogon fugax, Poa annua, Avena fatua, Alopecurus aequalis, and Oplismenus undulatifolius, and four C4 and one C3 Gramineae herbs distributed in summer, Digitaria sanguinalis, Eleusine indica, Setaria viridis, S. plicata, and O. undulatifolius, were sampled and analyzed for cuticular wax. Plates were the main epicuticular wax morphology in both C3 and C4 plants except S. plicata. The plates melted in C4 plants but not in C3 plants. The total cuticular wax amounts in C4 plants were significantly lower than those in C3 plants, except for O. undulatifolius. Primary alcohols were the most abundant compounds in C3 plants, whereas n-alkanes were relatively the most abundant compounds in C4 plants. C 29 was the most abundant n-alkane in C3 plants except for O. undulatifolius, whereas the most abundant n-alkane was C 31 or C 33 in C4 plants. The average chain length (ACL) of n-alkanes was higher in C4 than in C3 plants, whereas the ACL of n-alkanoic acids was higher in C3 than C4 plants. The cluster analysis based on the distribution of n-alkanes clearly distinguished C3 and C4 plants into two groups, except for O. undulatifolius which was grouped with C4 plants. These results suggest that the variations of cuticular waxes among C3 and C4 Gramineae herbs are related to the distribution of C3 and C4 plants under different environmental conditions. © 2016 Wiley-VHCA AG, Zurich, Switzerland.
Large-N(c) relations for the electromagnetic N to Delta(1232) transition
International Nuclear Information System (INIS)
Vladimir Pascalutsa; Marc Vanderhaeghen
2007-01-01
We examine the large-N c relations which express the electromagnetic N-to-Δ transition quantities in terms of the electromagnetic properties of the nucleon. These relations are based on the known large-N c relation between the N-to-Δ electric quadrupole moment and the neutron charge radius, and a newly derived large-N c relation between the electric quadrupole (E2) and Coulomb quadrupole (C2) transitions. Extending these relations to finite, but small, momentum transfer we find that the description of the electromagnetic N-to-Δ ratios (R EM and R SM ) in terms of the nucleon form factors predicts a structure which may be ascribed to the effect of the 'pion cloud'. These relations also provide useful constraints for the N-to-Δ generalized parton distributions
HfC plasma coating of C/C composites
International Nuclear Information System (INIS)
Boncoeur, M.; Schnedecker, G.; Lulewicz, J.D.
1992-01-01
The surface properties of C/C composites such as hardness and corrosion or erosion resistance can be modified by a ceramic coating applied by plasma torch. The technique of plasma spraying in controlled temperature and atmosphere, that was developed and patented by the CEA, makes it possible to apply coatings to the majority of metals and ceramics without affecting the characteristics of the composite. An example of hard deposit of HfC on a C/C composite is described. The characteristics of the deposit and of the bonding with the C/C composite were studied before and after a heat treatment under vacuum for 2 hours at 1000 C. 2 refs
Crystal structure of 4-fluoro-N-[2-(4-fluoro-benzo-yl)hydra-zine-1-carbono-thio-yl]benzamide.
Firdausiah, Syadza; Salleh Huddin, Ameera Aqeela; Hasbullah, Siti Aishah; Yamin, Bohari M; Yusoff, Siti Fairus M
2014-09-01
In the title compound, C15H11F2N3O2S, the dihedral angle between the fluoro-benzene rings is 88.43 (10)° and that between the central semithiocarbazide grouping is 47.00 (11)°. The dihedral angle between the amide group and attached fluoro-benzene ring is 50.52 (11)°; the equivalent angle between the carbonyl-thio-amide group and its attached ring is 12.98 (10)°. The major twists in the mol-ecule occur about the C-N-N-C bonds [torsion angle = -138.7 (2)°] and the Car-Car-C-N (ar = aromatic) bonds [-132.0 (2)°]. An intra-molecular N-H⋯O hydrogen bond occurs, which generates an S(6) ring. In the crystal, the mol-ecules are linked by N-H⋯O and N-H⋯S hydrogen bonds, generating (001) sheets. Weak C-H⋯O and C-H⋯F inter-actions are also observed.
Purine 3':5'-cyclic nucleotides with the nucleobase in a syn orientation: cAMP, cGMP and cIMP.
Řlepokura, Katarzyna Anna
2016-06-01
Purine 3':5'-cyclic nucleotides are very well known for their role as the secondary messengers in hormone action and cellular signal transduction. Nonetheless, their solid-state conformational details still require investigation. Five crystals containing purine 3':5'-cyclic nucleotides have been obtained and structurally characterized, namely adenosine 3':5'-cyclic phosphate dihydrate, C10H12N5O6P·2H2O or cAMP·2H2O, (I), adenosine 3':5'-cyclic phosphate 0.3-hydrate, C10H12N5O6P·0.3H2O or cAMP·0.3H2O, (II), guanosine 3':5'-cyclic phosphate pentahydrate, C10H12N5O7P·5H2O or cGMP·5H2O, (III), sodium guanosine 3':5'-cyclic phosphate tetrahydrate, Na(+)·C10H11N5O7P(-)·4H2O or Na(cGMP)·4H2O, (IV), and sodium inosine 3':5'-cyclic phosphate tetrahydrate, Na(+)·C10H10N4O7P(-)·4H2O or Na(cIMP)·4H2O, (V). Most of the cyclic nucleotide zwitterions/anions [two from four cAMP present in total in (I) and (II), cGMP in (III), cGMP(-) in (IV) and cIMP(-) in (V)] are syn conformers about the N-glycosidic bond, and this nucleobase arrangement is accompanied by Crib-H...Npur hydrogen bonds (rib = ribose and pur = purine). The base orientation is tuned by the ribose pucker. An analysis of data obtained from the Cambridge Structural Database made in the context of syn-anti conformational preferences has revealed that among the syn conformers of various purine nucleotides, cyclic nucleotides and dinucleotides predominate significantly. The interactions stabilizing the syn conformation have been indicated. The inter-nucleotide contacts in (I)-(V) have been systematized in terms of the chemical groups involved. All five structures display three-dimensional hydrogen-bonded networks.
Directory of Open Access Journals (Sweden)
Peter W. R. Corfield
2016-07-01
Full Text Available In the title compound, {(C6H16NO[Cu2(CN3]}n, the cyanide groups link the CuI atoms into an open three-dimensional anionic network, with the molecular formula Cu2(CN3−. One CuI atom is tetrahedrally bound to four CN groups, and the other CuI atom is bonded to three CN groups in an approximate trigonal-planar coordination. The tetrahedrally coordinated CuI atoms are linked into centrosymmetric dimers by the C atoms of two end-on bridging CN groups which bring the CuI atoms into close contact at 2.5171 (7 Å. Two of the cyanide groups bonded to the CuI atoms with trigonal-planar surrounding link the dimeric units into columns along the a axis, and the third links the columns together to form the network. The N,N-diethylethanolamine molecules used in the synthesis have become protonated at the N atoms and are situated in cavities in the network, providing charge neutrality, with no covalent interactions between the cations and the anionic network.
International Nuclear Information System (INIS)
Cheung Manki; Ho Chilai
2009-01-01
A simple, efficient and remotely operated synthesis apparatus for carrying out routine [ 11 C]carboxylation, on-column and bubbling [ 11 C]methylation was essential for reliable, day-to-day production of [ 11 C]-labelled PET radiopharmaceuticals. We developed an in-house apparatus specifically applied to the synthesis of [ 11 C]acetate, [ 11 C]choline, [ 11 C]methionine and 2-(4'-N-[ 11 C]methylaminophenyl)-6-hydroxybenzothiazole ([ 11 C]PIB), where high radiochemical purity (≥97%) and moderate radiochemical yields (18% for [ 11 C]PIB, 41-55% for the others) could be achieved. These findings provided evidence that this was a fast, versatile and reliable apparatus suitable for a PET/CT centre with limited financial budget and hot cell space for synthesis of [ 11 C]-labelled radiopharmaceuticals
The Electronic Structure of C59N and Its AxC59N (A=K, Rb, Cs) Salts from High Energy Spectroscopy
Golden, M.S.; Pichler, T.; Knupfer, M.; Friedlein, R.; Haffner, S.; Fink, J.; Andreoni, W.; Curioni, A.; Keshavarz-K, M.; Bellavia-Lund, C.; Sastre, A.; Hummelen, J.-C.; Wudl, F.
1998-01-01
Using a combination of results from photoemission, electron energy-loss spectroscopy in transmission and gradient-corrected density functional calculations, we have examined the effects of chemical substitution of N for C in the dimerised heterofullerene (C59N)2. We show that there is a new HOMO
Energy Technology Data Exchange (ETDEWEB)
Ma, Xiaojuan; Li, Xinru; Li, Mengmeng; Ma, Xiangchao; Yu, Lin, E-mail: yu-lin@sdu.edu.cn; Dai, Ying, E-mail: daiy60@sina.com
2017-08-31
Highlights: • The adsorption of C{sub 60} can induce an irreversible structure distortion for g-C{sub 3}N{sub 4} from flat to wrinkle. • The structure distortion of g-C{sub 3}N{sub 4} plays a crucial role in enhancing photocatalytic performances. • Stability, optical absorption and band edge all have positive correlations with wrinkle degree for g-C{sub 3}N{sub 4} monolayers. - Abstract: C{sub 60}/g-C{sub 3}N{sub 4} composite was reported experimentally to be of high photocatalytic activity in degrading organics. To investigate the underlying mechanism of high photocatalytic performance, the structural and electronic properties of g-C{sub 3}N{sub 4} monolayers with adsorbing and removing fullerene C{sub 60} are studied by means of density functional theory calculations. After 25 possible configurations examination, it is found that C{sub 60} prefers to stay upon the “junction nitrogen” with the carbon atom of fullerene being nearest to monolayers. Correspondingly, a type-I band alignment appears. Our results further demonstrate that the adsorption of C{sub 60} can lead to an irreversible structure distortion for g-C{sub 3}N{sub 4} from flat to wrinkle, which plays a crucial role in improving photocatalytic performance other than the separation of carriers at interface due to the formation of type-II heterojunctions as previous report. Compared to flat one, the light absorption of wrinkled structure shows augmented, the valence band maximum shifts towards lower position along with a stronger photo-oxidation capability. Interestingly, the results indicate that the energy, light absorption and band edge all have a particular relationship with wrinkle degree. The work presented here can be helpful to understand the mechanism behind the better photocatalytic performance for C{sub 60} modified g-C{sub 3}N{sub 4}.
Metal-organic cooperative catalysis in C-H and C-C bond activation and its concurrent recovery.
Park, Young Jun; Park, Jung-Woo; Jun, Chul-Ho
2008-02-01
The development of an efficient catalytic activation (cleavage) system for C-H and C-C bonds is an important challenge in organic synthesis, because these bonds comprise a variety of organic molecules such as natural products, petroleum oils, and polymers on the earth. Among many elegant approaches utilizing transition metals to activate C-H and C-C bonds facilely, chelation-assisted protocols based on the coordinating ability of an organic moiety have attracted great attention, though they have often suffered from the need for an intact coordinating group in a substrate. In this Account, we describe our entire efforts to activate C-H or C-C bonds adjacent to carbonyl groups by employing a new concept of metal-organic cooperative catalysis (MOCC), which enables the temporal installation of a 2-aminopyridyl group into common aldehydes or ketones in a catalytic way. Consequently, a series of new catalytic reactions such as alcohol hydroacylation, oxo-ester synthesis, C-C triple bond cleavage, hydrative dimerization of alkynes, and skeletal rearrangements of cyclic ketones was realized through MOCC. In particular, in the quest for an optimized MOCC system composed of a Wilkinson's catalyst (Ph 3P) 3RhCl and an organic catalyst (2-amino-3-picoline), surprising efficiency enhancements could be achieved when benzoic acid and aniline were introduced as promoters for the aldimine formation process. Furthermore, a notable accomplishment of C-C bond activation has been made using 2-amino-3-picoline as a temporary chelating auxiliary in the reactions of unstrained ketones with various terminal olefins and Wilkinson's catalyst. In the case of seven-membered cyclic ketones, an interesting ring contraction to five- or six-membered ones takes place through skeletal rearrangements initiated by the C-C bond activation of MOCC. On the other hand, the fundamental advances of these catalytic systems into recyclable processes could be achieved by immobilizing both metal and organic
Lifescience Database Archive (English)
Full Text Available klklnl*NQFVTKTSNLKKK--- ---xxxxxxxxxkkkkkkkkkkkkkxxxxxxxxxfff*kkkkkn Frame B: lnhcsilfifklnintikks*n*ickinl*...qklvi*kk--- ---XXXXXXXXXKKKKKKKKKKKKNXXKXXXXXXFFFKKKKKKI Frame C: *iivvfcsysn*isiqlkkvkikfvksicnkn**fkkk--- ---xxxxxxxxx...kkkkkkkkkkkkxxxkxxxxxxfflkkkkkk* Homology vs CSM-cDNA Score E Sequences producing significant al
Field-based cavity ring-down spectrometry of δ¹³C in soil-respired CO₂.
Munksgaard, Niels C; Davies, Kalu; Wurster, Chris M; Bass, Adrian M; Bird, Michael I
2013-06-01
Measurement of soil-respired CO₂ at high temporal resolution and sample density is necessary to accurately identify sources and quantify effluxes of soil-respired CO₂. A portable sampling device for the analysis of δ(13)C values in the field is described herein. CO₂ accumulated in a soil chamber was batch sampled sequentially in four gas bags and analysed by Wavelength-Scanned Cavity Ring-down Spectrometry (WS-CRDS). A Keeling plot (1/[CO₂] versus δ(13)C) was used to derive δ(13)C values of soil-respired CO₂. Calibration to the δ(13)C Vienna Peedee Belemnite scale was by analysis of cylinder CO₂ and CO₂ derived from dissolved carbonate standards. The performance of gas-bag analysis was compared to continuous analysis where the WS-CRDS analyser was connected directly to the soil chamber. Although there are inherent difficulties in obtaining absolute accuracy data for δ(13)C values in soil-respired CO₂, the similarity of δ(13)C values obtained for the same test soil with different analytical configurations indicated that an acceptable accuracy of the δ(13)C data were obtained by the WS-CRDS techniques presented here. Field testing of a variety of tropical soil/vegetation types, using the batch sampling technique yielded δ(13)C values for soil-respired CO₂ related to the dominance of either C₃ (tree, δ(13)C=-27.8 to-31.9 ‰) or C₄ (tropical grass, δ(13)C=-9.8 to-13.6 ‰) photosynthetic pathways in vegetation at the sampling sites. Standard errors of the Keeling plot intercept δ(13)C values of soil-respired CO₂ were typically7-9 μmol m(-2) s(-1)).
Assessment of Durable SiC JFET Technology for +600 C to -125 C Integrated Circuit Operation
Neudeck, P. G.; Krasowski, M. J.; Prokop, N. F.
2011-01-01
Electrical characteristics and circuit design considerations for prototype 6H-SiC JFET integrated circuits (ICs) operating over the broad temperature range of -125 C to +600 C are described. Strategic implementation of circuits with transistors and resistors in the same 6H-SiC n-channel layer enabled ICs with nearly temperature-independent functionality to be achieved. The frequency performance of the circuits declined at temperatures increasingly below or above room temperature, roughly corresponding to the change in 6H-SiC n-channel resistance arising from incomplete carrier ionization at low temperature and decreased electron mobility at high temperature. In addition to very broad temperature functionality, these simple digital and analog demonstration integrated circuits successfully operated with little change in functional characteristics over the course of thousands of hours at 500 C before experiencing interconnect-related failures. With appropriate further development, these initial results establish a new technology foundation for realizing durable 500 C ICs for combustion engine sensing and control, deep-well drilling, and other harsh-environment applications.
Estudios sobre la función de las células dendríticas y su aplicación en inmunoterapia del cáncer
Suarez, N. (Natalia); Gonzalez, A. (Álvaro); Melero, I. (Ignacio)
2013-01-01
Se ha realizado un ensayo clínico en fase II con vacunas de células dendríticas (CD)comprobando que el tratamiento combinado basado en la vacunación con CD (obtenidas a partir de la diferenciación de monocitos de sangre periférica y pulsadas con lisado tumoral autólogo) y la administración de ciclofosfamida, reduce la población de linfocitos T reguladores, las células endoteliales y las células tumorales en sangre periférica en algunos pacientes con cáncer avanzado. Las CD-tipo 1 obtenidas pr...
Yang, Wenguo; Tan, Davin; Lee, Richmond; Li, Lixin; Pan, Yuanhang; Huang, Kuo-Wei; Tan, Choonhong; Jiang, Zhiyong
2012-01-01
Through the cleavage of the C-C bond, the first catalytic tandem conjugate addition-elimination reaction of Morita-Baylis-Hillman C adducts has been presented. Various S N2′-like C-, S-, and P-allylic compounds could be obtained with exclusive E
2-Benzylsulfanyl-N-(1,3-dimethylimidazolidin-2-ylideneaniline
Directory of Open Access Journals (Sweden)
Ulrich Flörke
2013-04-01
Full Text Available The molecular structure of the title compound, C18H21N3S, shows a twisted conformation with a dihedral angle of 67.45 (4° between the aromatic ring planes and an N—C—C—S torsion angle of −5.01 (13°. The imidazolidine ring and the aniline moiety make a dihedral angle of 56.03 (4° and the asscociated C—N—C angle is 125.71 (10°. The guanidine-like C=N double bond is clearly localized, with a bond length of 1.2879 (14 Å. The C—S—C angle is 102.12 (5° and the S—C(aromatic and S—C bond lengths are 1.7643 (11 and 1.8159 (12 Å.
Low dose irradiation performance of SiC interphase SiC/SiC composites
International Nuclear Information System (INIS)
Snead, L.L.; Lowden, R.A.; Strizak, J.; More, K.L.; Eatherly, W.S.; Bailey, J.; Williams, A.M.; Osborne, M.C.; Shinavski, R.J.
1998-01-01
Reduced oxygen Hi-Nicalon fiber reinforced composite SiC materials were densified with a chemically vapor infiltrated (CVI) silicon carbide (SiC) matrix and interphases of either 'porous' SiC or multilayer SiC and irradiated to a neutron fluence of 1.1 x 10 25 n m -2 (E>0.1 MeV) in the temperature range of 260 to 1060 C. The unirradiated properties of these composites are superior to previously studied ceramic grade Nicalon fiber reinforced/carbon interphase materials. Negligible reduction in the macroscopic matrix microcracking stress was observed after irradiation for the multilayer SiC interphase material and a slight reduction in matrix microcracking stress was observed for the composite with porous SiC interphase. The reduction in strength for the porous SiC interfacial material is greatest for the highest irradiation temperature. The ultimate fracture stress (in four point bending) following irradiation for the multilayer SiC and porous SiC interphase materials was reduced by 15% and 30%, respectively, which is an improvement over the 40% reduction suffered by irradiated ceramic grade Nicalon fiber materials fabricated in a similar fashion, though with a carbon interphase. The degradation of the mechanical properties of these composites is analyzed by comparison with the irradiation behavior of bare Hi-Nicalon fiber and Morton chemically vapor deposited (CVD) SiC. It is concluded that the degradation of these composites, as with the previous generation ceramic grade Nicalon fiber materials, is dominated by interfacial effects, though the overall degradation of fiber and hence composite is reduced for the newer low-oxygen fiber. (orig.)
Crystal structure of N,N-diethylbenzene-1,4-diaminium dinitrate
Directory of Open Access Journals (Sweden)
Yasmina Bouaoud
2014-11-01
Full Text Available In the structure of the title molecular salt, C10H18N22+·2NO3−, the dinitrate salt of 4-(N,N-diethylaminoaniline, the two ethyl groups lie almost perpendicular to the plane of the benzene ring [the ring-to-ethyl C—C—N—C torsion angles are −59.5 (2 and 67.5 (3°]. The aminium groups of the cation form inter-species N—H...O hydrogen bonds with the nitro O-atom acceptors of both anions, giving rise to chain substructures lying along c. The chains are linked via further N—H...O hydrogen bonds, forming two-dimensional networks lying parallel to (010. These sheets are linked by C—H...O hydrogen bonds, forming a three-dimensional structure.
Directory of Open Access Journals (Sweden)
Wolfgang Holzer
2007-01-01
Full Text Available Starting from commercially available educts, a straightforward synthetic route to new heterocyclic building blocks is exemplified with the one- or two-step synthesis of tri-, tetra-, or pentacyclic ring systems. Representatives of the following novel ring systems are prepared from 3-methyl-1-phenyl-2-pyrazolin-5-one and the corresponding o-halo-arenecarbonyl chloride using calcium hydroxide in refluxing 1,4-dioxane: pyrimidino[4',5':5,6]pyrano[2,3-c]pyrazol-4(1H-one, thieno[3',2':5,6]pyrano[2,3c]pyrazol- 4-(1H-one, thieno[3',4':5,6]pyrano[2,3-c]pyrazol-4(1H-one, thieno[3'',2'':4',5']thieno[2',3':5,6]-pyrano[2,3-c]pyrazol-4(1H-one, [1,3]dioxolo[5',6'][1]benzothieno[2',3':5,6]pyrano-[2,3-c]- pyrazol-4(1H-one, pyridazino[4',3':5,6]pyrano[2,3-c]pyrazol-4(1H-one and pyrazolo-[4'',3'':5',6']pyrido[3',4':5,6]pyrano[2,3-c]pyrazol-4(1H-one. While the latter two ring systems are directly obtained due to a spontaneous intramolecular substitution reaction, in the other reactions uncyclised 4-aroylpyrazol-5-ols are produced, which are cyclised into the target heterocycles in a subsequent synthetic step (i.e. treatment with NaH in DMF. Detailed NMR spectroscopic investigations (1H-, 13C-, 15N- with the obtained compounds were undertaken to unambiguously prove the new structures.
Zabielski, Piotr; Ford, G. Charles; Persson, X. Mai; Jaleel, Abdul; Dewey, Jerry D.; Nair, K Sreekumaran
2013-01-01
Precise measurement of low enrichment of stable isotope labeled amino-acid tracers in tissue samples is a prerequisite in measuring tissue protein synthesis rates. The challenge of this analysis is augmented when small sample size is a critical factor. Muscle samples from human participants following an 8 hour intravenous infusion of L-[ring-13C6]phenylalanine and a bolus dose of L-[ring-13C6]phenylalanine in a mouse were utilized. Liquid Chromatography tandem mass spectrometry (LC/MS/MS), Gas Chromatography tandem mass spectrometry (GC/MS/MS) and Gas Chromatography/Mass spectrometry (GC/MS) were compared to the Gas Chromatography-Combustion-Isotope Ratio mass spectrometry (GC/C/IRMS), to measure mixed muscle protein enrichment of [ring13C6]phenylalanine enrichment. The sample isotope enrichment ranged from 0.0091 to 0.1312 Molar Percent excess (MPE). As compared with GC/C/IRMS, LC/MS/MS, GC/MS/MS and GC/MS showed coefficients of determination of R2 = 0.9962 and R2 = 0.9942, and 0.9217 respectively. However, the precision of measurements (coefficients of variation) for intra-assay are 13.0%, 1.7%, 6.3% and 13.5% and for inter-assay are 9.2%, 3.2%, 10.2% and 25% for GC/C/IRMS, LC/MS/MS, GC/MS/MS and GC/MS respectively. The muscle sample sizes required to obtain these results were 8μg, 0.8μg, 3μg and 3μg for GC/C/IRMS, LC/MS/MS, GC/MS/MS, and GC/MS respectively. We conclude that LC/MS/MS is optimally suited for precise measurements of L-[ring-13C6]phenylalanine tracer enrichment in low abundance and in small quantity samples. PMID:23378099
Szybinski, Marcin; Sokolowska, Katarzyna; Sicinski, Rafal R; Plum, Lori A; DeLuca, Hector F
2017-10-01
Prompted by results of molecular modeling performed on the seco-d-ring-vitamins D, we turned our attention to such analogs, having reversed configurations at C-13 and C-14, as the next goals of our studies on the structure-activity relationship for vitamin D compounds. First, we developed an efficient total synthesis of the "upper" C/seco-d-ring fragment with a 7-carbon side chain. Then, we coupled it with A-ring fragments using Sonogashira or Wittig-Horner protocol, providing the targeted D-seco analogs of 1α,25-dihydroxyvitamin D 3 and 1α,25-dihydroxy-19-norvitamin D 3 possessing a vinyl substituent at C-14 and a double bond between C-17 and C-20. The affinities of the synthesized vitamin D analogs to the full-length recombinant rat VDR were examined, as well as their differentiating and transcriptional activities. In these in vitro tests, they were significantly less active compared to 1α,25-(OH) 2 D 3 . Moreover, it was established that the analogs tested in vivo in rats showed no calcemic potency. Copyright © 2016 Elsevier Ltd. All rights reserved.
Excitation functions of the systems 12C+14C and 13C+12C
International Nuclear Information System (INIS)
Haindl, E.
1975-01-01
The excitation functions of the systems 12 C+ 14 C and 13 C+ 12 C are investigated for different exit channels. The excitation functions measured do not show correlated structures as in the system 12 C+ 12 C. (WL/AK) [de
Two Novel C3N4 Phases: Structural, Mechanical and Electronic Properties
Directory of Open Access Journals (Sweden)
Qingyang Fan
2016-05-01
Full Text Available We systematically studied the physical properties of a novel superhard (t-C3N4 and a novel hard (m-C3N4 C3N4 allotrope. Detailed theoretical studies of the structural properties, elastic properties, density of states, and mechanical properties of these two C3N4 phases were carried out using first-principles calculations. The calculated elastic constants and the hardness revealed that t-C3N4 is ultra-incompressible and superhard, with a high bulk modulus of 375 GPa and a high hardness of 80 GPa. m-C3N4 and t-C3N4 both exhibit large anisotropy with respect to Poisson’s ratio, shear modulus, and Young’s modulus. Moreover, m-C3N4 is a quasi-direct-bandgap semiconductor, with a band gap of 4.522 eV, and t-C3N4 is also a quasi-direct-band-gap semiconductor, with a band gap of 4.210 eV, with the HSE06 functional.
Zhou, Xiaoqi; Dong, Haibo; Lan, Zhongming; Bacon, Gary; Hao, Yanbin; Chen, Chengrong
2017-10-01
Few studies have focused on the effects of long-term forest plantations on the soil profile of carbon (C) and nitrogen (N) stocks. In this study, we selected 78-year-old tree plantations that included three coniferous tree species (i.e., slash pine, hoop pine and kauri pine) and a Eucalyptus species in subtropical Australia. We measured soil extractable organic C (EOC) and N (EON) contents and total C and N stocks under different tree species on the forest floor and along a soil profile to 100 cm depth. The results showed that Eucalyptus had significantly higher soil EOC contents (3.3 Mg ha -1 ) than the other tree species (EOC of 1.9-2.3 Mg ha -1 ) and had significantly higher EON (156 kg ha -1 ) contents than slash pine (107 kg ha -1 ). Eucalyptus had significantly higher soil C (58.9 Mg ha -1 ) and N (2.03 Mg ha -1 ) stocks than the other tree species (22.3-27.6 Mg C ha -1 and 0.71-1.23 Mg N ha -1 ) at 0-100 cm depth. There were no differences in soil C stocks at the 0-100 cm depth among the coniferous tree species. Forest floor C stocks had stronger effects on mineral soil total N stocks than fine root biomass, whereas fine root biomass exerted stronger effects on soil total C stocks at the 0-100 cm depth than forest floor C and N stocks. Our results addressed large differences in soil C and N stocks under different tree species, which can provide useful information for local forest management practices in this region.
McIntosh, Grant J; Russell, Douglas K
2015-12-24
Experimental and theoretical results concerning the growth and isomerization of chlorinated acenaphthylene, C12H8, during the pyrolysis of chlorohydrocarbons are presented here. A fullerene subunit, C12H8, is a useful system to investigate regarding C60 formation. However, direct experimental observation of isomerization and annealing processes in particular are difficult to confirm due to the high symmetry of the parent molecule. Chlorination lowers the symmetry, essentially labeling carbon atoms, allowing growth and isomerization to be followed directly. Pyrolysis of dichloro- and trichloroethylene, and their copyrolyses with trichlorobenzenes, provides an efficient and general source of chlorinated acenaphthylenes in a range of degrees of chlorination and over a number of unique congeners. Analysis of congener yields as a function of reagents employed, guided by DFT/B3LYP/6-311G(d,p) level calculations, strongly suggests that C2 addition across three-carbon bays in naphthalene is a major driver of growth. Additionally, extremely facile five-membered ring shifts are operative, with chlorine promoting isomerization. Theoretical study of C16H10- and C18H10-based congeners indicate that this is a general phenomenon, and with chlorine also favoring internal cyclopentafused rings in addition to increased isomerization rates, this suggests halogen moieties may be an important feature for efficient fullerene growth.
Formation of permeation barriers on ceramic SiC/SiC composites
International Nuclear Information System (INIS)
Racault, C.; Fenici, P.
1996-01-01
The effectiveness as permeation barriers of the following CVD and PVD (sputtering) coatings has been investigated: TiC+Al 2 O 3 (CVD), SiC(CVD), SiO 2 (CVD), TiN(CVD), TiN(CVD)+TiN(PVD) and SiC(CVD)+Al 2 O 3 (PVD). The substrate material was a SiC/SiC composite, proposed as low activation structural material for fusion applications. Permeation measurements were performed in the temperature range 300-750 K using deuterium at pressures in the range 0.5-150 kPa. A linear dependence of permeation rate on pressure was measured. The efficiency of the coatings as deuterium permeation barriers is discussed in terms of coating microstructure. The best result was obtained with a bilayer of TiN(CVD) (15 μm) +TiN(PVD) (8 μm). (orig.)
Jagannadham, K.
2018-01-01
TiC and TiN films were deposited by reactive magnetron sputtering on Si substrates. Scanning electron microscopy (SEM) and transmission electron microscopy (TEM) characterization of the microstructure and interface structure have been carried out and the stoichiometric composition of TiC is determined. Thermal conductivity and interface thermal conductance between different layers in the films are evaluated by the transient thermo reflectance (TTR) and three-omega (3- ω) methods. The results showed that the thermal conductivity of the TiC films increased with temperature. The thermal conductivity of TiC in the absence of TiN is dominated by phonon contribution. The electronic contribution to the thermal conductivity of TiC in the presence of TiN is found to be more significant. The interface thermal conductance of the TiC/TiN interface is much larger than that of interfaces at Au/TiC, TiC/Si, or TiN/Si. The interface thermal conductance between TiC and TiN is reduced by the layer formed as a result of interdiffusion.
Koopmans, Martin P.; Schaeffer-Reiss, Christine; de Leeuw, Jan W.; Lewan, Michael D.; Maxwell, James R.; Schaeffer, Philippe; Sinninghe Damsté, Jaap S.
1997-06-01
Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature ( Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330°C for 72 h to study the diagenetic fate of n-C 37 and n-C 38 di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260°C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C 37 and n-C 38 skeletons, saturated n-C 37 and n-C38 methyl, ethyl, and mid-chain ketones, C 37 and C 38 mid-chain 2,5-di- n-alkylthiophenes, C 37 and C 38 1,2-di- n-alkylbenzenes, and C 37 and C 38n-alkanes. With increasing thermal maturation, three forms of the n-C 37 and n-C 38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di- n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C 37 and n-C 38 skeleton can be expected as well as the corresponding hydrocarbons.
Koopmans, M.P.; Schaeffer-Reiss, C.; De Leeuw, J. W.; Lewan, M.D.; Maxwell, J.R.; Schaeffer, P.; Sinninghe, Damste J.S.
1997-01-01
Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330??C for 72 h to study the diagenetic fate of n-C37 and n-C38 di-and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260??C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S-and O-bound n-C37 and n-C38 skeletons, saturated n-C37 and n-C38 methyl, ethyl, and mid-chain ketones, C37 and C38 mid-chain 2,5-di-n-alkylthiophenes, C37 and C38 1,2-di-n-alkylbenzenes, and C37 and C38 n-alkanes. With increasing thermal maturation, three forms of the n-C37 and n-C38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S-and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C37 and n-C38 skeleton can be expected as well as the corresponding hydrocarbons. Copyright ?? 1997 Elsevier Science Ltd.
Deposition and characterisation of multilayer hard coatings. Ti/TiNδ/TiCxNy/(TiC) a-C:H/(Ti) a-C:H
International Nuclear Information System (INIS)
Burinprakhon, T.
2001-02-01
Multilayer hard coatings containing Ti, TiNδ, TiC x N y , (TiC m ) a-C:H, (TiC n ) a-C:H, and (Ti) a-C:H were deposited on commercially pure titanium substrates by using an asymmetric bipolar pulsed-dc reactive magnetron sputtering of a titanium target, with Ar, Ar+N 2 , Ar+N 2 +CH 4 , and Ar+CH 4 gas mixtures. The microstructures, elemental compositions and bonding states of the interlayers and the coating surfaces were studied by using cross-sectional transmission electron microscopy (XTEM), electron energy loss spectroscopy (EELS), X-ray diffraction (XRD), Raman spectroscopy, and X-ray photoelectron spectroscopy (XPS). The microstructure development of the multilayer coating was strongly influenced by target poisoning. As a result of the complete poisoning of the titanium target during the deposition of TiNδ and TiC x N y interlayers, the a-C:H interlayers containing graded titanium and nitrogen contents were found to develop successively to the TiC x N y interlayer without the formation of near-stoichiometric TiC. The (TiC m ) a-C:H interlayer consisted of nano-particles of distorted fcc crystal structure embedded in the a-C:H matrix. The (TiC n ) a-C:H and (Ti) a-C:H top layers were found to be a-C:H matrix without nano-particles. In the (Ti) a-C:H top layer there was no measurable amount of Ti observed, regardless of the variation of CH 4 concentration between 37.5 and 60 % flow rate in Ar+-CH4 gas mixture. The top layer (Ti) a-C:H was found to contain approximately 10 atomic % nitrogen, due to N 2 contamination during deposition caused by low conductance of N 2 through the nominally closed valve of the mass flow controller. The change of the CH 4 concentration during deposition of the top layer (Ti) a-C:H, however, showed a strong influence on the hydrogen content. The comparison of the fluorescence background of the Raman spectra revealed that hydrogen-less (Ti) a-C:H was deposited at a CH 4 concentration of less than 50 % flow rate in Ar. The hardness
Energy Technology Data Exchange (ETDEWEB)
Paredes G, L.C
1991-12-15
It was demonstrated that the influence on the fuel temperature to the movement of the control bars, this in direct relationship with the value in negative reactivity of each control bar for the different positions of the ring C. Consequently the influence of bigger to smaller, is given by the regulator bar, fine, of safety and transitory for the configuration of fuel No. 16. It was proven that the ring is the one that presents the biggest generation of power for ring of the reactor, for that in it is registered the fuel temperatures but high. Those were obtained response of different positions in the rings C and D in function of the route of the four control bars and safety of the reactor. (Author)
Kuvychko, Igor V; Dubceac, Cristina; Deng, Shihu H M; Wang, Xue-Bin; Granovsky, Alexander A; Popov, Alexey A; Petrukhina, Marina A; Strauss, Steven H; Boltalina, Olga V
2013-07-15
At sixes and sevens: The reaction of corannulene with 35 equivalents of 1,4-C4F8I2 is an efficient and a relatively selective process that yields two main products in which six H atoms are substituted with three C4F8 moieties that form six- and seven-membered rings. Low-temperature photoelectron spectroscopy showed the electron affinity of the major isomer (shown) exceeds that of C60 (2.74±0.02 and 2.689±0.008 eV, respectively). Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Chaintreau, Alain; Fieber, Wolfgang; Sommer, Horst; Gilbert, Alexis; Yamada, Keita; Yoshida, Naohiro; Pagelot, Alain; Moskau, Detlef; Moreno, Aitor; Schleucher, Jürgen; Reniero, Fabiano; Holland, Margaret; Guillou, Claude; Silvestre, Virginie; Akoka, Serge; Remaud, Gérald S.
2013-01-01
Graphical abstract: -- Highlights: •First ring test on isotopic 13 C NMR spectrometry. •Evaluation of the intra- and inter-variability of the NMR spectrometers used. •Definition of a protocol for qualification of the performance of the spectrometer. -- Abstract: Isotopic 13 C NMR spectrometry, which is able to measure intra-molecular 13 C composition, is of emerging demand because of the new information provided by the 13 C site-specific content of a given molecule. A systematic evaluation of instrumental behaviour is of importance to envisage isotopic 13 C NMR as a routine tool. This paper describes the first collaborative study of intra-molecular 13 C composition by NMR. The main goals of the ring test were to establish intra- and inter-variability of the spectrometer response. Eight instruments with different configuration were retained for the exercise on the basis of a qualification test. Reproducibility at the natural abundance of isotopic 13 C NMR was then assessed on vanillin from three different origins associated with specific δ 13 C i profiles. The standard deviation was, on average, between 0.9 and 1.2‰ for intra-variability. The highest standard deviation for inter-variability was 2.1‰. This is significantly higher than the internal precision but could be considered good in respect of a first ring test on a new analytical method. The standard deviation of δ 13 C i in vanillin was not homogeneous over the eight carbons, with no trend either for the carbon position or for the configuration of the spectrometer. However, since the repeatability for each instrument was satisfactory, correction factors for each carbon in vanillin could be calculated to harmonize the results
Désiré, J; Mondon, M; Fontelle, N; Nakagawa, S; Hirokami, Y; Adachi, I; Iwaki, R; Fleet, G W J; Alonzi, D S; Twigg, G; Butters, T D; Bertrand, J; Cendret, V; Becq, F; Norez, C; Marrot, J; Kato, A; Blériot, Y
2014-11-28
The glycosidase inhibitory properties of synthetic C-alkyl and N-alkyl six-membered iminosugars have been extensively studied leading to therapeutic candidates. The related seven-membered iminocyclitols have been less examined despite the report of promising structures. Using an in house ring enlargement/C-alkylation as well as cross-metathesis methodologies as the key steps, we have undertaken the synthesis and biological evaluation of a library of fourteen 2C- and eight N-alkyl tetrahydroxylated azepanes starting from an easily available glucopyranose-derived azidolactol. Four, six, nine and twelve carbon atom alkyl chains have been introduced. The study of two distinct D-gluco and L-ido stereochemistries for the tetrol pattern as well as R and S configurations for the C-2 carbon bearing the C-alkyl chain is reported. We observed that C-alkylation of the L-ido tetrahydroxylated azepane converts it from an α-L-fucosidase to a β-glucosidase and β-galactosidase inhibitor while N-alkylation of the D-gluco iminosugar significantly improves its inhibition profile leading to potent β-glucosidase, β-galactosidase, α-L-rhamnosidase and β-glucuronidase inhibitors whatever the stereochemistry of the alkyl chain. Interestingly, the N-alkyl chain length usually parallels the azepane inhibitor potency as exemplified by the identification of a potent glucocerebrosidase inhibitor (Ki 1 μM) bearing a twelve carbon atom chain. Additionally, several C-alkyl azepanes demonstrated promising F508del-CFTR correction unlike the parent tetrahydroxyazepanes. None of the C-alkyl and N-alkyl azepanes did inhibit ER α-glucosidases I or II.
Plutonium diffusion in advanced fuels (U,Pu)(C,O) and (U,Pu)(C,N)
International Nuclear Information System (INIS)
Bradbury, M.H.; Matzke, H.
1983-01-01
The self-diffusion of 238 Pu was measured in an oxicarbide (U,Pu)(C,O) and a carbonitride (U,Pu) (C,N). The activation enthalpies were 447 and 347 kJ mol -1 , respectively. The carbonitrides were confirmed to fall into three classes: carbide-like compositions with less than 30% nitrogen in the metalloid lattice, nitride-like composition with more than 70% nitrogen and with reduced atomic mobilities, and carbonitrides with about 50% nitrogen showing an intermediate behavior. The oxicarbide showed diffusion coefficients slightly larger than those of pure carbides
Dicty_cDB: Contig-U03072-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available verselong Onychiurus arcticus d... 38 0.010 2 ( CF439672 ) EST676017 normalized cDNA library of ...ornis cDN... 68 8e-07 1 ( BU884919 ) R017H10 Populus root cDNA library Populus tremula... 68 8e-07 1 ( ...us dormant bud cDNA library Populus ... 60 2e-04 1 ( CK110478 ) N067A08 Populus bark cDNA library Populus tremul...04 1 ( BU887484 ) R062A08 Populus root cDNA library Populus tremula... 60 2e-04 1 ( BU880608 ) UM52TC12 Populus flower cDNA library...us tremula cambium cDNA library Po... 60 2e-04 1 ( BU819297 ) UA42BPA08 Populus tremula cambium cDNA library
Ui, Mihoko; Tanaka, Yoshikazu; Tsumuraya, Takeshi; Fujii, Ikuo; Inoue, Masayuki; Hirama, Masahiro; Tsumoto, Kouhei
2008-07-11
Ciguatoxins are a family of marine toxins composed of transfused polycyclic ethers. It has not yet been clarified at the atomic level on the pathogenic mechanism of these toxins or the interaction between a polycyclic ether compounds and a protein. Using the crystal structures of anti-ciguatoxin antibody 10C9 Fab in ligand-free form and in complexes with ABCD-ring (CTX3C-ABCD) and ABCDE-ring (CTX3C-ABCDE) fragments of the antigen CTX3C at resolutions of 2.6, 2.4, and 2.3 angstroms, respectively, we elucidated the mechanism of the interaction between the polycyclic ethers and the antibody. 10C9 Fab has an extraordinarily large and deep binding pocket at the center of the variable region, where CTX3C-ABCD or CTX3C-ABCDE binds longitudinally in the pocket via hydrogen bonds and van der Waals interactions. Upon antigen-antibody complexation, 10C9 Fab adjusts to the antigen fragments by means of rotational motion in the variable region. In addition, the antigen fragment lacking the E-ring induces a large motion in the constant region. Consequently, the thermostability of 10C9 Fab is enhanced by 10 degrees C upon complexation with CTX3C-ABCDE but not with CTX3C-ABCD. The crystal structures presented in this study also show that 10C9 Fab recoginition of CTX3C antigens requires molecular rearrangements over the entire antibody structure. These results further expand the fundamental understanding of the mechanism by which ladder-like polycyclic ethers are recognized and may be useful for the design of novel therapeutic agents by antibodies, marine toxins, or new diagnostic reagents for the detection and targeting of members of the polycyclic ether family.
International Nuclear Information System (INIS)
Kotzer, T.G.; Watson, W.L.
1999-05-01
Dendrochronologically characterized tree rings from several different species across Central and Eastern Canada and spanning a time range of several decades have been analysed for their 14 C specific activities using oxygen combustion - direct liquid scintillation counting techniques. Carbon-14 specific activities varied between 218 and 439 Bq·kg -1 (±5 to 10%) and yielded a good correlation with the 14 C measured in long-term records of 14 C-in-air values, although 14 C levels in Canada are slightly higher (10 to 20 per mil). An average pre-bomb 14 C value of 225 Bq·kg -1 was obtained from tree rings between 1910 and 1945 which agrees with the value for NBS oxalic acid standard for 'modern' 14 C at 226 Bq·kg -1 . Present-day levels of 14 C in the tree rings are on the order of 250 Bq·kg -1 , indicating that they, like 14 C0 2 -in-air values, have yet to reach 'pre-nuclear testing' levels. Specific activities of 14 C in tree rings from several sites in Canada show no systematic changes with respect to their distance from CANDU heavy-water nuclear power generating stations, suggesting that these stations have had negligible effects on the atmospheric radiocarbon budget for mid-latitudinal North America. The radiocarbon data from the tree rings indicate that atmospheric 14 C has an atmospheric half-time on the order of approximately 15 years, similar to that from other data sets. (author)
C reaction from the Coulomb dissociation of C
Indian Academy of Sciences (India)
non-resonant continuum (corresponding to all multipoles and relative orbital angular ..... As mentioned earlier, 14C(n, γ )15C is in direct competition with proton, deuteron .... The local momentum approximation is also a price one has to pay to.
Investigating C4 Grass Contributions to N-alkane Based Paleoclimate Reconstructions
Doman, C. E.; Enders, S. K.; Chadwick, O.; Freeman, K. H.
2014-12-01
Plant wax n-alkanes are long-chain, saturated hydrocarbons contained within the protective waxy cuticle on leaves. These lipids are pervasive and persistent in soils and sediments and thus are ideal biomarkers of ancient terrestrial organic matter. In ecosystems dominated by C3 plants, the relationship between the carbon isotopic value of whole leaves and lipids is fairly well documented, but this relationship has not been fully investigated for plants that use C4 photosynthesis. In both cases, it is unclear if the isotopic relationships are sensitive to environmental conditions, or reflect inherited characteristics. This study used a natural climate gradient on the Kohala peninsula of Hawaii to investigate relationships between climate and the δ13C and δ2H values of n-alkanes in C3 and C4 plants. δ13C of C3 leaves and lipids decreased 5 ‰ from the driest to the wettest sites, consistent with published data. Carbon isotope values of C4 plants showed no relationship to moisture up to 1000 mm mean annual precipitation (MAP). Above this threshold, δ 13C values were around 10‰ more depleted, likely due to a combination of canopy effects and C4 grasses growing in an uncharacteristically wet and cold environment. In C3 plants, the fractionation between leaf and lipid carbon isotopes did not vary with MAP, which allows estimations of δ13C leaf to be made from alkanes preserved in ancient sediments. Along this transect, C3 plants produce around twice the quantity of n-alkanes as C4 grasses. C4 grasses produce longer carbon chains. As a result, n-alkanes in the geologic record will be biased towards C3 plants, but the presence of alkanes C33 and C35 indicate the contributions of C4 grasses. In both C3 and C4 plants, average chain length increased with mean annual precipitation, but the taxonomic differences in chain length were greater than environmental differences. Hydrogen isotopes of n-alkanes show no trends with MAP, but do show clear differences between plant
Photocatalytic C-H Activation and Oxidative Esterification Using Pd@g-C3N4
U.S. Environmental Protection Agency — Graphitic carbon nitride supported palladium nanoparticles, Pd@g-C3N4, have been synthesized and utilized for the direct oxidative esterification of alcohols using...
33 CFR 110.170 - Lockwoods Folly Inlet, N.C.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...
International Nuclear Information System (INIS)
Ye Qingfu; Sun Jinhe; Qi Wenyuan; Wu Jianmin
2003-01-01
during the process of BR formation of 14 C-chlorsulfuron. (4) During incubation for 90 days, about 4%-5% of 14 C-chlorsulfuron was degraded through opening 14 C-triazine ring and then mineralized to 14 -CO 2 in Soil 2, 3, 5 and 4, and about 7%-9% of 14 C-chlorsulfuron was mineralized to 14 C-CO 2 in Soil 1, 6 and 7. The results demonstrated that 14 C-chlorsulfuron was difficult to be mineralized to 14 CO 2 in soils. The results also indicated that the whole trend of mineralization of 14 C-chlorsulfuron to 14 CO 2 was not significantly different among in Soil 2, 3 and 5, and among in Soil 1, 6 and 7
/sup 13/C NMR spectra and electron conduction in 4-substituted diphenylamines
Energy Technology Data Exchange (ETDEWEB)
Filimonov, V.D.; Kogan, R.M.; Tverdokhlebova, N.E.; Shcherbakov, V.V.; Kushnarev, D.F.; Kalabin, G.A.
1986-07-10
The /sup 13/C NMR spectra were recorded for a series of 4-X-diphenylamines, and correlations equations relating the /sup 13/C NMR chemical shifts of the C/sup 1/ and C/sup 4/ positions to the electronic characteristics of the substituent X were obtained. It was established that the conduction of the substituted ring in the 4-X-diphenylamines is practically the same as in 4-X-biphenyls. Joint analysis of the spectral characteristics of the diphenylamines, biphenyls, N-substituted anilines, and carbazoles made it possible to conclude that the increased transmission characteristics of the diphenylamines are determined by the conformational mobility of the two benzene rings and by the unidirectional effect of changes in the introduction and resonance factors with variation in the substituent X.
Energy Technology Data Exchange (ETDEWEB)
Dalling, D.K.; Haider, G.; Hull, W.E.; Pugmire, R.J.; Shabtai, J.
1984-04-01
A middle-heavy SRC-II distillate (b.p. 230-455/sup 0/C), containing 3.0 wt% of oxygen, has been studied by means of /sup 13/C n.m.r. at 75, 100 and 125 MHz. The magnetization refocusing techniques INEPT and J-resolved two-dimensional Fourier transform have been utilized to demonstrate methods by which resonance line multiplicities may be determined in complex liquid mixtures. Products derived from the above coal liquid by hydrodeoxygenation at temperatures from 200 to 370/sup 0/C, using sulphided Co-Mo and Ni-W catalysts, were also examined. The fraction of aromatic carbon in the hydrotreated liquids was found to correlate directly with their C/H atomic ratio and inversely with the hydrogen content. Comparison of O/C atomic ratios with f /SUB a/ values for these liquids indicates that hydrogen uptake <260/sup 0/C is associated primarily with hydrogenolytic oxygen removal without attendant ring hydrogenation, while at temperatures between 260 and 350/sup 0/C hydrodeoxygenation is accompanied by ring hydrogenation and dealkylation reactions.
Lifescience Database Archive (English)
Full Text Available ens cDNA clone:pph30f12, 3' end,single read. 599 e-167 1 CN206669 |CN206669.1 Tor7097 Gametophyte rehydration...N206834 |CN206834.1 Tor7258 Gametophyte rehydration Library Tortula ruralis cDNA,
Study of the reaction 14 C (p,p) 14 C
International Nuclear Information System (INIS)
Murillo, G.; Ramirez, J.; Avila, O.; Fernandez, M.; Darden, S.E.; Prior, R.P.; Sen, S.
1991-04-01
The study of the elastic scattering of polarized protons in 14 C, it has been very limited. Some angular distributions exists to low energy, as well as measures of excitation functions to several angles for the differential section and the vectorial analyzer power. A detailed study of the elastic scattering of protons by 14 C, it give us experimental information of the excited states in 15 N. The study of these states, is since of considerable interest it is not very easy to obtain a target of 14 C also in a reaction 14 C (p,p) 14 C is possible to obtain information of levels in 15 N to an excitation energy E X >14.95 MeV. (Author)
In situ observation of mechanical damage within a SiC-SiC ceramic matrix composite
Energy Technology Data Exchange (ETDEWEB)
Saucedo-Mora, L. [Institute Eduardo Torroja for Construction Sciences-CSIC, Madrid (Spain); Department of Materials, University of Oxford (United Kingdom); Lowe, T. [Manchester X-ray Imaging Facility, The University of Manchester (United Kingdom); Zhao, S. [Department of Materials, University of Oxford (United Kingdom); Lee, P.D. [Research Complex at Harwell, Rutherford Appleton Laboratory (United Kingdom); Mummery, P.M. [School of Mechanical, Aerospace and Civil Engineering, The University of Manchester (United Kingdom); Marrow, T.J., E-mail: james.marrow@materials.ox.ac.uk [Department of Materials, University of Oxford (United Kingdom)
2016-12-01
SiC-SiC ceramic matrix composites are candidate materials for fuel cladding in Generation IV nuclear fission reactors and as accident tolerant fuel clad in current generation plant. Experimental methods are needed that can detect and quantify the development of mechanical damage, to support modelling and qualification tests for these critical components. In situ observations of damage development have been obtained of tensile and C-ring mechanical test specimens of a braided nuclear grade SiC-SiC ceramic composite tube, using a combination of ex situ and in situ computed X-ray tomography observation and digital volume correlation analysis. The gradual development of damage by matrix cracking and also the influence of non-uniform loading are examined. - Highlights: • X-ray tomography with digital volume correlation measures 3D deformation in situ. • Cracking and damage in the microstructure can be detected using the strain field. • Fracture can initiate from the monolithic coating of a SiC-SiC ceramic composite.
In situ observation of mechanical damage within a SiC-SiC ceramic matrix composite
International Nuclear Information System (INIS)
Saucedo-Mora, L.; Lowe, T.; Zhao, S.; Lee, P.D.; Mummery, P.M.; Marrow, T.J.
2016-01-01
SiC-SiC ceramic matrix composites are candidate materials for fuel cladding in Generation IV nuclear fission reactors and as accident tolerant fuel clad in current generation plant. Experimental methods are needed that can detect and quantify the development of mechanical damage, to support modelling and qualification tests for these critical components. In situ observations of damage development have been obtained of tensile and C-ring mechanical test specimens of a braided nuclear grade SiC-SiC ceramic composite tube, using a combination of ex situ and in situ computed X-ray tomography observation and digital volume correlation analysis. The gradual development of damage by matrix cracking and also the influence of non-uniform loading are examined. - Highlights: • X-ray tomography with digital volume correlation measures 3D deformation in situ. • Cracking and damage in the microstructure can be detected using the strain field. • Fracture can initiate from the monolithic coating of a SiC-SiC ceramic composite.
A Low Cost C8051F006 SoC-Based Quasi-Static C-V Meter for Characterizing Semiconductor Devices
Directory of Open Access Journals (Sweden)
Khairurrijal Khairurrijal
2012-12-01
Full Text Available Based on a C8051F006 SoC (system on-a-chip, a simple and low cost quasi-static capacitance-voltage (C-V meter was designed and developed to obtain C-V characteristics of semiconductor devices. The developed C-V meter consists of a capacitance meter, a programmable voltage source, a C8051F006 SoC-based slave controller, and a personal computer (PC as a master controller. The communication between the master and slave controllers is facilitated by the RS 232 serial communication. The accuracy of the C-V meter was guaranteed by the calibration functions, which are employed by the program in the PC and obtained through the calibration processes of analog to digital converter (ADC, digital to analog converters (DACs of the C8051F006 SoC, and the programmable voltage source. Examining 33-pF and 1000-pF capacitors as well three different p-n junction diodes, it was found that the capacitances of common capacitors are in the range of specified values and typical C-V curves of p-n junction diodes are achieved.
DEFF Research Database (Denmark)
Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter
1997-01-01
This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R)-hydroxymethyl-butyrolac......This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...
Evidence for concerted ring opening and C-Br bond breaking in UV-excited bromocyclopropane.
Pandit, Shubhrangshu; Preston, Thomas J; King, Simon J; Vallance, Claire; Orr-Ewing, Andrew J
2016-06-28
Photodissociation of gaseous bromocyclopropane via its A-band continuum has been studied at excitation wavelengths ranging from 230 nm to 267 nm. Velocity-map images of ground-state bromine atoms (Br), spin-orbit excited bromine atoms (Br(∗)), and C3H5 hydrocarbon radicals reveal the kinetic energies of these various photofragments. Both Br and Br(∗) atoms are predominantly generated via repulsive excited electronic states in a prompt photodissociation process in which the hydrocarbon co-fragment is a cyclopropyl radical. However, the images obtained at the mass of the hydrocarbon radical fragment identify a channel with total kinetic energy greater than that deduced from the Br and Br(∗) images, and with a kinetic energy distribution that exceeds the energetic limit for Br + cyclopropyl radical products. The velocity-map images of these C3H5 fragments have lower angular anisotropies than measured for Br and Br(∗), indicating molecular restructuring during dissociation. The high kinetic energy C3H5 signals are assigned to allyl radicals generated by a minor photochemical pathway which involves concerted C-Br bond dissociation and cyclopropyl ring-opening following single ultraviolet (UV)-photon absorption. Slow photofragments also contribute to the velocity map images obtained at the C3H5 radical mass, but the corresponding slow Br atoms are not observed. These features in the images are attributed to C3H5 (+) from the photodissociation of the C3H5Br(+) molecular cation following two-photon ionization of the parent compound. This assignment is confirmed by 118-nm vacuum ultraviolet ionization studies that prepare the molecular cation in its ground electronic state prior to UV photodissociation.
International Nuclear Information System (INIS)
Wu, Peng; Zheng, Yong; Zhao, Yongle; Yu, Haizhou
2011-01-01
Ti(C, N)-based cermets with addition of SiC whisker (SiC w ) were prepared by vacuum sintering. The microstructures of the prepared cermets were investigated by using X-ray diffractometry (XRD) and scanning electron microscopy (SEM). Mechanical properties such as transverse rupture strength (TRS), fracture toughness (K IC ) and hardness (HRA) were also measured. It was found that the grain size of the cermets was affected by the SiC whisker addition. The cermets with 1.0 wt.% SiC whisker addition exhibited the smallest grain size. The porosities of the cermets increased with increasing SiC whisker additions. The addition of the SiC whisker had no influence on the phase constituents of the cermets. Compared with the cermets with no whisker addition, the highest TRS and fracture toughness for cermets with 1.0 wt.% SiC whisker addition increased by about 24% and 29%, respectively. The strengthening mechanisms were attributed to finer grain size, homogeneous microstructure and moderate thickness of rim phase. The toughening mechanisms were characterized by crack deflection, whisker bridging and whisker pulling-out.
High temperature oxidation of carbide-carbon materials of NbC-C, NbC-TiC-C systems
International Nuclear Information System (INIS)
Afonin, Yu.D.; Shalaginov, V.N.; Beketov, A.R.
1981-01-01
The effect of titanium carbide additions on the oxidation of carbide - carbon composition NbC-TiC-C in oxygen under the pressure of 10 mm Hg and in the air at atmospheric pressure in the temperature range 800-1300 deg is studied. It is shown that the region of negative temperature coefficient during oxidation in the system NbC+C is determined by the processes of sintering and polymorphous transformation. The specific character of the oxide film, formed during oxidation of Nbsub(x)Tisub(y)C+C composites is connected with non-equilibrium nature of carbide grain in its composition. Carbon gasification takes place with the formation of carbon dioxide. Composite materials, containing titanium carbide in complex carbide up to 50-83 mol. %, are the most corrosion resisting ones [ru
Tuning of superconductivity by Ni substitution into noncentrosymmetric ThC o1 -xN ixC2
Grant, T. W.; Cigarroa, O. V.; Rosa, P. F. S.; Machado, A. J. S.; Fisk, Z.
2017-07-01
The recently discovered noncentrosymmetric superconductor ThCoC2 was observed to show unusual superconducting behavior with a critical temperature of Tc=2.65 K . Here we investigate the effect of nickel substitution on the superconducting state in ThC o1 -xN ixC2 . Magnetization, resistivity, and heat capacity measurements demonstrate Ni substitution has a dramatic effect with critical temperature increased up to Tc=12.1 K for x =0.4 Ni concentration, which is a rather high transition temperature for a noncentrosymmetric superconductor. In addition, the unusual superconducting characteristics observed in pure ThCoC2 appear to be suppressed or tuned with Ni substitution towards a more conventional fully gapped superconductor.
International Nuclear Information System (INIS)
Katsumi Iida
2013-01-01
The biosynthetic pathways leading to δ-aminolevulinic acid (ALA) from the Shemin precursor glycine via the C5 pathway in Arthrobacter hyalinus were quantitatively evaluated by means of feeding experiments with [2- 13 C]glycine, sodium [1- 13 C]acetate, and sodium [2- 13 C]acetate, followed by analysis of the labeling patterns of coproporphyrinogen III (Copro'gen III) (biosynthesized from ALA) using 13 C NMR spectroscopy. Two biosynthetic pathways leading to ALA from glycine via the C5 pathway were identified: i.e., transformation of glycine to l-serine catalyzed by glycine hydroxymethyltransferase, and glycine synthase-catalyzed catabolism of glycine to N 5 , N 10 -methylene-tetrahydrofolic acid (THF), which reacts with another molecule of glycine to afford l-serine. l-Serine is transformed to acetyl-CoA via pyruvic acid. Acetyl-CoA enters the tricarboxylic acid cycle, affording 2-oxoglutaric acid, which in turn is transformed to l-glutamic acid. The l-glutamic acid enters the C5 pathway, affording ALA in A. hyalinus. A 13 C NMR spectroscopic comparison of the labeling patterns of Copro'gen III obtained after feeding of [2- 13 C]glycine, sodium [1- 13 C]acetate, and sodium [2- 13 C]acetate showed that [2- 13 C]glycine transformation and [2- 13 C]glycine catabolism in A. hyalinus proceed in the ratio of 52 and 48 %. The reaction of [2- 13 C]glycine and N 5 , N 10 -methylene-THF, that of glycine and N 5 , N 10 -[methylene- 13 C]methylene-THF generated from the [2- 13 C]glycine catabolism, and that of [2- 13 C]glycine and N 5 , N 10 -[methylene- 13 C]methylene-THF transformed the fed [2- 13 C]glycine to [1- 13 C]acetyl-CoA, [2- 13 C]acetyl-CoA, and [1,2- 13 C 2 ]acetyl-CoA in the ratios of 42, 37, and 21 %, respectively. These labeled acetyl-CoAs were then incorporated into ALA. Our results provide a quantitative picture of the pathways of biosynthetic transformation to ALA from glycine in A. hyalinus. (author)
Wear behavior of A356/M{sub 7}C{sub 3} and A356/SiC particulate metal matrix composites
Energy Technology Data Exchange (ETDEWEB)
Turhan, H. [Univ. of Firat, Dept. of Metallurgy, Elazig (Turkey); Yilmaz, O. [Univ. of Firat, Dept. of Metallurgical Engineering, Elazig (Turkey)
2002-06-01
The stability of M{sub 7}C{sub 3} carbides as reinforcement for A356 materials for tribological applications has been investigated. For this purpose, A356/M{sub 7}C{sub 3}, A356/SiC and A356/M{sub 7}C{sub 3}/SiC composites were prepared by powder metallurgy and tested at room temperature against SAE 4620 steel ring and AISI 304 stainless steel counterfaces under loads of 10 - 150 N. For comparison, also unreinforced A356 specimens were processed and tested under the same conditions. The tribological behavior was evaluated by microstructural examination of the wear-effected zones and by weight loss measurements of the specimens and counterfaces. The wear behavior of A356/M{sub 7}C{sub 3} composite gave an excellent result as function of the applied load because the M{sub 7}C{sub 3} particles act as load-bearing elements due to their excellent bonding to the Al matrix, and their interfaces withtood the wear stresses even at the highest applied load. Moreover, the M{sub 7}C{sub 3} particles limited the incorporation of wear debris into the Al matrix and reduced the wear damage occasioned to the steel counterfaces compared to that of A356 Al alloy. (orig.)
Zhang, Shaohua; Yan, Han; Zhao, Mingwei; Zheng, Liqiang
2012-04-15
Three gemini pyrrolidine-based ionic liquids, 1,1'-(butane-1,4-diyl)bis(1-alkylpyrrolidinium) bromide ([C(n)py-4-C(n)py][Br(2)], n=10, 12, 14), were synthesized. Their aggregation behavior in aqueous solution was systematically investigated by surface tension, electrical conductivity, and steady-state fluorescence. Compared with their corresponding monomers, N-alkyl-N-methylpyrrolidinium bromide (C(n)MPB), [C(n)py-4-C(n)py][Br(2)], have higher surface activity. The special structure of [C(n)py-4-C(n)py][Br(2)] that has a spacer in their hydrophilic head groups results in a lower surface excess concentration (Γ(max)) and a larger molecular cross-sectional area (A(min)). Electrical conductivity studies show a lower degree of counter-ion binding to the aggregates. A smaller aggregation number (N(agg)) is observed by the pyrene fluorescence quenching method. A series of thermodynamic parameters (ΔG(agg)(0),ΔH(agg)(0),-TΔS(agg)(0)) of aggregation derived from electrical conductivity indicate that the aggregation of [C(n)py-4-C(n)py][Br(2)] is enthalpy-driven, while aggregation of C(n)MPB is entropy-driven at low temperatures but enthalpy-driven at high temperatures. Copyright © 2012 Elsevier Inc. All rights reserved.
Nitrogen washing from C3 and C4 cover grasses residues by rain
Directory of Open Access Journals (Sweden)
Ciro Antonio Rosolem
2010-12-01
Full Text Available Crop species with the C4 photosynthetic pathway are more efficient in assimilating N than C3 plants, which results in different N amounts prone to be washed from its straw by rain water. Such differences may affect N recycling in agricultural systems where these species are grown as cover crops. In this experiment, phytomass production and N leaching from the straw of grasses with different photosynthetic pathways were studied in response to N application. Pearl millet (Pennisetum glaucum and congo grass (Brachiaria ruziziensis with the C4 photosynthetic pathway, and black oat (Avena Strigosa and triticale (X Triticosecale, with the C3 photosynthetic pathway, were grown for 47 days. After determining dry matter yields and N and C contents, a 30 mm rainfall was simulated over 8 t ha-1 of dry matter of each plant residue and the leached amounts of ammonium and nitrate were determined. C4 grasses responded to higher fertilizer rates, whereas N contents in plant tissue were lower. The amount of N leached from C4 grass residues was lower, probably because the C/N ratio is higher and N is more tightly bound to organic compounds. When planning a crop rotation system it is important to take into account the difference in N release of different plant residues which may affect N nutrition of the subsequent crop.
Energy Technology Data Exchange (ETDEWEB)
Fraga, Vania da Silva
2002-10-01
Productivities under low input or subsistence agriculture are strongly dependent on nutrient supply from soil organic matter mineralization (SOM). Few results are available and they indicate declines in soil fertility under this agricultural system, particularly in SOM levels. In an attempt to understand the nature and extent of these declines we selected ten sites having cultivated areas adjacent with areas under native vegetation at the same slope position, in the states of Pernambuco and Paraiba. Based on the management history, in situ observations and {sup 137} Cs concentrations to evaluate soil erosion, the areas were divided in four groups having different levels of soil use intensity: Undisturbed Dry Forest (UDF), Disturbed Dry Forest (DDF), Preserved-Cultivated (PC) and Degraded-Cultivated (DC). In the first part of this work we quantified total organic C, N and P, in addition to {sup 137} Cs concentrations, under the assumption that changes in organic nutrient contents among land use groups would be greater than the within group variability, thus enabling inferences at a regional scale. Concentrations of C and N in DC were 50% smaller (P<0.05) than those in UDF. Of these losses, 43% were attributed to erosion processes while 57% were related to SOM mineralization. The Po/Pi ratio under UDF was 1.47 and decreased to o.82 in PC and DC (P<0.05). The effects of changes in land use were greater when considering the 0-7.5 cm layer rather than the 0-15 cm layer. Interrelationships between C and P in the dry forest areas suggested that P availability and water controlled C accumulation in these soils. In the second part of this work two experiments were conducted. The first one included a preliminary phase, comparing four methods in their capacity to detect changes in soil organic matter quality. Eighty samples that maximized the variability in C content of the whole set (n=160), were analyzed for: C in the light SOM fraction (density < 1 kg dm{sup -3}) (C-lf); C
C:N:P Molar Ratios, Sources and 14C Dating of Surficial Sediments from the NW Slope of Cuba.
Directory of Open Access Journals (Sweden)
Guadalupe de la Lanza Espino
Full Text Available The surficial sediments recovered from 12 sites located near the channel axis of the Florida Straits and the lower slope off NW Cuba were analyzed for total organic carbon (TOC, nitrogen (TN, phosphorus (TP, elemental C:N:P ratios, C and N isotopic values, and 14C dating. The depth profiles of TOC, TN, and TP (0-18 cm displayed a downcore trend and a significant variation. The TOC values were low (0.15 to 0.62%; 66 to 516 µmol g(-1. Sites near the island's lower slope had lower TOC average concentrations (158-333 µmol g(-1 than those closer to the channel axis (averaging 341-516 µmol g(-1; p <0.05. The TN concentrations near the lower slope attained 0.11% (80 µmol g(-1, whereas, towards the channel axis, they decreased to 0.07% (55 µmol g(-1; p<0.05. The C:N ratios ranged from 1.9 to 10.2. The mean molar C:N ratio (5.4 indicated a marine hemipelagic deposition. The TP was lower at sites near the lower slope (38.4 to 50.0 µmol gv; 0.12% to 0.16% than those near the channel axis (50.0 to 66 µmol g(-1; 0.15 to 0.21%. C:P fluctuated from 7.7 to 14.1 in the surficial sediment layer. The bulk organic δ13Corg and δ15N values confirmed pelagic organic sources, and the 14C dating revealed that the sediments were deposited during the Holocene (1000-5000 yr BP. We suggest that the hydrodynamic conditions in the Straits influence vertical and advective fluxes of particulate organic material trapped in the mixed-layer, which reduces the particulate matter flux to the seabed.
Energy Technology Data Exchange (ETDEWEB)
Angiuli, P.; Fontana, E.; Vicario, G.P. (Farmitalia Carlo Erba s.r.l., Milan (Italy))
1991-05-01
The labelling with radiocarbon of the new antidepressant agent Reboxetine is described. The preparation has been carried out in a two step procedure using 2-chloro-N-(3-(2-ethoxyphenoxy)-2-hydroxy-3-phenyl)propyl-(1-{sup 14}C)acetamide as starting material. The expected compound was prepared by cyclization of the above halogenoacylamido alcohol to the corresponding morpholone ring followed by reduction to the final (5-{sup 14}C)morpholine derivative 4, 98% radiochemically pure and with specific radioactivity of 988 MBq/mmol. An overall radiochemical yield of 57.5% was achieved. (author).
Tetraquark and two-meson states at large N{sub c}
Energy Technology Data Exchange (ETDEWEB)
Lucha, Wolfgang [Austrian Academy of Sciences, Institute for High Energy Physics, Vienna (Austria); Melikhov, Dmitri [Austrian Academy of Sciences, Institute for High Energy Physics, Vienna (Austria); M.V. Lomonosov Moscow State University, D.V. Skobeltsyn Institute of Nuclear Physics, Moscow (Russian Federation); University of Vienna, Faculty of Physics, Vienna (Austria); Sazdjian, Hagop [IPNO, Universite Paris-Sud, CNRS-IN2P3, Universite Paris-Saclay, Orsay (France)
2017-12-15
Considering four-point correlation functions of color-singlet quark bilinears, we investigate, in the large-N{sub c} limit of QCD, the subleading diagrams that involve, in the s-channel of meson-meson scattering amplitudes, two-quark-two-antiquark intermediate states. The latter contribute, together with gluon exchanges, to the formation, at the hadronic level, of two-meson and tetraquark intermediate states. It is shown that the two-meson contributions, which are predictable, in general, from leading-order N{sub c}-behaviors, consistently satisfy the constraints resulting from the 1/N{sub c} expansion procedure and thus provide a firm basis for the extraction of tetraquark properties from N{sub c}-subleading diagrams. We find that, in general, tetraquarks, if they exist in compact form, should have narrow decay widths, of the order of N{sub c}{sup -2}. For the particular case of exotic tetraquarks, involving four different quark flavors, two different types of tetraquark are needed, each having a preferred decay channel, to satisfy the consistency constraints. (orig.)
Dicty_cDB: Contig-U06794-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available opus laevis N-acetyltransferase... 179 7e-44 ( P41227 ) RecName: Full=N-terminal acetyltransferase compl...P2... 178 1e-43 (Q9QY36) RecName: Full=N-terminal acetyltransferase complex ARD1... 178 1e-43 AK009697_1( AK...3 (Q9UTI3) RecName: Full=N-terminal acetyltransferase A complex ca... 174 2e-42 D...( AL672002 |pid:none) Mouse DNA sequence from clone RP2... 152 6e-36 ( P07347 ) RecName: Full=N-terminal acetyltransferase A compl...867 |pid:none) Methanococcus maripaludis C6, c... 55 2e-06 ( Q03503 ) RecName: Full=N-terminal acetyltransferase C compl
Popov, Alexey A; Zhang, Lin; Dunsch, Lothar
2010-02-23
Y(3)C(80) obtained in the synthesis of nitride clusterfullerenes Y(3)N@C(2n) (2n = 80-88) by the reactive atmosphere method is found to be a genuine trimetallofullerene, Y(3)@C(80), with low ionization potential and divalent state of yttrium atoms. DFT studies of the electronic structure of Y(3)@C(80) show that this molecule mimics Y(3)N@C(80) with the pseudoatom (PA) instead of the nitrogen atom. Topology analysis of the electron density and electron localization function show that yttrium atoms form Y-PA bonds rather than direct Y-Y bonds. Molecular dynamics simulations show that the Y(3)PA cluster is as rigid as Y(3)N and rotates inside the fullerene cage as a single entity.
Caicedo, J. C.; Amaya, C.; Yate, L.; Aperador, W.; Zambrano, G.; Gómez, M. E.; Alvarado-Rivera, J.; Muñoz-Saldaña, J.; Prieto, P.
2010-02-01
Corrosion-resistance behavior of titanium carbon nitride (Ti-C-N) and titanium niobium carbon nitride (Ti-Nb-C-N) coatings deposited onto Si(1 0 0) and AISI 4140 steel substrates via r.f. magnetron sputtering process was analyzed. The coatings in contact with a solution of sodium chloride at 3.5% were studied by Tafel polarization curves and impedance spectroscopy methods (EIS). Variations of the bias voltage were carried out for each series of deposition to observe the influence of this parameter upon the electrochemical properties of the coatings. The introduction of Nb in the ternary Ti-C-N film was evaluated via X-ray diffraction (XRD) analysis. The structure was characterized by using Raman spectroscopy to identify ternary and quaternary compounds. Surface corrosion processes were characterized using optical microscopy and scanning electron microscopy (SEM). XRD results show conformation of the quaternary phase, change in the strain of the film, and lattice parameter as the effect of the Nb inclusion. The main Raman bands were assigned to interstitial phases and "impurities" of the coatings. Changes in Raman intensities were attributed to the incorporation of niobium in the Ti-C-N structure and possibly to resonance enhancement. Finally, the corrosion data obtained for Ti-C-N were compared with the results of corrosion tests of Ti-Nb-C-N coating. The results obtained showed that the incorporation of niobium to Ti-C-N coatings led to an increase in the corrosion-resistance. On another hand, an increase in the bias voltage led to a decrease in the corrosion-resistance for both Ti-C-N and Ti-Nb-C-N coatings.
Directory of Open Access Journals (Sweden)
Lyonel Beaulieu Lalanne
2011-01-01
Full Text Available OBJETIVO: Describir los resultados clínicos e imagenológicos utilizando la técnica de fijación C1 C2 con tornillos transarticulares y asas de alambre en pacientes portadores de AR en un seguimiento a largo plazo y revisar la literatura actual. MÉTODO: Entre los años 2002 y 2006, 11 pacientes (9 mujeres y 2 hombres con inestabilidad C1 C2 secundaria a AR fueron intervenidos quirúrgicamente. Se realizó fijación C1 C2 con tornillos transarticulares por vía posterior más asas de alambre y aplicación de injerto óseo autólogo de cresta ilíaca. Se registró Índice de Ranawat pre y posoperatorio, Distancia Anterior Atlas Odontoides (DAAO pre y posoperatorio, tiempo operatorio, días de hospitalización, complicaciones intra y posoperatorias y tiempo de consolidación radiológica, con un seguimiento promedio de 34 meses. RESULTADOS: Todos los pacientes presentaron mejoría del Índice de Ranawat en el postoperatorio. La DAAO preoperatoria promedio fue de 11,9 mm (DS ± 2,57, rango 7 a 16, y la DAAO postoperatoria promedio fue de 3 mm (DS ± 1,20, rango 2 a 6. El tiempo quirúrgico fue de 94 minutos en promedio y el promedio de días de hospitalización fue de 7 días. No se presentaron complicaciones intraoperatorias. Un caso presentó seroma de herida operatoria que requirió tratamiento quirúrgico. El tiempo de consolidación fue en promedio 14 semanas. CONCLUSIÓN: La artrodesis atlantoaxial con tornillos y amarras es una buena alternativa para el manejo de la inestabilidad C1-C2 en pacientes portadores de AR, consiguiendo buenos resultados clínicos e imagenológicos en un seguimiento a largo plazo.OBJETIVO: Apresentar a experiência com a técnica de fixação C1-C2 com parafusos transarticulares e cerclagem de fio metálico nos pacientes portadores de AR, assim como a revisão da literatura. MÉTODO: Entre os anos 2002 e 2006, 11 pacientes (9 mulheres e 2 homens com instabilidade C1-C2 e portadores de AR foram submetidos a
Cachero Castro, Cristina; Ponce de León Amador, Pedro José
2007-01-01
Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Clases en C++. Operaciones set/get/is. Tipo Referencia (&). El puntero 'this'. Los constructores. El destructor.
International Nuclear Information System (INIS)
Larrea, Edurne S.; Mesa, Jose L.; Pizarro, Jose L.; Arriortua, Maria I.; Rojo, Teofilo
2007-01-01
Ni 2 (C 4 H 4 N 2 )(V 4 O 12 )(H 2 O) 2 , 1, and Ni 3 (C 4 H 4 N 2 ) 3 (V 8 O 23 ), 2, have been synthesized using mild hydrothermal conditions at 170 deg. C under autogenous pressure. Both phases crystallize in the P-1 triclinic space group, with the unit-cell parameters, a=7.437(7), b=7.571(3), c=7.564(4) A, α=65.64(4), β=76.09(4), γ=86.25(3) o for 1 and a=8.566(2), b=9.117(2), c=12.619(3) A, α=71.05(2), β=83.48(4), γ=61.32(3) o for 2, being Z=2 for both compounds. The crystal structure of the three-dimensional 1 is constructed from layers linked between them through the pyrazine molecules. The sheets are formed by edge-shared [Ni 2 O 6 (H 2 O) 2 N 2 ] nickel(II) dimers octahedra and rings composed by four [V 4 O 12 ] vanadium(V) tetrahedra linked through vertices. The crystal structure of 2 is formed from vertex shared [VO 4 ] tetrahedra that give rise to twelve member rings. [NiO 4 (C 4 H 4 N 2 ) 2 ] ∞ chains, resulting from [NiO 4 N 2 ] octahedra and pyrazine molecules, give rise to a 3D skeleton when connecting to [VO 4 ] tetrahedra. Diffuse reflectance measurements of 1 indicate a slightly distorted octahedral geometry with values of Dq=880, B=980 and C=2700 cm -1 . Magnetic measurements of 1, carried out in the 5.0-300 K range, indicate the existence of antiferromagnetic couplings with a Neel temperature near to 38 K. - Graphical abstract: Crystal structure of a sheet of Ni 2 (C 4 H 4 N 2 )(V 4 O 12 )(H 2 O) 2
Caracterización de las cibercomunidades de aprendizaje (cCA
Directory of Open Access Journals (Sweden)
Iñaki Murua Anzola
2015-01-01
Full Text Available En este artículo se presentan los principales resultados de la investigación exploratoria llevada a cabo sobre las cibercomunidades de aprendizaje (cCA y la formación del profesorado aplicando , entre otros, el método Delphi; e l marco teórico y contextual de la misma se presentó en el número 43 de la revista RED. Los participantes de l panel de expertos han sido 31 encuestados online con el instrumento Delphi - cCA, y 19 respo nsables de comunidades que han contestado al cuestionario - cCA. Entre los principales resultados se destacan las condiciones para la creación y desarrollo de cCA, las herramientas y funcionalidades de las comunidades y las tipologías de participación ( perso nas implicadas, activas, pasivas y ausentes.
4-Chloro-N-(3,4-dichlorophenyl-2-methylbenzenesulfonamide
Directory of Open Access Journals (Sweden)
Vinola Z. Rodrigues
2011-11-01
Full Text Available In the title compound, C13H10Cl3NO2S, the N—C bond in the C—SO2—NH—C segment forms trans and gauche torsion angles with respect to the S=O bonds. Further, the N—H bond in the C—SO2—NH—C segment is anti to the meta-Cl atom in the anilino benzene ring and nearly syn with respect to the ortho-methyl group in the sulfonyl benzene ring. The C—SO2—NH—C torsion angle is −49.4 (2°. The sulfonyl and aniline benzene rings are tilted relative to each other by 54.6 (1°. In the crystal, molecules are linked into chains along the c-axis direction by intermolecular N—H...O hydrogen bonds.
Wang, Teng; Jiao, Ning
2014-04-15
Because of the importance of nitrogen-containing compounds in chemistry and biology, organic chemists have long focused on the development of novel methodologies for their synthesis. For example, nitrogen-containing compounds show up within functional materials, as top-selling drugs, and as bioactive molecules. To synthesize these compounds in a green and sustainable way, researchers have focused on the direct functionalization of hydrocarbons via C-H or C-C bond cleavage. Although researchers have made significant progress in the direct functionalization of simple hydrocarbons, direct C-N bond formation via C-H or C-C bond cleavage remains challenging, in part because of the unstable character of some N-nucleophiles under oxidative conditions. The nitriles are versatile building blocks and precursors in organic synthesis. Recently, chemists have achieved the direct C-H cyanation with toxic cyanide salts in the presence of stoichiometric metal oxidants. In this Account, we describe recent progress made by our group in nitrile synthesis. C-H or C-C bond cleavage is a key process in our strategy, and azides or DMF serve as the nitrogen source. In these reactions, we successfully realized direct nitrile synthesis using a variety of hydrocarbon groups as nitrile precursors, including methyl, alkenyl, and alkynyl groups. We could carry out C(sp(3))-H functionalization on benzylic, allylic, and propargylic C-H bonds to produce diverse valuable synthetic nitriles. Mild oxidation of C═C double-bonds and C≡C triple-bonds also produced nitriles. The incorporation of nitrogen within the carbon skeleton typically involved the participation of azide reagents. Although some mechanistic details remain unclear, studies of these nitrogenation reactions implicate the involvement of a cation or radical intermediate, and an oxidative rearrangement of azide intermediate produced the nitrile. We also explored environmentally friendly oxidants, such as molecular oxygen, to make our
Synthesis and purification of 14C N-2-hydroxyethyl-N-nitrosourea
International Nuclear Information System (INIS)
Perez, G.; Possagno, E.; Caponecchi, G.; Lilla, E.
1986-01-01
14 C N-2-hydroxyethyl-N-nitrosourea was prepared at a specific activity of 30 mCi/mmol and 1.29 mCi/mmol by a two-step synthetic sequence using 14 C ethanolamine as the labelled precursor. Its purification was performed by HPLC using a Lichrosorb-DIOL column eluted by ethyl ether. The overall radiochemical yield was 10%. (author)
International Nuclear Information System (INIS)
Jianchen Wang; Xiaowen Zhu; Chongli Song
2005-01-01
In this work, the extraction of cesium (Cs + ) in nitric acid and in a simulated high level liquid waste (HLLW) by iPr-C[4]C-6 was investigate in the dilluent n-octanol. The slope of the extractant dependency equals 1, indicating that the complex has 1:1[Cs + .iPr-C[4]C-6]Cs + to ligand. 0.025mol/L iPr-C[4]C-6 in n-octanol (abbreviated to iPr-C[4]C-6-n-octanol) has a stronger extracting ability to Cs when acidities are between 1.0mol/L and 4.0mol/L. The stripping properties of Cs loading in 0.025mol/L iPr-C[4]C-6-n-octanol was studied. Cs loading in iPr-C[4]C-6-n-octanol can be stripped easily into the aqueous phase because the distribution ratios of Cs are lower than 0.5 when pH is between 2 and 10 in the aqueous phase. On above basis, the better parameters were selected and the cold cascade test for removing Cs from the simulated HLLW was investigated on miniature centrifugal contactors. The results of the test are attractive. The removing ratio of Cs from the simulated HLLW is 99.5% and the stripping ratio of Cs loading in 0.025mol/L iPr-C[4]C-6-n-octanol is 99.2%. The results show that 0.025mol/L iPr-C[4]C-6-n-octanol is an effective process for removing Cs from HLLW. (author)
Lifescience Database Archive (English)
Full Text Available FLNDIKXGIKNQTAVWETKEFRDKYLTLDESK N*iksxxxxxxiiiiiiiiniayfpltlksqkkkkksxi*yk*ffflk...TAVWETKEFRDKYLTLDESK N*iksxxxxxxiiiiiiiiniayfpltlksqkkkkksxi*yk*ffflkk Frame C: ipihqxmmlhtqlpskklrlknnqslln
Arentson-Lantz, Emily J; Saeed, Isra H; Frassetto, Lynda A; Masharani, Umesh; Harnish, Roy J; Seo, Youngho; VanBrocklin, Henry F; Hawkins, Randall A; Mari-Aparici, Carina; Pampaloni, Miguel H; Slater, James; Paddon-Jones, Douglas; Lang, Thomas F
2017-05-01
The objective of this study was to determine if clinical dynamic PET/CT imaging with 11 C-L-methyl-methionine ( 11 C-MET) in healthy older women can provide an estimate of tissue-level post-absorptive and post-prandial skeletal muscle protein synthesis that is consistent with the more traditional method of calculating fractional synthesis rate (FSR) of muscle protein synthesis from skeletal muscle biopsies obtained during an infusion of L-[ring 13 C 6 ] phenylalanine ( 13 C 6 -Phe). Healthy older women (73 ± 5 years) completed both dynamic PET/CT imaging with 11 C-MET and a stable isotope infusion of 13 C 6 -Phe with biopsies to measure the skeletal muscle protein synthetic response to 25 g of a whey protein supplement. Graphical estimation of the Patlak coefficient K i from analysis of the dynamic PET/CT images was employed as a measure of incorporation of 11 C-MET in the mid-thigh muscle bundle. Post-prandial values [mean ± standard error of the mean (SEM)] were higher than post-absorptive values for both K i (0.0095 ± 0.001 vs. 0.00785 ± 0.001 min -1 , p Dynamic PET/CT imaging with 11 C-MET provides an estimate of the post-prandial anabolic response that is consistent with a traditional, invasive stable isotope, and muscle biopsy approach. These results support the potential future use of 11 C-MET imaging as a non-invasive method for assessing conditions affecting skeletal muscle protein synthesis.
Influence of applied load on wear behavior of C/C-Cu composites under electric current
Directory of Open Access Journals (Sweden)
Jian Yin
2017-04-01
Full Text Available Using carbon fiber needled fabrics with Cu-mesh and graphite powder as the preform, Cu mesh modified carbon/carbon(C/C-Cu composites were prepared by chemical vapor deposition (CVD with C3H6 and impregnation-carbonization (I/C with furan resin. C/C composites, as a comparison, were also prepared. Their microstructures and wear morphologies were observed by optical microscopy (OM and scanning electron microscope (SEM, respectively. Wear behavior of C/C and C/C-Cu composites under different applied loads were investigated on a pin-on-disc wear tester. The results show that Cu meshes are well dispersed and pyrolytic carbon is in rough laminar structure. Both C/C and C/C-Cu composites had good wear properties. The current-carrying capacity of C/C-Cu composites increases and the arc discharge is hindered as the applied load increases from 40 N to 80 N. Both C/C and C/C-Cu composites had good wear properties. The mass wear rate of C/C-Cu composites under 80 N was only 4.2% of that under 60 N. In addition, C/C-Cu composites represent different wear behaviors because wear mechanisms of arc erosion, abrasive wear, adhesive wear, and oxidative wear are changing under different applied loads.
Measurement of the /sup 12/C(n,γ0)/sup 13/C cross section in the giant dipole resonance region
International Nuclear Information System (INIS)
August, R.A.; Weller, H.R.; Tilley, D.R.
1987-01-01
The /sup 12/C(n,γ 0 ) /sup 13/C excitation function at 90 0 has been measured for neutron energies from 6.5 to 18.5 MeV. Whereas previous measurements disagreed at the lower energies with a direct-semidirect capture calculation based on /sup 12/C(p,γ 0 ) /sup 13/N data, the present results, especially when the uncertainty in absolute cross section is considered, indicate reasonable qualitative agreement with the calculation
Lifescience Database Archive (English)
Full Text Available ckivfqfvekqssywvwkfdggnlvvsfksicntsdnanfnfeall* n*xk Translated Amino Acid sequen...eiiryisqnivkrckdd dmvkegfveatqnckivfqfvekqssywvwkfdggnlvvsfksicntsdnanfnfeall* n*xk Frame C: tivilqtynflkcl*
Lifescience Database Archive (English)
Full Text Available 10.b1_C08.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL5210,... (bits) Value N X98286 |X98286.1 D.discoideum mRNA for P-type ATPase. 1285 0.0 1 EL476977 |EL476977.1 CHUL52
Soil [N] modulates soil C cycling in CO2-fumigated tree stands
DEFF Research Database (Denmark)
Dieleman, W. I. J.; Luyssaert, S.; Rey, A.
2010-01-01
Under elevated atmospheric CO2 concentrations, soil carbon (C) inputs are typically enhanced, suggesting larger soil C sequestration potential. However, soil C losses also increase and progressive nitrogen (N) limitation to plant growth may reduce the CO2 effect on soil C inputs with time. We...... compiled a data set from 131 manipulation experiments, and used meta-analysis to test the hypotheses that: (1) elevated atmospheric CO2 stimulates soil C inputs more than C losses, resulting in increasing soil C stocks; and (2) that these responses are modulated by N. Our results confirm that elevated CO2...... induces a C allocation shift towards below-ground biomass compartments. However, the increased soil C inputs were offset by increased heterotrophic respiration (Rh), such that soil C content was not affected by elevated CO2. Soil N concentration strongly interacted with CO2 fumigation: the effect...
Molecular dynamics simulation studies of mid-size liquid n-Alkanes, C12–C160
International Nuclear Information System (INIS)
Kwon, Tae Woo; Lee, Song Hi
2015-01-01
In this study, we report the results of molecular dynamics simulations (MD) for model systems of mid-size liquid n-alkanes (C 12 –C 160 ) at several temperatures (⁓2700 K) in canonical ensembles to calculate structural and dynamic properties (viscosity η, self-diffusion constant D, and monomeric friction constant ζ). For the small n-alkanes for n ≤ 80, the chains are clearly
Crystal structure of 4-methoxy-N-(piperidine-1-carbonothioylbenzamide
Directory of Open Access Journals (Sweden)
Khairi Suhud
2017-10-01
Full Text Available In the title compound, C14H18N2O2S, the piperidine ring has a chair conformation. Its mean plane is twisted with respect to the 4-methoxybenzoyl ring, with a dihedral angle of 63.0 (3°. The central N—C(=S—N(H—C(=O bridge is twisted with an N—C—N—C torsion angle of 74.8 (6°. In the crystal, molecules are linked by N—H...O and C—H...O hydrogen bonds, forming chains along the c-axis direction. Adjacent chains are linked by C—H...π interactions, forming layers parallel to the ac plane. The layers are linked by offset π–π interactions [intercentroid distance = 3.927 (3 Å], forming a supramolecular three-dimensional structure.
Probing the Statistical Decay and α-clustering effects in 12C + 12C and 14N + 10B reactions
Directory of Open Access Journals (Sweden)
Morelli L.
2014-03-01
Full Text Available An experimental campaign has been undertaken at Laboratori Nazionali di Legnaro (LNL INFN, Italy, in order to progress in our understanding of the statistical properties of light nuclei at excitation energies above particle emission threshold, by measuring exclusive data from fusion-evaporation reactions. On the experimental side, a first reaction: 12C+12C at 95 MeV beam energy has been measured, using the GARFIELD + Ring Counter (RCo apparatuses. Fusion-evaporation events have been exclusively selected out of the entire data set. The comparison to a dedicated Hauser-Feshbach calculation allows us to give constraints on the nuclear level density at high excitation energy for light systems ranging from C up to Mg. Out-of-equilibrium aα emission has been evidenced and attributed both to an entrance channel effect (favoured by the cluster nature of reaction partners, and, in more dissipative events, to the persistence of cluster correlations well above the 24Mg threshold for 6 α’s decay. In order to study the same 24Mg compound nucleus at similar excitation energy with respect to this first reaction a new measurement, 14N + 10B at 5.7 A.MeV, was performed at LNL laboratories with the same experimental setup. The comparison between the two systems would allow us to further constrain the level density of light nuclei in the mass-excitation energy range of interest. In this perspective, deviations from a statistical behaviour can be used as a tool to get information on nuclear clustering, both in the ground-state for projectile and target and in the hot source formed in the collision.
Dicty_cDB: Contig-U01201-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DT573931 ) EST1084571 GH_TMO Gossypium hirsutum cDNA, mRNA s... 46 2.3 1 ( DR026249 ) Osmo00116 F. cylindrus osmotic stress library...67 ) Glycine max cDNA clone: GMFL01-28-N10, 3'end. 44 9.0 1 ( BU869818 ) Q004H08 Populus flower cDNA library Populus tric...Lib... 46 2.3 1 ( DU120744 ) KBrH113B12F Brassica rapa BAC library KBrH Brassi......... 46 2.3 1 ( CB285041 ) DF1898 Dermatophagoides farinae cDNA library Derm... 46 2.3 1 ( C25513 ) Dic...rary Ictalurus... 44 9.0 1 ( CF230535 ) PtaC0009E5E0509 Poplar cDNA library from ca
Observation of Ξc0 semileptonic decay
International Nuclear Information System (INIS)
Albrecht, H.; Cronstroem, H.I.; Ehrlichmann, H.; Hamacher, T.; Hofmann, R.P.; Kirchhoff, T.; Nau, A.; Nowak, S.; Reidenbach, M.; Reiner, R.; Schroeder, H.; Schulz, H.D.; Walter, M.; Wurth, R.; Appuhn, R.D.; Hast, C.; Kolanoski, H.; Lange, A.; Lindner, A.; Mankel, R.; Schieber, M.; Siegmund, T.; Spaan, B.; Thurn, H.; Toepfer, D.; Walther, A.; Wegener, D.; Britton, D.I.; Charlesworth, C.E.K.; Edwards, K.W.; Hyatt, E.R.F.; Kapitza, H.; Krieger, P.; MacFarlane, D.B.; Patel, P.M.; Prentice, J.D.; Saull, P.R.B.; Seidel, S.C.; Tzamariudaki, K.; Van de Water, R.G.; Yoon, T.S.; Ressing, D.; Schmidtler, M.; Schneider, M.; Schubert, K.R.; Strahl, K.; Waldi, R.; Weseler, S.
1992-12-01
Observation of the semileptonic decay of the charmed baryon Ξ c 0 in the decay channel Ξ c 0 → Ξ - l + X has been made using the ARGUS detector at the e + e - storage ring DORIS II at DESY. The cross section times branching ratio was found to be σ(e + e - → Ξ c 0 X).BR(Ξ c 0 → Ξ - l + X) = 0.74±0.24±0.09 pb. (orig.)
Cachero Castro, Cristina; Ponce de León Amador, Pedro José
2007-01-01
Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. El compilador g++. Directivas de compilación. Make. Doxygen. Utilidad de compresión 'tar'. Introducción a UML. Ejercicio práctico.
International Nuclear Information System (INIS)
Tagmatarchis, Nikos; Shinohara, Hisanori
2001-01-01
Bisazafullerene (C 59 N) 2 and hydroazafullerene C 59 HN photosensitize the reaction of alkenes with oxygen. 2-methyl 2-butene and α-terpinene undergo ene and Diels-Alder photooxygenation reactions, respectively, in the presence of minute amounts of azafullerenes to produce the corresponding peroxides
Optimization of C20 isomers structure
International Nuclear Information System (INIS)
Ndjaka, J.M.B.; Charlier, J.C.
2001-07-01
We have performed geometry optimization of various possible planar and three-dimensional C 20 geometries. The planar structures considered include a linear chain, a monoclinic ring, and a bicyclic bow tie; while the three-dimensional geometric; consisted of a bowl or corranulene structure and a fullerene cage. In agreement with Wang et al MP2's calculations, our results predict the corranulene bowl to be the lowest energy structure. From the ground state geometry to the highest energy, considered C 20 structures, listed in increasing energy, are bowl, cage, bow tie, ring and chain. For the ring and bow tie isomers, the shape of the optimized structure deviates from that of the initial configuration; while the shape of the optimised bowl, cage and chain remain unchanged. (author)
Targeting MUC1-C suppresses polycomb repressive complex 1 in multiple myeloma.
Tagde, Ashujit; Markert, Tahireh; Rajabi, Hasan; Hiraki, Masayuki; Alam, Maroof; Bouillez, Audrey; Avigan, David; Anderson, Kenneth; Kufe, Donald
2017-09-19
The polycomb repressive complex 1 (PRC1) includes the BMI1, RING1 and RING2 proteins. BMI1 is required for survival of multiple myeloma (MM) cells. The MUC1-C oncoprotein is aberrantly expressed by MM cells, activates MYC and is also necessary for MM cell survival. The present studies show that targeting MUC1-C with (i) stable and inducible silencing and CRISPR/Cas9 editing and (ii) the pharmacologic inhibitor GO-203, which blocks MUC1-C function, downregulates BMI1, RING1 and RING2 expression. The results demonstrate that MUC1-C drives BMI1 transcription by a MYC-dependent mechanism. MUC1-C thus promotes MYC occupancy on the BMI1 promoter and thereby activates BMI1 expression. We also show that the MUC1-C→MYC pathway induces RING2 expression. Moreover, in contrast to BMI1 and RING2, we found that MUC1-C drives RING1 by an NF-κB p65-dependent mechanism. Targeting MUC1-C and thereby the suppression of these key PRC1 proteins was associated with downregulation of the PRC1 E3 ligase activity as evidenced by decreases in ubiquitylation of histone H2A. Targeting MUC1-C also resulted in activation of the PRC1-repressed tumor suppressor genes, PTEN, CDNK2A and BIM . These findings identify a heretofore unrecognized role for MUC1-C in the epigenetic regulation of MM cells.
Evidencias sobre la prevención del cáncer
Directory of Open Access Journals (Sweden)
D. Salas
2013-10-01
Full Text Available El cáncer es uno de los principales problemas de salud. Engloba a un conjunto de enfermedades que tienen un origen multicausal. Los tumores con mayor impacto en la salud son pulmón, próstata y colorrectal en los hombres y mama y colorrectal en las mujeres. Las mejores estrategias para evitar el cáncer son las basadas en la prevención primaria y en el diagnóstico precoz. Se estima que entre el 80-90% de los canceres son prevenibles. Respecto a la prevención primaria hay fuerte evidencia que no fumar, realizar ejercicio físico regular, y una dieta rica en frutas y verduras junto con el control de algunos factores de riesgo ambientales y laborales, puede disminuir la incidencia del cáncer. Está recomendado el diagnóstico precoz de cáncer de mama, cuello de útero y de cáncer colorrectal en algunos grupos de población en el contexto de programas organizados con la adecuada garantía de calidad.
Effects of carboxylic acids on nC60 aggregate formation
International Nuclear Information System (INIS)
Chang Xiaojun; Vikesland, Peter J.
2009-01-01
The discovery that negatively charged aggregates of C 60 fullerene (nC 60 ) are stable in water has raised concerns regarding the potential environmental and health effects of these aggregates. In this work, we show that nC 60 aggregates produced by extended mixing in the presence of environmentally relevant carboxylic acids (acetic acid, tartaric acid, citric acid) have surface charge and morphologic properties that differ from those produced by extended mixing in water alone. In general, aggregates formed in the presence of these acids have a more negative surface charge and are more homogeneous than those produced in water alone. Carboxylic acid identity, solution pH, and sodium ion concentration, which are all intricately coupled, play an important role in setting the measured surface charge. Comparisons between particle sizes determined by analysis of TEM images and those obtained by dynamic light scattering (DLS) indicate that DLS results require careful evaluation when used to describe nC 60 aggregates. - The effects of carboxylic acids on the formation of nC 60 aggregates are discussed
Radiación solar y prevención del cáncer de piel
Zapater López, María
2017-01-01
Introducción. El cáncer de piel se considera un problema de Salud Pública. Se clasifica en: cáncer de piel no melanoma (que, a su vez, se divide en cáncer basocelular y cáncer espinocelular) y cáncer melanoma. El primero es más frecuente y tiene un pronóstico relativamente bueno; el segundo es menos frecuente y su pronóstico puede ser infausto. Objetivos. El objetivo principal del trabajo es profundizar en la influencia de la radiación ultravioleta en el cáncer de piel y valorar posibles f...
Cachero Castro, Cristina; Ponce de León Amador, Pedro José
2007-01-01
Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Herencia simple. El destructor abstracto. Patrón de diseño singleton. Tipos enumerados. Declaraciones forward. Conversión entre objetos (upcasting/downcasting).
Designing new catalytic C-C and C-N bond formations promoted by organoactinides
International Nuclear Information System (INIS)
Eisen, M.S.; Straub, T.; Haskel, A.
1998-01-01
Organoactinides of the type Cp 2 * AcMe 2 (Cp * =C 5 Me 5 ; Ac=Th; U) are active catalytic precursors for the oligomerization of terminal alkynes HC≡CR (R=alkyl, aryl, SiMe 3 ). The regioselectivity and the extent of oligomerization depend strongly on the alkyne substituent R, whereas the catalytic reactivity is similar for both organoactinides. Reaction with tert-butylacetylene yields regioselectively the E-2,4-disubstituted 1-buten-3-yne dimer whereas trimethylsilylacetylene is regioselective trimerized to the E,E-1,4,6-tris(trimethylsilyl)-1,3-hexa diene-5-yne, with small amounts (3-5%) of the corresponding E-2,4-disubstituted 1-buten-3-yne dimer. Oligomerization with less bulky alkyl and aryl substituted alkynes produces a mixture of higher oligomers with no regioselectivity. Using the Cp 2 * ThMe 2 catalyst, we have recently developed a strategic method to control the extent and in some cases the regioselectivity of the catalyzed oligomerization of nonbulky terminal alkynes to dimers and/or trimers. The metallocene catalytic precursors ensure the selective synthesis of small oligomers by the addition of specific amines. Catalytic ''tailoring'' to dimer and trimers can be achieved by using small or bulky amines, respectively. Kinetic and mechanistic data for the controlling experiments argue that the turnover-limiting step involves the acetylide actinide complex formation with the rapid insertion of the alkyne and protonolysis by the amine. The analog Cp 2 * UMe 2 in the presence of primary amines induce the selective C-N bond formation, producing enamines which are tautomerized to the corresponding imines. (orig.)
Bassett, Matthew K.; Fortenberry, Ryan C.
2017-06-01
The C3H radical is believed to be prevalent throughout the interstellar medium and may be involved in the formation of polycyclic aromatic hydrocarbons. C3H exists as both a linear and a cyclic isomer. The C2 v cyclopropenylidenyl radical isomer was detected in the dark molecular cloud TMC-1, and the linear propenylidenyl radical isomer has been observed in various dark molecular clouds. Even though the c-C3H radical has been classified rotationally, the vibrational frequencies of this seemingly important interstellar molecule have never been directly observed. Established, highly accurate quartic force field methodologies are employed here to compute useful geometrical data, spectroscopic constants, and vibrational frequencies. The computed rotational constants are consistent with the experimental results. Consequently, the three a1 (ν1, ν2, and ν3) and one b1 (ν6) anharmonic vibrational frequencies at 3117.7 cm-1, 1564.3 cm-1, 1198.5 cm-1, and 826.7 cm-1, respectively, are reliable predictions for these, as of yet unseen, observables. Unfortunately, the two b2 fundamentals (ν4 and ν5) cannot be treated adequately in the current approach due to a flat and possible double-well potential described in detail herein. The dipole-bound excited state of the anion suffers from the same issues and may not even be bound. However, the trusted fundamental vibrational frequencies described for the neutral radical should not be affected by this deformity and are the first robustly produced for c-C3H. The insights gained here will also be applicable to other structures containing three-membered bare and exposed carbon rings that are surprisingly floppy in nature.
Near-surface microstructural modification of (Ti,W)(C,N)-based compacts with nitrogen
International Nuclear Information System (INIS)
Ucakar, V.; Kral, C.; Lengauer, W.
2001-01-01
For developing of functional-gradient hardmetals the interaction of nitrogen with (Ti,W)(C,N)-based compacts was investigated. Hot-pressed (Ti,W)(C,N) compacts as well as sintered compacts of (Ti,W)(C,N)+Co were subjected to sintering and heat treatment at 1200-1500 o C and up to 30 bar N 2 . In (Ti,W)(C,N) compacts four microstructure types were obtained upon reaction with nitrogen. A uniform single-phase (Ti,W)(C,N) forms in samples with a low WC and high TiN content. If medium WC and high TiN/TiC ratio is present a core-rim type structure forms during Ar annealing which remains the same when nitrogen in-diffusion occurs. The third type of microstructure shows sub-micron lamellae of nitrogen-rich fcc phase and WC. This structure forms at increased WC and/or TiC content. If the WC content is increased again a WC layer forms at the outermost surface. Compressive stresses introduced by phase formation/decomposition were obtained for the nitrogen in-diffusion. Sintered (Ti,W)(C,N)+Co compacts were heat treated above and below the eutectic temperature. Above the eutectic temperature compact Ti(C,N) top-layers independent an sample composition were observed. Below the eutectic temperature the microstructure formation is mainly influenced by the sample composition. A Ti(C,N) top-layer forms in materials with a high Ti(C,N) content. Contrary, interaction zones without a layer were obtained in compacts with high WC/Ti(C,N) ratio. Some of these surface modified compacts show surfaces and particle sizes favorable for a cutting tool. (author)
14C concentrations in tree stems, 1
International Nuclear Information System (INIS)
Kikata, Yoji; Yonenobu, Hitoshi; Morishita, Fumio; Hattori, Yoshiaki; Marsoen, S.N.
1993-01-01
The 14 C concentrations in trees sampled at various latitudes were measured with a Tandetron Accelerator Mass Spectrometer at Nagoya University. The growing periods of the parts for 14 C measurements were estimated by the relationship between meteorological conditions and the appearance of anatomical features of annual rings such as false rings, latewood formation, and so on. The following results were obtained: 1. The latitude dependence of the 14 C variation is found in tree stems as well as in the atmosphere. 2. The 14 C concentrations in tree stems are almost equal to those in the atmosphere at the latitude where the tree had grown and at the time when the sampled section is formed. Therefore the 14 C concentrations in the atmosphere are estimated by those of the tree stems. 3. The time when the 14 C concentration in the tree showed its maximum value has difference of 1 - 2 years with that of the latitude where the tree had grown. 4. This phenomena seemed to be related closely with the mechanism of global mixing of 14 CO 2 produced by atmospheric nuclear weapon tests. This mechanism causes a time lag of 14 C variation between northern and southern hemisphere. (author)
Mineralization and volatilization of ring labelled 14C-2,4-D in three different soils
International Nuclear Information System (INIS)
Shrivastwa, M.; Singh, D.K.; Jindal, T.; Agarwal, H.C.
2001-01-01
Mineralization and volatilization of ring labelled 14 C-2,4-dichlorophenoxyacetic acid in soil was studied over a period of six weeks under laboratory conditions at 25 deg. C in three different soils collected from three sites, Delhi, Jaipur and Ludhiana. A very slow rate of both mineralization and volatilization was observed in all the three soils. The observed mineralization, was highest for the Delhi soil, 0.93%, followed by the Ludhiana soil, 0.73% and the Jaipur soil 0.14% in 42 days. The extent of volatilization was 0.46% for the Jaipur soil, 0.37% for the Ludhiana soil and 0.32% for the Delhi soil. (author)
DEFF Research Database (Denmark)
Tanner, David Ackland; Tedenborg, Lars; Somfai, Peter
1997-01-01
This paper describes the construction of three key intermediates for a projected total synthesis of the marine alkaloid zoanthamine. These building blocks, corresponding to the C1-C5, C6-C10 and C11-C24 fragments of the target molecule, are synthesised efficiently form (R...
Energy Technology Data Exchange (ETDEWEB)
McCleskey, M; Mukhamedzhanov, A M; Trache, L; Tribble, R E; Banu, A; Eremenko, V; Goldberg, V Z; Lui, Y W; McCleskey, E; Roeder, B T; Spiridon, A; Carstoiu, F; Burjan, V; Hons, Z; Thompson, I J
2014-04-17
The 14C + n <--> 15C system has been used as a test case in the evaluation of a new method to determine spectroscopic factors that uses the asymptotic normalization coefficient (ANC). The method proved to be unsuccessful for this case. As part of this experimental program, the ANCs for the 15C ground state and first excited state were determined using a heavy-ion neutron transfer reaction as well as the inverse kinematics (d,p) reaction, measured at the Texas A&M Cyclotron Institute. The ANCs were used to evaluate the astrophysical direct neutron capture rate on 14C, which was then compared with the most recent direct measurement and found to be in good agreement. A study of the 15C SF via its mirror nucleus 15F and a new insight into deuteron stripping theory are also presented.
Rhodium-catalyzed C-H functionalization with N-acylsaccharins.
Wu, Hongxiang; Liu, Tingting; Cui, Ming; Li, Yue; Jian, Junsheng; Wang, Hui; Zeng, Zhuo
2017-01-18
A rhodium-catalyzed C-H functionalization with activated amides by decarbonylation has been developed. Notably, this is the first C-H arylation employing N-acylsaccharins as coupling partners to give biaryls in good to excellent yields. The highlight of the work is the high tolerance of functional groups such as formyl, ester, and vinyl and the use of a removable directing group.
Prácticas de informática industrial: del C al C++
Mazaeda Echevarría, Rogelio; Fuente López, Eusebio de la
2014-01-01
Se trata de un esfuerzo por utilizar las primeras prácticas de la asignatura de Informática Industrial de la titulación de Grado en Electrónica Industrial y Automática para introducir conceptos de programación orientada a objetos en C++ partiendo de la base de que el alumno conoce los fundamentos de programación de ordenadores en lenguaje C, tal y como se enseña en la asignatura básica de Fundamentos de Informática. Se intenta una aproximación gradual al C++ desde el C, a partir de ejemplos p...
Dicty_cDB: Contig-U04975-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 6227.fwd CAWX Helobdella robusta Primary Ear... 34 3.5 2 ( DY542495 ) HPO-N-S01-0370-LF Hematopoietic cDNA library...0.95 2 ( DT742604 ) EST1176453 Aquilegia cDNA library Aquilegia formo... 36 0.95 2 ( AC178959 ) Strongylocentrotus purpuratu...43 ) EST1164393 Aquilegia cDNA library Aquilegia formo... 48 0.037 2 ( AC115684 ) Dictyostelium discoideum c...36815 ) MM2_2_4_C09 Sugar beet 10-week GH root cDNA Beta ... 50 0.087 1 ( CF886656 ) tric084xc11.b1 T.reesei mycelial culture..., Version... 50 0.087 1 ( CB907997 ) tric084xc11 T.reesei mycelial culture
Caracterización morfológica de células pulpares
Merino, Graciela; Blascetti, Nahuel; Mayocchi, Karina; Butler, Teresa Adela; Basal, Roxana Lía; Dorati, Pablo Javier; Paggi, Ricardo; Bellesi, Carolina; Astudillo, Lisandro; Pinola, Lidia; Cantarini, Luis Martín; Micinquevich, Susana
2017-01-01
La investigación básica sobre células madre y el desarrollo de aplicaciones terapéuticas es uno de los campos de la investigación biomédica que más atención recibe en la actualidad. Las células madre dentales comparten muchas características con las células madre de la médula ósea de donde normalmente se extraen para las investigaciones. Objetivo: realizar una síntesis de la descripción morfológica de las células pulpares en cultivo. Para la caracterización se utilizó pulpas de gérmenes de te...
Clinical Chemistry Reference Intervals for C57BL/6J, C57BL/6N, and C3HeB/FeJ Mice (Mus musculus).
Otto, Gordon P; Rathkolb, Birgit; Oestereicher, Manuela A; Lengger, Christoph J; Moerth, Corinna; Micklich, Kateryna; Fuchs, Helmut; Gailus-Durner, Valérie; Wolf, Eckhard; Hrabě de Angelis, Martin
2016-01-01
Although various mouse inbred strains are widely used to investigate disease mechanisms and to establish new therapeutic strategies, sex-specific reference intervals for laboratory diagnostic analytes that are generated from large numbers of animals have been unavailable. In this retrospective study, we screened data from more than 12,000 mice phenotyped in the German Mouse Clinic from January 2006 through June 2014 and selected animals with the genetic background of C57BL/6J, C57BL/6N, or C3HeB/FeJ. In addition, we distinguished between the C57BL/6NTac substrain and C57BL/6N mice received from other vendors. The corresponding data sets of electrolytes (sodium, potassium, calcium, chloride, inorganic phosphate), lipids (cholesterol, triglyceride), and enzyme activities (ALT, AST, ALP, α-amylase) and urea, albumin, and total protein levels were analyzed. Significant effects of age and sex on these analytes were identified, and strain- or substrain- and sex-specific reference intervals for 90- to 135-d-old mice were calculated. In addition, we include an overview of the literature that reports clinical chemistry values for wild-type mice of different strains. Our results support researchers interpreting clinical chemistry values from various mouse mutants and corresponding wild-type controls based on the examined strains and substrains.
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHD152 (Link to dictyBase) - - - - - (Link to Original site) C...HD152F 603 - - - - - - Show CHD152 Library CH (Link to library) Clone ID CHD152 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHD...Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum...UF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to
International Nuclear Information System (INIS)
Benaud, Olivier; Berthet, Jean-Claude; Thuery, Pierre; Ephritikhine, Michel
2011-01-01
In contrast to the neutral macrocycle [UN* 2 (N,C)] (1) [N* = N(SiMe 3 ) 3 ; N,C = CH 2 SiMe 2 N-(SiMe 3 )] which was quite inert toward I 2 , the anionic bismetallacycle [NaUN*(N,C) 2 ] (2) was readily transformed into the enlarged monometallacycle [UN*(N,N)I] (4) [N,N = (Me 3 Si)NSiMe 2 CH 2 CH 2 SiMe 2 N(SiMe 3 )] resulting from C-C coupling of the two CH 2 groups, and [NaUN*(N,O) 2 ] (3) [N,O = OC(=CH 2 )SiMe 2 N(SiMe 3 )], which is devoid of any U-C bond, was oxidized into the UV bismetallacycle [Na{UN*(N,O) 2 }2(μ-I)] (5). Sodium amalgam reduction of 4 gave the U(III) compound [UN*(N,N)] (6). Addition of MN 3 or MCN to the (N,C), (N,N), and (N,O) metallacycles 1, 4, and 5 led to the formation of the anionic azide or cyanide derivatives M[UN* 2 (N,C)(N 3 )] [M = Na, 7a or Na(15-crown-5), 7b], M[UN* 2 (N,C)(CN)] [M = NEt 4 , 8a or Na(15-crown-5), 8b or K(18-crown-6), 8c], M[UN*(N,N)(N 3 ) 2 ] [M = Na, 9a or Na(THF)4, 9b], [NEt 4 ][UN*(N,N)(CN) 2 ] (10), M[UN*(N,O) 2 (N 3 )] [M = Na, 11a or Na(15-crown-5), 11b], M[UN*(N,O) 2 (CN)] [M = NEt 4 , 12a or Na(15-crown-5), 12b]. In the presence of excess iodine in THF, the cyanide 12a was converted back into the iodide 5, while the azide 11a was transformed into the neutral UV complex [U(N{SiMe 3 }-SiMe 2 C{CHI}O) 2 I(THF)] (13). The X-ray crystal structures of 4, 7b, 8a-c, 9b, 10, 12b, and 13 were determined. (authors)
International Nuclear Information System (INIS)
Kim, Kang-San; Han, Ki-Bong; Chung, Gwiy-Sang
2010-01-01
This paper describes the mechanical properties of poly (polycrystalline) 3C-SiC thin films with N 2 in situ doping. In this work, in situ doped poly 3C-SiC film was deposited by using the atmospheric pressure chemical vapor deposition (APCVD) method at 1200 deg. C using single-precursor hexamethyildisilane: Si 2 (CH 3 ) 6 (HMDS) as Si and C precursors, and 0∼100 sccm N 2 as the dopant source gas. The mechanical properties of doped poly 3C-SiC thin films were measured by nano-indentation. Young's modulus and hardness were measured to be 285 and 35 GPa at 0 sccm N 2 , respectively. Young's modulus and hardness decreased with increasing N 2 flow rate. Surface morphology was evaluated by atomic force microscopy (AFM) according to N 2 flow rate.
Preformulación de mitomicina C
Directory of Open Access Journals (Sweden)
Armando Gato del Monte
2004-04-01
Full Text Available Se realizó el estudio de preformulación de mitomicina C 2 mg para la elaboración de un liofilizado física y químicamente estable. Se describieron brevemente los pasos que se siguieron para la disolución del principio activo. Los estudios de estabilidad por el método de vida de estante en condiciones normales de temperatura y en refrigeración utilizando la cromatografía líquida de alta resolución, permitió cuantificar el principio activo y establecer el tiempo de vida útil del producto terminado, así como reconstituido. Se comprobó la ausencia de microorganismos vivos y en desarrollo al producto terminado.The study of preformulation of mitomycin C 2 mg was conducted to obtain a physical and chemically stable lyophilized. The steps followed for the disolution of the active principle were briefly described. The stability studies by the shelf life method under nomal conditions of temperature and refrigeration using high resolution liquid chromatography allowed to quantify the active principle and to establish the time of useful life of the finished and reconstituted product. The absence of living and developing microorganisms in the finished product was proved.
Corfield, Peter W R; Cleary, Emma; Michalski, Joseph F
2016-07-01
In the title compound, {(C6H16NO)[Cu2(CN)3]} n , the cyanide groups link the Cu(I) atoms into an open three-dimensional anionic network, with the mol-ecular formula Cu2(CN)3 (-). One Cu(I) atom is tetra-hedrally bound to four CN groups, and the other Cu(I) atom is bonded to three CN groups in an approximate trigonal-planar coordination. The tetra-hedrally coordinated Cu(I) atoms are linked into centrosymmetric dimers by the C atoms of two end-on bridging CN groups which bring the Cu(I) atoms into close contact at 2.5171 (7) Å. Two of the cyanide groups bonded to the Cu(I) atoms with trigonal-planar surrounding link the dimeric units into columns along the a axis, and the third links the columns together to form the network. The N,N-di-ethyl-ethano-lamine mol-ecules used in the synthesis have become protonated at the N atoms and are situated in cavities in the network, providing charge neutrality, with no covalent inter-actions between the cations and the anionic network.
Synthetic Swan band profile of (1,0) of 12C12C and (0,0) of 12C12C and 12C13C in comets
International Nuclear Information System (INIS)
Swamy, K.S.K.
1987-01-01
The statistical equilibrium calculations of the 12 C 13 C molecule based on the resonance fluorescence process give similar results to those of the normal molecule. Therefore the assumption that the observed intensities of bands of the normal and the isotopic molecule differ only by their abundance ratio is reasonable. The synthetic profile of the (1,0) Swan band of 12 C 13 C (0,0) band of 12 C 12 C and 12 C 13 C have been calculated. The relative merits of using the rotational structure of the (1,0) or (0,0) band for the determination of the isotopic ratio 12 C/ 13 C is discussed briefly. (author)
Atmospheric chemistry of C2F5CHO: mechanism of the C2F5C(O)O-2+HO2 reaction
DEFF Research Database (Denmark)
Andersen, Mads Peter Sulbæk; Hurley, MD; Wallington, TJ
2003-01-01
in a yield of 76 +/- 4 The gas phase reaction of CnF2n+1C(O)O-2 with HO2 radicals offers a potential explanation for at least part of the observed environmental burden of fluorinated carboxylic acids, CnF2n+1C(O)OH. As part of this work an upper limit for the rate constant of reaction of Cl atorns with C2F5C......(O)OH at 296 K was determined; k(Cl + C2F5C(O)OH) 1 x 10(-11) cm(3) molecule(-1) s(-1). (C) 2003 Published by Elsevier B.V....
Energy Technology Data Exchange (ETDEWEB)
Halfen, D. T.; Ziurys, L. M. [Department of Chemistry and Biochemistry, University of Arizona, 1305 E. 4th Street, Tucson, AZ 85719 (United States); Woolf, N. J., E-mail: halfend@email.arizona.edu [Department of Astronomy, Arizona Radio Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States)
2017-08-20
A study has been conducted of {sup 12}C/{sup 13}C ratios in five complex molecules in the Galactic center. H{sub 2}CS, CH{sub 3}CCH, NH{sub 2}CHO, CH{sub 2}CHCN, and CH{sub 3}CH{sub 2}CN and their {sup 13}C-substituted species have been observed in numerous transitions at 1, 2, and 3 mm, acquired in a spectral-line survey of Sgr B2(N), conducted with the telescopes of the Arizona Radio Observatory (ARO). Between 22 and 54 individual, unblended lines for the {sup 12}C species and 2–54 for {sup 13}C-substituted analogs were modeled in a global radiative transfer analysis. All five molecules were found to consistently exhibit two velocity components near V {sub LSR} ∼ 64 and 73 km s{sup −1}, with column densities ranging from N {sub tot} ∼ 3 × 10{sup 14} − 4 × 10{sup 17} cm{sup −2} and ∼2 × 10{sup 13} − 1 × 10{sup 17} cm{sup −2} for the {sup 12}C and {sup 13}C species, respectively. Based on 14 different isotopic combinations, ratios were obtained in the range {sup 12}C/{sup 13}C = 15 ± 5 to 33 ± 13, with an average value of 24 ± 7, based on comparison of column densities. These measurements better anchor the {sup 12}C/{sup 13}C ratio at the Galactic center, and suggest a slightly revised isotope gradient of {sup 12}C/{sup 13}C = 5.21(0.52) D {sub GC} + 22.6(3.3). As indicated by the column densities, no preferential {sup 13}C enrichment was found on the differing carbon sites of CH{sub 3}CCH, CH{sub 2}CHCN, and CH{sub 3}CH{sub 2}CN. Because of the elevated temperatures in Sgr B2(N), {sup 13}C isotopic substitution is effectively “scrambled,” diminishing chemical fractionation effects. The resulting ratios thus reflect stellar nucleosynthesis and Galactic chemical evolution, as is likely the case for most warm clouds.
Barick, B. K.; Saroj, Rajendra Kumar; Prasad, Nivedita; Sutar, D. S.; Dhar, S.
2018-05-01
Networks of vertically c-oriented prism shaped InN nanowalls, are grown on c-GaN/sapphire templates using a CVD technique, where pure indium and ammonia are used as metal and nitrogen precursors. A systematic study of the growth, structural and electronic properties of these samples shows a preferential growth of the islands along [ 1 1 2 bar 0 ] and [0 0 0 1] directions leading to the formation of such a network structure, where the vertically [0 0 0 1] oriented tapered walls are laterally align along one of the three [ 1 1 2 bar 0 ] directions. Inclined facets of these walls are identified as semipolar (1 1 2 bar 2) -planes of wurtzite InN. Onset of absorption for these samples is observed to be higher than the band gap of InN suggesting a high background carrier concentration in this material. Study of the valence band edge through XPS indicates the formation of positive depletion regions below the surface of the side facets [(1 1 2 bar 2) -planes] of the walls. This is in contrast with the observation for c-plane InN epilayers, where electron accumulation is often reported below the top surface.
Effect of different parameters on machining of SiC/SiC composites via pico-second laser
Energy Technology Data Exchange (ETDEWEB)
Li, Weinan; Zhang, Ruoheng [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an, Shaanxi 10068 (China); Liu, Yongsheng, E-mail: yongshengliu@nwpu.edu.cn [Science and technology on Thermostructure Composite Materials Laboratory, Northwestern Polytechnical University, Xi’an, Shaanxi 710072 (China); Wang, Chunhui; Wang, Jing [Science and technology on Thermostructure Composite Materials Laboratory, Northwestern Polytechnical University, Xi’an, Shaanxi 710072 (China); Yang, Xiaojun [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an, Shaanxi 10068 (China); Cheng, Laifei [Science and technology on Thermostructure Composite Materials Laboratory, Northwestern Polytechnical University, Xi’an, Shaanxi 710072 (China)
2016-02-28
Graphical abstract: - Highlights: • The highlights of the manuscript include the following two aspects. • First, we found that the different machining modes (helical line scanning and single ring line scanning) and processing power of machining have remarkable effect on the surface morphology of the machined area, such as the shape, depth and the formation of different surface structures. • Secondly, we investigated that the debris consisted of C, Si and O was observed on the machined surface. • Some of the Si–C bonds of the SiC matrix and fibers would be transformed into Si–O bonds after machined, depending on the processing power. - Abstract: Pico-second laser plays an important role in modern machining technology, especially in machining high hardness materials. In this article, pico-second laser was utilized for irradiation on SiC/SiC composites, and effects of different processing parameters including the machining modes and laser power were discussed in detail. The results indicated that the machining modes and laser power had great effect on machining of SiC/SiC composites. Different types of surface morphology and structure were observed under helical line scanning and single ring line scanning, and the analysis of their formulation was discussed in detail. It was believed that the machining modes would be responsible to the different shapes of machining results at the same parameters. The processing power shall also influence the surface morphology and quality of machining results. In micro-hole drilling process, large amount of debris and fragments were observed within the micro-holes, and XPS analysis showed that there existed Si–O bonds and Si–C bonds, indicating that the oxidation during processing was incomplete. Other surface morphology, such as pores and pits were discussed as well.
Trost, Barry M; Frontier, Alison J; Thiel, Oliver R; Yang, Hanbiao; Dong, Guangbin
2011-08-22
Bryostatins, a family of structurally complicated macrolides, exhibit an exceptional range of biological activities. The limited availability and structural complexity of these molecules makes development of an efficient total synthesis particularly important. This article describes our initial efforts towards the total synthesis of bryostatins, in which chemoselective and atom-economical methods for the stereoselective assembly of the ring C subunit were developed. A Pd-catalyzed tandem alkyne-alkyne coupling/6-endo-dig cyclization sequence was explored and successfully pursued in the synthesis of a dihydropyran ring system. Elaboration of this methodology ultimately led to a concise synthesis of the ring C subunit of bryostatins. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
DEFF Research Database (Denmark)
Moser, C; Johansen, H K; Song, Z
1997-01-01
model of this infection was established in two strains of mice: C3H/HeN and BALB/c, generally known as Th1 and Th2 responders, respectively, which were challenged with alginate-embedded P. aeruginosa. Mortality was significantly lower in C3H/HeN compared to BALB/c mice (p ... was cleared more efficiently in C3H/HeN mice and significantly more C3H/HeN mice showed normal lung histopathology (p BALB/c mice (p ... from the two strains of mice, the interferon-(IFN-) gamma levels were higher, whereas IL-4 levels were lower in C3H/HeN mice than in BALB/c mice. The implications of these findings for CF patients with chronic P. aeruginosa lung infection are discussed....
Energy Technology Data Exchange (ETDEWEB)
Koopmans, M.P.; De Leeuw, J.W.; Damste, J.S.S. [Netherlands Institute for Sea Research (NIOZ), Den Burg (Netherlands)] [and others
1997-06-01
Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (R{sub o} = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330{degrees}C for 72 h to study the diagenetic fate of n-C{sub 37} and n-C{sub 38} di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260{degrees}C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C{sub 37} and n-C{sub 38} skeletons, saturated n-C{sub 37} and n-C{sub 38} methyl, ethyl, and mid-chain ketones, C{sub 37} and C{sub 38} mid-chain 2,5-di-n-alkylthiophenes, C{sub 37} and C{sub 38} 1,2-di-n-alkylbenzenes, and C{sub 37} and C{sub 38} n-alkanes. With increasing thermal maturation, three forms of the n-C{sub 37} and n-C{sub 38} skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C{sub 37} and n-C{sub 38} skeleton can be expected as well as the corresponding hydrocarbons. 58 refs., 8 figs., 2 tabs.
Lifescience Database Archive (English)
Full Text Available -21 (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 3e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006
Indian Academy of Sciences (India)
2018-05-23
May 23, 2018 ... A comparative study on dielectric behaviours of Au/(Zn-doped. PVA)/n-4H-SiC .... To form MPS structures, the prepared PVA (Zn nanoparticle- doped) ..... 95 2885. [26] MacCallum J R and Vincent C A 1989 Polymer electrolyte.
Substrate-Mediated C-C and C-H Coupling after Dehalogenation.
Kong, Huihui; Yang, Sha; Gao, Hongying; Timmer, Alexander; Hill, Jonathan P; Díaz Arado, Oscar; Mönig, Harry; Huang, Xinyan; Tang, Qin; Ji, Qingmin; Liu, Wei; Fuchs, Harald
2017-03-15
Intermolecular C-C coupling after cleavage of C-X (mostly, X = Br or I) bonds has been extensively studied for facilitating the synthesis of polymeric nanostructures. However, the accidental appearance of C-H coupling at the terminal carbon atoms would limit the successive extension of covalent polymers. To our knowledge, the selective C-H coupling after dehalogenation has not so far been reported, which may illuminate another interesting field of chemical synthesis on surfaces besides in situ fabrication of polymers, i.e., synthesis of novel organic molecules. By combining STM imaging, XPS analysis, and DFT calculations, we have achieved predominant C-C coupling on Au(111) and more interestingly selective C-H coupling on Ag(111), which in turn leads to selective synthesis of polymeric chains or new organic molecules.
Average number of neutrons in π-p, π-n, and π-12C interactions at 4 GeV/c
International Nuclear Information System (INIS)
Bekmirzaev, R.N.; Grishin, V.G.; Muminov, M.M.; Suvanov, I.; Trka, Z.; Trkova, J.
1984-01-01
The average numbers of secondary neutrons in π - p, π - n, and π -12 C interactions at 4 GeV/c have been determined by investigating secondary neutral stars produced by neutrons in a propane bubble chamber. The following values were obtained for the charge-exchange coefficients: α(p→n) = 0.39 +- 0.04 and α(n→p) = 0.37 +- 0.08
Directory of Open Access Journals (Sweden)
Dolado, J. S.
2011-06-01
Full Text Available The textural and mechanical characterization of C-S-H gels formed from the hydration of pure T1-C3S, β-C2S and their blends are studied by Nitrogen sorption and nanoindentation experiments. The surface area and nanoporosity of C-S-H gels formed from the hydration of β-C2S and the 30-70 (T1-C3S and β-C2S mixture are higher than those from hydration of T1-C3S, and 70-30, with the difference decreasing with hydration age. Such changes are well supported by findings of nanoindentation study, which shows the greater relative volume of C-S-H phases with lower densities in the β-C2S and the 30-70 pastes. With the increase in hydration age, the relative volume of C-S-H phases with higher densities increased at the expenses of those with lower density. Important quantitative correlations were found among these textural characteristics and the mean chain length, determined from 29Si magic-angle-spinning (MAS NMR, of the C-S-H gels.La caracterización textural y mecánica de geles C-S-H formados a partir de la hidratación de muestras puras de T1-C3S, ß-C2S y sus mezclas ha sido estudiada por medio de adsorción de nitrógeno y nanoindentación. El área superficial y la nano-porosidad de los geles formados durante la hidratación del ß-C2S y la mezcla 30-70 (T1-C3S- ß-C2S son mayores que los correspondientes a los geles del T1-C3S, y la mezcla 70-30; esta diferencia disminuye con el tiempo de hidratación. Estos cambios coinciden con los resultados de nanoindentación que indican un aumento de volumen relativo de las fases C-S-H con una densidad menor en el caso del ß-C2S y la mezcla 30-70. Al aumentar el tiempo de hidratación, el volumen relativo de fases C-S-H de mayor densidad aumenta a expensas de aquellas de menor densidad. Importantes correlaciones cuantitativas se establecen entre las características texturales y la longitud de cadena media del gel C-S-H, determinada mediante RMN-MAS de 29Si.
Cachero Castro, Cristina; Ponce de León Amador, Pedro José
2007-01-01
Este seminario trata sobre principios de orientación a objetos con C++. Para comprender mejor sus contenidos, se debe tener un conocimiento básico sobre programación estructurada con C++ o C. Funciones amigas. Entrada / Salida. Sobrecarga de funciones y operadores. Gestión de memoria dinámica. Atributos y métodos de clase. Implementación de relaciones entre objetos.
Distinct Signaling Roles of cIMP, cCMP, and cUMP.
Seifert, Roland
2016-10-04
The cyclic purine nucleotide cIMP and the cyclic pyrimidine nucleotides cCMP and cUMP are emerging second messengers. These cNMPs show different biological effects, but the molecular mechanisms remain elusive. In this issue of Structure, Ng et al. (2016) provide structural evidence for distinct interactions of cIMP, cCMP, and cUMP with ion channels. Copyright © 2016 Elsevier Ltd. All rights reserved.
Siahaan, P.; Salimah, S. N. M.; Sipangkar, M. J.; Hudiyanti, D.; Djunaidi, M. C.; Laksitorini, M. D.
2018-04-01
Chitosan application in pharmaceutics and cosmeceutics industries is limited by its solubility issue. Modification of -NH2 and -OH fuctional groups of chitosan by adding carboxyl group has been shown to improve its solubility and application. Attempt to synthesize carboxymethyl chitosan (CMC) from monocloroacetic acid (MCAA) has been done prior this report. However no information is available wether –OH (-O-C bonding formation) or -NH2 (-N-C bonding formation) is the preference for - CH2COOH to attach. In the current study, the reaction mechanism between chitosan and MCAA reactants into carboxymethyl chitosan (CMC) was examined by computational approach. Dimer from of chitosan used as a molecular model in calculation All the molecular structure involved in the reaction mechanism was optimized by ab initio computational on the theory and basis set HF/6-31G(d,p). The results showed that the - N-C bonding formation via SN2 than the -O-C bonding formation via SN2 which have activation energy 469.437 kJ/mol and 533.219 kJ/mol respectively. However, the -O-C bonding formation more spontaneous than the -N-C bonding formation because ΔG the formation of O-CMC-2 reaction is more negative than ΔG of formation N-CMC-2 reaction is -4.353 kJ/mol and -1.095 kJ/mol respectively. The synthesis of N,O-CMC first forms -O-CH2COOH, then continues to form -NH-CH2COOH. This information is valuable to further optimize the reaction codition for CMC synthesis.
Lifescience Database Archive (English)
Full Text Available ents: (bits) Value BC142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 97 6e-19 (Q9NZJ4) RecName: Full=Sacsi...n; &AL157766_4( AL157766 |pid:none) 97 9e-19 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 1e-18 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 2e-18 (Q9JLC8) RecName: Full=Sacsin; 96 2e-18 CP001577_292( CP001577 |pid:none) Mi
Nqrs Data for C3H2Cl10N2PSb[C3HCl4N2P·Cl6HSb](Subst. No. 0601)
Chihara, H.; Nakamura, N.
This document is part of Subvolume A `Substances Containing Ag … C10H15' of Volume 48 `Nuclear Quadrupole Resonance Spectroscopy Data' of Landolt-Börnstein - Group III `Condensed Matter'. It contains an extract of Section `3.2 Data tables' of the Chapter `3 Nuclear quadrupole resonance data' providing the NQRS data for C3H2Cl10N2PSb [C3HCl4N2P·Cl6HSb] (Subst. No. 0601)
International Nuclear Information System (INIS)
1996-01-01
To satisfy the requirements of US Regulatory bodies the O-ring seals in the containment vessels of Package Design 2863B have to be shown to operate satisfactorily (i.e. remain leaktight) at the extremes of temperature that they are expected to experience during both normal and hypothetical accident conditions of transport. For Package Design 2863B this effectively means that the seals must remain leaktight over the temperature range -40 C to + 220 C, but to ensure that an adequate safety margin exists the seals should preferably remain leaktight over the range -50 C to +250 C. This test report describes the procedures and results of tests carried out on Viton seals over the temperature range -50 C to +250 C. The variability of the results at low temperature, by both pressure drop and helium leakage testing, would indicate that the particular formulation of Viton tested cannot be used to provide a reliable leaktight seal at -40 C. Although the results of the pressure drop tests at high temperature were satisfactory, insufficient testing has been carried out using helium leakage testing to draw a firm conclusion about the high temperature performance of the material tested
Martin, Gary E; Hilton, Bruce D; Irish, Patrick A; Blinov, Kirill A; Williams, Antony J
2007-10-01
Utilization of long-range (1)H--(15)N heteronuclear chemical shift correlation has continually grown in importance since the first applications were reported in 1995. More recently, indirect covariance NMR methods have been introduced followed by the development of unsymmetrical indirect covariance processing methods. The latter technique has been shown to allow the calculation of hyphenated 2D NMR data matrices from more readily acquired nonhyphenated 2D NMR spectra. We recently reported the use of unsymmetrical indirect covariance processing to combine (1)H--(13)C GHSQC and (1)H--(15)N GHMBC long-range spectra to yield a (13)C--(15)N HSQC-HMBC chemical shift correlation spectrum that could not be acquired in a reasonable period of time without resorting to (15)N-labeled molecules. We now report the unsymmetrical indirect covariance processing of (1)H--(13)C GHMBC and (1)H--(15)N IMPEACH spectra to afford a (13)C--(15)N HMBC-IMPEACH spectrum that has the potential to span as many as six to eight bonds. Correlations for carbon resonances long-range coupled to a protonated carbon in the (1)H--(13)C HMBC spectrum are transferred via the long-range (1)H--(15)N coupling pathway in the (1)H--(15)N IMPEACH spectrum to afford a much broader range of correlation possibilities in the (13)C--(15)N HMBC-IMPEACH correlation spectrum. The indole alkaloid vincamine is used as a model compound to illustrate the application of the method. (c) 2007 John Wiley & Sons, Ltd.
Roohi, Mahnaz; Riaz, Muhammad; Arif, Muhammad Saleem; Shahzad, Sher Muhammad; Yasmeen, Tahira; Ashraf, Muhammad Arslan; Riaz, Muhammad Atif; Mian, Ishaq A
2017-02-01
Application of raw and treated wastewater for irrigation is an extensive practice for agricultural production in arid and semiarid regions. Raw textile wastewater has been used for cultivation in urban and peri-urban areas in Pakistan without any systematic consideration to soil quality. We conducted a laboratory incubation study to investigate the effects of low C/N ratio raw textile wastewater on soil nitrogen (N) contents, labile carbon (C) as water-soluble C (WSC) contents, and activities of urease and dehydrogenase enzymes. The 60-day incubation study used an alkaline clay loam aridisol that received 0 (distilled water), 25, 50, and 100% wastewater concentrations, and microcosms were incubated aerobically under room temperature at 70% water holding capacity. Results revealed that raw wastewater significantly (p 50% of the soil total Kjeldahl N (TKN) contents and served as the major N pool. However, nitrification index (NO 3 - -N/NH 4 + -N ratio) decreased at high wastewater concentrations. A significant negative correlation was observed between EON and WSC (p production and accumulation of soil NO 3 - -N and EON contents in concentrated wastewater-treated soil could pose an ecological concern for soil fertility, biological health, and water quality. However, the EON could lead to mineral N pool but only if sufficient labile C source was present. The effects of wastewater irrigation on soil N cycling need to be assessed before it is recommended for crop production.
Energy Technology Data Exchange (ETDEWEB)
Norman, M.H.; Gabriel, S.D. [Glaxo Wellcome Inc., Research Triangle Park, NC (United States)
1996-03-01
Three isotopic forms of potential antipsychotic agent 1192U90 (2-amino-N-(4-(4-(1,2-benzisthiazol-3-yl)-piperazinyl)butyl)benzam ide) were synthesized: one containing {sup 13}C-isotopes and two containing {sup 14}C-isotopes. The compound in which the ortho-amino benzamide ring is completely {sup 13}C-labeled was prepared in a four-step sequence starting from [{sup 13}C{sub 6}]aniline. The {sup 14}C-labeled compounds were prepared by methods analogous to those previously described for the unlabeled material. The key step involved the condensation of 3-(4-(4aminobutyl)-1-piperazinyl)-1,2-benzisothiazole with isatoic anhydride. The first {sup 14}C-labeled compound (3) was prepared from {sup 14}C-labeled 3-(4-(4-aminobutyl)-1-piperazinyl)-1,2-benzisothiazole, while the second compound (4) derived its isotopic label from [{sup 14}C]isatoic anhydride. Compound 3 had a specific activity of 26.55 mCi/mmol, a radiochemical purity of 99.3%, and a radiochemical yield of 3.4%. Compound 4 had a specific activity of 22.67 mCi/mmol and a radiochemical purity of 99.2%. (author).
Rowell, Douglas M; Ades, Peter K; Tausz, Michael; Arndt, Stefan K; Adams, Mark A
2009-02-01
We assessed the variation in delta(13)C signatures of Pinus radiata D. Don stemwood taken from three genetic trials in southern Australia. We sought to determine the potential of using delta(13)C signatures as selection criteria for drought tolerance. Increment cores were taken from P. radiata and were used to determine the basal area increment and the delta(13)C signature of extracted cellulose. Both growth increment and cellulose delta(13)C were affected by water availability. Growth increment and delta(13)C were negatively correlated suggesting that growth was water-limited. While there was significant genetic variation in growth, there was no significant genetic variation in cellulose delta(13)C of tree rings. This suggests that different genotypes of P. radiata display significant differences in growth and yet respond similarly to drought stress. The delta(13)C response to drought stress was more due to changes in stomatal conductance than to the variation in photosynthetic capacity, and this may explain the lack of genetic variation in delta(13)C. The lack of genetic variation in cellulose delta(13)C of tree rings precludes its use as a selection criterion for drought tolerance among P. radiata genotypes.
Dicty_cDB: Contig-U14319-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ium discoideum cDNA clone:dda24i16, 3' ... 299 2e-77 1 ( DR934252 ) EST1125791 Aquilegia cDNA library Aquile...1.5 1 ( EB527188 ) 301633 Pigtailed macaque ovary library Macaca nem... 44 1.5 1 ( DY755095 ) 177840 Pigtailed macaque ovary library... Macaca nem... 44 1.5 1 ( DY753779 ) 179483 Pigtailed macaque ovary library Macaca n... anubis cDN... 44 1.5 1 ( EY285509 ) 1106514291549 03BABOON-C-01-1-3KB Papio anubis cD... 44 1.5 1 ( EU795295 ) Unculture...ve search space used: 26623730980 Neighboring words threshold: 12 Window for multiple hits: 40
Wong, Siew Ying; Tan, Michelle G K; Banks, William A; Wong, W S Fred; Wong, Peter T-H; Lai, Mitchell K P
2016-02-09
Andrographolide is the major bioactive compound isolated from Andrographis paniculata, a native South Asian herb used medicinally for its anti-inflammatory properties. In this study, we aimed to assess andrographolide's potential utility as an anti-neuroinflammatory therapeutic. The effects of andrographolide on lipopolysaccharide (LPS)-induced chemokine up-regulation both in mouse cortex and in cultured primary astrocytes were measured, including cytokine profiling, gene expression, and, in cultured astrocytes, activation of putative signaling regulators. Orally administered andrographolide significantly attenuated mouse cortical chemokine levels from the C-C and C-X-C subfamilies. Similarly, andrographolide abrogated a range of LPS-induced chemokines as well as tumor necrosis factor (TNF)-α in astrocytes. In astrocytes, the inhibitory actions of andrographolide on chemokine and TNF-α up-regulation appeared to be mediated by nuclear factor-κB (NF-κB) or c-Jun N-terminal kinase (JNK) activation. These results suggest that andrographolide may be useful as a therapeutic for neuroinflammatory diseases, especially those characterized by chemokine dysregulation.
Lifescience Database Archive (English)
Full Text Available *nlygsnql yss*np*ktsfnsktrwnk**c*snin*yfnyyf*wyfcwyekywlnynykiliin*lii ikiiiikiiiivlhyfkdaxk*in*kf Translated... 2004.12.24 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N DQ538352 |DQ538352.1 Bienertia si... aralocaspica phosphoenolpyruvate carboxylase mRNA, partial cds. 48 2e-07 2 DQ538354 |DQ538354.1 Suaeda eltoni...lmekk**n** kh*f*lnhqvkelqns*rni*krlai*virkh*myqecyhiy*i*lmlqnniiwldqlen hsstmkmi*si...tfry*nd**thknykcnlginkt*nsstr**npstfcfns*nlygsnql yss*np*ktsfnsktrwnk**c*snin*yfnyyf*wyfcwyekywlnynykiliin*lii ikiiiikiiiivlhyfkda
On C{sub J} and C{sub T} in conformal QED
Energy Technology Data Exchange (ETDEWEB)
Giombi, Simone; Tarnopolsky, Grigory [Princeton University, Department of Physics,Jadwin Hall, Washington Road, Princeton NJ 08544 (United States); Klebanov, Igor R. [Princeton University, Department of Physics,Jadwin Hall, Washington Road, Princeton NJ 08544 (United States); Princeton Center for Theoretical Science, Princeton University,Jadwin Hall, Washington Road, Princeton NJ 08544 (United States)
2016-08-26
QED with a large number N of massless fermionic degrees of freedom has a conformal phase in a range of space-time dimensions. We use a large N diagrammatic approach to calculate the leading corrections to C{sub T}, the coefficient of the two-point function of the stress-energy tensor, and C{sub J}, the coefficient of the two-point function of the global symmetry current. We present explicit formulae as a function of d and check them versus the expectations in 2 and 4−ϵ dimensions. Using our results in higher even dimensions we find a concise formula for C{sub T} of the conformal Maxwell theory with higher derivative action F{sub μν}(−∇{sup 2}){sup (d/2)−2}F{sup μν}. In d=3, QED has a topological symmetry current, and we calculate the correction to its two-point function coefficient, C{sub J}{sup top}. We also show that some RG flows involving QED in d=3 obey C{sub T}{sup UV}>C{sub T}{sup IR} and discuss possible implications of this inequality for the symmetry breaking at small values of N.
Yang, Wenguo
2012-02-08
Through the cleavage of the C-C bond, the first catalytic tandem conjugate addition-elimination reaction of Morita-Baylis-Hillman C adducts has been presented. Various S N2′-like C-, S-, and P-allylic compounds could be obtained with exclusive E configuration in good to excellent yields. The Michael product could also be easily prepared by tuning the β-C-substituent group of the α-methylene ester under the same reaction conditions. Calculated relative energies of various transition states by DFT methods strongly support the observed chemoselectivity and diastereoselectivity. © 2012 Wiley-VCH Verlag GmbH&Co. KGaA, Weinheim.
Synthesis of phenobarbital {sup 14}C - 5 (1964); Synthese du phenobarbital {sup 14}C - 5 (1964)
Energy Technology Data Exchange (ETDEWEB)
Benakis, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1964-07-01
Phenobarbital (Luminal), well known as a hypnotic agent, plays also an important role in the medical treatment of epilepsy. With the object of studying the metabolism of this medicament in the living system, the synthesis of phenobarbital marked in position 2 of the pyrimidinic ring has been effected. It has been necessary, in order to carry out to research into the metabolism of this product, to have a phenobarbital marked in position 5 of the pyrimidinic ring. This synthesis, making it possible to introduce C-14 into position 5 of the pyrimidinic ring, consists of seven stages starting from C-14 carboxyl benzoic acid having a specific activity of 25 mc/mM. The melting point of the final product is 172 - 173 deg. C and its specific activity is 11.15 mc/mM. The overall radioactive yield of the pure product, with respect to the original benzoic acid (10 mM) is of the order of 3 per cent. The purity of the product has been controlled by paper chromatography; it is of the order of 99 per cent. (author) [French] Le phenobarbital (Luminal) bien connu comme agent hypnotique, joue egalement un role important dans la medication anti-epileptique. Pour l'etude du metabolisme de ce medicament dans l'organisme vivant, nous avons synthetise le phenobarbital marque en position 2 du cycle pyrimidinique. Afin de poursuivre la recherche du metabolisme de ce produit, il a ete necessaire de disposer du phenobarbital marque en position 5 du cycle. pyrimidinique. Cette synthese, permettant l'introduction du {sup 14}C en position 5 du cycle pyrimidinique, comporte sept etapes, au depart de l'acide benzoique carboxyle {sup 14}C, d'une activite specifique de 25 mc/mM. Point de fusion du produit final: 172 - 173 deg. C Activite specifique: 11,15 mC/mM. Rendement total radioactif du produit pur, par rapport a l'acide benzoique de depart sur 10 mM, de l'ordre de 3 pour cent. La purete du produit a ete controlee par chromatographie sur papier; elle est de l'ordre de 99 pour cent. (auteur)
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFL826 (Link to dictyBase) - - - - AFL826P (Link to Original s...ite) AFL826F 588 AFL826Z 766 AFL826P 1334 - - Show AFL826 Library AF (Link to library) Clone ID AFL826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t... Score E Sequences producing significant alignments: (bits) Value N ( BJ346543 ) Dictyostelium discoideum cD...NA clone:dda24d08, 3' ... 1100 0.0 1 ( BJ341682 ) Dictyostelium discoideum cDNA c
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH264 (Link to dictyBase) - - - Contig-U16382-1 SLH264Z (Link... to Original site) - - SLH264Z 532 - - - - Show SLH264 Library SL (Link to library) Clone ID SLH264 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH264Q.Seq.d/ Representative seq. ID SLH26...4Z (Link to Original site) Representative DNA sequence >SLH264 (SLH264Q) /CSM/SL/SLH2-C/SLH264Q.Seq.d/ XXXXX...g significant alignments: (bits) Value N ( AU039244 ) Dictyostelium discoideum slug cDNA, clone SLH2
Gauge theories on the lattice at N/sub c/ = infinity
International Nuclear Information System (INIS)
Cristofano, G.A.
1982-01-01
The thesis is devoted to the study of the physical properties of the SU(N/sub c/) Yang Mills theory on the lattice at N/sub c/ = infinity. Since the lattice approach provides a natural framework toward a better understanding of nonperturbative phenomena, like quark confinement, nonperturbative physical quantities, like the string tension and the glueball mass are studied. The first two chapters are introductory in nature. In chapters (3,4) the strong coupling expansion for the Euclidean SU(N/sub c/) lattice gauge theory at N/sub c/ = infinity to 16th and 12th order in β = 1/g 0 2 N/sub c/ for the free energy F and the string tension k respectively is performed. Estimates of the ratio √k/Λ/sub L/ and of the crossover point from strong to weak coupling for the string tension are made by matching the strong coupling series to the asymptotically free continuum theory. In chapter (5) the strong coupling expansion for the glueball mass m/sub g/ to the 8th order in β for the Euclidean SU(infinity) lattice gauge theory is performed. The ratio of the glueball mass m/sub g/ to the squareroot of the string tension √k for the SU(infinity) theory is estimated to be m/sub g//√k = 2.6 +/- 0.2. It is found that the ratio m/sub g//√k has a rather small dependence on N/sub c/ and appears to increase with the number of colors N/sub c/. In chapter (6) two-point Pade approximants for the one plaquette expectation value E/sub p/ for the SU(2) lattice gauge theory by using the known strong and weak coupling series for D/sub p/ is performed. Comparison with the correspondent Monte Carlo results is made, especially in the delicate transition region, at intermediate β = 4/g 0 2
Gold-Catalyzed Formal C-C Bond Insertion Reaction of 2-Aryl-2-diazoesters with 1,3-Diketones.
Ren, Yuan-Yuan; Chen, Mo; Li, Ke; Zhu, Shou-Fei
2018-06-29
The transition-metal-catalyzed formal C-C bond insertion reaction of diazo compounds with monocarbonyl compounds is well established, but the related reaction of 1,3-diketones instead gives C-H bond insertion products. Herein, we report a protocol for a gold-catalyzed formal C-C bond insertion reaction of 2-aryl-2-diazoesters with 1,3-diketones, which provides efficient access to polycarbonyl compounds with an all-carbon quaternary center. The aryl ester moiety plays a crucial role in the unusual chemoselectivity, and the addition of a Brønsted acid to the reaction mixture improves the yield of the C-C bond insertion product. A reaction mechanism involving cyclopropanation of a gold carbenoid with an enolate and ring-opening of the resulting donor-acceptor-type cyclopropane intermediate is proposed. This mechanism differs from that of the traditional Lewis-acid-catalyzed C-C bond insertion reaction of diazo compounds with monocarbonyl compounds, which involves a rearrangement of a zwitterion intermediate as a key step. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Liquid phase interaction in TiC0,5N0,5-TiNi-Mo and TiC0,5N0,5-TiNi-Ti-Mo
International Nuclear Information System (INIS)
Askarova, L.Kh; Grigorov, I.G.; Zajnulin, Yu.G.
1998-01-01
Using the methods of X ray diffraction analysis, electron microscopy and X ray spectrum microanalysis a study was made into specific features of phase and structure formation in alloys TiC 0,5 N 0,5 -TiNi-Mo and TiC 0,5 N 0,5 -TiNi-Mo in the presence of a liquid phase at temperatures of 1380-1600 deg C. It is revealed that the physical and chemical processes taking place during the liquid-phase sintering result in the formation of a three-phase alloy consisting of nonstoichiometric titanium carbonitride TiC 0.5-x N 0.5-x , a molybdenum base solid solution of titanium, nickel and carbon Mo(Ti, Ni, C) and one of two intermetallic compounds, either TiNi or Ni 3 Ti. Metallic element concentration in individual phase constituents of the alloy is determined by means of X ray spectrum microanalysis
Excited states in 22Mg via the 12C(12C,2n)22Mg reaction
International Nuclear Information System (INIS)
Jewett, Cybele; Baktash, Cyrus; Bardayan, Daniel W.; Blackmon, Jeff C.; Chipps, K.; Galindo-Uribarri, Alfredo; Greife, U.; Gross, Carl J.; Jones, K. L.; Liang, Junjien; Livesay, Jake; Kozub, R. L.; Nesaraja, Caroline D; Radford, David C.; Sarazin, F.; Smith, Michael Scott; Thomas, J. S.; Yu, Chang-Hong
2007-01-01
The 12C(12C, 2n)22Mg reaction was measured with the CLARION array and the RMS separator at the Holifield Facility of Oak Ridge National Laboratory. This experiment was performed to gather more information on the excited states in 22Mg, which might be of relevance to recent radioactive ion beam measurements of the astrophysically important 21Na(p,γ)22Mg reaction. The results are compared to direct measurements, transfer experiments and a competing experiment performed with Gammasphere
International Nuclear Information System (INIS)
Suess, H.E.; Linick, T.W.
1990-01-01
When, in 1950, Willard Libby and his coworkers obtained their first radiocarbon ( 14 C) dates, C W Ferguson at the University of Arizona Tree Ring Laboratory was working on establishing a continuous tree ring series for the newly discovered bristlecone pine Pinus aristata. Before his untimely death in 1986, he had extended the series nearly 8000 years into the past. From the Ferguson series I obtained for 14 C determinations wood samples grown at various times. Also, two other laboratories obtained such samples. For B.C. times in particular, our measured 14 C-values that deviated consistently from those calculated from tree rings, and the deviations increased with age. This general trend was observed by other laboratories, but the presence of deviations from these trends, of the so-called 'wiggles', was questioned by other workers. To me these wiggles indicated the existence of a most interesting geophysical parameter valid for the whole terrestrial atmosphere. Fourier spectra obtained at my request by Kruse in 1972, and by Neftel, demonstrated the consistency of the results, and supported my contention that the secular variations of 14 C in atmospheric CO 2 are related to variations of solar activity. (author)
Directory of Open Access Journals (Sweden)
Gabriel Cabrera
2011-06-01
Full Text Available El virus del tumor mamario murino (MMTV es un retrovirus que se transmite durante la lactancia y que ha desarrollado estrategias para explotar y subvertir el sistema inmune. En un modelo de infección natural con MMTV hemos mostrado previamente que la infección causa incrementos tempranos y progresivos de células T regulatorias (Treg CD4+CD25+Foxp3+ específicas para el superantígeno (Sag viral en las placas de Peyer (PP. En este trabajo se evaluó si la depleción de las células Treg influencia la población de células CD8+ durante la infección con MMTV a través del amamantamiento. La depleción de las células Treg al día 6 de infección causó incrementos en el porcentaje y número absoluto de las células CD8+ en los ganglios y provocó un incremento en la intensidad de fluorescencia media del marcador de activación CD44 en esas células. Los incrementos en el número absoluto de las células CD8 se observaron en células con cadenas variables Vβ del receptor de las células T (TCR tanto reactivas como no reactivas al Sag. Previamente habíamos demostrado que la depleción de las células Treg al día 6 de infección disminuye la carga viral. Los resultados presentados en este trabajo sugieren que, al menos a partir del día 6 de infección con MMTV, las células Treg podrían tener un rol inhibiendo la generación de una respuesta CD8 antiviral.
Electroluminescence of doped and undoped AlN/SiC-heterojunctions
Energy Technology Data Exchange (ETDEWEB)
Bruesewitz, Christoph; Vetter, Ulrich; Hofsaess, Hans [II. Physikalisches Institut, Georg-August-Universitaet Goettingen (Germany)
2010-07-01
AlN with its large and direct bandgap is a useful host for optoelectronic applications. Grown on 6H-SiC, a heterojunction is created, forming a diode. The light emitted by n-doped 6H-SiC via electroluminescence forms a broad band with a maximum at a wavelength of 475 nm. With the AlN layer on the surface, nitrogen atoms can diffuse into the 6H-SiC, creating new energy levels. Depending on the direction of the current and additional dopants in the AlN layer, the carrier concentration changes and new levels are available, resulting in different colours. It is shown that in this heterojunction blue, red and white colours are feasible.
Energy Technology Data Exchange (ETDEWEB)
Dalling, D.K.; Haider, G.; Pugmire, R.J.; Shabtai, J.; Hull, W.E.
1984-04-01
A middle - heavy SRC-II distillate (b.p. 230-455 C), containing 3.0 wt% of oxygen, has been studied by means of /SUP/1/SUP/3C N.M.R. at 75, 100 and 125 MHz. The magnetization refocussing techniques INEPT and J-resolved two-dimensional Fourier transform have been utilized to demonstrate methods by which resonance line multiplicities may be determined in complex liquid mixtures. Products derived from the above coal liquid by hydrodeoxygenation at temperatures from 200 to 370 C, using sulphided Co-Mo and Ni-W catalysts, were also examined. The fraction of aromatic carbon in the hydrotreated liquids was found to correlate directly with their C/H atomic ratio and inversely with the hydrogen content. Comparison of O/C atomic ratios with f/SUB/a values for these liquids indicates that hydrogen uptake <260 C is associated primarily with hydrogenolytic oxygen removal without attendant ring hydrogenation, while at temperatures between 260 and 350 C hydrodeoxygenation is accompanied by ring hydrogenation and dealkylation reactions. (19 refs.)
Indian Academy of Sciences (India)
C P CHAUDHARI. Articles written in Bulletin of Materials Science. Volume 41 Issue 1 February 2018 pp 24. A logical explanation of structurally unfit X-ray diffraction peaks in nanoferroelectrics · C M DUDHE B K SAKHARE S S PANCHBHAI S J KHAMBADKAR N V DHOKE C P CHAUDHARI U A PALIKUNDWAR.
Shin, J H; Bridgewater, B M; Churchill, D G; Parkin, G
2001-10-22
The chiral monodentate phosphine PhP[(C(5)Me(4))(2)] is readily obtained by oxidation of the lithium complex Li(2)[PhP(C(5)Me(4))(2)] with I(2), which couples the two cyclopentadienyl groups to form a five-membered heterocyclic ring. The steric and electronic properties of PhP[(C(5)Me(4))(2)] have been evaluated by X-ray diffraction and IR spectroscopic studies on a variety of derivatives, including Ph[(C(5)Me(4))(2)]PE (E = S, Se), Cp*MCl(4)[P[(C(5)Me(4))(2)]Ph] (M = Mo, Ta), Ir[P[(C(5)Me(4))(2)]Ph](2)(CO)Cl, and CpFe(CO)[PhP[(C(5)Me(4))(2)
Thakur, A K; Kishore, R
2006-04-15
The chemical synthesis and single-crystal X-ray diffraction analysis of a model peptide, Boc-Thr-Thr-NH2 (1) comprised of proteinogenic residues bearing an amphiphilic Cbeta -stereogenic center, has been described. Interestingly, the analysis of its molecular structure revealed the existence of a distinct conformation that mimics a typical beta-turn and Asx-turns, i.e., the two Thr residues occupy the left- and right-corner positions. The main-chain torsion angles of the N- and C-terminal residues i.e., semiextended: phi = -68.9 degrees , psi = 128.6 degrees ; semifolded: phi = -138.1 degrees , psi = 2.5 degrees conformations, respectively, in conjunction with a gauche- disposition of the obligatory C-terminus Thr CgammaH3 group, characterize the occurrence of the newly described beta-turn- and Asx-turns-like topology. The preferred molecular structure is suggested to be stabilized by an effective nonconventional main-chain to side-chain Ci=O . . . H--Cgamma(i+2)-type intraturn hydrogen bond. Noteworthy, the observed topology of the resulting 10-membered hydrogen-bonded ring is essentially similar to the one perceived for a classical beta-turn and the Asx-turns, stabilized by a conventional intraturn hydrogen bond. Considering the signs as well as magnitudes of the backbone torsion angles and the orientation of the central peptide bond, the overall mimicked topology resembles the type II beta-turn or type II Asx-turns. An analysis of Xaa-Thr sequences in high-resolution X-ray elucidated protein structures revealed the novel topology prevalence in functional proteins (unpublished). In view of indubitable structural as well as functional importance of nonconventional interactions in bioorganic and biomacromolecules, we intend to highlight the participation of Thr CgammaH in the creation of a short-range C=O . . . H--Cgamma -type interaction in peptides and proteins. Copyright 2006 Wiley Periodicals, Inc.
THE {sup 12}C + {sup 12}C REACTION AND THE IMPACT ON NUCLEOSYNTHESIS IN MASSIVE STARS
Energy Technology Data Exchange (ETDEWEB)
Pignatari, M. [Department of Physics, University of Basel, Klingelbergstrasse 82, CH-4056 Basel (Switzerland); Hirschi, R.; Bennett, M. [Astrophysics Group, EPSAM Institute, Keele University, Keele, ST5 5BG (United Kingdom); Wiescher, M.; Beard, M. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Gallino, R. [Universita' di Torino, Torino, Via Pietro Giuria 1, I-10126 Torino (Italy); Fryer, C.; Rockefeller, G. [Computational Physics and Methods (CCS-2), LANL, Los Alamos, NM 87545 (United States); Herwig, F.; Timmes, F. X., E-mail: marco.pignatari@unibas.ch [The Joint Institute for Nuclear Astrophysics, Notre Dame, IN 46556 (United States)
2013-01-01
Despite much effort in the past decades, the C-burning reaction rate is uncertain by several orders of magnitude, and the relative strength between the different channels {sup 12}C({sup 12}C, {alpha}){sup 20}Ne, {sup 12}C({sup 12}C, p){sup 23}Na, and {sup 12}C({sup 12}C, n){sup 23}Mg is poorly determined. Additionally, in C-burning conditions a high {sup 12}C+{sup 12}C rate may lead to lower central C-burning temperatures and to {sup 13}C({alpha}, n){sup 16}O emerging as a more dominant neutron source than {sup 22}Ne({alpha}, n){sup 25}Mg, increasing significantly the s-process production. This is due to the chain {sup 12}C(p, {gamma}){sup 13}N followed by {sup 13}N({beta} +){sup 13}C, where the photodisintegration reverse channel {sup 13}N({gamma}, p){sup 12}C is strongly decreasing with increasing temperature. Presented here is the impact of the {sup 12}C+{sup 12}C reaction uncertainties on the s-process and on explosive p-process nucleosynthesis in massive stars, including also fast rotating massive stars at low metallicity. Using various {sup 12}C+{sup 12}C rates, in particular an upper and lower rate limit of {approx}50,000 higher and {approx}20 lower than the standard rate at 5 Multiplication-Sign 10{sup 8} K, five 25 M {sub Sun} stellar models are calculated. The enhanced s-process signature due to {sup 13}C({alpha}, n){sup 16}O activation is considered, taking into account the impact of the uncertainty of all three C-burning reaction branches. Consequently, we show that the p-process abundances have an average production factor increased up to about a factor of eight compared with the standard case, efficiently producing the elusive Mo and Ru proton-rich isotopes. We also show that an s-process being driven by {sup 13}C({alpha}, n){sup 16}O is a secondary process, even though the abundance of {sup 13}C does not depend on the initial metal content. Finally, implications for the Sr-peak elements inventory in the solar system and at low metallicity are
A comparative computational study of Csbnd N and Csbnd C bonding visible to NIR absorbing croconines
Chetti, Prabhakar; Tripathi, Anuj
2018-03-01
The lowest electronic excitations and charge transfer properties in two series of croconine dyes; 1) molecules with Csbnd N bonding, having an absorption in the visible region (400-600 nm) and 2) molecules with Csbnd C bonding, showing absorption in visible to near infrared (NIR) region (600-1100 nm) are analyzed by quantum-chemical calculations. The absorption maxima in Csbnd C bonding croconines (CCR) are always having 200-300 nm red shifted than its corresponding Csbnd N bonding croconines (NCR). The reason for this drastic red shift in CCR series than its corresponding NCR has been systematically studied by DFT, TDDFT and SAC-CI methods. It is found that, CCR series are with less charge transfer in nature and are having larger diradical character, whereas NCR series molecules showing larger charge transfer with lower diradical character. The change in bonding mode of central five membered croconate ring, from Csbnd N to Csbnd C, destabilization and/stabilization of HOMO LUMO levels were observed. This study may helpful in the design and synthesis of new visible to NIR absorbing croconine dyes which are useful in materials applications.
Elshewy, Ahmed M.
2013-12-01
Oxygen and Nitrogen containing compounds are of utmost importance due to their interesting and diverse biological activities. The construction of the C-O and C–N bonds is of significance as it opens avenues for the introduction of ether and amine linkages in organic molecules. Despite significant advancements in this field, the construction of C-O and C–N bonds is still a major challenge for organic chemists, due to the involvement of harsh reaction conditions or the use of expensive catalysts or ligands in many cases. Thus, it is a challenge to develop alternative, milder, cheaper and more reproducible methodologies for the construction of these types of bonds. Herein, we introduce a new efficient ligand free catalytic system for C-O and C-N bond formation reactions.
Simulación con hojas de cálculo de código abierto: OpenOffice.org y Gnumeric
Sánchez Garcia, Juan Fco.
2008-01-01
Una de las posibles alternativas para realizar técnicas de simulación dentro del ámbito de la investigación es utilizar una aplicación de hoja de cálculo, y hacer uso de las funciones propias de las que dispone dicha aplicación. Evidentemente, existen muchas otras aplicaciones especializadas en tareas de simulación pero la hoja de cálculo presenta la característica de su fácil disposición en cualquier organización (ya sea ésta la administración pública o una empresa) unido a su bajo coste que...
Wang, Weiwei; Dang, Jingshuang; Zhao, Xiang
2011-08-28
Density functional theory (DFT) methods have been applied to study C(32) fullerenes built from four-, five-, and six-membered rings. The relative energies of pure C(32) fullerenes have been evaluated to locate three most stable structures, 32:D(4d) with two squares, 1:D(3) without square and 5:C(s) with one square. Structural analysis reveals that there is a rearrangement pathway between the lowest energy classical isomer 1:D(3) and the lowest energy non-classical isomer 32:D(4d), and 5:C(s) behaves just as an intermediate between them. The kinetic processes of generalized Stone-Wales transformation (GSWT) with four-membered rings have been explored and two distinct reaction mechanisms are determined by all the transition states and intrinsic reaction coordinates with PBE1PBE/6-31G(d) approach for the first time. One mechanism is the concerted reaction with a rotating dimer closed to the cage surface and another is the stepwise reaction with a carbene-like sp(3) structure, whereas the latter is sorted into two paths based on four-membered ring vanishing before or after the formation of the carbene-like structure. It is indicated that there is no absolute preference for any mechanism, which depends on the adaptability of different reactants on the diverse mechanisms. Furthermore, it's found that the interconversion process with the participation of squares is more reactive than the rearrangement between C(60)_I(h) and C(60)_C(2v), implying some potential importance of non-classical small fullerenes in the fullerene isomerization.
LABORATORY GAS-PHASE DETECTION OF THE CYCLOPROPENYL CATION (c-C{sub 3}H{sub 3} {sup +})
Energy Technology Data Exchange (ETDEWEB)
Zhao, Dongfeng; Doney, Kirstin D.; Linnartz, Harold, E-mail: zhao@strw.leidenuniv.nl [Sackler Laboratory for Astrophysics, Leiden Observatory, University of Leiden, PO Box 9513, NL 2300 RA Leiden (Netherlands)
2014-08-20
The cyclopropenyl cation (c-C{sub 3}H{sub 3} {sup +}) is the smallest aromatic hydrocarbon molecule and considered to be a pivotal intermediate in ion-molecule reactions in space. An astronomical identification has been prohibited so far, because of a lack of gas-phase data. Here we report the first high resolution infrared laboratory gas-phase spectrum of the ν {sub 4} (C-H asymmetric stretching) fundamental band of c-C{sub 3}H{sub 3} {sup +}. The c-C{sub 3}H{sub 3} {sup +} cations are generated in supersonically expanding planar plasma by discharging a propyne/helium gas pulse, yielding a rotational temperature of ∼35 K. The absorption spectrum is recorded in the 3.19 μm region using sensitive continuous-wave cavity ring-down spectroscopy. The analysis of about 130 ro-vibrational transitions results in precise spectroscopic parameters. These constants allow for an accurate comparison with high-level theoretical predictions, and provide the relevant information needed to search for this astrochemically relevant carbo-cation in space.
The synthesis of [U-14C phenyl] LS 840606, an agricultural fungicide
International Nuclear Information System (INIS)
Madegard, G.; Mestre, P.; Raimond, P.; Noel, J.-P.
1995-01-01
2,2',4'-Trichloro-[ring U- 14 C]acetophenone was the key intermediate of this synthesis patterned after the industrial route. An unexpected poor yield was observed during the preparation by the Friedel-Crafts reaction of chloroacetyl chloride with 1,3-dichloro-[U- 14 C]benzene, possibly the result of an isotope effect although this poor yield might be explained by other factors. Two routes were checked for the preparation of 1,3-dichloro-[U- 14 C]benzene. The action of CCl 4 with 1,3-dinitro-[U- 14 C]benzene at 280 o C was entailed with explosions. A safer route started from [U- 14 C]aniline via 2,4-dichloro-[ring U- 14 C]acetanilide. Friedel-Crafts reaction with acetyl chloride gave rise in 52% yield to 2',4'-dichloro-[ring U- 14 C]acetophenone which was brominated to 2-bromo-2',4'-dichloro-[ring U- 14 C]acetophenone; was condensed with 2,2-ethylenedioxy)etylmagnesium bromide to compound, was condensed with 1,2,4-triazole then successively treated with HCl:water:dioxane and 2,2,2-trifluoroethanol/HCl. Separation of the two diastereomers by medium pressure liquid chromatography. 7% overall radioactivity yield from [U- 14 C]aniline. Radiochemical purity 99%. (author)
Energy Technology Data Exchange (ETDEWEB)
Chaintreau, Alain; Fieber, Wolfgang; Sommer, Horst [Firmenich SA, Corporate R and D Division, P.O. Box 239, 1211 Geneva 8 (Switzerland); Gilbert, Alexis; Yamada, Keita [Department of Environmental Chemistry and Engineering, Tokyo Institute of Technology, 4259 Nagatsuta-cho, Midori-ku, Yokohama, Kanagawa 226-8503 (Japan); Yoshida, Naohiro [Department of Environmental Chemistry and Engineering, Tokyo Institute of Technology, 4259 Nagatsuta-cho, Midori-ku, Yokohama, Kanagawa 226-8503 (Japan); Earth-Life Science Institute, Tokyo Institute of Technology, Meguro, Tokyo 152-8551 (Japan); Pagelot, Alain [Bruker Biospin SAS, 34 rue de l‘Industrie, 67166 Wissembourg Cedex (France); Moskau, Detlef; Moreno, Aitor [Bruker Biospin AG, Industriestrasse 26, 8117 Fällanden (Switzerland); Schleucher, Jürgen [Department of Medical Biochemistry and Biophysics, Umeå University, S-90187 Umeå (Sweden); Reniero, Fabiano; Holland, Margaret; Guillou, Claude [European Commission, Joint Research Centre – Institute for Health and Consumer Protection, via E. Fermi 2749, I-21027 Ispra (Italy); Silvestre, Virginie; Akoka, Serge [EBSI team, Interdisciplinary Chemistry: Synthesis, Analysis, Modelling (CEISAM), University of Nantes-CNRS UMR 6230, 2 rue de la Houssinière, BP 92208, F-44322 Nantes cedex 3 (France); Remaud, Gérald S., E-mail: gerald.remaud@univ-nantes.fr [EBSI team, Interdisciplinary Chemistry: Synthesis, Analysis, Modelling (CEISAM), University of Nantes-CNRS UMR 6230, 2 rue de la Houssinière, BP 92208, F-44322 Nantes cedex 3 (France)
2013-07-25
Graphical abstract: -- Highlights: •First ring test on isotopic {sup 13}C NMR spectrometry. •Evaluation of the intra- and inter-variability of the NMR spectrometers used. •Definition of a protocol for qualification of the performance of the spectrometer. -- Abstract: Isotopic {sup 13}C NMR spectrometry, which is able to measure intra-molecular {sup 13}C composition, is of emerging demand because of the new information provided by the {sup 13}C site-specific content of a given molecule. A systematic evaluation of instrumental behaviour is of importance to envisage isotopic {sup 13}C NMR as a routine tool. This paper describes the first collaborative study of intra-molecular {sup 13}C composition by NMR. The main goals of the ring test were to establish intra- and inter-variability of the spectrometer response. Eight instruments with different configuration were retained for the exercise on the basis of a qualification test. Reproducibility at the natural abundance of isotopic {sup 13}C NMR was then assessed on vanillin from three different origins associated with specific δ{sup 13}C{sub i} profiles. The standard deviation was, on average, between 0.9 and 1.2‰ for intra-variability. The highest standard deviation for inter-variability was 2.1‰. This is significantly higher than the internal precision but could be considered good in respect of a first ring test on a new analytical method. The standard deviation of δ{sup 13}C{sub i} in vanillin was not homogeneous over the eight carbons, with no trend either for the carbon position or for the configuration of the spectrometer. However, since the repeatability for each instrument was satisfactory, correction factors for each carbon in vanillin could be calculated to harmonize the results.
International Nuclear Information System (INIS)
Klauss, E.U.
1984-01-01
In the present thesis the excitation functions of the reaction 10 B( 14 N, 12 C) 12 C to the ground states, the first excited state at 4.43 MeV (Jsup(π) = 2 1 + ) of a 12 C residual nucleus, and to the double excitation of ejectile and residue nucleus to the 4.43 state are studied. The measurements were performed in an energy range 13MeV 14 N) 0 (in the c.m. system). By a fitting to elastic scattering data the optical potential for 10 B+ 14 N was determined. With this potential it was tried by means of Hauser-Feshbach calculations to calculate the cross sections of the reaction 10 B( 14 N, 12 C) 12 C. The strong 16 + resonance and indications of 18 + in the excitation function of the reaction 10 B( 14 N, 12 Csub(g.s.)) 12 Csub(g.s.) should be pronounced. An unexpected large cross section was observed in the reaction 10 B( 14 N, 12 Csub(g.s.)) 12 C(4 1 + ). This is considered as a further indication to the strong contribution of a direct process. (orig./HSI) [de
Dicty_cDB: Contig-U16238-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 5I14R Mouse 10kb plasmid UUGC2M library Mus ... 46 2.0 1 ( AZ954756 ) 2M0220N05R Mouse 10kb plasmid UUGC2M library...... 46 2.0 1 ( DT769112 ) EST1202962 Aquilegia cDNA library Aqui...legia formo... 46 2.0 1 ( DT765721 ) EST1199570 Aquilegia cDNA library Aquilegia formo... 46 2.0 1 ( DT76040...9 ) EST1194258 Aquilegia cDNA library Aquilegia formo... 46 2.0 1 ( DT753653 ) EST1187502 Aquilegia cDNA library... Aquilegia formo... 46 2.0 1 ( DR922919 ) EST1114458 Aquilegia cDNA library Aquilegia formo... 46 2.0 1
A new form of the rotating C-metric
International Nuclear Information System (INIS)
Hong, Kenneth; Teo, Edward
2005-01-01
In a previous paper, we showed that the traditional form of the charged C-metric can be transformed, by a change of coordinates, into one with an explicitly factorizable structure function. This new form of the C-metric has the advantage that its properties become much simpler to analyse. In this paper, we propose an analogous new form for the rotating charged C-metric, with structure function G(ξ) = (1 - ξ 2 )(1 + r + Aξ)(1 + r - Aξ), where r ± are the usual locations of the horizons in the Kerr-Newman black hole. Unlike the non-rotating case, this new form is not related to the traditional one by a coordinate transformation. We show that the physical distinction between these two forms of the rotating C-metric lies in the nature of the conical singularities causing the black holes to accelerate apart: the new form is free of torsion singularities and therefore does not contain any closed timelike curves. We claim that this new form should be considered the natural generalization of the C-metric with rotation
Roy, Sudeshna; Spilling, Christopher D
2010-11-19
A convergent synthesis of the C(18)-C(34) fragment of amphidinolide C and the C(18)-C(29) fragment of amphidinolide F is reported. The approach involves the synthesis of the common intermediate tetrahydrofuranyl-β-ketophosphonate via cross metathesis, Pd(0)-catalyzed cyclization, and hydroboration-oxidation. The β-ketophosphonate was coupled to three side chain aldehydes using a Horner-Wadsworth-Emmons (HWE) olefination reaction to give dienones, which were reduced with l-selectride to give the fragments of amphidinolide C and F.
Photoinduced C-C Cross-Coupling of Aryl Chlorides and Inert Arenes
Directory of Open Access Journals (Sweden)
Lele Wang
2016-01-01
Full Text Available Here we report a facile, efficient, and catalyst-free method to realize C-C cross-coupling of aryl chlorides and inert arenes under UV light irradiation. The aryl radical upon homolytic cleavage of C-Cl bond initiated the nucleophilic substitution reaction with inert arenes to give biaryl products. This mild reaction mode can also be applied to other synthetic reactions, such as the construction of C-N bonds and trifluoromethylated compounds.
Duan, Xiaofeng F; Burggraf, Larry W; Huang, Lingyu
2013-07-22
To find low energy Si(n)C(n) structures out of hundreds to thousands of isomers we have developed a general method to search for stable isomeric structures that combines Stochastic Potential Surface Search and Pseudopotential Plane-Wave Density Functional Theory Car-Parinello Molecular Dynamics simulated annealing (PSPW-CPMD-SA). We enhanced the Sunders stochastic search method to generate random cluster structures used as seed structures for PSPW-CPMD-SA simulations. This method ensures that each SA simulation samples a different potential surface region to find the regional minimum structure. By iterations of this automated, parallel process on a high performance computer we located hundreds to more than a thousand stable isomers for each Si(n)C(n) cluster. Among these, five to 10 of the lowest energy isomers were further optimized using B3LYP/cc-pVTZ method. We applied this method to Si(n)C(n) (n = 4-12) clusters and found the lowest energy structures, most not previously reported. By analyzing the bonding patterns of low energy structures of each Si(n)C(n) cluster, we observed that carbon segregations tend to form condensed conjugated rings while Si connects to unsaturated bonds at the periphery of the carbon segregation as single atoms or clusters when n is small and when n is large a silicon network spans over the carbon segregation region.
STUDY ON POLYMRIZED C3N4 FILM BY DYAMICSCATALYTIC AGENT METHOD%动态催化聚合C3N4膜的研究
Institute of Scientific and Technical Information of China (English)
陈剑瑄; 刘仲阳; 张大忠; 孙官清; 罗伯诚
2001-01-01
The C3N4 film on Al2O3 formed by dynamic catalytic at low energy Ar+ ion sputtering C3H6N6 + Ni target. The ratio of nitroge atoms to carbon in the films is 4:3. C(ls) peakes for graphite, diamond and C≡N not have observed, above results are obtained by XPS. The main peak appears at 1275cm- 1 in the Raman spectrum. Resuits of SEM cant observed that sample is consist of cluter type crystal, but is no needle type. The colour is yellow but is no white. The experimental result indicated films consist of inorganic cavalent solid carbon nitride. The results from XRF observed sample contain Fe and Ni elements. It has been illustrated that Fe and Ni responsible for one C3N4 polymerization.
Synthesis and purification of /sup 14/C N-2-hydroxyethyl-N-nitrosourea
Energy Technology Data Exchange (ETDEWEB)
Perez, G.; Possagno, E.; Caponecchi, G.; Lilla, E.; Polcaro, C.
1986-04-01
/sup 14/C N-2-hydroxyethyl-N-nitrosourea was prepared at a specific activity of 30 mCi/mmol and 1.29 mCi/mmol by a two-step synthetic sequence using /sup 14/C ethanolamine as the labelled precursor. Its purification was performed by HPLC using a Lichrosorb-DIOL column eluted by ethyl ether. The overall radiochemical yield was 10%.
Czech Academy of Sciences Publication Activity Database
Chodounský, David; Zapletal, Jindřich
2015-01-01
Roč. 166, č. 11 (2015), s. 1123-1149 ISSN 0168-0072 R&D Projects: GA ČR(CZ) GF15-34700L Institutional support: RVO:67985840 Keywords : c.c.c. partitions * proper forcing * forcing axiom Subject RIV: BA - General Mathematics Impact factor: 0.582, year: 2015 http://www.sciencedirect.com/science/article/pii/S0168007215000664
A new superhard carbon allotrope: Orthorhombic C20
Wei, Qun; Zhao, Chenyang; Zhang, Meiguang; Yan, Haiyan; Zhou, Yingjiao; Yao, Ronghui
2018-06-01
A new superhard carbon orthorhombic allotrope oC20 is proposed, which exhibits distinct topologies including C4, C3 and two types of C6 carbon rings. The calculated elastic constants and phonon spectra reveal that oC20 is mechanically and dynamically stable at ambient pressure. The calculated electronic band structure of oC20 shows that it is an indirect band gap semiconductor with a band gap of 4.46 eV. The Vickers hardness of oC20 is 75 GPa. The calculated tensile and shear strength indicate that the weakest tensile strength is 64 GPa and the weakest shear strength is 48 GPa, which means oC20 is a potential superhard material.
DEFF Research Database (Denmark)
Rasmussen, Jim; Kusliene, Gedrime; Jacobsen, Ole Stig
2013-01-01
that 15N also had a heterogeneous distribution (up to two orders of magnitude). Conclusion Bicarbonate can efficiently be used to introduce 14C or 13C into plant via the leaf-labeling method. Both 14C and 15N showed heterogeneous distribution in the plant, although the distribution of 15N was more even......Aims: Application of carbon (C) and nitrogen (N) isotopes is an essential tool to study C and N flows in plant-soil-microorganisms systems. When targeting single plants in a community the tracers need to be added via e.g., leaf-labeling or stem-feeding approaches. In this study we: (i) investigated...... if bicarbonate can be used to introduce 14C (or 13C) into white clover and ryegrass, and (ii) compared the patterns of 14C and 15N allocation in white clover and ryegrass to evaluate the homogeneity of tracer distribution after two alternative labeling approaches. Methods Perennial ryegrass and white clover were...
International Nuclear Information System (INIS)
Artuso, M.; Boulahouache, C.; Blusk, S.; Butt, J.; Dorjkhaidav, O.; Menaa, N.; Mountain, R.; Muramatsu, H.; Nandakumar, R.; Randrianarivony, K.; Sia, R.; Skwarnicki, T.; Stone, S.; Wang, J.C.; Zhang, K.
2006-01-01
We report on tests of a novel ring imaging Cherenkov (RICH) detection system consisting of a 3-m-long gaseous C 4 F 8 O radiator, a focusing mirror, and a photon detector array based on Hamamatsu multi-anode photomultiplier tubes. This system was developed to identify charged particles in the momentum range from 3 to 70GeV/c for the BTeV experiment
Synthesis of (+-)-[1,1'-15N2, 2'-13C]-trans-3'-methylnicotine
International Nuclear Information System (INIS)
Sirimanne, S.R.; Maggio, V.L.; Patterson, D.G. Jr.
1992-01-01
The synthesis of (±)- [1,1'- 15 N 2 , 2'- 13 C]-trans-3'-methylnicotine is reported. 15 N-3-Bromopyridine obtained from bromination of pyridine was formylated with nBuLi/[carbonyl- 13 C]-methyl formate. The resulting 15 n-Pyridine-3-[ 13 C-carbonyl]-carboxaldehyde was reacted with 15 N-methylamine and then the resulting Schiff's base was condensed with succinic anhydride to give (±)- [1,1'- 15 N 2 , 5'- 13 C]-trans-4'-carboxycotinine. Reduction with lithium aluminum hydride and mesylation followed by reduction with Zn/NaI gave (±)-[1,1'- 15 N 2 , 2'- 13 C]-trans-3'-methylnicotine. (Author)
Mecanismo de corrosión a refractarios de MgO-C y MgO-C-Al en horno eléctrico
Directory of Open Access Journals (Sweden)
Guerrero Barranco, M.
2010-06-01
Full Text Available This article presents the results of a post-mortem study of various MgO-C and MgO-C-Al pieces that are used in the electric furnaces at the Acerinox factory in Cádiz. From the chemical, thermal, mineralogical and microstructural characterization of the materials prior to use and post-mortem it has been established that, in both types of refractories, the corrosion has lead to the formation of reaction layers with different chemical and mineralogical composition, as a function of temperature and oxygen partial pressure, ranging from the hot to the cold face and strongly depending on the zone of the electric furnace where the piece is situated. Changes in graphite content have been observed in both types of materials by X-ray diffraction. These changes have been quantified by Differential Thermal Analysis. In MgO-C-Al refractories it has been observed the formation of small amounts of C3Al4 inside the pieces and MgAl2O4 in the refractories’ hot face. Keeping in mind the obtained results and the phase equilibrium diagram of Mg-C-Al-O it has been established a corrosion mechanism for both types of materials. It cannot be established by the present results that additions of Al (≈ 2 % in weight improve the performance of MgO-C materials.
Se describen los resultados del estudio post-mortem de diversas piezas de MgO-C y MgO-C-Al utilizadas en los hornos eléctricos de la factoría de Acerinox en Cádiz. De la caracterización química, térmica, mineralógica y microestructural de los materiales sin usar y post-mortem se ha establecido que la corrosión ha dado lugar, en ambos tipos de refractarios, a la formación de capas de reacción con distinta composición química y mineralógica, en función de la temperatura y presión parcial de oxígeno en la pieza, que varían desde la cara caliente a la cara fría y dependen fuertemente de la zona del horno eléctrico en que está situada la pieza. En
The structure of C2b, a fragment of complement component C2 produced during C3 convertase formation
Energy Technology Data Exchange (ETDEWEB)
Krishnan, Vengadesan [Center for Biophysical Sciences and Engineering, School of Optometry, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Xu, Yuanyuan [Division of Clinical Immunology and Rheumatology, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Macon, Kevin [Center for Biophysical Sciences and Engineering, School of Optometry, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Volanakis, John E. [Department of Medicine, University of Alabama at Birmingham, Birmingham, AL 35294 (United States); Narayana, Sthanam V. L., E-mail: narayana@uab.edu [Center for Biophysical Sciences and Engineering, School of Optometry, University of Alabama at Birmingham, Birmingham, AL 35294 (United States)
2009-03-01
The crystal structure of C2b has been determined at 1.8 Å resolution, which reveals the arrangement of its three complement control protein (CCP) modules. A model for complement component C2 is presented and its conformational changes during the C3-convertase formation are also discussed. The second component of complement (C2) is a multi-domain serine protease that provides catalytic activity for the C3 and C5 convertases of the classical and lectin pathways of human complement. The formation of these convertases requires the Mg{sup 2+}-dependent binding of C2 to C4b and the subsequent cleavage of C2 by C1s or MASP2, respectively. The crystal structure of full-length C2 is not yet available, although the structure of its C-terminal catalytic segment C2a has been determined. The crystal structure of the N-terminal segment C2b of C2 determined to 1.8 Å resolution presented here reveals the arrangement of its three CCP domains. The domains are arranged differently compared with most other CCP-domain assemblies, but their arrangement is similar to that found in the Ba part of the full-length factor B structure. The crystal structures of C2a, C2b and full-length factor B are used to generate a model for C2 and a discussion of the domain association and possible interactions with C4b during formation of the C4b–C2 complex is presented. The results of this study also suggest that upon cleavage by C1s, C2a domains undergo conformational rotation while bound to C4b and the released C2b domains may remain folded together similar to as observed in the intact protein.
The structure of C2b, a fragment of complement component C2 produced during C3 convertase formation
International Nuclear Information System (INIS)
Krishnan, Vengadesan; Xu, Yuanyuan; Macon, Kevin; Volanakis, John E.; Narayana, Sthanam V. L.
2009-01-01
The crystal structure of C2b has been determined at 1.8 Å resolution, which reveals the arrangement of its three complement control protein (CCP) modules. A model for complement component C2 is presented and its conformational changes during the C3-convertase formation are also discussed. The second component of complement (C2) is a multi-domain serine protease that provides catalytic activity for the C3 and C5 convertases of the classical and lectin pathways of human complement. The formation of these convertases requires the Mg 2+ -dependent binding of C2 to C4b and the subsequent cleavage of C2 by C1s or MASP2, respectively. The crystal structure of full-length C2 is not yet available, although the structure of its C-terminal catalytic segment C2a has been determined. The crystal structure of the N-terminal segment C2b of C2 determined to 1.8 Å resolution presented here reveals the arrangement of its three CCP domains. The domains are arranged differently compared with most other CCP-domain assemblies, but their arrangement is similar to that found in the Ba part of the full-length factor B structure. The crystal structures of C2a, C2b and full-length factor B are used to generate a model for C2 and a discussion of the domain association and possible interactions with C4b during formation of the C4b–C2 complex is presented. The results of this study also suggest that upon cleavage by C1s, C2a domains undergo conformational rotation while bound to C4b and the released C2b domains may remain folded together similar to as observed in the intact protein
Directory of Open Access Journals (Sweden)
Mauricio Marín Montoya
2006-06-01
Full Text Available El género Ceratocystis sensu stricto incluye un alto número de hongos fitopatógenos de plantas angiospermas y gimnospermas en diversas regiones del mundo. Entre las principales enfermedades causadas por estos hongos se destacan los marchitamientos vasculares, manchado de maderas, chancros y pudriciones radiculares, de tallos y frutos. Muchas especies producen metabolitos volátiles con olores que atraen una amplia variedad de insectos a los tejidos vegetales infectados, sin embargo, el grado de asociación entre los insectos y las diferentes especies de Ceratocystis es altamente variable, presentandose asociaciones mutualistas tales como aquellas entre C. polonica, C. laricicola y C. rufipenni e insectos escolítidos, así como también relaciones no específicas como en los casos de C. paradoxa, C. fagacearum y C. fimbriata con nitidúlidos, moscas y diversos coleópteros. El alto grado de similitud morfológica encontrada entre estos hongos hace difícil la definición de los límites entre las especies de Ceratocystis. Durante la pasada década, la utilización de estudios filogenéticos basados en comparaciones de DNA ha contribuido sustancialmente a clarificar la taxonomía de este grupo de hongos, así por ejemplo, dichos estudios han permitido concluir que algunas especies de Ceratocystis realmente representan complejos de especies crípticas. Esta revisión tiene como objetivo principal proveer una introducción a los estudios experimentales desarrollados para las especies de Ceratocystis sensu stricto y brevemente discutir aspectos relacionados con los denominados hongos ophiostomatoides.The genus Ceratocystis sensu stricto Ellis & Halst. includes many economically important plant pathogens of both angiosperms and gymnosperms, worldwide. Diseases caused by these fungi include vascular wilts, sap stains on logs and lumber, stem cankers and rots of roots, stems and fruits. Most Ceratocystis species are well adapted to dispersal by
Synthesis and morphology evolution of GaN/C nanocables
International Nuclear Information System (INIS)
Du Xuefeng; Zhu Yingchun; Yang Tao; Shen Yue; Zeng Yi; Xu Fangfang
2009-01-01
GaN/C nanocables were synthesized via a thermochemical process. The GaN/C nanocables were composed of single crystalline GaN nanowire cores with a mean diameter of 80 nm and parallel carbon sheathes with a thickness of several nanometers. We find that GaN nanocables were partially evolved into waved GaN nanowires and discontinuously ordered nanodots within the carbon sheaths due to the decomposition of GaN at high temperature regions. Both the carbon sheathes and GaN nanowire cores show a high degree of crystalline perfection. This method may be applied to coat a wide range of nanostructures with carbon sheathes and prepare various hetrostructures, which may serve as potential building blocks in nanodevices.
Hu, Feng; Lalancette, Roger; Szostak, Michal
2016-04-11
Herein, we describe the first structural characterization of N-alkylated twisted amides prepared directly by N-alkylation of the corresponding non-planar lactams. This study provides the first experimental evidence that N-alkylation results in a dramatic increase of non-planarity around the amide N-C(O) bond. Moreover, we report a rare example of a molecular wire supported by the same amide C=O-Ag bonds. Reactivity studies demonstrate rapid nucleophilic addition to the N-C(O) moiety of N-alkylated amides, indicating the lack of n(N) to π*(C=O) conjugation. Most crucially, we demonstrate that N-alkylation activates the otherwise unreactive amide bond towards σ N-C cleavage by switchable coordination. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Trionfetti, C.; Agiral, A.; Gardeniers, Johannes G.E.; Lefferts, Leonardus; Seshan, Kulathuiyer
2008-01-01
Activating bonds: A cold plasma generated by dielectric barrier discharge in a microreactor converts alkanes (C1–C3) at atmospheric pressure. Large amounts of products with higher molecular weight than the starting hydrocarbons are observed showing that C-H activation at lower T favourably leads to
Herramienta Web Ligera para La Programación en C-Concurrente
Directory of Open Access Journals (Sweden)
Pablo Basanta-Val
2013-10-01
Full Text Available Resumen: El uso de herramientas a la hora de enseñar una determinada disciplina aporta múltiples beneficios desde el punto de vista de la actividad docente pues permite enfatizar o ilustrar determinados cuestiones que a veces resultan difíciles de enfatizar sin tal apoyo. Ese es también el caso de las herramientas que permiten detectar si ha habido algún tipo de problema en un programa escrito en C- concurrente. Dichas herramientas ofrecen interfaces que pueden complementar la información dada por un compilador con información adicional sobre diferentes tipos de condiciones de carrera o fugas de memoria que aparecen en el código. El presente trabajo tiene por objetivo ver cómo se ha integrado un núcleo de validación para C ya existente como aplicación web, lo que le permite estar accesible a través de la red. Dicha herramienta ha sido evaluada en un curso de programación ya existente, donde ha mostrado que es capaz aportar información adicional de utilidad para el discente y el docente. También se han realizado una serie de mediciones de rendimiento para establecer los límites operativos de la herramienta diseñada dentro de los límites de una asignatura donde se enseña C concurrente. Abstract: Tools for computer-aided teaching and learning provide multiple benefits from the point of view of teaching because it allows emphasizing or illustrating certain issues that are sometimes difficult to emphasize without such type of support. This is exactly the case for the tools to detect if there is any type of problem in a concurrent-C program. These tools provide interfaces that can complement the information given by a compiler with additional information about different types of race conditions and memory leaks that appear in the code. This article aims to address how to integrate a core validation tools for concurrent-C as a web application, allowing you to be accessible through the Internet. This tool has been evaluated in an
Physical properties of layered homologous RE-B-C(N) compounds
International Nuclear Information System (INIS)
Mori, Takao; Zhang Fuxiang; Leithe-Jasper, Andreas
2004-01-01
Physical properties of a series of homologous RE-B-C(N) B 12 cluster compounds REB 17 CN, REB 22 C 2 N, and REB 28.5 C 4 (RE=Er,Ho) were investigated. The structures of the compounds are layer-like along the c-axis, with rare earth and B 6 octahedral layers separated by B 12 icosahedral and C-B-C chain layers whose number increases successively from two B 12 layers for the REB 17 CN compound to four for the REB 28.5 C 4 compound. The rare earth atoms are configured in two triangular flat layers which are stacked on top of one another in AB stacking where the nearest-neighbor rare earth directions are the three atoms forming a triangle in the adjacent layer. The series of homologous compounds exhibit a spin glass transition with T f shifting in correspondence with variations of the basal plane lattice constants, consistent with the magnetic interaction being effective in the basal planes. The isothermal remanent magnetization shows a stretched exponential decay I m (t)∝ exp[-Ct -(1-n) ]. Exponents determined for the different homologous compounds were scaled as a function of T r =T/T f and found to follow the empirical dependency determined for typical spin glasses. It is indicated that a mixture of disorder originating from the partial occupancy of the rare earth sites and frustration of interactions due to the unique configuration is responsible for the manifestation of spin glass transitions in these homologous systems
4-Nitro-N-[(E-thiophen-2-ylmethylidene]aniline
Directory of Open Access Journals (Sweden)
Abdullah M. Asiri
2012-07-01
Full Text Available In the title compound, C11H8N2O2S, there is a twist in the molecule, with the dihedral angle between the five- and six-membered rings being 31.77 (9°. The nitro group is slightly twisted out of the plane of the benzene ring to which it is attached [O—N—C—C torsion angle = 9.0 (3°]. The S and N atoms are syn. In the crystal, supramolecular layers parallel to (-204 are formed by C—H...O and C—H...N interactions. These layers are connected into a three-dimensional architecture by π–π interactions occurring between centrosymmetrically related benzene rings [centroid–centroid distance = 3.6020 (11 Å].
International Nuclear Information System (INIS)
Lever, J.R.; Dannals, R.F.; Kinter, C.M.; Mathews, W.B.
1995-01-01
A delta opioid receptor antagonist, Nl'-methylnaltrindole (MeNTI), has been labeled with carbon-11. The precursor for radiolabeling was prepared in 71% yield by benzylation of the phenolic moiety of naltrindole. Alkylation of the indole nitrogen using [ 11 C]iodomethane and aqueous tetra(n-butyl)ammonium hydroxide at 80 o C in dimethylformamide followed by hydrogenolysis (H 2 , 10% Pd-C) of the benzyl protecting group gave [ 11 C]MeNTI. The average (n = 10) time for radiosynthesis, HPLC purification and formulation was 24 min from end-of-bombardment. [ 11 C]MeNTI of high radiochemical purity was obtained at end-of-synthesis with an average specific activity of 2050 mCi/μmol and radiochemical yield, based on [ 11 C]iodomethane, of 6%. (Author)
Indian Academy of Sciences (India)
J. Chem. Sci. Vol. 128, No. 7, July 2016, pp. 1037–1045. c Indian Academy of ..... Teraski O, Barry J C and Thomas J M 1987 Nature ... Betteridge P W, Carruthers J R, Cooper R I, Prout K and ... Clegg W and Watson D G 2007 Acta Cryst.
Energy Technology Data Exchange (ETDEWEB)
Yoder, Karmen K.; Hutchins, Gary D.; Mock, Bruce H.; Fei, Xiangshu; Winkle, Wendy L. [Department of Radiology, Indiana University School of Medicine, L3-208, Indianapolis, IN 46202 (United States); Gitter, Bruce D.; Territo, Paul R. [Lilly Center for Anatomical and Molecular Imaging, Integrative Biology Division, Lilly Research Laboratories, Greenfield, IN 46140 (United States); Zheng Qihuang [Department of Radiology, Indiana University School of Medicine, L3-208, Indianapolis, IN 46202 (United States)], E-mail: qzheng@iupui.edu
2009-01-15
Introduction: Positron emission tomography scanning with radiolabeled phenyltropane cocaine analogs is important for quantifying the in vivo density of monoamine transporters, including the dopamine transporter (DAT). [{sup 11}C]{beta}-CFT is useful for studying DAT as a marker of dopaminergic innervation in animal models of psychiatric and neurological disorders. [{sup 11}C]{beta}-CFT is commonly labeled at the N-methyl position. However, labeling of [{sup 11}C]{beta}-CFT at the O-methyl position is a simpler procedure and results in a shorter synthesis time [desirable in small-animal studies, where specific activity (SA) is crucial]. In this study, we sought to validate that the O-methylated form of [{sup 11}C]{beta}-CFT provides equivalent quantitative results to that of the more commonly reported N-methyl form. Methods: Four female Sprague-Dawley rats were scanned twice on the IndyPET II small-animal scanner, once with [N-methyl-{sup 11}C]{beta}-CFT and once with [O-methyl-{sup 11}C]{beta}-CFT. DAT binding potentials (BP{identical_to}B'{sub avail}/K{sub d}) were estimated for right and left striata with a nonlinear least-squares algorithm, using a reference region (cerebellum) as the input function. Results: [N-Methyl-{sup 11}C]{beta}-CFT and [O-methyl-{sup 11}C]{beta}-CFT were synthesized with 40-50% radiochemical yields (HPLC purification). Radiochemical purity was >99%. SA at end of bombardment was 258{+-}30 GBq/{mu}mol. Average BP values for right and left striata with [N-methyl-{sup 11}C]{beta}-CFT were 1.16{+-}0.08 and 1.23{+-}0.14, respectively. BP values for [O-methyl-{sup 11}C]{beta}-CFT were 1.18{+-}0.08 (right) and 1.22{+-}0.16 (left). Paired t tests demonstrated that labeling position did not affect striatal DAT BP. Conclusions: These results suggest that [O-methyl-{sup 11}C]{beta}-CFT is quantitatively equivalent to [N-methyl-{sup 11}C]{beta}-CFT in the rat striatum.
Crystallization behavior and controlling mechanism of iron-containing Si-C-N ceramics.
Francis, Adel; Ionescu, Emanuel; Fasel, Claudia; Riedel, Ralf
2009-11-02
The crystallization behavior and controlling mechanism of the Si-Fe-C-N system based on polymer-derived SiCN ceramic filled with iron metal powder has been studied. The composite preparation conditions allow the formation of a random distribution of metallic particles in the polymer matrix volume for the Si-C-N system. Pyrolysis of the composite material at 1100 degrees C indicates the presence of one crystalline phase Fe(3)Si. While the sample pyrolyzed at 1200 degrees C reveals the formation of both Fe(3)Si and Fe(5)Si(3) phases, a crystallization of beta-SiC is additionally observed by increasing the temperature up to 1300 degrees C. The propensity for the formation of SiC is due to the presence of Fe(5)Si(3), where a solid-liquid-solid (SLS) growth mechanism was suggested to occur. X-ray diffraction (XRD), scanning electron microscopy (SEM), differential thermal analysis (DTA), and thermal gravimetric analysis with mass spectroscopic detection (TGA-MS) were employed to investigate the crystallization behavior of the Si-Fe-C-N system.
Fabrication of AlN-TiC/Al composites by gas injection processing
Institute of Scientific and Technical Information of China (English)
YU Huashun; CHEN Hongmei; MA Rendian; MIN Guanghui
2006-01-01
The fabrication of AlN-TiC/Al composites by carbon-and nitrogen-containing gas injection into Al-Mg-Ti melts was studied. It was shown that AlN and TiC particles could be formed by the in situ reaction of mixture gas (N2+C2H2+NH3) with Al-Mg-Ti melts. The condition for the formation of AlN was that the treatment temperature must be higher than 1373 K, and the amounts of AlN and TiC increased with the increase of the treatment temperature and the gas injection time.It was considered that AlN was formed by the direct reaction of Al with nitrogen-containing gas at the interface of the gas bubble and the melt. However, the mechanism of TiC formation is a combination mechanism of solution-precipitation and solid-liquid reaction.
Dicty_cDB: Contig-U04444-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 5004 ) sat05c04.y1 Gm-c1036 Glycine max cDNA clone SOYBE... 52 0.025 1 ( BU894001 ) P085G03 Populus petioles cDNA library Popul...s cDNA, RIKEN full-l... 52 0.025 1 ( CF870513 ) tric023xm17.b1 T.reesei mycelial culture, Versio...n... 52 0.025 1 ( CF869757 ) tric020xf11.b1 T.reesei mycelial culture, Version... 52 0.025 1 ( CF867854 ) tric012xm19.b1 T.re...esei mycelial culture, Version... 52 0.025 1 ( CF867232 ) tric010xg18.b1 T.re...esei mycelial culture, Version 3 ... 52 0.025 1 ( CB899903 ) tric020xf11 T.reesei mycelial culture
Changes in organic matter (C, N and P) of soils under subsistence agriculture
International Nuclear Information System (INIS)
Fraga, Vania da Silva
2002-10-01
Productivities under low input or subsistence agriculture are strongly dependent on nutrient supply from soil organic matter mineralization (SOM). Few results are available and they indicate declines in soil fertility under this agricultural system, particularly in SOM levels. In an attempt to understand the nature and extent of these declines we selected ten sites having cultivated areas adjacent with areas under native vegetation at the same slope position, in the states of Pernambuco and Paraiba. Based on the management history, in situ observations and 137 Cs concentrations to evaluate soil erosion, the areas were divided in four groups having different levels of soil use intensity: Undisturbed Dry Forest (UDF), Disturbed Dry Forest (DDF), Preserved-Cultivated (PC) and Degraded-Cultivated (DC). In the first part of this work we quantified total organic C, N and P, in addition to 137 Cs concentrations, under the assumption that changes in organic nutrient contents among land use groups would be greater than the within group variability, thus enabling inferences at a regional scale. Concentrations of C and N in DC were 50% smaller (P -3 ) (C-lf); C-CO 2 produced during three days of incubation (C-min3d); C oxidized with 333 mM (C-ox 333) and 16,5 mM (C-ox16) KMnO 4 . The only fraction that did not correlate with total C was C-fl. Average proportions of total C extracted by C-mins3d, C-ox 16 were 1.5%, 24% and 7.2 %, respectively. In the second phase, the whole sample set (n=160) was analyzed for C-ox16. This C fraction decreased from 1.65 g kg -1 under UDF to 0.70 in DC (P -1 , in a pot experiment. Total C correlated significantly with N mineralized in 60 d (N-min60d) (r=0.79***) while N-min60 and P-Mehlich-1 explained 80% of the variation in dry matter production by buffel grass (Cenchrus ciliaris). Low P availability, C and N losses, limited water availability and sometimes-inappropriate land management techniques, are considered strong limiting conditions for
Synthesis of phenobarbital 14C - 5 (1964)
International Nuclear Information System (INIS)
Benakis, A.
1964-01-01
Phenobarbital (Luminal), well known as a hypnotic agent, plays also an important role in the medical treatment of epilepsy. With the object of studying the metabolism of this medicament in the living system, the synthesis of phenobarbital marked in position 2 of the pyrimidinic ring has been effected. It has been necessary, in order to carry out to research into the metabolism of this product, to have a phenobarbital marked in position 5 of the pyrimidinic ring. This synthesis, making it possible to introduce C-14 into position 5 of the pyrimidinic ring, consists of seven stages starting from C-14 carboxyl benzoic acid having a specific activity of 25 mc/mM. The melting point of the final product is 172 - 173 deg. C and its specific activity is 11.15 mc/mM. The overall radioactive yield of the pure product, with respect to the original benzoic acid (10 mM) is of the order of 3 per cent. The purity of the product has been controlled by paper chromatography; it is of the order of 99 per cent. (author) [fr
Millimetre-wave spectrum of anti-13C1 and 13C2 isotopologues of ethanol
International Nuclear Information System (INIS)
Bouchez, Aurelia; Walters, Adam; Müller, Holger S.P.; Ordu, Matthias; Lewen, Frank; Koerber, Monika; Bottinelli, Sandrine; Endres, Christian P.; Schlemmer, Stephan
2012-01-01
The rotational spectra of the two monosubstituted 13 C isotopologues of the anti conformer of ethanol have been measured between 80-800 GHz using three different spectrometers at the Cologne Laboratory Astrophysics group. The dataset was constrained for fitting with a standard Watson-S reduction Hamiltonian by rejecting transitions from high-lying states showing significant perturbation with the gauche states and by averaging some small methyl torsional splits. This treatment is compatible with the needs for a first astrophysical research for which an appropriate set of predictions is given.
Lifescience Database Archive (English)
Full Text Available yslnvqldpivyqvkakepststf*vlkksfqilklts*pkvkkf hsqfh*nhtlihhllmmvihtiqlafhfkdsiemn...ivyqvkakepststf*vlkksfqilklts*pkvkkf hsqfh*nhtlihhllmmvihtiqlafhfkdsiemn Frame C: neknniifnsttciiiw*n*itfiye
Ecosystem Controls on C & N Sequestration Following Afforestation of Agricultural Lands
Energy Technology Data Exchange (ETDEWEB)
E.A. Paul, S.J. Morris, R.T. Conant
2013-03-05
In our project, we proposed to continue analysis of our available soil samples and data, and to develop new studies to answer the following objectives: Objective 1) Broaden field based studies of ecosystem C and N compartments to enhance current understanding of C and N sequestration and dynamics. Objective 2) Improve our understanding of mechanism controlling C and N stabilization and dynamics. Objective 3) Investigate the interrelated role of soil temperature and organism type and activity as controlling mechanism in SOC dynamics and sequestration.
International Nuclear Information System (INIS)
Boeddinghaus, M. Bele; Klein, Wilhelm; Wahl, Bernhard; Faessler, Thomas F.; Jakes, Peter; Eichel, Ruediger A.
2014-01-01
Five new compounds, [Rb(18crown-6)]_3[C_6_0] (1), [Rb(18crown-6)]_6[C_6_0]_2(C_3H_7NO)_2(C_4H_8O)_2 (2), [Rb(benzo18crown-6)]_6[C_6_0]_2(C_2H_8N_2)_5 (3), [Cs(benzo18crown-6)]_3C_6_0(C_2H_8N_2)_2 (4), and [Cs_3(benzo18crown-6)_5]C_6_0(C_2H_8N_2)_(_4_._5_+_x_) (5) were synthesized and characterized by single-crystal X-ray structure determination. All compounds contain discrete C_6_0 anions, which are ordered in 1, 2, and 4, where direct cation-anion contacts occur. The unit cells of 1 and 2 contain two independent fullerides, which coordinate to the rubidium atoms either of two or of four [Rb(18crown-6)] units. Owing to the presence of differently coordinated fullerene units in compounds 1 and 2, a possible disproportionation of C_6_0"3"- into C_6_0"2"- and C_6_0"4"- anions is discussed. In 3 and 4 the C_6_0 anions are coordinated by three Rb and Cs atoms, respectively. In all compounds the average charge of the anion is -3. Magnetic data reveal a doublet spin state for 3. The EPR spectra are discussed for compounds 3 and 5. The role of a dynamic Jahn-Teller distortion is discussed, and we report the first IR spectroscopic data of fullerene trianions, which have been obtained in solution. (Copyright copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
N,N′-Bis(4-aminobenzyloxalamide
Directory of Open Access Journals (Sweden)
Juan Saulo Gonzalez-Gonzalez
2011-02-01
Full Text Available In the title compound, C16H18N4O2, the two carbonyl groups are in an antiperiplanar conformation with an O=C—C=O torsion angle of 173.86 (17°. In the crystal, a pair of intermolecular N—H...O hydrogen bonds, forming an R22(10 ring motif, connect the molecules into an inversion dimer. The dimers are further linked by N—H...N and C—H...π interactions, forming a zigzag chain along the b axis.
Joining of SiC ceramics and SiC/SiC composites
Energy Technology Data Exchange (ETDEWEB)
Rabin, B.H. [Idaho National Engineering Lab., Idaho Falls, ID (United States)
1996-08-01
This project has successfully developed a practical and reliable method for fabricating SiC ceramic-ceramic joints. This joining method will permit the use of SiC-based ceramics in a variety of elevated temperature fossil energy applications. The technique is based on a reaction bonding approach that provides joint interlayers compatible with SiC, and excellent joint mechanical properties at temperatures exceeding 1000{degrees}C. Recent emphasis has been given to technology transfer activities, and several collaborative research efforts are in progress. Investigations are focusing on applying the joining method to sintered {alpha}-SiC and fiber-reinforced SiC/SiC composites for use in applications such as heat exchangers, radiant burners and gas turbine components.
Synthesis of some 11C-labelled alkaloids
International Nuclear Information System (INIS)
Laangstroem, B.; Antoni, G.; Halldin, H.; Svaerd, H.; Bergson, G.
1982-01-01
Using ( 11 C)-methyl iodide in N-alkylation reactions in dimethylformamide (DMF), the alkaloids N-( 11 C-methyl)-morphine, N-( 11 C-methyl)-codeine, 6-N(methyl)-9, 10-dihydroergotamine, 6-N-( 11 C-methyl)-bromocriptine and N-( 11 C-methyl)-nicotine have been synthesized in radiochemical yields of 50-95%, within 5-10 min of introducing ( 11 C)-methyl iodide into the reaction vial. ( 11 C)-Methyl iodide was obtained within 4-7 min from ( 11 C)-carbon dioxide prepared by the 14 N(p,α) 11 C reaction. (Authors)
Dicty_cDB: Contig-U00762-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available s nodule library 5 and... 42 0.012 2 ( BI417355 ) LjNEST38c2r Lotus japonicus nodule library...KT7B.103O19F.060124T7 KT7 Nicotiana tabacum cDNA ... 36 0.012 2 ( CK417989 ) AUF_IpInt_57_n24 Intestine cDNA library Ictalur...3' end. 42 0.012 2 ( FG637668 ) TT-33_B14 Samsun trichome library Nicotiana tabac... 36 0.012 2 ( CX557480 ) yda37e04.y2 Sea ur...( CX552206 ) ydb21c02.y2 Sea urchin EST Lib1 Strongylocentrotu... 42 9e-04 2 ( DN149991 ) 5218_B03_C06 Switchgrass callus cDNA librar...10F Mouse 10kb plasmid UUGC1M library Mus ... 42 0.003 2 ( BQ858872 ) QGC11H15.yg.ab1 QG_ABCDI lettuce salinas Lactu
Ruiz, Lino
2016-01-01
En la edición anterior nuestro principal énfasis fue el de presentar el control numérico computarizado (C.N.C.) como una alternativa tecnológica que pueda potenciar nuestro desarrollo industrial, por lo que describimos sus características principales y su incidencia en el trabajador. En el presente articulo nos enfocaremos, más al manejo de la información en las máquinas CNC, las tendencias actuales del desarrollo de las MHCNC y las tendencias industriales de nuestra época.
STM topographical images of C60
International Nuclear Information System (INIS)
Wang, Z.; Zhang, P.; Moskovits, M.
1991-01-01
In this paper STM topographical images of C 60 are reported. The images are consistent with a molecule approximately 9 Angstrom in diameter possessing the now-famous soccer ball structure. With the molecule deposited on gold, its atomic structure is not resolved. On graphite the structure of the within the borders of the C 60 molecule is dominated by that of the graphite forming a moire-like pattern. Some evidence of atomic structure is seen in multilayers of C 60 where some five- and six-membered rings are visible. These may, however, be features of fragments of the fullerene rather than whole molecules
International Nuclear Information System (INIS)
Cui Yanhong; Tian, Wei Quan; Feng Jikang; Chen Deli
2010-01-01
Among all the 4478 classical isomers of C 66 , C 66 (C s :0060) with the lowest number of pentagon-pentagon fusions was predicted to be the most stable isomer, followed by isomers C 66 (C 2v :0011) and C 66 (C 2 :0083). The infrared spectra and aromaticity of the most stable isomers were predicted. The relative stabilities of C 66 isomers change with charges or doping of metals. The structures and relative stabilities of the most stable metallofullerenes were delineated and compared with experiment. Sc 2 -C 66 (C 2 :0083) was predicted to be the most stable metallofullerene, although Sc 2 -C 66 (C 2v :0011) was observed. Charge-transfer from Sc 2 to the fused pentagons and the bonding between these two moieties significantly decrease the strain energies caused by the pair of fused pentagons thereby stabilizing the fullerene cage.
Energy Technology Data Exchange (ETDEWEB)
Azam, F.; Haider, K.; Malik, K.A.
1985-01-01
Uniformly /sup 14/C labeled glucose, cellulose and wheat straw and specifically /sup 14/C labeled lignin component in corn stalks were aerobically incubated for 12 weeks in a chernozem soil along with /sup 15/N labeled ammonium sulfate. Glucose was most readily decomposed, followed in order by cellulose, wheat straw and corn stalk lignins labeled at methoxyl-, side chain 2- and ring-C. More than 50% of /sup 14/C applied as glucose, cellulose and wheat straw evolved as CO/sub 2/ during the first week. Lignin however, decomposed relatively slowly. A higher proportion of /sup 14/C was transformed into microbial biomass whereas lignins contributed a little to this fraction. After 12 weeks of incubation nearly 60% of the lignin /sup 14/C was found in humic compounds of which more than 70% was resistant to hydrolysis with 6N HCl. Maximum incorporation of /sup 15/N in humic compounds was observed in cellulose amended soil. However, in this case more than 80% of the /sup 15/N was in hydrolysable forms. Immobilization-remineralization of applied /sup 15/N was most rapid in glucose treated soil and a complete immobilization followed by remineralization was observed after 3 days. The process was much slow in soil treated with cellulose, wheat straw or corn stalks. More than 70% of the newly immobilized N was in hydrolysable forms mainly representing the microbial component. Serial hydrolysis of soil at different incubation intervals showed a greater proportion of 6N HCl hydrolysable /sup 14/C and /sup 15/N in fractions representing microbial material. /sup 14/C from lignin carbons was relatively more uniformly distributed in different fractions as compared to glucose, cellulose and wheat straw where a major portion of /sup 14/C was in easily hydrolysable fractions. 25 refs., 3 figs., 4 tabs.
A review on g-C{sub 3}N{sub 4}-based photocatalysts
Energy Technology Data Exchange (ETDEWEB)
Wen, Jiuqing; Xie, Jun [College of Materials and Energy, Key Laboratory of Energy Plants Resource and Utilization, Ministry of Agriculture, Key Laboratory of Biomass Energy of Guangdong Regular Higher Education Institutions, South China Agricultural University, Guangzhou, 510642 (China); Chen, Xiaobo, E-mail: chenxiaobo@umkc.edu [Department of Chemistry, University of Missouri – Kansas City, Kansas City, MO, 64110 (United States); Li, Xin, E-mail: Xinliscau@yahoo.com [College of Materials and Energy, Key Laboratory of Energy Plants Resource and Utilization, Ministry of Agriculture, Key Laboratory of Biomass Energy of Guangdong Regular Higher Education Institutions, South China Agricultural University, Guangzhou, 510642 (China)
2017-01-01
Graphical abstract: The photocatalytic fundamentals, versatile properties, design strategies and potential applications of g-C{sub 3}N{sub 4}-based photocatalysts were systematically summarized and addressed. - Highlights: • The photocatalytic fundamentals of g-C{sub 3}N{sub 4} were systematically summarized. • The versatile properties of g-C{sub 3}N{sub 4} photocatalysts were highlighted. • The different design strategies of g-C{sub 3}N{sub 4} photocatalysts were reviewed. • The important photocatalytic applications of g-C{sub 3}N{sub 4} were also addressed. - Abstract: As one of the most appealing and attractive technologies, heterogeneous photocatalysis has been utilized to directly harvest, convert and store renewable solar energy for producing sustainable and green solar fuels and a broad range of environmental applications. Due to their unique physicochemical, optical and electrical properties, a wide variety of g-C{sub 3}N{sub 4}-based photocatalysts have been designed to drive various reduction and oxidation reactions under light irradiation with suitable wavelengths. In this review, we have systematically summarized the photocatalytic fundamentals of g-C{sub 3}N{sub 4}-based photocatalysts, including fundamental mechanism of heterogeneous photocatalysis, advantages, challenges and the design considerations of g-C{sub 3}N{sub 4}-based photocatalysts. The versatile properties of g-C{sub 3}N{sub 4}-based photocatalysts are highlighted, including their crystal structural, surface phisicochemical, stability, optical, adsorption, electrochemical, photoelectrochemical and electronic properties. Various design strategies are also thoroughly reviewed, including band-gap engineering, defect control, dimensionality tuning, pore texture tailoring, surface sensitization, heterojunction construction, co-catalyst and nanocarbon loading. Many important applications are also addressed, such as photocatalytic water splitting (H{sub 2} evolution and overall water
Oxidation protection of multilayer CVD SiC/B/SiC coatings for 3D C/SiC composite
International Nuclear Information System (INIS)
Liu Yongsheng; Cheng Laifei; Zhang Litong; Wu Shoujun; Li Duo; Xu Yongdong
2007-01-01
A CVD boron coating was introduced between two CVD SiC coating layers. EDS and XRD results showed that the CVD B coating was a boron crystal without other impurity elements. SEM results indicated that the CVD B coating was a flake-like or column-like crystal with a compact cross-section. The crack width in the CVD SiC coating deposited on CVD B is smaller than that in a CVD SiC coating deposited on CVD SiC coating. After oxidation at 700 deg. C and 1000 deg. C, XRD results indicated that the coating was covered by product B 2 O 3 or B 2 O 3 .xSiO 2 film. The cracks were sealed as observed by SEM. There was a large amount of flake-like material on hybrid coating surface after oxidation at 1300 deg. C. Oxidation weight loss and residual flexural strength results showed that hybrid SiC/B/SiC multilayer coating provided better oxidation protection for C/SiC composite than a three layer CVD SiC coating at temperatures from 700 deg. C to 1000 deg. C for 600 min, but worse oxidation protection above 1000 deg. C due to the large amount of volatilization of B 2 O 3 or B 2 O 3 .xSiO 2
A comparative study of the progression of radiation pulmonary injury in C57BL/6J and C3H/HeN mice
International Nuclear Information System (INIS)
Liu Ying; Li Yang; Peng Ruiyun; Wang Shuming; Gao Yabing; Ma Junjie; Song Liangwen
2007-01-01
Objective: To compare the course of radiation pulmonary injury in C57BL/6J and C3H/HeN mice. Methods: C57BL/6J and C3H/HeN mice irradiated with 20 Gy 60 Co gamma rays were used as animal models. Sirius red staining and hydroxyproline measurement were used to detect the distribution of type I and III collagens and the content of pulmonary hydroxyproline. Immunohistochemistry was used to observe the changes of the expressions of fibronectin (FN) and laminin (LN) and alpha-smooth muscle actin (α-SMA) in the lung. Results: The changes in the lungs in C57BL/6J mice were as follows: the pathological changes undergone interstitial pneumonia, proliferation and fibrosis; significant increase of collagen deposition; FN increased rapidly to a significantly higher level at 1 and 3 months after irradiation than that in the control (P<0.01), and then decreased gradually to a normal level at 6 month after irradiation; LN elevated gradually after irradiation; the expressions of α-SMA were more intense than that in C3H/HeN mice. The changes in the lungs in C3H/HeN mice were as follows: the pathological changes mainly developed institial pneumonitis; no significant changes of FN expression was observed after irradiation compared to that in the control; LN increased significantly at 1 and 3 months after irradiation, and then decreased gradually. Conclusions: The models of radiation pulmonary fibrosis-sensitive and-resistant were established by irradiation with gamma rays, C57BL/6J mice developed late radiation pulmonary fibrosis, and were characterized by the significant accumulation of collagen. C3H/HeN mice did not develop radiation pulmonary fibrosis. (authors)
Measurement of one-bond 15N-13C' dipolar couplings in medium sized proteins
International Nuclear Information System (INIS)
Chou, James J.; Delaglio, Frank; Bax, Ad
2000-01-01
A simple and accurate method is described for measurement of 1 J C'N splittings in isotopically enriched proteins. The method is of the quantitative J correlation type, and the 1 J C'N splitting is derived from the relative intensity in two 3D TROSY-HNCO spectra with 1 J C'N dephasing intervals of ∼1/(2 1 J C'N ) (reference intensity) and ∼1/ 1 J C'N (residual intensity). If the two spectra are recorded under identical conditions and with the same number of scans, the random error in the 1 J C'N value extracted in this manner is inversely related to the signal-to-noise (S/N) in the reference spectrum. A S/N of 30:1 in the reference spectrum yields random errors of less than 0.2 Hz in the extracted 1 J C'N value. Dipolar couplings obtained from the difference in 1 J C'N splitting in the isotropic and liquid crystalline phase for the C-terminal domain of calmodulin are in excellent agreement with its 1.68-A crystal structure, but agree considerably less with the 2.2-A structure
Lifescience Database Archive (English)
Full Text Available g significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 5...e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsi...n; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA
Energy Technology Data Exchange (ETDEWEB)
Pejov, Ljupco [Institute of Chemistry, Department of Physical Chemistry, SS. Cyril and Methodius University, Arhimedova 5, P.O. Box 162, 1000 Skopje(Macedonia, The Former Yugoslav Republic of)], E-mail: ljupcop@iunona.pmf.ukim.edu.mk; La Rosa, Manuela [PST Group- M6, STMicroelectronics, Stradale Primosole 50, 95121 Catania (Italy); Kocarev, Ljupco [Institute for Nonlinear Science, University of California, San Diego 9500 Gilman, Drive, La Jolla, CA 92093-0402 (United States); Macedonian Academy of Sciences and Arts, bul. Krste Misirkov 2, P.O. Box 428, 1000 Skopje (Macedonia, The Former Yugoslav Republic of)
2007-11-09
The dynamics of intramolecular torsional motion of central phenylene ring in a series of phenylene ethynylene oligomer derivatives was investigated. On the basis of calculated hindered rotational potentials corresponding to this motion, the torsional energy levels were obtained by solving the torsional Schroedinger equation. Subsequently, the torsional correlation time and transition probability was computed within the Bloembergen-Purcell-Pound (BPP) formalism, considering both the classical and quantum mechanical tunneling contributions to the intramolecular rotation. The results were interpreted in the context of molecular conductivity switching behavior of the considered series of compounds. Also some other parameters relevant to molecular admittance were calculated, such as the HOMO-LUMO energy difference and the spatial extent of the frontier molecular orbitals. Classical electrostatic arguments were applied to understand the physical basis of the conformational stability differences in the studied compounds. It was found that halogenation of the central phenylene ring may be used for fine-tuning of molecular conduction behavior, in the sense of modulating the HOMO-LUMO energy difference, the spatial extent of frontier MOs, as well as the barrier height to torsional motion of the central phenylene ring. The time scale of the temperature induced stochastic conformational switching between the 'on' and 'off' states, along with the corresponding transition probability could be varied by an order of magnitude upon halogenation of the central phenylene ring. The tunneling contributions to the torsional correlation time were found to be of minor importance in this context, and this quantity may be quite correctly estimated with the classical BPP approach.
International Nuclear Information System (INIS)
Pejov, Ljupco; La Rosa, Manuela; Kocarev, Ljupco
2007-01-01
The dynamics of intramolecular torsional motion of central phenylene ring in a series of phenylene ethynylene oligomer derivatives was investigated. On the basis of calculated hindered rotational potentials corresponding to this motion, the torsional energy levels were obtained by solving the torsional Schroedinger equation. Subsequently, the torsional correlation time and transition probability was computed within the Bloembergen-Purcell-Pound (BPP) formalism, considering both the classical and quantum mechanical tunneling contributions to the intramolecular rotation. The results were interpreted in the context of molecular conductivity switching behavior of the considered series of compounds. Also some other parameters relevant to molecular admittance were calculated, such as the HOMO-LUMO energy difference and the spatial extent of the frontier molecular orbitals. Classical electrostatic arguments were applied to understand the physical basis of the conformational stability differences in the studied compounds. It was found that halogenation of the central phenylene ring may be used for fine-tuning of molecular conduction behavior, in the sense of modulating the HOMO-LUMO energy difference, the spatial extent of frontier MOs, as well as the barrier height to torsional motion of the central phenylene ring. The time scale of the temperature induced stochastic conformational switching between the 'on' and 'off' states, along with the corresponding transition probability could be varied by an order of magnitude upon halogenation of the central phenylene ring. The tunneling contributions to the torsional correlation time were found to be of minor importance in this context, and this quantity may be quite correctly estimated with the classical BPP approach
Energy Technology Data Exchange (ETDEWEB)
Haeberlen, Maik
2006-12-15
In this work, large area epitaxial 3C-SiC films on Si(100) and Si(111) were formed by ion beam synthesis and subsequently characterized for their structural and crystalline properties. These SiC/Si structures are meant to be used as SiC pseudosubstrates for the homo- and heteroepitaxial growth of other compound semiconductors. The suitability of these pseudosubstrates for this purpose was tested using various epitaxial systems and thin film growth methods. For this the homoepitaxial growth of 3C-SiC employing C{sub 60}-MBE and the heteroepitaxial growth of hexagonal GaN films grown by MOCVD and IBAMBA was studied in detail. The comparison of the structural and crystalline properties with data from literature enabled a qualified judgement of the potential of the 3C-SiC pseudosubstrates as an alternative substrate for the epitaxial growth of such films. These new 3C-SiC pseudosubstrates also enabled studies of other little known epitaxial systems: For the first time hexagonal ZnO films on (111) oriented pseudosubstrates were grown using PLD. The method if IBAMBE enabled the growth of cubic GaN layers on (100)-oriented pseudosubstrates. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Molera, J M; Gamboa, J M; Val del Cob, M; Ortin, N
1964-07-01
The rearrangement of N-n-propyl aniline to p-amino propylbenzene has been studied at 250 degree centigrade using several catalysts: CoCl{sub 2}, ZnCl{sub 2} and HBr. N-propyl-1-14{sup C}-aniline has been synthesized from sodium propionate-1-14{sup C} through conversion to n-propyl-1-14{sup C}-iodide and further reaction with aniline. After the rearrangement and among the reaction products both p-aminopropylbenzene and p-aminoisopropylbencene were found. To determine the 14{sup C} position in both the starting aniline and reaction products two degradation schemes are followed. In the light of experimental evidence a mechanism is set forth based on the assumption of an organic cation as intermediate. (Author) 13 refs.
N-terminally truncated POM121C inhibits HIV-1 replication.
Directory of Open Access Journals (Sweden)
Hideki Saito
Full Text Available Recent studies have identified host cell factors that regulate early stages of HIV-1 infection including viral cDNA synthesis and orientation of the HIV-1 capsid (CA core toward the nuclear envelope, but it remains unclear how viral DNA is imported through the nuclear pore and guided to the host chromosomal DNA. Here, we demonstrate that N-terminally truncated POM121C, a component of the nuclear pore complex, blocks HIV-1 infection. This truncated protein is predominantly localized in the cytoplasm, does not bind to CA, does not affect viral cDNA synthesis, reduces the formation of 2-LTR and diminished the amount of integrated proviral DNA. Studies with an HIV-1-murine leukemia virus (MLV chimeric virus carrying the MLV-derived Gag revealed that Gag is a determinant of this inhibition. Intriguingly, mutational studies have revealed that the blockade by N-terminally-truncated POM121C is closely linked to its binding to importin-β/karyopherin subunit beta 1 (KPNB1. These results indicate that N-terminally-truncated POM121C inhibits HIV-1 infection after completion of reverse transcription and before integration, and suggest an important role for KPNB1 in HIV-1 replication.
The 12C/13C Isotopic Ratio in Planetary Nebulae as Deduced from IUE Data
Miskey, C. L.; Feibelman, W. A.; Bruhweiler, F. C.
2000-05-01
The relative abundances of C, N, and O and the isotopic ratio of 12C/13C represent tracers of nucleosynthesis in intermediate stars with main-sequence masses between 0.6 and 8.0 solar masses in our Galaxy. Determining these abundances and the isotopic 12C/13C ratio in planetary nebulae (PNe) represent perhaps the best means to discern exactly how the ISM is enriched by CNO stellar nucleosynthesis. Walsh et al. (1996) and Clegg et al. (1997), using the Hubble Space Telescope, have derived the isotopic 12C/13C abundance ratio in the galactic carbon-rich PN, NGC 3918, and placed marginal constraints on it for the Magellanic PNe, N2 (SMC) and N122 (LMC). This was done using the well-known 12C 3P-1S (J=1-0 and J=2-0) transitions of C+2 at 1906.68 Angstroms and 1908.77 Angstroms and a J=0-0 transition at 1909.6 Angstroms, which is strictly forbidden in 12C. The finite nuclear spin of 13C (I=1/2) permits a corresponding F=1/2-1/2 electric dipole transition not seen in 12C. Since the 1909.6 Angstroms line is well separated from the other two 12C transitions, it provides an important means of determining 12C/13C in planetary nebulae. We have just completed a search of archival International Ultraviolet Explorer (IUE) high-dispersion spectra of approximately three dozen PNe, and derived 12C/13C ratios of 39 and 23 for the galactic PNe, NGC 2440 and NGC 6302, respectively. These are values much lower than the solar value of 89. In the other objects, the limited S/N of the IUE data indicate 12C/13C ratio upper limits much higher than 50. The implications of these results and their pertinence to stellar evolution are discussed.
Tamm, Nadezhda B; Brotsman, Victor A; Markov, Vitaliy Yu; Kemnitz, Erhard; Troyanov, Sergey I
2018-05-22
High-temperature chlorination of an Isolated-Pentagon Rule (IPR) D2-C76 fullerene followed by high-temperature trifluoromethylation of non-IPR C76 chlorides with CF3I unexpectedly resulted in a series of non-IPR C76(CF3)nFm compounds. X-ray diffraction study with the use of synchrotron radiation revealed the mixed CF3/F structures of non-classical, non-IPR C76(CF3)14, C76(CF3)14F2, and C76(CF3)16F6.
DEFF Research Database (Denmark)
Palarasah, Yaseelan; Skjodt, Karsten; Brandt, Jette
2010-01-01
complex (C5b-C9) and quantification of complement split products by precipitation-in-gel techniques (e.g. C3d). We have developed a mouse monoclonal antibody (mAb) that is able to detect fluid phase C3c without interference from other products generated from the complement component C3. The C3c specific m....... The C3c mAb was confirmed to be C3c specific, as it showed no cross-reactivity with native (un-cleaved) C3, with C3b, iC3b, or with C3d. Also, no significant reaction was observed with C3 fragments in factor I deficient sera or plasma. This antibody forms the basis for the generation of a robust ELISA...... that allows for a quick and reliable evaluation of complement activation and consumption as a marker for inflammatory processes. We established the C3c plasma range in 100 healthy Danish blood donors with a mean of 3.47 μg/ml and a range of 2.12-4.92 μg/ml. We believe that such an antibody might...
Bowling, Nathan P; Halter, Robert J; Hodges, Jonathan A; Seburg, Randal A; Thomas, Phillip S; Simmons, Christopher S; Stanton, John F; McMahon, Robert J
2006-03-15
1-Diazo-2,4-pentadiyne (6a), along with both monodeuterio isotopomers 6b and 6c, has been synthesized via a route that proceeds through diacetylene, 2,4-pentadiynal, and 2,4-pentadiynal tosylhydrazone. Photolysis of diazo compounds 6a-c (lambda > 444 nm; Ar or N2, 10 K) generates triplet carbenes HC5H (1) and HC5D (1-d), which have been characterized by IR, EPR, and UV/vis spectroscopy. Although many resonance structures contribute to the resonance hybrid for this highly unsaturated carbon-chain molecule, experiment and theory reveal that the structure is best depicted in terms of the dominant resonance contributor of penta-1,4-diyn-3-ylidene (diethynylcarbene, H-C[triple bond]C-:C-C[triple bond]C-H). Theory predicts an axially symmetric (D(infinity h)) structure and a triplet electronic ground state for 1 (CCSD(T)/ANO). Experimental IR frequencies and isotope shifts are in good agreement with computed values. The triplet EPR spectrum of 1 (absolute value(D/hc) = 0.6157 cm(-1), absolute value(E/hc) = 0.0006 cm(-1)) is consistent with an axially symmetric structure, and the Curie law behavior confirms that the triplet state is the ground state. The electronic absorption spectrum of 1 exhibits a weak transition near 400 nm with extensive vibronic coupling. Chemical trapping of triplet HC5H (1) in an O2-doped matrix affords the carbonyl oxide 16 derived exclusively from attack at the central carbon.
Photocatalytic decomposition of N2O over TiO2/g-C3N4 photocatalysts heterojunction
Kočí, K.; Reli, M.; Troppová, I.; Šihor, M.; Kupková, J.; Kustrowski, P.; Praus, P.
2017-02-01
TiO2/g-C3N4 photocatalysts with the various TiO2/g-C3N4 weight ratios from 1:2 to 1:6 were fabricated by mechanical mixing in water suspension followed by calcination. Pure TiO2 was prepared by thermal hydrolysis and pure g-C3N4 was prepared from commercial melamine by thermal annealing at 620 °C. All the nanocomposites were characterized by X-ray powder diffraction, UV-vis diffuse reflectance spectroscopy, Raman spectroscopy, infrared spectroscopy, scanning electron microscopy, transmission electron microscopy, photoelectrochemical measurements and nitrogen physisorption. The prepared mixtures along with pure TiO2 and g-C3N4 were tested for the photocatalytic decomposition of nitrous oxide under UVC (λ = 254 nm), UVA (λ = 365 nm) and Vis (λ > 400 nm) irradiation. The TiO2/g-C3N4 nanocomposites showed moderate improvement compared to pure g-C3N4 but pure TiO2 proved to be a better photocatalyst under UVC irradiation. However, under UVA irradiation conditions, the photocatalytic activity of TiO2/g-C3N4 (1:2) nanocomposite exhibited an increase compared to pure TiO2. Nevertheless, further increase of g-C3N4 amount leads/led to a decrease in reactivity. These results are suggesting the nanocomposite with the optimal weight ratio of TiO2 and g-C3N4 have shifted absorption edge energy towards longer wavelengths and decreased the recombination rate of charge carriers compared to pure g-C3N4. This is probably due to the generation of heterojunction on the TiO2/g-C3N4 interface.
Directory of Open Access Journals (Sweden)
Dimas Estrásulas de Oliveira
2000-06-01
Full Text Available Foi feito um trabalho de extração e análise de n-alcanos com o objetivo de investigar o uso do n-alcano (C35 presente nas forragens como um indicador interno para determinação de digestibilidade. Foram utilizadas amostras de experimentos de digestibilidade convencional realizados previamente entre os anos de 1978 e 1982. O C35 subestimou as digestibilidades da matéria seca e orgânica, apresentando diferença média, em relação ao método in vivo, de 4,68 (± 0,69 e 4,43 (± 0,85 unidades percentuais, respectivamente. O coeficiente de regressão não diferiu da unidade, indicando que os métodos foram equivalentes, havendo, porém, a necessidade de um fator de correção. Os coeficientes de correlação para a matéria seca e orgânica, observados entre os dois métodos, foram 0,87 e 0,85, respectivamente. O C35 apresentou recuperação fecal média de 91,76% (± 7,94, que contribuiu para o vício da técnica.An experiment was conducted, on extraction and analysis of n-alkanes, to investigate the use of n-alkane (C35 present in forages as an internal marker for the digestibility determination. Samples of forages and feces were taken from conventional digestibility trials, which were previous conducted from 1978 to 1982. The C35 underestimated the dry matter and organic matter digestibilities, presenting an average difference in relation to in vivo of 4.68 (± 0.69 and 4,43 (± 0.85 perceptual units, respectively. The coefficient of regression did not differ from the unit, indicating that both methods were equivalent, having, however, the necessity of a correction factor. The coefficients of correlation observed for the dry and organic matter between the two methods were 0.87 and 0.85, respectively. The average fecal recovery of C35 was 91.76% (± 7.94, and this contributed to the bias of the method.
Synthesis of pinacolyl [14C]methylphosphonochloridate
International Nuclear Information System (INIS)
Horvat, J.; Keglevic, D.; Klaic, B.; Kveder, S.; Ladesic, B.; Cosic, M.; Zupanc, S.
1982-01-01
A three-step synthetic route to pinacolyl [ 14 C]methylphosphonochloridate (3) from [ 14 C]methyl iodide is described. Condensation of sodium di-n-butyl phosphite with [ 14 C]methyl iodide gave di-n-butyl [ 14 C]methylphosphonate (1) which was converted into [ 14 C]methylphosphonic dichloride (2) by prolonged refluxing with thionyl chloride. Reaction of 2 with pinacolyl alcohol in the presence of N,N-di-n--propylaniline as the base afforded the title compound 3. The radiochemical yield of redistilled 3 was 34,2% based on 1, and the overall radiochemical yield was 20,0% from [ 14 C]methyl iodide. (author)
Novel precursor-derived Si-C-N ceramic material for purification application.
Roh, Changhyun; Lee, Sea-Hoon; Francois, Villatte
2008-02-01
Metagenomic DNA (gDNA) is an important research topic because uncultivated microorganisms represent an interesting reservoir of genes with potential biotechnological applications. Here we describe a novel Si-C-N chromatography approach of gDNA extraction from environmental samples. Amorphous Si-C-N ceramic was obtained by the pyrolysis of a polymer precursor (polycarbosilazane) at 1350 degrees C in Ar. The purified gDNA fragments were at least 12 kilo base pairs in size and were sufficiently free of contaminants, thus were applicable to both restriction enzyme digestion using five different enzymes and polymerase chain reaction amplification for detecting phylogenetic groups of native microorganisms in environmental samples. This Si-C-N material produces pure gDNA that can be utilized in some of the most common molecular biological procedures applied in the purification step.
International Nuclear Information System (INIS)
Fella, R.
1992-10-01
In the Ti-Si-C and Ti-Si-C-N systems, metastable layers were precipitated by means of non-reactive magnetron sputtering of hot-pressed two-phase TiC/SiC and TiN/SiC targets with 20 mole% and 50 mole% SiC. The preparation parameters were varied as follows: ion bombardment during precipitation (bias sputtering), substrate temperature, and annealing times when annealing amorphous 50%:50% TiC/SiC and 50%:50% TiN/SiC layers. Sputtering of targets containing 20% SiC was found to result in monophase fcc layers (NaCl structure). This was documented on the basis of X-ray and electron diffraction patterns. Direct precipitation of targets with 50 mole% SiC resulted in amorphous layers. Increasing the ion bombardment during accretion, raising the substrate temperature, and annealing amorphous 50%:50% TiC/SiC and 50%:50% TiN/SiC (layers precipitated directly) resulted in the crystallization of TiC and TiN nanocrystallites, respectively, imbedded in an amorphous SiC matrix. These crystallites were detected both by X-ray and by electron diffractions and by XPS studies. The XPS measurements of crystalline TiC and amorphous SiC reference layers demonstrated the existence of new kinds of carbon interface phases ('pseudocarbide layers') around TiC and amorphous SiC regions, respectively, which have a positive impact on the mechanical properties of the layers. The hardness of the layers can be correlated with the degrees of crystallization and texture. Adhesion and toughness are worse in SiC-bearing layers than PVD TiC and TiN layers, respectively. The application characteristics of the layers were determined by model wear tests relative to 100Cr6 by means of a pin/disk tribometer. N-bearing layers were found to have clearly higher friction coefficients and greater wear than layers without N. (orig.)
Anisotropic carrier mobility in single- and bi-layer C3N sheets
Wang, Xueyan; Li, Qingfang; Wang, Haifeng; Gao, Yan; Hou, Juan; Shao, Jianxin
2018-05-01
Based on the density functional theory combined with the Boltzmann transport equation with relaxation time approximation, we investigate the electronic structure and predict the carrier mobility of single- and bi-layer newly fabricated 2D carbon nitrides C3N. Although C3N sheets possess graphene-like planar hexagonal structure, the calculated carrier mobility is remarkably anisotropic, which is found mainly induced by the anisotropic effective masses and deformation potential constants. Importantly, we find that both the electron and hole mobilities are considerable high, for example, the hole mobility along the armchair direction of single-layer C3N sheets can arrive as high as 1.08 ×104 cm2 V-1 s-1, greatly larger than that of C2N-h2D and many other typical 2D materials. Owing to the high and anisotropic carrier mobility and appropriate band gap, single- and bi-layer semiconducting C3N sheets may have great potential applications in high performance electronic and optoelectronic devices.
Volatility study of [C1C1im][NTf2] and [C2C3im][NTf2] ionic liquids
International Nuclear Information System (INIS)
Rocha, Marisa A.A.; Ribeiro, Filipe M.S.; Schröder, Bernd; Coutinho, João A.P.; Santos, Luís M.N.B.F.
2014-01-01
Highlights: • Vapor pressures of [C 1 C 1 im][NTf 2 ] and [C 2 C 3 im][NTf 2 ] ionic liquids are reported. • [C 1 C 1 im][NTf 2 ] presents higher enthalpy and entropy of vaporization than expected. • The high volatility of [C 2 C 3 im][NTf 2 ] is a result from its asymmetric character. -- Abstract: Vapor pressures of 1,3-dimethylimidazolium bis(trifluoromethylsulfonyl)imide, ([C 1 C 1 im][NTf 2 ]) and 1-ethyl-3-propylimidazolium bis(trifluoromethylsulfonyl)imide, ([C 2 C 3 im][NTf 2 ]) ionic liquids were measured as a function of temperature using a Knudsen effusion apparatus combined with a quartz crystal microbalance. Enthalpies and entropies of vaporization were derived from the fitting of vapor pressure and temperature results to the Clarke and Glew equation. [C 1 C 1 im][NTf 2 ] presents a higher enthalpy and entropy of vaporization than the neighboring members of the series. The enthalpy of vaporization of [C 2 C 3 im][NTf 2 ] lies in between the asymmetric and symmetric ionic liquid series, reflecting a decrease in the electrostatic interactions due to a decrease of the charge accessibility between the ionic pairs when the methyl group is replaced by an ethyl group. The obtained higher volatility of [C 2 C 3 im][NTf 2 ] arises from its asymmetric character, leading to an higher entropic contribution that compensates the enthalpic penalty. The border conditions ([C 1 C 1 im][NTf 2 ], [C 2 C 1 im][NTf 2 ] and [C 2 C 2 im][NTf 2 ]), topology ([C 2 C 3 im][NTf 2 ]) and symmetry/asymmetry of the ILs effect were evaluated and rationalized based on a comparative analysis of the thermodynamic properties, enthalpies and entropies of vaporization
Molecularly Tuning the Radicaloid N-H···O═C Hydrogen Bond.
Lu, Norman; Chung, Wei-Cheng; Ley, Rebecca M; Lin, Kwan-Yu; Francisco, Joseph S; Negishi, Ei-Ichi
2016-03-03
Substituent effects on the open shell N-H···O═C hydrogen-bond has never been reported. This study examines how 12 functional groups composed of electron donating groups (EDG), halogen atoms and electron withdrawing groups (EWG) affect the N-H···O═C hydrogen-bond properties in a six-membered cyclic model system of O═C(Y)-CH═C(X)N-H. It is found that group effects on this open shell H-bonding system are significant and have predictive trends when X = H and Y is varied. When Y is an EDG, the N-H···O═C hydrogen-bond is strengthened; and when Y is an EWG, the bond is weakened; whereas the variation in electronic properties of X group do not exhibit a significant impact upon the hydrogen bond strength. The structural impact of the stronger N-H···O═C hydrogen-bond are (1) shorter H and O distance, r(H···O) and (2) a longer N-H bond length, r(NH). The stronger N-H···O═C hydrogen-bond also acts to pull the H and O in toward one another which has an effect on the bond angles. Our findings show that there is a linear relationship between hydrogen-bond angle and N-H···O═C hydrogen-bond energy in this unusual H-bonding system. In addition, there is a linear correlation of the r(H···O) and the hydrogen bond energy. A short r(H···O) distance corresponds to a large hydrogen bond energy when Y is varied. The observed trends and findings have been validated using three different methods (UB3LYP, M06-2X, and UMP2) with two different basis sets.
The Main Path to C, N, O Elements in Big Bang Nucleosynthesis
International Nuclear Information System (INIS)
Su-Qing, Hou; Kai-Su, Wu; Yong-Shou, Chen; Neng-Chuan, Shu; Zhi-Hong, Li
2010-01-01
The production of C, N, O elements in a standard big bang nucleosynthesis scenario is investigated. Using the up-to-date data of nuclear reactions in BBN, in particular the 8 Li (n,γ) 9 Li which has been measured in China Institute of Atomic Energy, a full nucleosynthesis network calculation of BBN is carried out. Our calculation results show that the abundance of 12 C is increased for an order of magnitude after addition of the reaction chain 8 Li(n,γ) 9 Li(α,n) 12 B(β) 12 C, which was neglected in previous studies. We find that this sequence provides the main channel to convert the light elements into C, N, O in standard BBN. (nuclear physics)
The synthesis of [U-{sup 14}C phenyl] LS 840606, an agricultural fungicide
Energy Technology Data Exchange (ETDEWEB)
Madegard, G.; Mestre, P.; Raimond, P.; Noel, J.-P. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France)
1995-12-01
2,2`,4`-Trichloro-[ring U-{sup 14}C]acetophenone was the key intermediate of this synthesis patterned after the industrial route. An unexpected poor yield was observed during the preparation by the Friedel-Crafts reaction of chloroacetyl chloride with 1,3-dichloro-[U-{sup 14}C]benzene, possibly the result of an isotope effect although this poor yield might be explained by other factors. Two routes were checked for the preparation of 1,3-dichloro-[U-{sup 14} C]benzene. The action of CCl{sub 4} with 1,3-dinitro-[U-{sup 14} C]benzene at 280{sup o}C was entailed with explosions. A safer route started from [U-{sup 14}C]aniline via 2,4-dichloro-[ring U-{sup 14}C]acetanilide. Friedel-Crafts reaction with acetyl chloride gave rise in 52% yield to 2`,4`-dichloro-[ring U-{sup 14}C]acetophenone which was brominated to 2-bromo-2`,4`-dichloro-[ring U-{sup 14}C]acetophenone; was condensed with 2,2-(ethylenedioxy)etylmagnesium bromide to compound, was condensed with 1,2,4-triazole then successively treated with HCl:water:dioxane and 2,2,2-trifluoroethanol/HCl. Separation of the two diastereomers by medium pressure liquid chromatography. 7% overall radioactivity yield from [U-{sup 14}C]aniline. Radiochemical purity 99%. (author).
Energy Technology Data Exchange (ETDEWEB)
Schreiber, Sascha
2006-01-15
Within this work epitaxial 3C-SiC-films were grown on Si(001) substrates and on ion beam synthesized 3C-SiC(001) pseudo substrates. A rather new process was used which is based on the simultaneous deposition of C60 and Si. In order to set up the necessary experimental conditions an ultra-high vacuum chamber has been designed and built. A RHEED system was used to examine SiC film growth in-situ. Using the described technique 3C-SiC films were grown void-free on Si(001) substrates. Deposition rates of C60 and Si were chosen adequately to maintain a Si:C ratio of approximately one during the deposition process. It was shown that stoichiometric and epitaxial 3C-SiC growth with the characteristic relationship (001)[110]Si(001)[110]3C-SiC could be achieved. TEM investigations revealed that the grown 3C-SiC films consist of individual grains that extend from the Si substrate to the film surface. Two characteristic grain types could be identified. The correlation between structure and texture of void-free grown 3C-SiC films and film thickness was studied by X-ray diffraction (XRD). Pole figure measurements showed that thin films only contain first-order 3C-SiC twins. With higher film thickness also second-order twins are found which are located as twin lamellae in grain type 2. Improvement of polar texture with increasing film thickness couldn't be observed in the investigated range of up to 550 nm. On ion beam synthesized 3C-SiC pseudo substrates homoepitaxial 3C-SiC growth could be demonstrated for the first time by using a C{sub 60} carbon source. In respect to the crystalline quality of the grown films the surface quality of the used substrates was identified as a crucial factor. Furthermore a correlation between the ratio of deposition rates of C{sub 60} and Si and 3C-SiC film quality could be found. Under silicon-rich conditions, i.e. with a Si:C ratio of slightly greater one, homoepitaxial 3C-SiC layer-by-layer growth can be achieved. Films grown under these
The Chlamydia type III secretion system C-ring engages a chaperone-effector protein complex.
Directory of Open Access Journals (Sweden)
Kris E Spaeth
2009-09-01
Full Text Available In Gram-negative bacterial pathogens, specialized chaperones bind to secreted effector proteins and maintain them in a partially unfolded form competent for translocation by type III secretion systems/injectisomes. How diverse sets of effector-chaperone complexes are recognized by injectisomes is unclear. Here we describe a new mechanism of effector-chaperone recognition by the Chlamydia injectisome, a unique and ancestral line of these evolutionarily conserved secretion systems. By yeast two-hybrid analysis we identified networks of Chlamydia-specific proteins that interacted with the basal structure of the injectisome, including two hubs of protein-protein interactions that linked known secreted effector proteins to CdsQ, the putative cytoplasmic C-ring component of the secretion apparatus. One of these protein-interaction hubs is defined by Ct260/Mcsc (Multiple cargo secretion chaperone. Mcsc binds to and stabilizes at least two secreted hydrophobic proteins, Cap1 and Ct618, that localize to the membrane of the pathogenic vacuole ("inclusion". The resulting complexes bind to CdsQ, suggesting that in Chlamydia, the C-ring of the injectisome mediates the recognition of a subset of inclusion membrane proteins in complex with their chaperone. The selective recognition of inclusion membrane proteins by chaperones may provide a mechanism to co-ordinate the translocation of subsets of inclusion membrane proteins at different stages in infection.
Energy Technology Data Exchange (ETDEWEB)
Losurdo, M.; Grimaldi, A.; Sacchetti, A.; Capezzuto, P.; Ambrico, M.; Bruno, G.; Roca, Francesco
2003-03-03
Investigation of n-p heterojunction solar cells obtained by depositing a n-type thin silicon films either amorphous or microcrystalline on p-type c-Si is carried out. The study is focused on the improvement of the c-Si surface and emitter layer/c-Si substrate interface. The peculiarity is the use of SiF{sub 4}-based plasmas for the in situ dry cleaning and passivation of the c-Si surface and for the PECVD deposition of the emitter layer that can be either amorphous (a-Si:H,F) or microcrystalline ({mu}c-Si). The use of SiF{sub 4} instead of the conventional SiH{sub 4} results in a lower hydrogen content in the film and in a reduction of the interaction of the c-Si surface with hydrogen atoms. Furthermore, the dependence of the heterojunction solar cell photovoltaic parameters on the insertion of an intrinsic buffer layer between the n-type thin silicon layer and the p-type c-Si substrate is discussed.
Neoplasia Intraepitelial Cervical: Preámbulo del cáncer cérvicouterino
Sarduy Nápoles, Miguel R.
2008-01-01
La neoplasia intraepitelial cervical es una lesión que se considera la antesala del cáncer cérvicouterino. La infección por el virus del papiloma humano (VPH) en el aparato genital, sobre todo algunos subtipos llamados oncogénicos, juegan un papel relevante en la aparición de las lesiones intraepiteliales y su posible evolución al cáncer invasor en esas localizaciones. Existe además un importante grupo de factores de riesgo o cofactores que asociados a la infección por el VPH pueden producir ...
DEFF Research Database (Denmark)
Calum, Henrik; Moser, Claus; Jensen, Peter Østrup
2003-01-01
The purpose of the present study was to investigate whether NK cells from resistant C3H/HeN mice and susceptible BALB/c mice showed different release of cytokines and expression of surface molecules during chronic P. aeruginosa lung infection using alginate-embedded P. aeruginosa mimicking...... expression of the LFA-1 and Fc receptors on NK cells. At day 2, IFN-gamma levels increased in C3H/HeN mice but decreased in BALB/c mice. The GM-CSF levels increased only in the C3H/HeN mice at day 1 and 2. Surface expression of LFA-1 on the NK cells was higher in C3H/HeN mice at day 1 and 2. In contrast...
Microstructure, consolidation and mechanical behaviour of Mg/n-TiC composite
Directory of Open Access Journals (Sweden)
N. Vijay Ponraj
2016-09-01
Full Text Available In this work, the microstructure, consolidation and mechanical properties of pure magnesium, magnesium based composite containing with different fractions (5, 10, 15 wt% of Titanium carbide nanoparticles (n-TiC were fabricated via powder metallurgy technique. The fabricated composites exhibited homogeneous distribution of TiC with little porosity. Microstructure of the composite and powders was studied using X-ray diffraction, Scanning electron microscope, and Transmission electron microscope. Microstructural characterization of the materials exposed that the accumulation of nanosized titanium carbide reinforcement enhanced the homogenization during mechanical blending. The relative density, compressibility, green compressive strength, sinterability and hardness of the nanocomposites were also examined. The effect of reinforcement on the densification was studied and reported in terms of the relative density and consolidation behaviour of the Magnesium matrix with n-TiC was studied and best compacted fit obtained through the Heckel, Panelli Ambrosio Filho and Ge equations. The compressive strength of the composite significantly increases from 230 MPa to 389 MPa with content of n-TiC and sintering temperature. Experiments have been performed under different conditions of temperature, n-TiC Content, and compacting pressure.
The Effective Prepotential of N=2 Supersymmetric $SU(N_c)$ Gauge Theories
D'Hoker, Eric; Phong, D.H.; D'Hoker, Eric
1996-01-01
We determine the effective prepotential for N=2 supersymmetric SU(N_c) gauge theories with an arbitrary number of flavors N_f < 2N_c, from the exact solution constructed out of spectral curves. The prepotential is the same for the several models of spectral curves proposed in the literature. It has to all orders the logarithmic singularities of the one-loop perturbative corrections, thus confirming the non-renormalization theorems from supersymmetry. In particular, the renormalized order parameters and their duals have all the correct monodromy transformations prescribed at weak coupling. We evaluate explicitly the contributions of one- and two-instanton processes.
Estudo da reatividade C-Alquil versus C-Fenil em ciclopropenonas não-simetricas
Jair Correa Filho
1992-01-01
Resumo: A presente pesquisa se desenvolveu no sentido de esclarecer as diferenças de reatividade dos carbonos C-Alquil versus C-Ph.das ciclopropenonas.Com êste objetivo os coeficientes de HOMO-LUMO foram obtidos de um tratamento teórico da metilfenilciclopropenona. Para tanto recorreu-se ao método de cálculo AM1,cujos resultados mostraram que os coeficientes de HOMO e LUMO são maiores no C-Me. Isto apontaria para o fato de que as reações de nucleófilos com a metilfenilciclopropenona procederi...
Toward a complete soil C and N cycle: incorporating the soil fauna.
Osler, Graham H R; Sommerkorn, Martin
2007-07-01
Increasing pressures on ecosystems through global climate and other land-use changes require predictive models of their consequences for vital processes such as soil carbon and nitrogen cycling. These environmental changes will undoubtedly affect soil fauna. There is sufficient evidence that soil fauna have significant effects on all of the pools and fluxes in these cycles, and soil fauna mineralize more N than microbes in some habitats. It is therefore essential that their role in the C and N cycle be understood. Here we introduce a new framework that attempts to reconcile our current understanding of the role of soil fauna within the C and N cycle with biogeochemical models and soil food web models. Using a simple stoichiometric approach to integrate our understanding of N mineralization and immobilization with the C:N ratio of substrates and faunal life history characteristics, as used in food web studies, we consider two mechanisms through which soil fauna can directly affect N cycling. First, fauna that are efficient assimilators of C and that have prey with similar C:N ratios as themselves, are likely to contribute directly to the mineral N pool. Second, fauna that are inefficient assimilators of C and that have prey with higher C:N ratios than themselves are likely to contribute most to the dissolved organic matter (DOM) pool. Different groups of fauna are likely to contribute to these two pathways. Protists and bacteria-feeding nematodes are more likely to be important for N mineralization through grazing on microbial biomass, while the effects of enchytraeids and fungal-feeding microarthropods are most likely to be important for DOM production. The model is consistent with experimental evidence and, despite its simplicity, provides a new framework in which the effects of soil fauna on pools and fluxes can be understood. Further, the model highlights our gaps in knowledge, not only for effects of soil fauna on processes, but also for understanding of the
Nowak, Izabela; Bylińska, Aleksandra; Wilczyńska, Karolina; Wiśniewski, Andrzej; Malinowski, Andrzej; Wilczyński, Jacek R; Radwan, Paweł; Radwan, Michał; Barcz, Ewa; Płoski, Rafał; Motak-Pochrzęst, Hanna; Banasik, Małgorzata; Sobczyński, Maciej; Kuśnierczyk, Piotr
2017-01-01
Almost 1600 individuals from the Polish population were recruited to this study. Among them 319 were fertile couples, 289 were recurrent spontaneous abortion (RSA) couples, and 131 were in the group of recurrent implantation failure (RIF) following in vitro fertilization. The aim of this study was to evaluate the MTHFR c.c.677 C>T and c.c.1298 A>C polymorphisms' association with RSA and RIF. We used PCR-RFLP with HinfI (677 C>T) and MboII (1298 A>C) digestion. We observed a protective effect of the female AC genotype (OR = 0.64, p = 0.01) and the C allele (AC+CC genotypes; OR = 0.65, p = 0.009) against RSA. Moreover, 1298 AA/677 CT women were more frequent in RSA (31.14%) and RIF (25.20%) groups in comparison to fertile women (22.88%), although this difference was significant only in the case of RSA (p = 0.022, OR = 1.52). Male combined genotype analysis revealed no association with reproductive failure of their partners. Nevertheless, the female/male combination AA/AC of the 1298 polymorphism was more frequent in RSA couples (p = 0.049, OR = 1.49). However, the significant results became insignificant after Bonferroni correction. In addition, analysis of haplotypes showed significantly higher frequency of the C/C haplotype (1298 C/677 C) in the female control group than in the female RSA group (p = 0.03, OR = 0.77). Moreover, the association between elevated homocysteine (Hcy) level in plasma of RSA and RIF women and MTHFR polymorphisms was investigated but did not reveal significant differences. In conclusion, for clinical practice, it is better to check the homocysteine level in plasma and, if the Hcy level is increased, to recommend patients to take folic acid supplements rather than undergo screening of MTHFR for 1298 A>C and 677 C>T polymorphisms.
Roy, Sudeshna; Spilling, Christopher D.
2010-01-01
A convergent synthesis of the C(18)–C(34) fragment of amphidinolide C and the C(18)–C(29) fragment of amphidinolide F is reported. The approach involves the synthesis of the common intermediate tetrahydrofuranyl-β-ketophosphonate via cross metathesis, Pd(0)-catalyzed cyclization and hydroboration-oxidation. The β-ketophosphonate was coupled to three side chain aldehydes using a Horner-Wadsworth-Emmons (HWE) olefination reaction to give dienones, which were reduced with L-selectride to give the fragments of amphidinolide C and F. PMID:21028791
Dicty_cDB: Contig-U02054-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 0.080 1 ( DT656898 ) pgr1n.UA001.227 Normalized chicken reproductive t... 50 0.080 1 ( AJ454996 ) Gallus gallus EST, clone library...90810 XtSt10-30 Xenopus (Silurana) t... 36 0.17 2 ( DV037739 ) BRS3230 storage root cDNA library Ipomoea bat..... 44 4.9 1 ( BM959958 ) cihA1L9S Ascidian hemocytes cDNA library Ciona in... 44 4.9 1 ( BM230365 ) K0294C12-3 NIA Mouse Unferti...... 36 0.010 3 ( EY189411 ) LLAE1039S Spider Loxosceles laeta cDNA library Lo... ... riken1, clone 4e... 50 0.080 1 ( AJ453299 ) Gallus gallus EST, clone library riken1,
Construction of Agrobacterium tumefaciens-mediated tomato black ring virus infectious cDNA clones.
Zarzyńska-Nowak, Aleksandra; Ferriol, Inmaculada; Falk, Bryce W; Borodynko-Filas, Natasza; Hasiów-Jaroszewska, Beata
2017-02-15
Tomato black ring virus (TBRV, genus Nepovirus) infects a wide range of economically important plants such as tomato, potato, tobacco and cucumber. Here, a successful construction of infectious full-length cDNA clones of the TBRV genomic RNAs (RNA1 and RNA2) is reported for the first time. The engineered constructs consisting of PCR-amplified DNAs were cloned into binary vector pJL89 immediately downstream of a double cauliflower mosaic virus (CaMV) 35S promoter, and upstream of the hepatitis delta virus (HDV) ribozyme and nopaline synthase terminator (NOS). The symptoms induced on plants agroinoculated with both constructs were indistinguishable from those caused by the wild-type virus. The infectivity of obtained clones was verified by reinoculation to Nicotiana tabacum cv. Xanthi, Chenopodium quinoa and Cucumis sativus. The presence of viral particles and RNA was confirmed by electron microscopy and reverse transcription polymerase chain reaction, respectively. Constructed full-length infectious cDNA clones will serve as an excellent tool to study virus-host-vector interactions. Copyright © 2017 Elsevier B.V. All rights reserved.
Acetone n-radical cation internal rotation spectrum: The torsional potential surface
International Nuclear Information System (INIS)
Shea, Dana A.; Goodman, Lionel; White, Michael G.
2000-01-01
The one color REMPI and two color ZEKE-PFI spectra of acetone-d 3 have been recorded. The 3p x Rydberg state of acetone-d 3 lies at 59 362.3 cm-1 and both of the torsional modes are visible in this spectrum. The antigearing Rydberg (a 2 ) mode, v 12 * , has a frequency of 62.5 cm-1, while the previously unobserved gearing (b 1 ) mode, v 17 * , is found at 119.1 cm-1. An ionization potential of 78 299.6 cm-1 for acetone-d 3 has been measured. In acetone-d 3 n-radical cation ground state, the fundamentals of both of the torsional modes have been observed, v 12 + at 51.0 cm-1 and v 17 + at 110.4 cm-1, while the first overtone of v 12 + has been measured at 122.4 cm-1. Deuterium shifts show that v 12 + behaves like a local C 3v rotor, but that v 17 + is canonical. Combining this data with that for acetone-d 0 and aacetone-d 6 has allowed us to fit the observed frequencies to a torsional potential energy surface based on an ab initio C 2v cation ground state geometry. This potential energy surface allows for prediction of the v 17 vibration in acetone-d 0 and acetone-d 6 . The barrier to synchronous rotation is higher in the cation ground state than in the neutral ground state, but significantly lower than in the 3s Rydberg state. The 3p x Rydberg and cation ground state potential energy surfaces are found to be very similar to each other, strongly supporting the contention that the 3p x Rydberg state has C 2v geometry and is a good model for the ion core. The altered 3s Rydberg state potential surface suggests this state has significant valence character. (c) 2000 American Institute of Physics
Hemoglobin C, S-C, and E Diseases
... quickly than others, resulting in chronic anemia. Hemoglobin C disease Hemoglobin C disease occurs mostly in blacks. ... a common complication of hemoglobin C disease. Hemoglobin S-C disease Hemoglobin S-C disease occurs in people who ...
Rahman, M; Dang, B H Q; McDonnell, K; MacElroy, J M D; Dowling, D P
2012-06-01
The photocatalytic splitting of water into hydrogen and oxygen using a photoelectrochemical (PEC) cell containing titanium dioxide (TiO2) photoanode is a potentially renewable source of chemical fuels. However, the size of the band gap (-3.2 eV) of the TiO2 photocatalyst leads to its relatively low photoactivity toward visible light in a PEC cell. The development of materials with smaller band gaps of approximately 2.4 eV is therefore necessary to operate PEC cells efficiently. This study investigates the effect of dopant (C or N) and co-dopant (C+N) on the physical, structural and photoactivity of TiO2 nano thick coating. TiO2 nano-thick coatings were deposited using a closed field DC reactive magnetron sputtering technique, from titanium target in argon plasma with trace addition of oxygen. In order to study the influence of doping such as C, N and C+N inclusions in the TiO2 coatings, trace levels of CO2 or N2 or CO2+N2 gas were introduced into the deposition chamber respectively. The properties of the deposited nano-coatings were determined using Spectroscopic Ellipsometry, SEM, AFM, Optical profilometry, XPS, Raman, X-ray diffraction UV-Vis spectroscopy and tri-electrode potentiostat measurements. Coating growth rate, structure, surface morphology and roughness were found to be significantly influenced by the types and amount of doping. Substitutional type of doping in all doped sample were confirmed by XPS. UV-vis measurement confirmed that doping (especially for C doped sample) facilitate photoactivity of sputtered deposited titania coating toward visible light by reducing bandgap. The photocurrent density (indirect indication of water splitting performance) of the C-doped photoanode was approximately 26% higher in comparison with un-doped photoanode. However, coating doped with nitrogen (N or N+C) does not exhibit good performance in the photoelectrochemical cell due to their higher charge recombination properties.
International Nuclear Information System (INIS)
Shen Yang; Bax, Ad
2007-01-01
Chemical shifts of nuclei in or attached to a protein backbone are exquisitely sensitive to their local environment. A computer program, SPARTA, is described that uses this correlation with local structure to predict protein backbone chemical shifts, given an input three-dimensional structure, by searching a newly generated database for triplets of adjacent residues that provide the best match in φ/ψ/χ 1 torsion angles and sequence similarity to the query triplet of interest. The database contains 15 N, 1 H N , 1 H α , 13 C α , 13 C β and 13 C' chemical shifts for 200 proteins for which a high resolution X-ray (≤2.4 A) structure is available. The relative importance of the weighting factors for the φ/ψ/χ 1 angles and sequence similarity was optimized empirically. The weighted, average secondary shifts of the central residues in the 20 best-matching triplets, after inclusion of nearest neighbor, ring current, and hydrogen bonding effects, are used to predict chemical shifts for the protein of known structure. Validation shows good agreement between the SPARTA-predicted and experimental shifts, with standard deviations of 2.52, 0.51, 0.27, 0.98, 1.07 and 1.08 ppm for 15 N, 1 H N , 1 H α , 13 C α , 13 C β and 13 C', respectively, including outliers
Weber, Lothar; Kahlert, Jan; Brockhinke, Regina; Böhling, Lena; Halama, Johannes; Brockhinke, Andreas; Stammler, Hans-Georg; Neumann, Beate; Nervi, Carlo; Harder, Rachel A; Fox, Mark A
2013-08-14
Six new C,C'-bis(benzodiazaborolyl)dicarba-closo-dodecaboranes, 1,A-R2-1,A-C2B10H10, where R represents the group 2-(1,3-Et2-1,3,2-N2BC6H4) or 2-(1,3-Ph2-1,3,2-N2BC6H4) and A is 2, 7 or 12, were synthesized from o-, m-, and p-dicarbadodecaboranes (carboranes) by lithiation and subsequent treatment with the respective 2-bromo-1,3,2-benzodiazaboroles. UV-visible and fluorescence spectra of all carboranes display low energy charge transfer emissions. While such emissions with Stokes shifts between 17,330 and 21,290 cm(-1) are typical for C,C'-bis(aryl)-ortho-carboranes, the observed low-energy emissions with Stokes shifts between 8320 and 15,170 cm(-1) for the meta- and para-isomers are unusual as high-energy emissions are typical for meta- and para-dicarbadodecaboranes. Fluorescence quantum yields (φF) for the novel 1,7- and 1,12-bis(benzodiazaborolyl)-carboranes depend on the substituents at the nitrogen atoms of the heterocycle. Thus, the para-carborane with N-ethyl substituents 1,12-(1',3'-Et2-1',3',2'-N2BC6H4)2-1,12-C2B10H10 has a φF value of 41% in cyclohexane solution and only of 9% in the solid state, whereas the analogous 1,12-(1',3'-Ph2-1',3',2'-N2BC6H4)2-1,12-C2B10H10 shows quantum yields of 3% in cyclohexane solution and 72% in the solid state. X-ray crystallographic, computational and cyclic voltammetry studies for these carboranes are also presented.
Prakash, S. M.; Pandiarajan, K.; Kumar, S.
2013-06-01
Four new [N-methyl-3t-alkyl-2r,6c-diaryl-4-ylidine]-5'-methylthiozolidin-4-ones 9-12 have been synthesized by the condensation of N-methyl-3t-alkyl-2r,6c-diarylpiperidin-4-one thiosemicarbazones with ethyl 2-bromopropionate. These compounds have been characterized using FT-IR, 1H NMR, 13C NMR spectral techniques. HOMOCOSY, HSQC and HMBC spectral study have been done for [N-methyl-3,3-dimethyl-2r,6c-bis(p-methoxyphenyl)piperidin-4-ylidine]-5'-methylthiazolidine-4-one (12). Two geometrical isomers are formed in this reaction. In all these compounds piperidin rings adopt chair conformation. The rotation of the aryl group at C-2 is rather slow in 10-12. Antimicrobial activities have also been studied for 9-12. These compounds are active against all the tested bacterial and fungal strains.
Yan, Cai-Feng; Gessler, Arthur; Rigling, Andreas; Dobbertin, Matthias; Han, Xing-Guo; Li, Mai-He
2016-05-01
Most mistletoes are xylem-tapping hemiparasites, which derive their resources from the host's xylem solution. Thus, they affect the host's water relations and resource balance. To understand the physiological mechanisms underlying the mistletoe-host relationship, we experimentally removed Viscum album ssp. austriacum (Wiesb.) Vollmann from adult Pinus sylvestris L. host trees growing in a Swiss dry valley. We analyzed the effects of mistletoe removal over time on host tree growth and on concentrations of nonstructural carbohydrates (NSC) and nitrogen (N) in needles, fine roots and sapwood. In addition, we assessed the δ(13)C and δ(18)O in host tree rings. After mistletoe removal, δ(13)C did not change in newly produced tree rings compared with tree rings in control trees (still infected with mistletoe), but δ(18)O values increased. This pattern might be interpreted as a decrease in assimilation (A) and stomatal conductance (gs), but in our study, it most likely points to an inadequacy of the dual isotope approach. Instead, we interpret the unchanged δ(13)C in tree rings upon mistletoe removal as a balanced increase in A and gs that resulted in a constant intrinsic water use efficiency (defined as A/gs). Needle area-based concentrations of N, soluble sugars and NSC, as well as needle length, single needle area, tree ring width and shoot growth, were significantly higher in trees from which mistletoe was removed than in control trees. This finding suggests that mistletoe removal results in increased N availability and carbon gain, which in turn leads to increased growth rates of the hosts. Hence, in areas where mistletoe is common and the population is large, mistletoe management (e.g., removal) may be needed to improve the host vigor, growth rate and productivity, especially for relatively small trees and crop trees in xeric growth conditions. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Improving g-C3N4 photocatalysis for NOx removal by Ag nanoparticles decoration
International Nuclear Information System (INIS)
Sun, Yanjuan; Xiong, Ting; Ni, Zilin; Liu, Jie; Dong, Fan; Zhang, Wei; Ho, Wing-Kei
2015-01-01
Graphical abstract: Ag/g-C 3 N 4 nanocomposites were prepared via a facile method for enhanced photocatalytic NO x removal due to surface plasmon resonance of Ag. - Highlights: • The Ag/g-C 3 N 4 nanocomposites were prepared using urea as the precursor. • The Ag/g-C 3 N 4 nanocomposites were applied in removal of NO x in air. • The Ag nanoparticles enhanced the photocatalytic activity of g-C 3 N 4 . • The surface plasmon resonance of Ag played a key role in photocatalysis. - Abstract: In order to overcome the intrinsic drawback of pristine g-C 3 N 4 , we prepared g-C 3 N 4 nanosheets with enhanced photocatalytic performance by Ag nanoparticles decoration using urea as the precursor. It was revealed that the monodispersed Ag nanoparticles were deposited on the surface of g-C 3 N 4 nanosheets. The Ag/g-C 3 N 4 nanocomposites were applied in removal of NO x in air under visible light irradiation. The results showed that the decoration of Ag nanoparticles not only enhanced the photocatalytic activity of g-C 3 N 4 nanosheets, but also benefited the oxidation of NO to final products. The increased visible light absorption arising from the surface plasmon resonance of Ag and improved separation and transfer of photoinduced carriers over Ag/g-C 3 N 4 composites were demonstrated by the UV–vis diffuse reflectance spectra and photoluminescence spectra, respectively. It was therefore proposed that the enhanced photocatalytic activity of Ag/g-C 3 N 4 composites could be attributed to the extended light response range and enhanced charge separation due to the introduction of Ag nanoparticles.
Ma, Jun; Xiao, Dejian; Chen, Chang Li; Luo, Qiaomei; Yu, Yue; Zhou, Junhao; Guo, Changding; Li, Kai; Ma, Jie; Zheng, Lirong; Zuo, Xia
2018-02-01
In this work, a category of Fe3C-containing Fe/N/C mesoporous material has been fabricated by carbonizing the mixture of uric acid, Iron (Ⅲ) chloride anhydrous and carbon support (XC-72) under different pyrolysis temperature. Of all these samples, pyrolysis temperature (800 °C) becomes the most crucial factor in forming Fe3C active sites which synergizes with high content of graphitic N to catalyze oxygen reduction reaction (ORR). X-ray absorption fine structure spectroscopy (XAFS) is used to exhibit that the space structure around Fe atoms in the catalyst. This kind of catalyst possesses comparable ORR properties with commercial 20% Pt/C (onset potential is 0 V vs. Ag/AgCl in 0.1 M KOH), the average transfer electron number is 3.84 reflecting the 4-electron process. Moreover, superior stability and methanol tolerance deserve to be mentioned.
Flexural-torsional vibration of a tapered C-section beam
Dennis, Scott T.; Jones, Keith W.
2017-04-01
Previous studies have shown that numerical models of tapered thin-walled C-section beams based on a stepped or piecewise prismatic beam approximation are inaccurate regardless of the number of elements assumed in the discretization. Andrade recently addressed this problem by extending Vlasov beam theory to a tapered geometry resulting in new terms that vanish for the uniform beam. (See One-Dimensional Models for the Spatial Behaviour of Tapered Thin-Walled Bars with Open Cross-Sections: Static, Dynamic and Buckling Analyses, PhD Thesis, University of Coimbra, Portugal, 2012, https://estudogeral.sib.uc.pt) In this paper, we model the coupled bending-twisting vibration of a cantilevered tapered thin-walled C-section using a Galerkin approximation of Andrade's beam equations resulting in an 8-degree-of-freedom beam element. Experimental natural frequencies and mode shapes for 3 prismatic and 2 tapered channel beams are compared to model predictions. In addition, comparisons are made to detailed shell finite element models and exact solutions for the uniform beams to confirm the validity of the approach. Comparisons to the incorrect stepped model are also presented.
International Nuclear Information System (INIS)
Patt, M.; Machulla, H.J.; Guendisch, D.; Kovar, K.A.; Wuellner, U.; Blocher, A.
1999-01-01
In order to evaluate the neurobiological mechanism causing the psychogenic effects of methylenedioxy-derivatives of amphetamine, the carbon-11 labeled analogues of 3,4-methylenedioxymethamphetamine (MDMA), 2 and 2,N-dimethyl-4,5-methylenedioxyamphetamine (MADAM-6) 4 were prepared for application in in-vivo PET studies by methylation of 3,4-methylenedioxyamphetamine (MDA) 1 and 2-methyl-4,5-methylenedioxyamphetamine 3 with [ 11 C]CH 3 I. The radiochemical yield was determined in dependence on time, temperature and amount of precursor. The best conditions for a fast labeling reaction with carbon-11 on a preparative scale were found to be a reaction time of 10 min using 1 mg of the corresponding dimethyl-precursors 1 or 3, thus obtaining radiochemical yields of 60% (based on produced [ 11 C]CH 3 I). Biodistribution studies were performed in rats, a high brain to blood ratio of 7.5 was observed for [ 11 C]MDMA in contrast to a ratio of 3.7 for [ 11 C]MADAM-6. (author)
Lifescience Database Archive (English)
Full Text Available vlivyhviq*iqlllmkhqeyyisn *aqhhiimmlkskkfnhh*ihhhqmvvkenhqnyqvvqllvlqlvvllvlvl*lvlsfil n*slvlkkhsiniliivfdgvnyklgsklq*iihkfk*itlitlen...in*ciiknihnixt vsyxyxiil Homology vs CSM-cDNA Score E Sequences producing significa
Rocchigiani, Luca; Fernandez-Cestau, Julio; Budzelaar, Peter H M; Bochmann, Manfred
2018-06-21
The factors affecting the rates of reductive C-C cross-coupling reactions in gold(III) aryls were studied by using complexes that allow easy access to a series of electronically modified aryl ligands, as well as to gold methyl and vinyl complexes, by using the pincer compounds [(C^N^C)AuR] (R=C 6 F 5 , CH=CMe 2 , Me and p-C 6 H 4 X, where X=OMe, F, H, tBu, Cl, CF 3 , or NO 2 ) as starting materials (C^N^C=2,6-(4'-tBuC 6 H 3 ) 2 pyridine dianion). Protodeauration followed by addition of one equivalent SMe 2 leads to the quantitative generation of the thioether complexes [(C^N-CH)AuR(SMe 2 )] + . Upon addition of a second SMe 2 pyridine is displaced, which triggers the reductive aryl-R elimination. The rates for these cross-couplings increase in the sequence k(vinyl)>k(aryl)≫k(C 6 F 5 )>k(Me). Vinyl-aryl coupling is particularly fast, 1.15×10 -3 L mol -1 s -1 at 221 K, whereas both C 6 F 5 and Me couplings encountered higher barriers for the C-C bond forming step. The use of P(p-tol) 3 in place of SMe 2 greatly accelerates the C-C couplings. Computational modelling shows that in the C^N-bonded compounds displacement of N by a donor L is required before the aryl ligands can adopt a conformation suitable for C-C bond formation, so that elimination takes place from a four-coordinate intermediate. The C-C bond formation is the rate-limiting step. In the non-chelating case, reductive C(sp 2 )-C(sp 2 ) elimination from three-coordinate ions [(Ar 1 )(Ar 2 )AuL] + is almost barrier-free, particularly if L=phosphine. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Lifescience Database Archive (English)
Full Text Available ucing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 1...05 4e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsi...n; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 CP0015
Wang, Ning; Wicht, Kathryn J; Imai, Kento; Wang, Ming-Qi; Anh Ngoc, Tran; Kiguchi, Ryo; Kaiser, Marcel; Egan, Timothy J; Inokuchi, Tsutomu
2014-05-01
A series of indolo[3,2-c]quinolines were synthesized by modifying the side chains of the ω-aminoalkylamines at the C6 position and introducing substituents at the C2 position, such as F, Cl, Br, Me, MeO and NO2, and a methyl group at the N11 position for an SAR study. The in vitro antiplasmodial activities of the derivative agents against two different strains (CQS: NF54 and CQR: K1) and the cytotoxic activity against normal L6 cells were evaluated. The test results showed that compounds 6k and 6l containing the branched methyl groups of 3-aminopropylamino at C6 with a Cl atom at C2 exhibited a very low cytotoxicity with IC50 values above 4000 nM, high antimalarial activities with IC50 values of about 11 nM for CQS (NF54), IC50 values of about 17 nM for CQR (K1), and RI resistance indices of 1.6. Furthermore, the compounds were tested for β-haematic inhibition, and QSAR revealed an interesting linear correlation between the biological activity of CQS (NF54) and three contributing factors, namely solubility, hydrophilic surface area, and β-haematin inhibition for this series. In vivo testing of 6l showed a reduction in parasitaemia on day 4 with an activity of 38%. Copyright © 2014 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Wolfgang Holzer
2010-09-01
Full Text Available The synthesis of the title compounds is described. Reaction of 1-substituted 2-pyrazolin-5-ones with 5-chloro-1-phenyl-1H-pyrazole-4-carbonyl chloride or 5-chloro-3-methyl-1-phenyl-1H-pyrazole-4-carbonyl chloride, respectively, using calcium hydroxide in refluxing 1,4-dioxane gave the corresponding 4-heteroaroylpyrazol-5-ols, which were cyclized into 1H-pyrano[2,3-c:6,5-c]dipyrazol-4(7H-ones by treatment with K2CO3/DMF. The latter were converted into the corresponding thiones upon reaction with Lawesson’s reagent. Detailed NMR spectroscopic investigations (1H, 13C, 15N of the ring systems and their precursors are presented.
Schulze, Brigit; Wirth, Christian; Linke, Petra; Brand, Willi A; Kuhlmann, Iris; Horna, Viviana; Schulze, Ernst-Detlef
2004-11-01
We present a new, rapid method for high-resolution online determination of delta13C in tree rings, combining laser ablation (LA), combustion (C), gas chromatography (GC) and isotope ratio mass spectrometry (IRMS) (LA-C-GC-IRMS). Sample material was extracted every 6 min with a UV-laser from a tree core, leaving 40-microm-wide holes. Ablated wood dust was combusted to CO2 at 700 degrees C, separated from other gases on a GC column and injected into an isotope ratio mass spectrometer after removal of water vapor. The measurements were calibrated against an internal and an external standard. The tree core remained intact and could be used for subsequent dendrochronological and dendrochemical analyses. Cores from two Scots pine trees (Pinus sylvestris spp. sibirica Lebed.) from central Siberia were sampled. Inter- and intra-annual patterns of delta13C in whole-wood and lignin-extracted cores were indistinguishable apart from a constant offset, suggesting that lignin extraction is unnecessary for our method. Comparison with the conventional method (microtome slicing, elemental analysis and IRMS) indicated high accuracy of the LA-C-GC-IRMS measurements. Patterns of delta13C along three parallel ablation lines on the same core showed high congruence. A conservative estimate of the precision was +/- 0.24 per thousand. Isotopic patterns of the two Scots pine trees were broadly similar, indicating a signal related to the forest stand's climate history. The maximum variation in delta13C over 22 years was about 5 per thousand, ranging from -27 to -22.3 per thousand. The most obvious pattern was a sharp decline in delta13C during latewood formation and a rapid increase with spring early growth. We conclude that the LA-C-GC-IRMS method will be useful in elucidating short-term climate effects on the delta13C signal in tree rings.
TNFalpha -308 C-->t and -863 C-->a polymorphisms and spermiogram characteristics.
Kurz, Christine; Bentz, Eva-Katrin; Denschlag, Dominik; Berner, Isabel; Keck, Christoph; Tempfer, Clemens B; Pietrowski, Detlef
2008-01-01
Genetic factors may play a role in male infertility. In a prospective case-control study, we assessed the allele and genotype frequencies of the TNFalpha -308 C-->T and -863 C-->A polymorphisms, detected by PCR of sperm DNA, of 577 Caucasian men recruited in an infertility clinic. Semen sampling was performed and spermiogram results were correlated to genetic data. The allele frequencies of the TNFalpha -308 C-->T and -863 C-->A polymorphisms were not significantly different between non-normozoospermic (n = 447) and normozoospermic (n = 130) men [758/894 (85%) and 134/894 (15%) vs. 213/269 (82%) and 43/260 (18%), p = 0.5, odds ratio (OR) 1.1, 95% confidence interval (CI) 0.74-1.76, and 749/894 (84%) and 145/894 (16%) vs. 212/260 (82%) and 48/260 (18%), p = 0.4, OR 1.2, 95% CI 0.78-1.76, respectively]. The genotype frequencies of the TNFalpha -308 C-->T and -863 C-->A polymorphisms were also not significantly different between non-normozoospermic and normozoospermic men. In addition, mutant alleles were not overrepresented in subgroups of men with the oligoasthenoteratozoospermia syndrome and asthenozoospermia. The TNFalpha -308 C-->T and -863 C-->A polymorphisms are not associated with spermiogram characteristics and do not represent molecular markers for genetic susceptibility to male infertility. Copyright 2008 S. Karger AG, Basel.
Effects of Land Use Change on C-N cycling: Microbes Matter.
Hofmockel, K.
2012-12-01
Large swaths of the terrestrial landscape have been altered by human actions on Earth's biophysical systems, resulting in the homogenization of Earth's biota, while simultaneously increasing greenhouse gases and reactive nitrogen (N). This is especially poignant in grasslands that have been largely replaced by managed agricultural systems with substantial N inputs, or by unmanaged grasslands that are dominated by exotic species. Impacted ecosystems may be important for global C models, because they comprise a major portion of the global land area, terrestrial NPP and the world's soil C stocks. This research investigates how anthropogenic changes in plant community composition and agricultural management systems influence the composition and function of microbial communities that mediate key aspects of belowground C and N cycling and storage. Data from agroecology and grassland climate change experiments are used to illustrate how microbial responses can have important implications for large scale coupling of C and N cycles. In this study exotic plant species significantly decreased root inputs, causing shifts in microbial community composition, including both specific taxa and functional guilds of bacteria. By contrast, climate change (precipitation manipulation) caused functional responses (increased carbon and phosphorus cycling) that were not detected in the microbial community composition. Mycorrhizal fungi in managed systems were responsive to both root biomass and nitrogen inputs, significantly altering hydrolytic enzyme activity and aggregate turnover. Collectively small-scale processes can alter the ecosystem biogeochemical cycles. Together theses results suggest that linking microbial communities to coupled C-N cycles may have important implications for terrestrial C cycling feedbacks that are an integral part of the anthropocene era.
Matsui, T; Nakayama, H; Yoshida, K; Shinmyo, A
2003-10-01
Peroxidases (PRX, EC 1.11.1.7) are widely distributed across microorganisms, plants, and animals; and, in plants, they have been implicated in a variety of secondary metabolic reactions. In particular, horseradish (Armoracia rusticana) root represents the main source of commercial PRX production. The prxC1a gene, which encodes horseradish PRX (HRP) C, is expressed mainly in the roots and stems of the horseradish plant. HRP C1a protein is shown to be synthesized as a preprotein with both a N-terminal (NTPP) and a C-terminal propeptide (CTPP). These propeptides, which might be responsible for intracellular localization or secretion, are removed before or concomitant with production of the mature protein. We investigated the functional role of HRP C1a NTPP and CTPP in the determination of the vesicular transport route, using an analytical system of transgenically cultured tobacco cells (Nicotiana tabacum, BY2). Here, we report that NTPP and CTPP are necessary and sufficient for accurate localization of mature HRP C1a protein to vacuoles of the vesicular transport system. We also demonstrate that HRP C1a derived from a preprotein lacking CTPP is shunted into the secretory pathway.
The C-12/C-13 abundance ratio in Comet Halley
International Nuclear Information System (INIS)
Wyckoff, S.; Lindholm, E.; Wehinger, P.A.; Peterson, B.A.; Zucconi, J.M.
1989-01-01
The individual (C-13)N rotational lines in Comet Halley are resolved using high-resolution spectra of the CN B2Sigma(+)-X2Sigma(+) (0,0) band. The observe C-12/C-13 abundance ratio excludes a site of origin for the comet near Uranus and Neptune and suggests a condensation environment quite distinct from other solar system bodies. Two theories are presented for the origin of Comet Halley. One theory suggest that the comet originated 4.5 Gyr ago in an inner Oort cloud at a heliocentric distance greater than 100 AU where chemical fractionation led to the C-13 enrichment in the CN parent molecule prior to condensation of the comet nucleus. According to the other, more plausible theory, the comet nucleus condensed relatively recently from the interstellar medium which has become enriches in C-13 and was subsequently gravitationally captured by the solar system. 107 refs
Indian Academy of Sciences (India)
Administrator
C r. C. = CTPPY: concentration of TPPY; CAuNPs: concentration of Au NPs. The concentration of the Au NPs is calculated as follows: (1) The weight of Au (WAu) produced from the complete reduction of HAuCl4 is calculated by multiplying the mole of added HAuCl4 (weight of added. HAuCl4·4H2O divided by molecular ...
Directory of Open Access Journals (Sweden)
Wilson Mauricio Chicaiza
2013-11-01
Full Text Available En el presente documento se presenta una breve caracterización de los medios de comunicación empleados en arquitecturas multiprocesadas. Esta caracterización tiene como objetivo principal el mostrar un nuevo modelo de comunicación basado en conmutación de paquetes a los cuales se les denomina como Networks-On-Chip (NoC. Esta publicación muestra una arquitectura de red llamada NoC Hermes, la cual fue interconectada a un Multiprocessor-Systems-on-Chip (MPSoC compuesto de cuatro procesadores MicroBlaze. Está conexión se la realizó gracias al diseño y desarrollo de una Interfaz de Red generada en código VHDL. Por medio de la Interfaz de Red se consiguió que los procesadores MicroBlaze interactúen con los Switches de Hermes a fin de crear una arquitectura multiprocesada interconectada por una NoC. Con el motivo de realizar comparaciones también se creó otra arquitectura de multiprocesadores interconectados por buses. Para ambas arquitecturas se desarrolló una aplicación de Esteganografía enla que existe multiprocesamiento de dos procesadores trabajando simultáneamente. Lamentablemente sobre dicha aplicación no fue posible medir directamente la latencia y el consumo de energía, razón por la cual se utilizó simuladores que permitieron estimar dichas mediciones.
Endres, Eric S; Lakhmanskaya, Olga; Hauser, Daniel; Huber, Stefan E; Best, Thorsten; Kumar, Sunil S; Probst, Michael; Wester, Roland
2014-08-21
In the interstellar medium (ISM) ion–molecule reactions play a key role in forming complex molecules. Since 2006, after the radioastronomical discovery of the first of by now six interstellar anions, interest has grown in understanding the formation and destruction pathways of negative ions in the ISM. Experiments have focused on reactions and photodetachment of the identified negatively charged ions. Hints were found that the reactions of CnH(–) with H2 may proceed with a low (rate [Eichelberger, B.; et al. Astrophys. J. 2007, 667, 1283]. Because of the high abundance of molecular hydrogen in the ISM, a precise knowledge of the reaction rate is needed for a better understanding of the low-temperature chemistry in the ISM. A suitable tool to analyze rare reactions is the 22-pole radiofrequency ion trap. Here, we report on reaction rates for Cn(–) and CnH(–) (n = 2, 4, 6) with buffer gas temperatures of H2 at 12 and 300 K. Our experiments show the absence of these reactions with an upper limit to the rate coefficients between 4 × 10(–16) and 5 × 10(–15) cm(3) s(–1), except for the case of C2(–), which does react with a finite rate with H2 at low temperatures. For the cases of C2H(–) and C4H(–), the experimental results were confirmed with quantum chemical calculations. In addition, the possible influence of a residual reactivity on the abundance of C4H(–) and C6H(–) in the ISM were estimated on the basis of a gas-phase chemical model based on the KIDA database. We found that the simulated ion abundances are already unaffected if reaction rate coefficients with H2 were below 10(–14) cm(3) s(–1).
Formation and early hydration characteristics of C2.75B1.25A3$ in binary system of C2.75B1.25A3$-C2S
Directory of Open Access Journals (Sweden)
Wang, Shoude
2016-09-01
Full Text Available C2.75B1.25A3$ (2.75CaO•1.25BaO• 3Al2O3• SO3 is one of the important minerals and it govern-directly the early-strength of belite-barium calcium sulphoaluminate cement. In this paper a binary system C2.75B1.25A3$-C2S is selected to investigate the formation of C2.75B1.25A3$. In the range of 1100 °C–1200 °C, the earlier formed C2S hinders the formation of C2.75B1.25A3$. On the contrary, when the temperature is in the range of 1200 °C–1350 °C, the initially formed C2S could provide a surface for the nucleation of C2.75B1.25A3$ and cut down the potential barrier (?Gk* for the heterogeneous nucleation of C2.75B1.25A3$, which contributes to its formation. Moreover, at 1350 °C, the large amount of previously formed C2S benefits the extent of formation of C2.75B1.25A3$. The possible reason was that it could prevent sulfur evaporation. In early hydration age, AFm and AFt originating from C2.75B1.25A3$ hydration are found within 2 h and 12 h under 95% RH at 1 °C, respectively, whereas C2S is unhydrated at this moment.En el cemento de sulfoaluminato de calcio y bario, el C2.75B1.25A3$ (2.75CaO•1.25BaO• 3Al2 O3• SO3 es una de las principales fases, y regula directamente la resistencia inicial del cemento. En este trabajo, se ha seleccionado el sistema binario C2.75B1.25A3$-C2S para investigar la formación de C2.75B1.25A3$. En el rango de 1100 °C-1200 °C, el C2S formado anteriormente impide la formación de C2.75B1.25A3$, mientras que cuando la temperatura está entre 1200 °C-1350 °C, el C2S proporcionaría una superficie de nucleación de C2.75B1.25A3$ reduciendo la barrera de potencial (?Gk* para la nucleación heterogénea de C2.75B1.25A3$, lo que contribuye a su formación. Además, a 1350 °C, la gran cantidad de C2S formado beneficia la formación de C2.75B1.25A3$, ya que podía prevenir la evaporación del azufre. En las primeras etapas de la hidratación (entre 2 y 12h y 95% HR a 1 ºC se pueden encontrar AFM y AFt
C- and N-Metalated Nitriles: The Relationship between Structure and Selectivity.
Yang, Xun; Fleming, Fraser F
2017-10-17
Metalated nitriles are exceptional nucleophiles capable of forging highly hindered stereocenters in cases where enolates are unreactive. The excellent nucleophilicity emanates from the powerful inductive stabilization of adjacent negative charge by the nitrile, which has a miniscule steric demand. Inductive stabilization is the key to understanding the reactivity of metalated nitriles because this permits a continuum of structures that range from N-metalated ketenimines to nitrile anions. Solution and solid-state analyses reveal two different metal coordination sites, the formally anionic carbon and the nitrile nitrogen, with the site of metalation depending intimately on the solvent, counterion, temperature, and ligands. The most commonly encountered structures, C- and N-metalated nitriles, have either sp 3 or sp 2 hybridization at the nucleophilic carbon, which essentially translates into two distinct organometallic species with similar but nonidentical stereoselectivity, regioselectivity, and reactivity preferences. The hybridization differences are particularly important in S N i displacements of cyclic nitriles because the orbital orientations create very precise trajectories that control the cyclization selectivity. Harnessing the orbital differences between C- and N-metalated nitriles allows selective cyclization to afford nitrile-containing cis- or trans-hydrindanes, decalins, or bicyclo[5.4.0]undecanes. Similar orbital constraints favor preferential S N i displacements with allylic electrophiles on sp 3 centers over sp 2 centers. The strategy permits stereoselective displacements on secondary centers to set contiguous tertiary and quaternary stereocenters or even contiguous vicinal quaternary centers. Stereoselective alkylations of acyclic nitriles are inherently more challenging because of the difficulty in creating steric differentiation in a dynamic system with rotatable bonds. However, judicious substituent placement of vicinal dimethyl groups and a
Acera Pérez, Amèlia
2016-01-01
El cribado regular para el cáncer cervical ha demostrado reducir la incidencia y la mortalidad por esta enfermedad. El objetivo de este estudio fue mejorar la participación y la cobertura del cribado de cáncer de cérvix en las mujeres de 30 a 70 años, evaluar el impacto en la cobertura y conocer las características (lugar y periodicidad) de la misma, tras invitación personalizada en tres formas diferentes dirigida a las mujeres que en nuestra base de datos constaba una ausencia de cribado o u...
Zhang, Guanghui; Zhang, Tianyong; Li, Bin; Jiang, Shuang; Zhang, Xia; Hai, Li; Chen, Xingwei; Wu, Wubin
2018-03-01
An ingenious method was employed to design and fabricate the TiO2/g-C3N4 heterojunction photocatalysts in this study. The thermal oxidation etching of g-C3N4 nanosheets and the in situ growth of TiO2 nanocrystal on the surface of g-C3N4 nanosheets were completed simultaneously by the calcination process. The g-C3N4 nanosheets played a crucial role in regulating and assembling the structures and morphologies of TiO2. Furthermore, the thickness and content of g-C3N4, and the crystallinity of TiO2 in TiO2/g-C3N4 composites could be regulated and controlled by the calcination temperature. Among the resultant TiO2/g-C3N4 samples, the TiO2/g-C3N4 sample with 41.6 wt% g-C3N4 exhibited the highest photocatalytic activity. It could degrade almost all MO molecules under visible light irradiation within 3 h. Moreover, it displayed higher visible light photocatalytic performance for degrading MO solution than pure g-C3N4 and D-TiO2. The synergistic effect between TiO2 and g-C3N4 makes significant contributions to the enhancement of the visible light photocatalytic activity. In addition, the favorable photocatalytic performance of TiO2/g-C3N4 nanocomposites is also attributed to the porous structures and uniform morphologies, and large surface area. Furthermore, the resultant TiO2/g-C3N4 exhibits excellent photocatalytic stability. Radical trapping experiments indicated that rad O2- and h+ were the main reactive species during the photodegradation process under visible light irradiation. Hopefully, the results can offer new design and strategy for preparing other g-C3N4-based nanocomposites for environmental and energy applications.
Stevanovic, Milan
2014-01-01
Learning how to write C/C++ code is only the first step. To be a serious programmer, you need to understand the structure and purpose of the binary files produced by the compiler: object files, static libraries, shared libraries, and, of course, executables.Advanced C and C++ Compiling explains the build process in detail and shows how to integrate code from other developers in the form of deployed libraries as well as how to resolve issues and potential mismatches between your own and external code trees.With the proliferation of open source, understanding these issues is increasingly the res
N-(2,6-Dichlorophenyl-4-methylbenzamide
Directory of Open Access Journals (Sweden)
Vinola Z. Rodrigues
2011-08-01
Full Text Available In the title compound, C14H11Cl2NO, the two aromatic rings are nearly orthogonal to each other [dihedral angle 79.7 (1°], while the central amide core –NH—C(=O– is nearly coplanar with the benzoyl ring [N—C—C—C torsion angles = −5.5 (3 and 1772. (2°]. In the crystal, intermolecular N—H...O hydrogen bonds link the molecules into C(4 chains propagating in [001].
Hacia una definición de la virtud cívica
Directory of Open Access Journals (Sweden)
Jordi Tena Sánchez
2010-01-01
Full Text Available En el presente trabajo se trata de ofrecer una definición del concepto de virtud cívica. Se define la virtud cívica como la motivación causalmente eficiente para la acción públicamente orientada. En este sentido, las disposiciones y las conductas no se consideran constitutivas de dicha virtud. Se cree que la motivación virtuosa es aquella que se encuentra orientada hacia la promoción de la justicia social. Este elemento normativo del concepto lo vincula con la tradición liberal-igualitarista. Determinadas motivaciones, como el egoísmo, resultan incompatibles con la virtud cívica; otras, como el altruismo, son compatibles con la misma pero sólo serán virtuosas de manera efectiva cuando se hallen públicamente orientadas. Desde la perspectiva que aquí se sostiene, motivaciones incorrectas pueden dar lugar a acciones correctas; sin embargo, las motivaciones virtuosas no pueden generar acciones incorrectas en ningún caso. Finalmente, en lo referente a la extensión social de la virtud, se argumentará que la correcta articulación entre diseño institucional y virtud cívica puede constituir un óptimo social.
Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2
Energy Technology Data Exchange (ETDEWEB)
Cha Gon, Lee, E-mail: leechagon@eulji.ac.kr [Department of Pediatrics, Eulji General Hospital, College of Medicine, Eulji University, 68 Hangeulbiseok-ro, Nowon-gu, Seoul 139-711 (Korea, Republic of)
2016-03-21
A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)
Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2
International Nuclear Information System (INIS)
Cha Gon, Lee
2016-01-01
A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)
Directory of Open Access Journals (Sweden)
Juan Raúl Hernández Silva
2011-12-01
Full Text Available Objetivo: Determinar los cambios estructurales de la córnea en la cirugía de catarata por facoemulsificación sin complicaciones. Métodos: Se realizó un estudio prospectivo de pacientes operados de catarata por facoemulsificación coaxial por la técnica de pre chop sin complicaciones. A estos se les realizó microscopia confocal de la córnea con el CONFOSCAN 4 (Nidek Technologies con el objetivo de 40x y adaptador Z-Ring. Se realizó el estudio en el preoperatorio y en el posoperatorio (a las 24 horas, después de una semana, de un mes y a los tres meses. Resultados: Se demostraron cambios estructurales en la córnea como células epiteliales con núcleos hiperreflectivos alargadas en ocasiones y áreas de hiperreflectividad anómala a las 24 horas del posoperatorio. Persistieron queratocitos activados y la disminución de la hiperreflectividad de la matriz extracelular que desapareció al mes. Conclusiones: Aunque por biomicroscopia no se observen alteraciones corneales en el posoperatorio de la cirugía de catarata por facoemulsificación, sí se pueden demostrar por microscopia confocal de la córnea. Estas variaciones no influyen en la recuperación visual óptima de los pacientes.Objective: To determine the structural changes in the cornea in the cataract surgery using phacoemulsification without complications. Methods: A prospective study of patients operated on from cataract using the coaxial phacoemulsification (Pre Chop technique without complications was carried out. These patients also underwent confocal microscopy of the cornea with Confoscan4 (Nidek Technologies with 40x target and Z - Ring adapter. The study was performed in the preoperative period and postoperative period for 24 hours, one week, one month and three months after surgery. Results: Structural changes were observed in the cornea such as epithelial cells with hypereflectivity nucleus, occasionally elongated, , areas of anomalous hypereflectivity 24 hours after
Oxidation behavior of TiC, ZrC, and HfC dispersed in oxide matrices
International Nuclear Information System (INIS)
Arun, R.; Subramanian, M.; Mehrotra, G.M.
1990-01-01
The oxidation behavior of hot pressed TiC-Al 2 O 3 , TiC-ZrO 2 , ZrC-ZrO 2 , and HfC-HfO 2 composites has been investigated at 1273 K. The oxidation of TiC, ZrC, and HfC in hot-pressed composites containing ZrO 2 and HfO 2 has been found to be extremely rapid. The kinetics of oxidation of TiC and a 90 wt% TiC-Al 2 O 3 composite appear to be faster compared to that of pure TiC. X-ray diffraction results for hot-pressed ZrC-HfO 2 and HfC-HfO 2 composites indicate partial stabilization of tetragonal ZrO 2 and HfO 2 phases in these composites
Functional materials - Study of process for CVD SiC/C composite material
Energy Technology Data Exchange (ETDEWEB)
Choi, Doo Jin; Wang, Chae Chyun; Lee, Young Jin; Oh, Byung Jun [Yonsei University, Seoul (Korea)
2000-04-01
The CVD SiC coating techniques are the one of high functional material manufactures that improve the thermal, wear, oxidization and infiltration resistance of the surface of raw materials and extend the life of material. Silicon carbide films have been grown onto graphite substrates by low pressure chemical vapor deposition using MTS(CH{sub 3}SiCl{sub 3}) as a source precursor and H{sub 2} or N{sub 2} as a diluent gas. The experiments for temperature and diluent gas addition changes were performed. The effect of temperature from 900 deg. C to 1350 deg. C and the alteration of diluent gas species on the growth rate and structure of deposits have been studied. The experimental results showed that the deposition rate increased with increasing deposition temperature irrespective of diluent gases and reactant depletion effect increased especially at H{sub 2} diluent gas ambient. As the diluent gas added, the growth rate decreased parabolically. For N{sub 2} addition, surface morphology of leaf-like structure appeared, and for H{sub 2}, faceted structure at 1350 deg. C. The observed features were involved by crystalline phase of {beta}-SiC and surface composition with different gas ambient. We also compared the experimental results of the effect of partial pressure on the growth rate with the results of theoretical approach based on the Langmuir-Hinshelwood model. C/SiC composites were prepared by isothermal chemical vapor infiltration (ICVI). In order to fabricate the more dense C/SiC composites, a novel process of the in-situ whisker growing and filling during ICVI was devised, which was manipulated by alternating dilute gas species. The denser C/SiC composites were successfully prepared by the novel process comparing with the conventional ICVI process. 64 refs., 36 figs., 5 tabs. (Author)
Directory of Open Access Journals (Sweden)
Concepción López
2014-11-01
Full Text Available The study of the reactivity of the enantiopure ferrocenyl Schiff base (SC-[FcCH=N–CH(Me(C6H5] (1 (Fc = (η5-C5H5Fe(η5-C5H4 with cis-[PtCl2(dmso2] under different experimental conditions is reported. Four different types of chiral Pt(II have been isolated and characterized. One of them is the enantiomerically pure trans-(SC-[Pt{κ1-N[FcCH=N–CH(Me(C6H5]}Cl2(dmso] (2a in which the imine acts as a neutral N-donor ligand; while the other three are the cycloplatinated complexes: [Pt{κ2-C,N [(C6H4–N=CHFc]}Cl(dmso] (7a and the two diastereomers {(Sp,SC and (Rp,SC} of [Pt{κ2-C,N[(η5-C5H3–CH=N–{CH(Me(C6H5}]Fe(η5-C5H5}Cl(dmso] (8a and 9a, respectively. Isomers 7a-9a, differ in the nature of the metallated carbon atom [CPh (in 7a or CFc (in 8a and 9a] or the planar chirality of the 1,2-disubstituted ferrocenyl unit (8a and 9a. Reactions of 7a–9a with PPh3 gave [Pt{κ2-C,N[(C6H4–N=CHFc]}Cl(PPh3] (in 7b and the diastereomers (Sp,SC and (Rp,SC of [Pt{κ2-C,N[(η5-C5H3–CH=N–{CH(Me(C6H5}] Fe(η5-C5H5}Cl(PPh3] (8b and 9b, respectively. Comparative studies of the electrochemical properties and cytotoxic activities on MCF7 and MDA-MB231 breast cancer cell lines of 2a and cycloplatinated complexes 7b-9b are also reported. Theoretical studies based on DFT calculations have also been carried out in order to rationalize the results obtained from the cycloplatination of 1, the stability of the Pt(II complexes and their electrochemical properties.
Lifescience Database Archive (English)
Full Text Available niaqfvviq*kmkekkkil*llanivinqftix aikil*itlkmsxsfinvxivlvtsx*nxvgiigvveektpkkslgkrkkk Frame C: ---*n*merklym...l*xlffkrf**kikilpnl*sfnkr*rrrrrfynylpils*issrsl rskyyr*x*k*afhl*msxly**xanktx*e*l
Lifescience Database Archive (English)
Full Text Available 25 Translated Amino Acid sequence glleninni*q*tk*INKKKNNNHFFFLXFXIKN--- ---MNWAIRDGTYESFKGSPASKGILQFDMWNVTPS...r*cnsihc*snrisnskts*k*yklnytt*nsn*n skll Frame C: glleninni*q*tk*INKKKNNNHFFFLXFX
Chen, Ruirui; Senbayram, Mehmet; Blagodatsky, Sergey; Dittert, Klaus; Lin, Xiangui; Blagodatskaya, Evgenia; Kuzyakov, Yakov
2014-05-01
The increasing input of anthropogenically derived nitrogen (N) to ecosystems raises a crucial question: how does available N modify the decomposer community and thus affects the mineralization of soil organic matter (SOM). Moreover, N input modifies the priming effect (PE), that is, the effect of fresh organics on the microbial decomposition of SOM. We studied the interactive effects of C and N on SOM mineralization (by natural 13C labelling adding C4-sucrose or C4-maize straw to C3-soil) in relation to microbial growth kinetics and to the activities of five hydrolytic enzymes. This encompasses the groups of parameters governing two mechanisms of priming effects - microbial N mining and stoichiometric decomposition theories. In sole C treatments, positive PE was accompanied by a decrease in specific microbial growth rates, confirming a greater contribution of K-strategists to the decomposition of native SOM. Sucrose addition with N significantly accelerated mineralization of native SOM, whereas mineral N added with plant residues accelerated decomposition of plant residues. This supports the microbial mining theory in terms of N limitation. Sucrose addition with N was accompanied by accelerated microbial growth, increased activities of β-glucosidase and cellobiohydrolase, and decreased activities of xylanase and leucine amino peptidase. This indicated an increased contribution of r-strategists to the PE and to decomposition of cellulose but the decreased hemicellulolytic and proteolytic activities. Thus, the acceleration of the C cycle was primed by exogenous organic C and was controlled by N. This confirms the stoichiometric decomposition theory. Both K- and r-strategists were beneficial for priming effects, with an increasing contribution of K-selected species under N limitation. Thus, the priming phenomenon described in 'microbial N mining' theory can be ascribed to K-strategists. In contrast, 'stoichiometric decomposition' theory, that is, accelerated OM
Directory of Open Access Journals (Sweden)
Maximilian Lauterbach
2017-11-01
Full Text Available C4 photosynthesis is a carbon-concentrating mechanism that evolved independently more than 60 times in a wide range of angiosperm lineages. Among other alterations, the evolution of C4 from ancestral C3 photosynthesis requires changes in the expression of a vast number of genes. Differential gene expression analyses between closely related C3 and C4 species have significantly increased our understanding of C4 functioning and evolution. In Chenopodiaceae, a family that is rich in C4 origins and photosynthetic types, the anatomy, physiology and phylogeny of C4, C2, and C3 species of Salsoleae has been studied in great detail, which facilitated the choice of six samples of five representative species with different photosynthetic types for transcriptome comparisons. mRNA from assimilating organs of each species was sequenced in triplicates, and sequence reads were de novo assembled. These novel genetic resources were then analyzed to provide a better understanding of differential gene expression between C3, C2 and C4 species. All three analyzed C4 species belong to the NADP-ME type as most genes encoding core enzymes of this C4 cycle are highly expressed. The abundance of photorespiratory transcripts is decreased compared to the C3 and C2 species. Like in other C4 lineages of Caryophyllales, our results suggest that PEPC1 is the C4-specific isoform in Salsoleae. Two recently identified transporters from the PHT4 protein family may not only be related to the C4 syndrome, but also active in C2 photosynthesis in Salsoleae. In the two populations of the C2 species S. divaricata transcript abundance of several C4 genes are slightly increased, however, a C4 cycle is not detectable in the carbon isotope values. Most of the core enzymes of photorespiration are highly increased in the C2 species compared to both C3 and C4 species, confirming a successful establishment of the C2 photosynthetic pathway. Furthermore, a function of PEP-CK in C2 photosynthesis
Applications of Palladium-Catalyzed C-N Cross-Coupling Reactions.
Ruiz-Castillo, Paula; Buchwald, Stephen L
2016-10-12
Pd-catalyzed cross-coupling reactions that form C-N bonds have become useful methods to synthesize anilines and aniline derivatives, an important class of compounds throughout chemical research. A key factor in the widespread adoption of these methods has been the continued development of reliable and versatile catalysts that function under operationally simple, user-friendly conditions. This review provides an overview of Pd-catalyzed N-arylation reactions found in both basic and applied chemical research from 2008 to the present. Selected examples of C-N cross-coupling reactions between nine classes of nitrogen-based coupling partners and (pseudo)aryl halides are described for the synthesis of heterocycles, medicinally relevant compounds, natural products, organic materials, and catalysts.