WorldWideScience

Sample records for ricinus communis polyurethane

  1. Activity of Ricinus communis (Euphorbiaceae) against Spodoptera ...

    African Journals Online (AJOL)

    One of the most studied plant species with insecticidal properties is the castor bean Ricinus communis. However, its activity against Spodoptera frugiperda is unclear. Therefore, to determinate the insecticidal and insectistatic activities of methanol, hexane and ethyl acetate extracts of the seeds and leaves of R. communis, ...

  2. Poliuretana de mamona (Ricinus communis para desvio da crista tibial no cão Polyurethane resins derived from castor oil (Ricinus communis for tibial crest deviation in dogs

    Directory of Open Access Journals (Sweden)

    Patricia Popak Maria

    2004-06-01

    Full Text Available A luxação medial de patela é uma das principais afecções ortopédicas que afetam cães de raças de pequeno porte. Tendo como princípio que o desvio da crista tibial é uma das alterações anatômicas encontradas, este estudo objetivou avaliar o efeito da poliuretana de mamona (Ricinus communis aplicada em defeitos produzidos experimentalmente na porção proximal medial da tíbia de cães normais em fase de crescimento. Para isto, foram utilizados 12 cães subdivididos aleatoriamente em 3 grupos de igual número, com mesmo tratamento, mas com análise histopatológica aos 30 (GI, 60 (GII e 90 (GIII dias. O estudo constou de avaliações clínica, radiográfica, macroscópica, histopatológica, tomográfica e análise estatística. Avaliação clínica demonstrou não haver rejeição do implante. A análise radiográfica revelou intensa reação periosteal e neoformações ósseas no local da implantação. Macroscopicamente observou-se espessamento da crista tibial, neoformações ósseas e desvio lateral da crista. Os achados à microscopia óptica revelaram presença de tecido conjuntivo fibroso ao redor da poliuretana, ausência de proliferação óssea em direção ao implante e proliferação de periósteo na face medial das tíbias. A tomografia computadorizada revelou desvio lateral da crista em 11 animais e estes desvios foram estatisticamente significantes em nível de 5% por meio do teste t pareado.Medial patellar luxation is one of the most common orthopedic problems in small breeds of dogs and tibial crest deviation is a frequent accompaining anatomical abnormality. For that reason, the purpose of this study was to evaluate the behavior of castor oil derived polyurethane implants when apllied to experimental defects created on the medial side of the proximal tibia of normal puppies. Twelve dogs were randomly divided in 3 groups of 4 animals and were submitted to the same treatment. Histopathological study was performed

  3. Genotyping and Bioforensics of Ricinus communis

    Energy Technology Data Exchange (ETDEWEB)

    Hinckley, Aubree Christine [Univ. of California, Davis, CA (United States)

    2006-01-01

    The castor bean plant (Ricinus communis) is a member of the family Euphorbiaceae. In spite of its common name, the castor plant is not a true bean (i.e., leguminous plants belonging to the family, Fabaceae). Ricinus communis is native to tropical Africa, but because the plant was recognized for its production of oil with many desirable properties, it has been introduced and cultivated in warm temperate regions throughout the world (Armstrong 1999 and Brown 2005). Castor bean plants have also been valued by gardeners as an ornamental plant and, historically, as a natural rodenticide. Today, escaped plants grow like weeds throughout much of the southwestern United States, and castor seeds are even widely available to the public for order through the Internet. In this study, multiple loci of chloroplast noncoding sequence data and a few nuclear noncoding regions were examined to identify DNA polymorphisms present among representatives from a geographically diverse panel of Ricinus communis cultivated varieties. The primary objectives for this research were (1) to successfully cultivate castor plants and extract sufficient yields of high quality DNA from an assortment of castor cultivated varieties, (2) to use PCR and sequencing to screen available universal oligos against a small panel of castor cultivars, (3) to identify DNA polymorphisms within the amplified regions, and (4) to evaluate these DNA polymorphisms as appropriate candidates for assay development (see Figure 1). Additional goals were to design, test and optimize assays targeting any DNA polymorphisms that were discovered and to rapidly screen many castor cultivars to determine the amount of diversity present at that particular locus. Ultimately, the goal of this study was to construct a phylogeographic tree representing the genetic relationships present among Ricinus communis cultivars from diverse geographic regions. These research objectives were designed to test the hypothesis that cultivated varieties

  4. Implantes de resina de poliuretana vegetal (Ricinus communis na tração linear, fixação e fusão vertebral no cão: estudo experimental Implants of Ricinus communis polyurethane resin in distraction, fixation and vertebral fusion in dogs: experimental study

    Directory of Open Access Journals (Sweden)

    M.G. Laranjeira

    2004-10-01

    Full Text Available Placa e espaçador de polímero derivado do óleo de mamona (PDOM (Ricinus communis foram avaliados clínica, radiográfica e histologicamente na tração linear, fixação e fusão vertebral cervical em 20 cães adultos, sem raça definida, pesando entre 17 e 22kg. Foram sacrificados quatro animais aos 10, 30, 60, 90 e 120 dias de pós-operatório. Após exposição da coluna cervical, por acesso ventral, o disco intervertebral de C4-C5 foi fenestrado e a abordagem ao canal medular foi feita por meio de fenda óssea. Um espaçador de PDOM foi colocado preenchendo o defeito ósseo. Os corpos vertebrais C4-C5 foram fixados com placa do mesmo material, utilizando-se dois parafusos corticais em cada corpo vertebral. Apenas um animal apresentou déficit neurológico no pós-operatório imediato. Radiograficamente as vértebras mostravam-se normais e alinhadas, sem colapso do espaço intervertebral, porém não houve neoformação óssea entre as vértebras. Ao exame mielográfico, não houve compressão da medula espinhal. Os implantes foram efetivos em manter a tração linear e fixação das vértebras cervicais e não ocorreu a fusão vertebral.Clinical, radiographic and histological evaluation of plate and biomechanical spacer of Ricinus communis polyurethane resin were performed in distraction, fixation and vertebral cervical fusion in 20 adult dogs, weighting between 17 and 22kg. Four animals were euthanized at 10, 30, 60, 90 and 120 days after surgery. After ventral exposition of cervical spine, cervical disk fenestration was performed on intervertebral spaces C4-C5 and a slot was created. A biomechanical spacer of Ricinus communis polyurethane resin was placed to fill bone defect. C4-C5 spinous processes were fixed with plate of the same material, utilizing two cortical screws in each spinal process. Only one animal had neurological signs immediately after surgery. Radiographic examination indicated that vertebrae were normal and aligned

  5. Immunogenic Properties of Ricinus Communis Var Minor Seed on ...

    African Journals Online (AJOL)

    The immunogenic properties of Ricinus communis var minor seed was determined after feeding 7 healthy virgin albino white rabbits with varying doses of 0.5g – 0.9g dried ground Ricinus communis var minor seed included in their feed (5g/100g body weight). Booster doses of the same weight were further administered ...

  6. Antibacterial profile of fermented seed extracts of ricinus communis ...

    African Journals Online (AJOL)

    The study was carried out to ascertain the antibacterial properties inherent in fermented seed extracts of Ricinus communis. Dry seeds of R. communis (Castor oil plant) were deshelled, grounded to powder, fermented, and then extracted both with alcohol and water using Soxhlet machine. Different concentrations of the ...

  7. Estudo experimental do poliuretano de óleo de mamona (Ricinus communis como substituto parcial do tendão calcâneo comum em coelhos (Oryctolagus cuniculus An experimental study of polyurethane of castor-oil plant (Ricinus communis as a partial substitute of the common calcaneous tendon in rabbits (Oryctogalus cuniculus

    Directory of Open Access Journals (Sweden)

    C.M.F. Rezende

    2001-12-01

    Full Text Available Com o objetivo de avaliar a eficiência da prótese de poliuretano de mamona como substituto parcial do tendão calcâneo comum, foram utilizadas 30 coelhas da raça Nova Zelândia, entre dois e três meses de idade e peso médio de 2kg. Após anestesia geral, o procedimento cirúrgico em ambos os membros constou de incisão caudo-lateral no sentido longitudinal do terço médio ao distal da tíbia e exposição do tendão calcâneo comum. Após a tenectomia do tendão do músculo gastrocnêmio, a prótese de poliuretano de cerca de 0,5cm de extensão por 0,5cm de diâmetro foi fixada aos cotos proximal e distal do tendão, empregando-se o fio de polipropileno monofilamentar 4-0, conforme técnica modificada de Kessler. A prótese de poliuretano na forma elastomérica revelou propriedades como textura e flexibilidade semelhantes à do tecido tendinoso, pode ser confeccionada na forma e no tamanho almejados e permite ser moldada, cortada e esterilizada por calor úmido. Todos os animais apoiaram os membros operados imediatamente após o retorno anestésico. Não se observaram sinais clínicos de infecção e não ocorreu deiscência de ferida. Percebeu-se aumento de volume local devido ao edema, evidente na primeira semana pós-cirúrgica, que gradualmente desapareceu . À palpação foi possível delimitar com facilidade a prótese que se conservou fixa no local e intacta. Clinicamente o poliuretano de mamona não induziu reação desfavorável que comprometesse a cicatrização tendínea, podendo ser indicado como substituto temporário de tendão.With the goal of evaluating the efficiency of a prosthesis of castor-oil plant (Ricinus communis polyurethane as a partial substitute for common calcaneous tendon, 30 New Zealand female rabbits, aging between two to three months, weighting about 2kg were used. After general anesthesia, the surgical procedure in both members consisted of rear lateral longitudinal incision, in the medium third of the

  8. Phytochemical and Pharmacological Investigations of Ricinus communis Linn.

    Directory of Open Access Journals (Sweden)

    Ram Singh

    2015-01-01

    Full Text Available Medicinal plants have always played a vital role for the healthy human life. The family Euphorbiaceous is a family of flowering plants and contains nearly about 300 genera and 7,500 species. Amongst all, the species Ricinus communis or castor plant has high traditional and modern medicinal values. The individual parts of the plant like the seed, seed oil, leaves and the roots showed their importance in pharmacology. Traditionally, the plant has been used for the treatment of various diseases in traditional or folk remedies throughout the world. In modern pharmacology, this plant is reported to possess antioxidant, anti-inflammatory, anti-diabetic, central analgesic, antitumor, anti-nociceptive, antiasthmatic activity and other medicinal properties. These activities of the plant are due to the presence of important phytochemical constituents like flavonoids, glycosides, alkaloids, steroids, terpenoids etc. The aim of present article is to explore the chemical constituents, their structures and medicinal importance of Ricinus communis.

  9. Qualitative histologic evaluation of the tissue reaction to the polyurethane resin (ricinus communis - based biopolymer implantation assessed by light and scanning electron microscopy

    Directory of Open Access Journals (Sweden)

    Gustavo Campos Belmonte

    2013-01-01

    Full Text Available The tissue reaction of bone tissue accessed by light microscopy and scanning electron microscopy (SEM images after polyurethane resin implantation is presented in this study. Twenty four male rabbits were used, divided into two groups of 12 animals each (experimental group and control group in which full-thickness cranial defect was surgically created. At 30 and 90 days post operation 6 animals of each group were euthanized and bone samples were removed for analysis. The microscopic results indicated no inflammatory foreign body reaction, a perfect union between the polymer and surgical bone bed surface, lack of bone resorption and presence of a thin layer of osteogenic material covering the polymer surface in contact with the surgical bone bed. The SEM images demonstrate the porosity of the resin, with diameters from 120 to 500 µm. This important feature of this polymer is associated with its osteoconductivity, allowing the bone growth inside it, improving the integration between the material and bone tissue. These results confirm that polyurethane resin derived from Ricinuscommunis is an excellent bone substitute for use in repair surgery for great bone losses.

  10. [Control effects of Ricinus communis extracts on Meloidogyne incognita].

    Science.gov (United States)

    Gao, Qian-Yuan; Hu, Fei-Long; Zhu, Hong-Hong; Liu, Man-Qiang; Li, Hui-Xin; Hu, Feng

    2011-11-01

    Toxicity test and pot experiment were conducted to study the nematocidal activity and control effects of Ricinus communis extracts on Meloidogyne incognita. The results showed that both the ricinine and the R. communis water extracts had high nematocidal activity. The ricinine at concentration 2 g x L(-1) and treated for 48 hours had the strongest nematocidal activity, leading to 91.5% of corrected mortality of M. incognita and with the LC50 being 0.6 g x L(-1), whereas the R. communis water extracts at concentration 100 g x L(-1) and treated for 48 hours had the strongest nematocidal activity, which led to 83.5% of corrected mortality of M. incognita, and the LC50 was 18.3 g x L(-1). With the inoculation of M. incognita treated with ricinine, R. communis water extracts, and R. communis leaf powder, respectively, on tomato seedlings, the mean number of plant root-knots was 17.6 +/- 1.7, 20.6 +/- 1.5 and 22.8 +/- 3.7, respectively, being significantly lower than the control (37.4 +/- 2.3), and the root length increased by 46.8%, 34.5% and 33.8%, and the plant height increased by 33.5%, 22.6% and 15.8%, and the fresh mass increased by 41.4%, 18.9% and 10.1%, respectively, compared with the control. All the results suggested that R. communis extracts could mitigate the harm of M. incognita, and had obvious effects on potted tomato against M. incognita.

  11. Draft genome sequence of the oilseed species Ricinus communis.

    Science.gov (United States)

    Chan, Agnes P; Crabtree, Jonathan; Zhao, Qi; Lorenzi, Hernan; Orvis, Joshua; Puiu, Daniela; Melake-Berhan, Admasu; Jones, Kristine M; Redman, Julia; Chen, Grace; Cahoon, Edgar B; Gedil, Melaku; Stanke, Mario; Haas, Brian J; Wortman, Jennifer R; Fraser-Liggett, Claire M; Ravel, Jacques; Rabinowicz, Pablo D

    2010-09-01

    Castor bean (Ricinus communis) is an oilseed crop that belongs to the spurge (Euphorbiaceae) family, which comprises approximately 6,300 species that include cassava (Manihot esculenta), rubber tree (Hevea brasiliensis) and physic nut (Jatropha curcas). It is primarily of economic interest as a source of castor oil, used for the production of high-quality lubricants because of its high proportion of the unusual fatty acid ricinoleic acid. However, castor bean genomics is also relevant to biosecurity as the seeds contain high levels of ricin, a highly toxic, ribosome-inactivating protein. Here we report the draft genome sequence of castor bean (4.6-fold coverage), the first for a member of the Euphorbiaceae. Whereas most of the key genes involved in oil synthesis and turnover are single copy, the number of members of the ricin gene family is larger than previously thought. Comparative genomics analysis suggests the presence of an ancient hexaploidization event that is conserved across the dicotyledonous lineage.

  12. Spontaneous poisoning by Ricinus communis (Euphorbiaceae in cattle

    Directory of Open Access Journals (Sweden)

    Samuel S.C. Albuquerque

    2014-09-01

    Full Text Available The aim of this study is to report cases of spontaneous poisoning of cattle by Ricinus communis (castor beans in Paraíba, a semiarid region of northeastern Brazil. The cases were observed in 2 herds on neighboring properties in 2013. Clinical signs developed within 6-24 h and consisted of weakness, tachycardia, dyspnea, profuse watery diarrhea, dehydration, depression, instability, cramps, permanent lateral recumbency and death within 48-72 h. Of the 60 cattle at risk, 19 were affected and 14 died. Five fully recovered after the course of 12 days. Three animals were necropsied. The main gross lesions were hemopericardium, hemothorax, pulmonary edema, petechial hemorrhages in the epicardium and endocardium, ecchymoses at the papillary muscles and suffusions on the intercostal muscles. Hemorrhages were also observed in the abdominal cavity, spleen and mucosa of the abomasum and small intestine. The rumen content was liquid with a large amount of castor bean seeds. There were circular, whitish and focally diffuse areas in the liver parenchyma. The main microscopic lesions consisted of multifocal coagulative myocardial necrosis with the presence of mononuclear cell infiltration and varying degrees of bleeding between cardiac muscle fibers. The abomasum and small intestine mucosae and submucosa had mild edema and mononuclear and polymorphonuclear inflammatory cell infiltration. The diagnosis of R. communis was based on the history of plant consumption, clinical signs, pathology of the disease and the presence of large amounts of castor bean seeds in the forestomachs.

  13. Effect of copper on castor bean (Ricinus communis L.) growth

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Lucia Helena Garofalo; Cunha, Tassio Cavalcanti da Silva; Lima, Vinicius Mota; Cabral, Paulo Cesar Pinto; Barros Junior, Genival; Lacerda, Rogerio Dantas de [Universidade Federal de Campina Grande (UAEAg/UFCG), PB (Brazil). Unidade Academica de Engenharia Agricola

    2008-07-01

    Castor beans crop (Ricinus communis L.) is raising attention as an alternative crop for oil and biodiesel production. Despite the mineral fertilization is an important factor for increasing castor yield, few research has been made on this issue, mainly on the use de copper. In order to evaluate the effects of copper on growth of this plant an experiment was carried out in a greenhouse, in Campina Grande, Paraiba State, Brazil, from July to December 2007. The substrate for the pot plants was a 6 mm-sieved surface soil (Neossolo Quartzarenico). The experimental design was a completely randomized with three replications. The treatments were composed of five levels of Cu (0; 1; 2; 3 and 4 mg dm{sup -3}), which were applied at the time of planting. One plant of castor bean, cultivar BRS 188 - Paraguacu, was grown per pot after thinning and was irrigated whenever necessary. Data on plant height, number and length of leaves and stem diameter were measured at 21, 34, 77 and 103 days after planting. Copper levels used, in general, did not affect the plant height, stem diameter and leaf area, however they influenced the leaves and shoot biomass dry mass and the quadratic trend was the best to show the behavior of these. (author)

  14. Identification and differentiation of Ricinus communis L. using SSR markers

    Directory of Open Access Journals (Sweden)

    Zdenka Gálová

    2015-12-01

    Full Text Available Normal 0 false false false CS JA X-NONE The castor-oil plant (Ricinus communis L., a member of the spurge family (Euphorbiaceae, is a versatile industrial oil crop that is cultivated in many tropical and subtropical regions of the world. Castor oil is of continuing importance to the global specialty chemical industry because it is the only commercial source of a hydroxylated fatty acid. Castor also has tremendous future potential as an industrial oilseed crop because of its high seed oil content, unique fatty acid composition, potentially high oil yields and ability to be grown under drought and saline conditions. Knowledge of genetic variability is important for breeding programs to provide the basis for developing desirable genotypes. The aim of this study was to assess genetic diversity within the set of 60 ricin genotypes using 10 SSR primers. Ten SSR primers revealed a total of 67 alleles ranging from 4 to 9 alleles per locus with a mean value of 6.70 alleles per locus. The PIC values ranged from 0.719 to 0.860 with an average value of 0.813 and the DI value ranged from 0.745 to 0.862 with an average value of 0.821. Probability of identity (PI was low ranged from 0.004 to 0.018 with an average of 0.008. A dendrogram was constructed from a genetic distance matrix based on profiles of the 10 SSR loci using the unweighted pair-group method with the arithmetic average (UPGMA. According to analysis, the collection of 60 diverse accessions of castor bean was clustered into six clusters. We could not distinguish 2 genotypes grouped in cluster 1, RM-96 and RM-98, which are genetically the closest. Knowledge on the genetic diversity of castor can be used to future breeding programs of castor.

  15. Toxic effects of Ricinus communis non-protein trypsin inhibitor on ...

    African Journals Online (AJOL)

    In the study reported herein, we aimed to isolate a trypsin inhibitor from Ricinus communis leaves through chromatographic and spectrometric techniques and evaluate its toxic effects on the development of Spodoptera frugiperda larvae. Plant extracts were submitted to fractionation in adsorption column. The fraction 10 ...

  16. In vitro antimicrobial and larvicidal properties of wild Ricinus communis L. in Mauritius

    Directory of Open Access Journals (Sweden)

    Sillma Rampadarath

    2016-02-01

    Conclusions: Ricinus communis (castor plant extracts possess larvicidal properties providing an effective eco-friendly control for fruit flies. The antimicrobial results justify the use of this plant in traditional medicine and the practice of supplementing decoctions/concoctions with conventional antibiotics.

  17. Essential oil of the leaves of Ricinus communis L.: in vitro cytotoxicity and antimicrobial properties.

    Science.gov (United States)

    Zarai, Zied; Ben Chobba, Ines; Ben Mansour, Riadh; Békir, Ahmed; Gharsallah, Néji; Kadri, Adel

    2012-08-13

    The aim of the present study was to appraise the antimicrobial activity of Ricinus communis L. essential oil against different pathogenic microorganisms and the cytotoxic activity against HeLa cell lines. The agar disk diffusion method was used to study the antibacterial activity of Ricinus communis L. essential oil against 12 bacterial and 4 fungi strains. The disc diameters of zone of inhibition (DD), the minimum inhibitory concentrations (MIC) and the concentration inhibiting 50% (IC50) were investigated to characterize the antimicrobial activities of this essential oil. The in vitro cytotoxicity of Ricinus communis L. essential oil was examined using a modified MTT assay; the viability and the IC50 were used to evaluate this test. The essential oil from the leaves of Ricinus communis L. was analyzed by GC-MS and bioassays were carried out. Five constituents of the oil were identified by GC-MS. The antimicrobial activity of the oil was investigated in order to evaluate its efficacy against twelve bacteria and four fungi species, using disc diffusion and minimum inhibitory concentration methods. The essential oil showed strong antimicrobial activity against all microorganisms tested with higher sensitivity for Bacillus subtilis, Staphylococcus aureus and Enterobacter cloacae. The cytotoxic and apoptotic effects of the essential oil on HeLa cell lines were examined by MTT assay. The cytotoxicity of the oil was quite strong with IC50 values less than 2.63 mg/ml for both cell lines. The present study showed the potential antimicrobial and anticarcinogenic properties of the essential oil of Ricinus communis L., indicating the possibilities of its potential use in the formula of natural remedies for the topical treatment of infections.

  18. Use of Energy Crop (Ricinus communis L.) for Phytoextraction of Heavy Metals Assisted with Citric Acid.

    Science.gov (United States)

    Zhang, Hui; Chen, Xueping; He, Chiquan; Liang, Xia; Oh, Kokyo; Liu, Xiaoyan; Lei, Yanru

    2015-01-01

    Ricinus communis L. is a bioenergetic crop with high-biomass production and tolerance to cadmium (Cd) and lead (Pb), thus, the plant is a candidate crop for phytoremediation. Pot experiments were performed to study the effects of citric acid in enhancing phytoextraction of Cd/Pb by Ricinus communis L. Citric acid increased Cd and Pb contents in plant shoots in all treatments by about 78% and 18-45%, respectively, at the dosage of 10 mM kg(-1) soil without affecting aboveground biomass production. Addition of citric acid reduced CEC, weakened soil adsorption of heavy metals and activated Cd and Pb in soil solutions. The acid-exchangeable fraction (BCR-1) of Pb remained lower than 7% and significantly increased with citric acid amendment. Respective increases in soil evaluation index induces by 14% and 19% under the Cd1Pb50 and Cd1Pb250 treatments upon addition of citric acid resulted in soil quality improvement. Ricinus communis L. has great potential in citric acid-assisted phytoextraction for Cd and Pb remediation.

  19. In vitro antimicrobial activity of an experimental dentifrice based on Ricinus communis.

    Science.gov (United States)

    Leite, Vanessa Maria Fagundes; Pinheiro, Juliana Barchelli; Pisani, Marina Xavier; Watanabe, Evandro; de Souza, Raphael Freitas; Paranhos, Helena de Freitas Oliveira; Lovato-Silva, Cláudia Helena

    2014-01-01

    This study evaluated the antimicrobial activity of a Ricinus communis-based experimental dentifrice for denture hygiene against the following standard strains: Staphylococcus aureus, Escherichia coli, Streptococcus mutans, Enterococcus faecalis, Candida albicans and Candida glabrata. The minimum inhibitory concentration (MIC) assay was performed with R. communis in pure oil at 2.5%. Only E. coli was not inhibited by R. communis, but the MIC (0.0781%) was effective against the other microorganisms. From these results it was determined the R. communis concentrations for experimental dentifrices, 1, 2, 5 and 10%, which were evaluated by the test-well diffusion in agar. The commercial dentifrices Colgate, Trihydral and Corega Brite were tested for comparative purposes. The diameter of the zones of bacterial growth inhibition produced around the wells was measured (in mm) with a rule under reflected light. Data were analyzed statistically by analysis of variance and Tukey's post-hoc test (α=0.05). Neither the commercial nor the experimental dentifrices were effective against E. coli. The experimental dentifrices containing R. communis at 2, 5 and 10% presented action against S. mutans, S. aureaus and E. faecallis. The experimental dentifrices showed no antimicrobial activity against Candida spp. and E. coli in any of the tested concentrations. Trihydral was the most effective. Comparing the experimental dentifrices, the product with 10% R. communis produced the largest zones of bacterial growth inhibition and had similar antimicrobial activity to the commercial dentifrices, except against S. aureus.

  20. IMUNIDADE CRUZADA PELAS SEMENTES DE Abrus precatorius E Ricinus communis EM BOVINOS Crossimmunity by the seeds of Abrus precatorius and Ricinus communis in cattle

    Directory of Open Access Journals (Sweden)

    Carlos Hubinger Tokarnia

    1997-01-01

    Full Text Available Cinco bovinos imunizados contra a ação tóxica das sementes de Abrus precatorius L. ("tento", "jiquiriti" não adoeceram ou somente levemente pela administração das sementes de Ricinus communis L. ("mamona", em doses que em bovinos que antes nunca ingeriram sementes de A. precatorius ou R. communis, causaram intoxicação de intensidade de grau moderado a acentuado ou até a morte. Um sexto bovino, que não ficou bem imunizado contra a ação tóxica das sementes de A. precatorius, adoeceu em grau acentuado pela administração de dose elevada das sementes de R. communis. Já dos cinco bovinos imunizados contra a ação tóxica das sementes de R. communis quatro adoeceram em grau acentuado, oquinto em grau moderado, pela administração das sementes de A. precatorias em doses que em bovinos que antes nunca ingeriram sementes de R. communis ou A. precatorius causaram intoxicação de intensidade leve a acentuada. Estes resultados permitem concluir que bovinos imunizados contra a ação tóxica das sementes de A. precatorius são resistentes à ação tóxica das sementes de R. communis, mas que o contrário não ocorre, isto é, bovinos imunizados contra a ação tóxica das sementes de R. communis, não se mostraram protegidos contra a intoxicação por A. precatorius. Estudos anteriores por outros autores mostraram que as toxalbuminas de A. precatorius e R. communis, respectivamente abrina e ricina, são diferentes do ponto de vista antigênico. Uma explicação para a divergência desses resultados com os nossos poderia estar no fato de que no presente estudo foram usados poligástricos que receberam as sementes por via oral, enquanto que nos estudos anteriores foram usados monogástricos em que as sementes ou as toxinas foram aplicadas por via parenteral. A administração de folhas frescas ou do pericarpo do fruto de R. communis a bovinos imunizados contra a ação das sementes desta planta tiveram o mesmo efeito tóxico que em animais n

  1. Evaluation of Ricinus communis L. for the Phytoremediation of Polluted Soil with Organochlorine Pesticides

    Directory of Open Access Journals (Sweden)

    Sandra Regina Rissato

    2015-01-01

    Full Text Available Phytoremediation is an attractive alternative to conventional treatments of soil due to advantages such as low cost, large application areas, and the possibility of in situ treatment. This study presents the assessment of phytoremediation processes conducted under controlled experimental conditions to evaluate the ability of Ricinus communis L., tropical plant species, to promote the degradation of 15 persistent organic pollutants (POPs, in a 66-day period. The contaminants tested were hexachlorocyclohexane (HCH, DDT, heptachlor, aldrin, and others. Measurements made in rhizosphere soil indicate that the roots of the studied species reduce the concentration of pesticides. Results obtained during this study indicated that the higher the hydrophobicity of the organic compound and its molecular interaction with soil or root matrix the greater its tendency to concentrate in root tissues and the research showed the following trend: HCHs < diclofop-methyl < chlorpyrifos < methoxychlor < heptachlor epoxide < endrin < o,p′-DDE < heptachlor < dieldrin < aldrin < o,p′-DDT < p,p′-DDT by increasing order of log Kow values. The experimental results confirm the importance of vegetation in removing pollutants, obtaining remediation from 25% to 70%, and demonstrated that Ricinus communis L. can be used for the phytoremediation of such compounds.

  2. Effects of autoclaving on the proximate composition of stored castor (Ricinus communis seeds

    Directory of Open Access Journals (Sweden)

    ANTHONY NEGEDU

    2013-11-01

    Full Text Available Negedu A, Ameh JB, Umoh VJ, Atawodi SE, Rai MK. 2013. Effects of autoclaving on the proximate composition of stored castor (Ricinus communis seeds. Nusantara Bioscience 5: 51-56. The effect of autoclaving on the proximate composition, free fatty acids and peroxide value of castor (Ricinus communis L. seeds in storage were studied. Seeds of castor were surface sterilized, dried and divided into two equal sets of 300g each. One set was autoclaved at 15 1b pressure for 30 minutes at 121oC and the other set served as control. Each set was prepared in triplicates and both sets were stored under same room temperature conditions for a period of 180 days and agitated intermittently. Analysis of the proximate composition showed that autoclaving treatment caused an increased total fat content, reduced moisture, protein, nitrogen free extract (soluble sugar and ash contents of the seeds in storage, as well as a non-significant increase in crude fiber (non-soluble sugar content. It increased the free fatty acid content and decreased the peroxide value of seed oil.

  3. Fractionation of Stable Cadmium Isotopes in the Cadmium Tolerant Ricinus communis and Hyperaccumulator Solanum nigrum

    Science.gov (United States)

    Wei, Rongfei; Guo, Qingjun; Wen, Hanjie; Liu, Congqiang; Yang, Junxing; Peters, Marc; Hu, Jian; Zhu, Guangxu; Zhang, Hanzhi; Tian, Liyan; Han, Xiaokun; Ma, Jie; Zhu, Chuanwei; Wan, Yingxin

    2016-01-01

    Cadmium (Cd) isotopes provide new insights into Cd uptake, transport and storage mechanisms in plants. Therefore, the present study adopted the Cd-tolerant Ricinus communis and Cd-hyperaccumulator Solanum nigrum, which were cultured under controlled conditions in a nutrient solution with variable Cd supply, to test the isotopic fractionation of Cd during plant uptake. The Cd isotope compositions of nutrient solutions and organs of the plants were measured by multiple collector inductively coupled plasma mass spectrometry (MC-ICPMS). The mass balance of Cd isotope yields isotope fractionations between plant and Cd source (δ114/110Cdorgans-solution) of −0.70‰ to −0.22‰ in Ricinus communis and −0.51‰ to −0.33‰ in Solanum nigrum. Moreover, Cd isotope fractionation during Cd transport from stem to leaf differs between the Cd-tolerant and -hyperaccumulator species. Based on these results, the processes (diffusion, adsorption, uptake or complexation), which may induce Cd isotope fractionation in plants, have been discussed. Overall, the present study indicates potential applications of Cd isotopes for investigating plant physiology. PMID:27076359

  4. Effects of cold-girdling on flows in the transport phloem in Ricinus communis: is mass flow ihibited?

    NARCIS (Netherlands)

    Peuke, A.D.; Windt, C.W.; As, van H.

    2006-01-01

    The effects of cold girdling of the transport phloem at the hypocotyl of Ricinus communis on solute and water transport were investigated. Effects on the chemical composition of saps of phloem and xylem as well as of stem tissue were studied by conventional techniques and the water flow in the

  5. Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.

    2015-01-01

    Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach by Paulo Roberto Ribeiro de Jesus The main objective of this thesis was to provide a detailed analysis of physiological,

  6. Metabolite profiling of Ricinus communis germination at different temperatures provides new insights into thermo-mediatedrequirements for successful seedling establishment

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.; Willems, L.A.J.; Mutimawurugo, M.C.; Fernandez, L.G.; Castro, De R.D.; Ligterink, W.; Hilhorst, H.W.M.

    2015-01-01

    Ricinus communis seeds germinate to a high percentage and faster at 35¿C than at lower temperatures, butwith compromised seedling establishment. However, seedlings are able to cope with high temperaturesat later stages of seedling establishment if germination occurred at lower temperatures. Our

  7. Selective response of Ricinus communis seedlings to soil borne rhizoctonia infection

    Directory of Open Access Journals (Sweden)

    Andras Bittsanszky

    2015-09-01

    Full Text Available Seedlings of Ricinus communis tolerated soil-borne Rhizoctonia infection in strain dependent manner. There was no connection revealed between pathogenicity of strains and their origin or taxonomic position, however, the castor plant proved to be susceptible to most strains highly pathogenic to other host plants as well. Rhizoctonia zeae (teleomorph: Waitea circinata, a species new for European flora, was less aggressive to R. communis as the most potent R. solani strains. The effect of Rhizoctonia infection on mass accumulation of hypocotyls was more prominent than that on cotyledons. The protein content and glutathione S-transferase (GST activity increased in parallel with evolution of disease syndrome. Metalaxyl, an acetanilide type systemic anti-omycete fungicide induced locally the GST activity in R. communis cotyledons with 24 hours lag phase, and this induction was altered in the seedlings grown in Rhizoctonia infested soil by strain dependent manner. It might be concluded, that the stress response related detoxication mechanisms of plants in tolerant host/parasite pairs take effect at higher level than in highly susceptible relationships.

  8. Apis mellifera pollination improves agronomic productivity of anemophilous castor bean (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Rômulo A.G. Rizzardo

    2012-12-01

    Full Text Available Castor bean (Ricinus communis L. is cultivated mainly for biodiesel production because of its oil-rich seeds; it is assumed to be an anemophylous species. But pollination deficit can lead to low productivity often attributed to other reasons. In this paper, we investigated pollination requirements, pollination mechanism, occurrence of pollination deficit, and the role of biotic pollinators in a large commercial plantation of castor bean. Our results show that R. communis bears a mixed breeding system favoring selfing by geitonogamy, although the wind promotes mostly outcrossing. We also found that the honey bee (Apis mellifera L. foraging on castor bean can both transfer pollen from male to female flowers within the same raceme and boost the release of airborne pollen by male flowers. Both situations increase geitonogamy rates, raising significantly fruit set and seed yield. This is the first report of an animal foraging activity increasing seed yield in an anemophilous and geitonogamous crop and elucidates the role of biotic pollinators in castor bean reproduction.A mamoneira (Ricinus communis L. é cultivada principalmente para produção de biodiesel devido ao alto teor de óleo de suas sementes e considerada como sendo de polinização anemófila. Mas déficits de polinização podem levar a baixos índices de produtividade geralmente atribuídos a outros fatores. Neste trabalho foram investigados os requerimentos, mecanismos e déficit de polinização e o papel dos polinizadores bióticos em um monocultivo comercial de mamona. Os resultados mostram que R. communis possui um sistema de polinização misto, favorecendo a autopolinização por geitonogamia, embora o vento normalmente promova polinização cruzada. Observou-se também que a abelha melífera (Apis mellifera L. forrageando na mamoneira pode tanto transferir pólen das flores estaminadas para as pistiladas do mesmo racemo, quanto aumentar consideravelmente a liberação de p

  9. Green synthesis of silver nanoparticles by Ricinus communis var. carmencita leaf extract and its antibacterial study

    Science.gov (United States)

    Ojha, Sunita; Sett, Arghya; Bora, Utpal

    2017-09-01

    In this study, we report synthesis of silver nanoparticles (RcAgNPs) from silver nitrate solution using methanolic leaf extract of Ricinus communis var. carmencita. The polyphenols present in the leaves reduce Ag++ ions to Ag0 followed by a color change. Silver nanoparticle formation was ensured by surface plasmon resonance between 400 nm to 500 nm. Crystallinity of the synthesized nanoparticles was confirmed by UHRTEM, SAED and XRD analysis. The capping of phytochemicals and thermal stability of RcAgNPs were assessed by FTIR spectra and TGA analysis, respectively. It also showed antibacterial activity against both gram positive and gram negative strains. RcAgNPs were non-toxic against normal cell line (mouse fibroblast cell line L929) at lower concentrations (80 µg ml-1).

  10. Forensic Applications of Light-Element Stable Isotope Ratios of Ricinus communis Seeds and Ricin Preparations

    Energy Technology Data Exchange (ETDEWEB)

    Kreuzer, Helen W.; West, Jason B.; Ehleringer, James

    2013-01-01

    Seeds of the castor plant Ricinus communis, also known as castor beans, are of forensic interest because they are the source of the poison ricin. We have tested whether stable isotope ratios of castor seeds and ricin prepared by various methods can be used as a forensic signature. We collected over 300 castor seed samples from locations around the world and measured the C, N, O, and H stable isotope ratios of the whole seeds, oil, and three types of ricin preparations. Our results demonstrate that N isotope ratios can be used to correlate ricin prepared by any of these methods to source seeds. Further, stable isotope ratios distinguished >99% of crude and purified ricin protein samples in pair-wise comparison tests. Stable isotope ratios therefore constitute a valuable forensic signature for ricin preparations.

  11. Isotope labeling-based quantitative proteomics of developing seeds of castor oil seed (Ricinus communis L.)

    DEFF Research Database (Denmark)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Schwämmle, Veit

    2013-01-01

    could be mapped to extant castor gene models, considerably expanding the number of proteins so far identified from developing castor seeds. Cluster validation and statistical analysis resulted in 975 protein trend patterns and the relative abundance of 618 proteins. The results presented in this work......In this study, we used a mass spectrometry-based quantification approach employing isotopic (ICPL) and isobaric (iTRAQ) labeling to investigate the pattern of protein deposition during castor oil seed (Ricinus communis L.) development, including that of proteins involved in fatty acid metabolism......, seed-storage proteins (SSPs), toxins, and allergens. Additionally, we have used off-line hydrophilic interaction chromatography (HILIC) as a step of peptide fractionation preceding the reverse-phase nanoLC coupled to a LTQ Orbitrap. We were able to identify a total of 1875 proteins, and from these 1748...

  12. Production, optimization and quality assessment of biodiesel from Ricinus communis L. oil

    Directory of Open Access Journals (Sweden)

    Maryam Ijaz

    2016-04-01

    Full Text Available At present, biodiesel is gaining tremendous attention due to its eco-friendly nature and is possible substitute for diesel fuel. Biodiesel as renewable energy source can be produced from edible and non-edible feedstock. Non-edible resources are preferred to circumvent for food competition. In the present study FAME was produced from Ricinus communis L. oil by transesterification with methanol and ethanol in the presence of potassium hydroxide. The practical optimal condition for the production of biodiesel from castor bean was found to be: methanol/oil molar ratio, 6:1; temperature, 60 °C; time, 45 min; catalyst concentration 0.32 g. Quality assessment of biodiesel showed comparable results with ASTM standards. The values of specific gravity (SG were 0.5, kinematic viscosity 2.45 cSt, acid values 0.13 mg KOH/g, carbon residue 0.03%, flash point 119 °C, fire point 125 °C, cloud point −10 °C and pour point −20 °C of Ricinus FAME, respectively. Based on our data, it is suggested that to overcome prevailing energy crisis this non-edible plant is useful for production of biodiesel, which is an alternate to fossil fuel and may be used alone or in blend with HSD in engine combustion.

  13. Apis mellifera pollination improves agronomic productivity of anemophilous castor bean (Ricinus communis).

    Science.gov (United States)

    Rizzardo, Rômulo A G; Milfont, Marcelo O; Silva, Eva M S da; Freitas, Breno M

    2012-12-01

    Castor bean (Ricinus communis L.) is cultivated mainly for biodiesel production because of its oil-rich seeds; it is assumed to be an anemophylous species. But pollination deficit can lead to low productivity often attributed to other reasons. In this paper, we investigated pollination requirements, pollination mechanism, occurrence of pollination deficit, and the role of biotic pollinators in a large commercial plantation of castor bean. Our results show that R. communis bears a mixed breeding system favoring selfing by geitonogamy, although the wind promotes mostly outcrossing. We also found that the honey bee (Apis mellifera L.) foraging on castor bean can both transfer pollen from male to female flowers within the same raceme and boost the release of airborne pollen by male flowers. Both situations increase geitonogamy rates, raising significantly fruit set and seed yield. This is the first report of an animal foraging activity increasing seed yield in an anemophilous and geitonogamous crop and elucidates the role of biotic pollinators in castor bean reproduction.

  14. Identification and expression profiles of the WRKY transcription factor family in Ricinus communis.

    Science.gov (United States)

    Li, Hui-Liang; Zhang, Liang-Bo; Guo, Dong; Li, Chang-Zhu; Peng, Shi-Qing

    2012-07-25

    In plants, WRKY proteins constitute a large family of transcription factors. They are involved in many biological processes, such as plant development, metabolism, and responses to biotic and abiotic stresses. A large number of WRKY transcription factors have been reported from Arabidopsis, rice, and other higher plants. The recent publication of the draft genome sequence of castor bean (Ricinus communis) has allowed a genome-wide search for R. communis WRKY (RcWRKY) transcription factors and the comparison of these positively identified proteins with their homologs in model plants. A total of 47 WRKY genes were identified in the castor bean genome. According to the structural features of the WRKY domain, the RcWRKY are classified into seven main phylogenetic groups. Furthermore, putative orthologs of RcWRKY proteins in Arabidopsis and rice could now be assigned. An analysis of expression profiles of RcWRKY genes indicates that 47 WRKY genes display differential expressions either in their transcript abundance or expression patterns under normal growth conditions. Copyright © 2012 Elsevier B.V. All rights reserved.

  15. Energy flow in castor bean (Ricinus communis L. production systems Fluxos de energia em sistemas de produção de mamona (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Adilson Nunes da Silva

    2010-12-01

    Full Text Available Although energy analysis is a way to evaluate the sustainability of production systems, this practice is not often used in the agribusiness. In this context, the castor bean (Ricinus communis L is an agricultural crop not yet well studied despite its great potential in the Brazilian energetic scenario. This article aimed to evaluate the productive potential of the castor bean oil, using an energetic view applied to two management systems: low (System 1 and medium (System 2 technologies. The quantification of the used material fluxes was made converting these factors in energy units. The input energy fluxes were 3,170.6 MJ ha¹ and 10,366.0 MJ ha¹ for Systems 1 and 2, respectively. The energy balance of System 1 was 11,938.2 MJ ha¹ and that of System 2 16,296.5 MJ ha¹. The net energetic gain or the energy gain over the invested energy (EROI of System 1 was 3.8 and of System 2, 2.6. Although presenting a greater energy demand and a lower EROI, System 2 had a greater energy balance, demonstrating a better viability of this cultivation system for the production of castor bean oil.A análise energética é uma forma de se avaliar a sustentabilidade de um sistema produtivo, apesar de ainda pouco utilizada no setor agropecuário. Inserida neste setor encontra-se a produção da mamoneira (Ricinus communis L., cultura ainda pouco estudada e que apresenta grande importância para o agronegócio brasileiro. Avaliou-se sob a ótica energética a produção potencial de óleo de mamona em dois sistemas de cultivo: com baixa (Sistema 1 e média (Sistema 2 tecnologias. Foi realizada a quantificação dos fluxos de materiais empregados nos dois sistemas de produção e conversão destes fatores em unidades de energia. Os fluxos de energia de entrada foram de 3.170,6 MJ ha¹ e 10.366 MJ ha¹ para os sistemas 1 e 2, respectivamente. O balanço de energia foi de 11.938,2 MJ ha¹ no sistema 1 e 16.296,5 MJ ha¹ no sistema 2. A lucratividade energética, retorno

  16. Sintesis N-Etanol -9,10,12- Trihidroksi Stearamida Yang Diturunkan Dari Minyak Jarak (Ricinus Communis Linn.)

    OpenAIRE

    Manurung, Simon

    2008-01-01

    Penelitian ini bertujuan untuk memanfaatkan metil risinoleat yang merupakan komponen utama sebagai trigliserida yang dijumpai pada minyak jarak (Ricinus Communis Linn.) sebagai bahan untuk sintesis senyawa N-etanol-9,10,12-trihidroksi stearamida. Untuk mendapatkan senyawa N-etanol-9,10,12-trihidroksi stearamida, minyak jarak terlebih dahulu dimetanolisis dengan metanol menggunakan katalis H2SO4 dalam pelarut benzena pada kondisi refluks. Metil risinoleat dipisahkan dari metil ester asam le...

  17. Single nucleotide polymorphisms for assessing genetic diversity in castor bean (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Rabinowicz Pablo D

    2010-01-01

    Full Text Available Abstract Background Castor bean (Ricinus communis is an agricultural crop and garden ornamental that is widely cultivated and has been introduced worldwide. Understanding population structure and the distribution of castor bean cultivars has been challenging because of limited genetic variability. We analyzed the population genetics of R. communis in a worldwide collection of plants from germplasm and from naturalized populations in Florida, U.S. To assess genetic diversity we conducted survey sequencing of the genomes of seven diverse cultivars and compared the data to a reference genome assembly of a widespread cultivar (Hale. We determined the population genetic structure of 676 samples using single nucleotide polymorphisms (SNPs at 48 loci. Results Bayesian clustering indicated five main groups worldwide and a repeated pattern of mixed genotypes in most countries. High levels of population differentiation occurred between most populations but this structure was not geographically based. Most molecular variance occurred within populations (74% followed by 22% among populations, and 4% among continents. Samples from naturalized populations in Florida indicated significant population structuring consistent with local demes. There was significant population differentiation for 56 of 78 comparisons in Florida (pairwise population ϕPT values, p Conclusion Low levels of genetic diversity and mixing of genotypes have led to minimal geographic structuring of castor bean populations worldwide. Relatively few lineages occur and these are widely distributed. Our approach of determining population genetic structure using SNPs from genome-wide comparisons constitutes a framework for high-throughput analyses of genetic diversity in plants, particularly in species with limited genetic diversity.

  18. Evaluation of the cadmium and lead phytoextraction by castor bean (Ricinus communis L.) in hydroponics

    Science.gov (United States)

    Niu, Z. X.; Sun, L. N.

    2017-06-01

    Phytoextraction has been considered as an innovative method to remove toxic metals from soil; higher biomass plants such as castor bean (Ricinus communis L.) have already been considered as a hyperaccumulating candidate. In the present study, castor bean was used to accumulate the cadmium and lead in hydroponic culture, and the root exudates and biomass changes were analyzed. Results demonstrated that ratios of aerial biomass/ root biomass (AW/RW) in treatments declined with concentrations of Cd or Pb. Optical density (OD) at 190 nm and 280 nm of root exudates observed in Cd and Pb treatments were lower than the control. In single Cd or Pb treatments, bioconcentration factors (BCF) of Cd or Pb increased with time and decreased with concentrations, the highest BCFs appeared in Cd5 (14.36) and Pb50 (6.48), respectively. Cd-BCF or Pb-BCF showed positive correlations with AW/RW ratios and OD values, and they were negative correlated with Cd and Pb concentration. Results in this study may supply useful information for phytoremediation of soil contaminated with cadmium and lead in situ.

  19. CAPILLARY ELECTROPHORETIC ANALYSIS OF LOW-MOLECULAR-MASS OF CA SPECIES IN PHLOEM SAP OF Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Noor Fitri

    2010-06-01

    Full Text Available A capillary electrophoretic (CE analysis with ultra-violet (UV detection was performed for further separation of low-molecular-mass (LMM calcium species in phloem sap of Ricinus communis L. Two different background electrolytes (BGE were used for the separation; these are (1 hydrogen phosphate/dihydrogen phosphate buffer containing cetyltrimethylammonium bromide (CTAB as an electro-osmotic flow (EOF modifier, and (2 boric acid buffer containing CTAB. Various parameters affecting the analysis, including the composition and pH of the BGE were systematically studied. The sensitivity, resolution, baseline noise, migration time of the species peaks, and reproducibility of the method were evaluated under optimised condition. At least 13 UV-active species were optimally separated within about ten minutes. The optimised measurement condition was also achieved using 10 mM hydrogen phosphate/10 mM dihydrogen phosphate containing 0.5 mM CTAB at pH 8.0 as BGE, and by applying voltage of ‑20 kV and temperature of 14°C. Evidently, the analytical method was successfully used for the separation of LMM calcium species in phloem sap of R. communis L.   Keywords: capillary electrophoresis, calcium species, phloem sap, Ricinus communis

  20. Isolamento do alcalóide ricinina das folhas de Ricinus communis (Euphorbiaceae através de cromatografias em contracorrente Isolation of the alkaloid ricinine from the leaves of Ricinus communis (Euphorbiaceae through counter-current chromatography

    Directory of Open Access Journals (Sweden)

    Ana Cristina Leite

    2005-12-01

    Full Text Available Droplet counter-current chromatography, rotation locular counter-current chromatography and high-speed counter-current chromatography were applied to the preparative separation of the alkaloid ricinine from the dichloromethane extracts of Ricinus communis leaves. The solvent system used was composed of dichloromethane-methanol-water (93:35:72 v/v/v and all techniques led to the isolation of large amounts of the alkaloid. The best result was obtained through HSCCC, since the ricinine yield was respectively 50% and 30% higher than when using RLCCC or DCCC.

  1. Collection of castor-oil plant germoplasm (Ricinus communis L. in two municipalities of Arauca, Colombia

    Directory of Open Access Journals (Sweden)

    Carlos Iván Cardozo Conde

    2013-05-01

    Full Text Available Ricinus communis L., commonly known as the castor-oil plant, is important for its use in biofuels production. With the objective of learning about its current status, in 40 villages influential to the oil complex of Caricare (municipality of Arauquita and Caño Limón (municipality of Arauca in Arauca, Colombia (where five years earlier the crop had been established, a collection of sexual seed was carried out between December 2011 and January 2012. The variables studied include passport data as a collection resource, local name, relief, and soil type among others. A Garmin map76CSx was used in order to identify the transects and record data such as geographic location and elevation. Simple descriptive statistics were used to identify the variables of greatest variation. Using the qualitative variables of greatest importance, a contingency table analysis with a significance level of 5%, a multiple correspondence analysis (MCA and principal component analysis (PCA were performed for quantitative and qualitative variables, in addition to a classification analysis through a similarity matrix. The castor-oil plant was found in 25% of the villages visited. 12 introductions were collected, four from Caricare and eight from Caño Limón. Although the environmental conditions were favo­rable for its cultivation, there are no castor-oil plant crops in the locations visited. The absence of grain commercialization and oil extraction equipment is the main limiting factor. A garden was established using collected materials for the purpose of research, breeding and propagation.

  2. ABA flow modelling in Ricinus communis exposed to salt stress and variable nutrition.

    Science.gov (United States)

    Peuke, Andreas D

    2016-10-01

    In a series of experiments with Ricinus communis, abscisic acid (ABA) concentrations in tissues and transport saps, its de novo biosynthesis, long-distance transport, and metabolism (degradation) were affected by nutritional conditions, nitrogen (N) source, and nutrient limitation, or salt stress. In the present study these data were statistically re-evaluated, and new correlations presented that underpin the importance of this universal phytohormone. The biggest differences in ABA concentration were observed in xylem sap. N source had the strongest effect; however, nutrient limitation (particularly phosphorus limitation) and salt also had significant effects. ABA was found in greater concentration in phloem sap compared with xylem sap; however, the effect of treatment on ABA concentration in phloem was lower. In the leaves, ABA concentration was most variable compared with the other tissues. This variation was only affected by the N source. In roots, ABA was significantly decreased by nutrient limitation. Of the compartments in which ABA was quantified, xylem sap ABA concentration was most significantly correlated with leaf stomatal conductance and leaf growth. Additionally, ABA concentration in xylem was significantly correlated to that in phloem, indicating a 6-fold concentration increase from xylem to phloem. The ABA flow model showed that biosynthesis of ABA in roots affected the xylem flow of ABA. Moreover, ABA concentration in xylem affected the degradation of the phytohormone in shoots and also its export from shoots via phloem. The role of phloem transport is discussed since it stimulates ABA metabolism in roots. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  3. Effects of Oganic and Biofertilizers on Growth Indices of Castor Bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    A Amin Ghafori

    2016-07-01

    Full Text Available Introduction Castor plant, Ricinus communis L. is a species of flowering plant in the spurge family; Euphorbiaceae, which contains a vast number of plants mostly native to the tropics. It belongs to a monotypic genus Ricinus. The name Ricinus is a latin word for tick. The plant is probably named because its seed has markings and a dump at the end that resemble certain ticks (NCRI, 2014. Castorbean is an industrial oil seed crop containing about 45-58 percent oil, which has tremendous application in petrochemicals, pharmaceuticals, cosmetics, textiles, chemicals, soap, leather, paints, varnishes, ink, nylon and plastic. Castor oil is traditionally associated with medicine and veterinary use in the fields of obstetrics, dermatology. It is also used as laxative. Presently, its utilization as bio-diesel has magnified its importance. Its oil does not freeze even at high altitudes and it is one the best lubricants for jet engines. This 100% castor-based product, has numerous applications in industry such as rotating glass car-wipers, ski boots fixatives, and for use in air-brake systems on trucks. Many new uses, based on the biodegradability of castor oil derived products, are expected in the future (Labalette et al., 1996. The shell of the castor bean is used as an organic termite control agent and its seed cake as manure in the soil. Medicinal plants are valuable resources in a wide range of natural resources that scientific identification, cultivation, development and proper utilization of them can have an important role in community health, employment and non-petrol exports. Quality of medicinal plants is more important than other crops. One of the most important factors determining the yield of castor bean is fertility. Integrated supply of nutrient to plants through combinations of organic and inorganic sources is becoming an increasingly important aspect of environmentally sound agriculture. Reports showed that the application of manure on bean

  4. Metabolite profiling of the oilseed crop Ricinus communis during early seed imbibition reveals a specific metabolic signature in response to temperature

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.; Willems, L.A.J.; Mudde, E.; Fernandez, L.G.; Castro, de R.D.; Ligterink, W.; Hilhorst, H.W.M.

    2015-01-01

    Seed imbibition is an important process in the plant life cycle and determines whether seed germination and plant growth will be successful or not. Ricinus communis is becoming an important crop for oil production, and therefore, studying the physiological and biochemical aspects of seed imbibition

  5. Amino acid profile of raw and locally processed seeds of Prosopis africana and Ricinus communis: potential antidotes to protein malnutrition

    Directory of Open Access Journals (Sweden)

    Chidi U. Igwe

    2012-04-01

    Full Text Available Background: Increasing incidence of malnutrition occasioned by high incidence of hunger,worsening food situation in the world, insufficient availability and high cost of animal protein sources, has necessitated extensive research into and use of alternative plant protein sources especially underexploited leguminous seeds.Methods: Flours from raw, boiled and fermented seeds of Prosopis africana and Ricinus communis were evaluated for crude protein and amino acid (AA profiles, and their protein qualities determined. Results: Fermentation improved the protein contents of raw seeds of P. africana and R. communis by 18.70% and 3.95% respectively. In the raw and fermented P. africana seeds, glutamate at 132.60 ± 1.30 and 182.70 ± 3.02 mg/g crude protein (mg/gcp was the most abundant amino acid (AA, while leucine (62.80 ± 0.60 and 79.50 ± 2.01 mg/gcp was the most concentrated essential amino acid (EAA. Aspartate (151.90 ± 2.01 and 170.10 ± 2.00 mg/gcp and arginine (72.80 ± 2.01 and 78.60 ± 2.00 mg/gcp were the most concentrated and abundant non-essential amino acid (NEAA and EAA in the raw and fermented samples of R. communisrespectively. The total AA concentrations (mg/gcp of raw and fermented P. africana were 733.00 and 962.60 respectively, while those of R. communis were 823.50 and 894.10 respectively. The total EAA contents (mg/gcp for P. africana were 311.00 (raw and 404.50 (fermented, and for R. communis; 401.10 (raw and 430.30 (fermented. Threonine was the limiting EAA in raw and fermented P. africana, whereas lysine was the limiting EAA in R. communis raw sample. Fermentation significantly (p<0.05 increased the individual AA compositions of P. africana and R. communis by 94% and 53% respectively, while boiling reduced these parameters significantly (p<0.05 by 47% and 82% respectively. Conclusion: P. africana and R. communis seeds are potentially important plant sources of protein and essential amino acids, and so could be of great

  6. Irrigation of Castor Bean (Ricinus communis L.) and Sunflower (Helianthus annus L.) Plant Species with Municipal Wastewater Effluent: Impacts on Soil Properties and Seed Yield

    OpenAIRE

    Chatzakis, Michalis K.; Tzanakakis, Vasileios A.; Mara, Duncan D.; Angelakis, Andreas N.

    2011-01-01

    The effects of plant species (castor bean (Ricinus communis L.) versus sunflower (Helianthus annus L.)) and irrigation regime (freshwater versus secondary treated municipal wastewater) on soil properties and on seed and biodiesel yield were studied in a three year pot trial. Plant species were irrigated at rates according to their water requirements with either freshwater or wastewater effluent. Pots irrigated with freshwater received commercial fertilizer, containing N, P, and K, applied at ...

  7. Bis(β-lactosyl-[60]fullerene as novel class of glycolipids useful for the detection and the decontamination of biological toxins of the Ricinus communis family

    Directory of Open Access Journals (Sweden)

    Hirofumi Dohi

    2014-07-01

    Full Text Available Glycosyl-[60]fullerenes were first used as decontaminants against ricin, a lactose recognition proteotoxin in the Ricinus communis family. A fullerene glycoconjugate carrying two lactose units was synthesized by a [3 + 2] cycloaddition reaction between C60 and the azide group in 6-azidohexyl β-lactoside per-O-acetate. A colloidal aqueous solution with brown color was prepared from deprotected bis(lactosyl-C60 and was found stable for more than 6 months keeping its red color. Upon mixing with an aqueous solution of Ricinus communis agglutinin (RCA120, the colloidal solution soon caused precipitations, while becoming colorless and transparent. In contrast, a solution of concanavalin A (Con A caused no apparent change, indicating that the precipitation was caused specifically by carbohydrate–protein interactions. This notable phenomenon was quantified by means of sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE, and the results were discussed in terms of detection and decontamination of the deadly biological toxin in the Ricinus communis family.

  8. Castor (Ricinus communis L. and Pigweed (Amaranthus retroflexus L. Growth Indices in Terms of Interference

    Directory of Open Access Journals (Sweden)

    naser jafarzadeh

    2016-11-01

    Full Text Available Introduction Growth analysis has been widely used in breeding programs to identify the important plant developmental phases and components related to higher yield under a particular set of environmental conditions. Castor bean (Ricinus communis L. is an important commercial crop. Castor oil based by products is used in manufacturing of several commercially important commodities like surfactants, coatings, greases, pharmaceuticals, cosmetics, polyesters, polymers, etc. Interference (Interactive effects among species on inter-species populations is one of the main issues on the eco-physiology of plant populations where weeds impose negative effects by approaching the plant to compete in light, water and nutrient elements availability and results in reduced growth and yield (Shinggu et al., 2011. Growth indices are useful for interpreting plant reactions to the crop and weed density. Various reasons have been attributed for the low productivity among the most important is weed competition (Radosevich, 1987. The aim of the present experiment was evaluating the interference effects of redroot pigweed on growth indices of castor bean in northwest of Iran. Materials and methods This experiment was conducted in Urmia, Iran (Agricultural Research of West Azarbayjan, Saatlo Station (37°44´18״ N Latitude and 45° 10´ 53״ E Longitude, at 1338 m above sea level in 2012. The soil of the experimental field was sandy - loam, with pH of 7.2. Competitive pattern of experiment was in two-factor based on a randomized complete block design (RCBD with three replications arranged in four castor plant densities (3, 4, 5 and 6 plants.m-2 and four redroot pigweed densities (0, 5, 10 and 15 plants.m-2. Redroot pigweed and castor seeds were simultaneously directly planted on the 22th May in 2012. Redroot pigweed plants were weeded at the times related to the treatments level. Irrigation and intercultural operations were performed whenever necessary. Plots were 3m×5m

  9. Metal concentration in plant tissues of Ricinus communis L. (Castor oil)

    African Journals Online (AJOL)

    Accumulation of the metals by plant parts were not concentration dependent. Specifically metal accumulation in R. communis, in the present study showed that Mn , Ni and Pb were mostly accumulated in the leaves; while V was highest in roots. Journal of Applied Sciences and Environmental Management Vol. 10(3) 2006: ...

  10. Inibição do desenvolvimento de fungos fitopatogênicos por detergente derivado de óleo da mamona (Ricinus communis The castor oil plant detergent (Ricinus communis inhibits the asexual development of phytopathogenic fungi

    Directory of Open Access Journals (Sweden)

    Eunice Hitomi Takano

    2007-10-01

    Full Text Available No presente estudo avaliou-se o efeito fungitóxico do detergente derivado do óleo da mamona (Ricinus communis sobre o desenvolvimento dos fitopatógenos: Pyricularia grisea, Fusarium graminearum e Colletotrichum lindemuthianum. Seis concentrações do detergente (12,5mL L-1 a 300mL L-1 foram, individualmente, incorporadas ao Meio Basal; a seguir, após inoculação fúngica, o crescimento radial dos micélios foi avaliado. A inibição total do desenvolvimento de C. lindemuthianum e P. grisea foi observada entre as concentrações de 50mL L-1 e 200mL L-1, respectivamente. Com base no crescimento miceliano das colônias de F. graminearum, a atividade antifúngica do detergente do óleo da mamona (DOM determinou inibição variável entre 79,4 e 91% para a raça F2 e entre 80,7 e 90,7% para a raça F4. O detergente, nas concentrações de 100 a 300mL L-1, inibiu em 100% a germinação de conídios de F. graminearum (raças F-4 e F-2. Os resultados demonstram nítida atividade antifúngica do detergente derivado do óleo da mamona sobre fitopatógenos.In the present study the fungitoxic effect of the castor oil plant detergent (Ricinus communis on the development of the phytopathogens Pyricularia grisea, Fusarium graminearum and Colletotrichum lindemuthianum was evaluated. Six concentrations of the detergent (12.5mL L-1 to 300mL L-1 had been, individually, incorporated to the Basal Medium. After fungi inoculations, the radial growth of mycelia were evaluated. Detergent at 50mL L-1 and 200mL L-1 inhibited completely the development of P. grisea and C. lindemuthianum, respectively. On the basis of the mycelial growth of F. graminearum, the fungitoxic activity of the castor oil plant detergent (DOM determined inhibition in the range of 79.4 and 91% for the F2 race and 80.7 and 90.7% for the F4 race. Detergent at the concentrations of 100mL L-1 to 300mL L-1 inhibited in 100% the F. graminearum germination conidia (races F-4 and F-2. Results

  11. Escala diagramática para avaliação de mofo cinzento (Amphobotrys ricini da mamoneira (Ricinus communis L. Diagramatic scale to assess gray mold (Amphobotyrs ricini in castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Haroldo Antunes Chagas

    2010-06-01

    Full Text Available O objetivo do trabalho foi a elaboração de uma escala diagramática para avaliação de mofo cinzento causado por Amphobotrys ricini (Buchw. em mamoneira (Ricinus communis L.. Utilizaram 59 cachos, que foram desinfestados em solução de hipoclorito de sódio a 2% por 30 segundos e em água destilada e esterilizada. Depois foram acondicionados em bandejas com espuma umedecida, onde receberam discos de micélio de 5mm do patógeno, permanecendo em câmara climática a 25ºC e UR de 80%. Observou-se a evolução da doença e foram obtidos fotos dos cachos doentes diariamente. Para a determinação da porcentagem de severidade dos cachos, os frutos infectados e sadios foram contados, estimando-se dessa forma a porcentagem da área lesionada e elaborando uma escala diagramática com seis níveis de severidade. A adoção da escala proposta, melhorou a acurácia (R²=0,94, com valores de "a" não significativamente diferentes de zero (0 e os valores de "b" não diferentes de um (1.The aim of the present study was to develop a diagrammatic scale to assess gray mold caused by Amphobotrys ricini in castor bean (Ricinus communis L.. The experiment included 59 clusters, which were disinfected in solution of sodium hypochlorite to 2% for 30 seconds and distilled water and sterilized. Then, they were packed in moistened foam trays which received 5mm mycelial discs, and were kept in a climatic chamber at 25º C and 80%. RH. The disease evolution was observed daily pictures of the clusters diseased. To determine the severity percentage of the bunches, infected and healthy fruits were counted, estimating thus the percentage of the injured area, and developing a diagrammatic scale with six severity levels. The adoption of the proposed scale, improved the accuracy (R² = 0,94 "a" values were not significantly different from zero (0 and "b" values were not significantly different from one (1.

  12. Balanço energético para a produção de biodiesel pela cultura da mamona (Ricinus communis L. Energy balance for biodiesel production by the castor bean crop (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Rodolfo Glauber Chechetto

    2010-12-01

    Full Text Available A cultura da mamona (Ricinus communis L. adquiriu prestígio ao interesse da indústria pela qualidade de seu óleo e, recentemente, pela busca de novas fontes de energias. O experimento que serviu como base para os dados utilizados nesse trabalho foi realizado na Fazenda Experimental Lageado, FCA - UNESP, no município de Botucatu - SP, no ano de 2008. O objetivo deste trabalho foi avaliar a viabilidade energética da cultura através do balanço e da eficiência energética, desde a implantação até a produção de biodiesel, utilizando parâmetros de consumo operacional no manejo para instalação e manutenção da cultura, colheita e processamento de óleo. As operações de manejo de solo, semeadura e colheita consumiramo total de 266,20 MJ ha-1, que juntamente com fertilizantes, agrotóxicos, combustíveis e lubrificantes, mão-de-obra, sementes e processamento industrial totalizaram uma entrada de energia de 56.808,10 MJ ha-1. A produção de energia foi de 72.814,00 MJ ha-1. O setor ainda carece de estudos que contribuiriam para o levantamento de dados e coeficientes energéticos mais específicos. A cultura da mamona foi considerada eficiente, permitindo ganho de 15.983,44 MJ ha-1, equivalente a aproximadamente 415 L de óleo diesel.The castor bean crop (Ricinus communis L. has acquired prestige due to industries interest in the oil quality and recently for new sources of energy demand. The experiment that served as basis for the data used in this study was conducted at the Lageado Experimental Farm, in Botucatu - SP, 2008. This study aimed to avaluate the crop viability through energy balance and energy efficiency since the implantation until biodiesel production using parameters of consumption in operational management for installation and maintenance of culture harvest and oil production. The soil management operations, sow and harvest consumed the total of 266.20 MJ ha-1, gathering with the fertilizers, pesticides, fuels

  13. Serpentine bacteria influence metal translocation and bioconcentration of Brassica juncea and Ricinus communis grown in multi-metal polluted soils

    Directory of Open Access Journals (Sweden)

    Ying eMa

    2015-01-01

    Full Text Available The aim of this study was to assess the effects of inoculation of rhizosphere or endophytic bacteria (Psychrobacter sp. SRS8 and Pseudomonas sp. A3R3, respectively isolated from a serpentine environment on the plant growth and the translocation and accumulation of Ni, Zn and Fe by Brassica juncea and Ricinus communis on a multi-metal polluted serpentine soil (SS. Field collected SS was diluted to 0, 25, 50 and 75% with pristine soil in order to obtain a range of heavy metal concentrations and used in microcosm experiments. Regardless of inoculation with bacteria, the biomass of both plant species decreased with increase of the proportion of SS. Inoculation of plants with bacteria significantly increased the plant biomass and the heavy metal accumulation compared with non-inoculated control in the presence of different proportion of SS, which was attributed to the production of plant growth promoting and/or metal mobilizing metabolites by bacteria. However, SRS8 showed a maximum increase in the biomass of the test plants grown even in the treatment of 75% SS. In turn, A3R3 showed maximum effects on the accumulation of heavy metals in both plants. Regardless of inoculation of bacteria and proportion of SS, both plant species exhibited low values of bioconcentration factor (<1 for Ni and Fe. The inoculation of both bacterial strains significantly increased the translocation factor (TF of Ni while decreasing the TF of Zn in both plant species. Besides this contrasting effect, the TFs of all metals were < 1, indicating that all studied bacteria-plant combinations are suitable for phytostabilization. This study demonstrates that the bacterial isolates A3R3 and SRS8 improved the growth of B. juncea and R. communis in SS soils and have a great potential to be used as inoculants in phytostabilization scenarios of multi-metal contaminated soils.

  14. Evaluation of leishmanicidal activity and cytotoxicity of Ricinus communis and Azadirachta indica extracts from western Kenya: in vitro and in vivo assays.

    Science.gov (United States)

    Jumba, Bernard N; Anjili, Christopher O; Makwali, Judith; Ingonga, Johnstone; Nyamao, Rose; Marango, Sylvia; Choge, Joseph K; Khayeka-Wandabwa, Christopher

    2015-11-05

    Despite advances to targeted leishmanicidal chemotherapy, defies around severe toxicity, recent emergence of resistant variants and absence of rational vaccine still persist. This necessitates search and/or progressive validation of accessible medicinal remedies including plant based. The study examined both in vivo and in vitro response of L. major infection to combined therapy of Ricinus communis and Azadirachta indica extracts in BALB/c mice as the mouse model. A comparative study design was applied. BALB/c mice, treated with combination therapy resulted in significantly (p indica and R. communis on amastigote with a 50 % inhibitory concentration (IC50) was of 11.5 and 16.5 µg mL(-1) respectively while combination therapy gave 9.0 µg ml(-1) compared to the standard drugs, Pentostam and amphotericin B which had an IC50 of 6.5 and 4.5 µg ml(-1) respectively. Optimal efficacy of A. indica and R. communis was 72 and 59.5 % respectively, combination therapy gave 88 %, while Pentostam and amphotericin B had 98 and 92 % respectively against amastigotes. Against promastigotes A. indica and R. Communis gave an IC50 of 10.1, 25.5 µg mL(-1) respectively, while combination, 12.2 µg mL(-1) against 4.1 and 5.0 µg ml(-1) for Pentostam and amphotericin B respectively. The optimal efficacy of the compounds against promastigotes was 78.0, 61.5 and 91.2 % (A. indica, R. communis and A. indica + R. communis respectively) against 96.5 and 98 % for Pentostam and amphotericin B respectively. The concentrations at optimal efficacy were significantly different (p indica and R. communis had best antileishmanial activity than the monotherapies. The active ingredients of both R. communis and A. indica need to be fractionated, and studied further for activity against Leishmania parasites.

  15. Gene Structures, Evolution and Transcriptional Profiling of the WRKY Gene Family in Castor Bean (Ricinus communis L.).

    Science.gov (United States)

    Zou, Zhi; Yang, Lifu; Wang, Danhua; Huang, Qixing; Mo, Yeyong; Xie, Guishui

    2016-01-01

    WRKY proteins comprise one of the largest transcription factor families in plants and form key regulators of many plant processes. This study presents the characterization of 58 WRKY genes from the castor bean (Ricinus communis L., Euphorbiaceae) genome. Compared with the automatic genome annotation, one more WRKY-encoding locus was identified and 20 out of the 57 predicted gene models were manually corrected. All RcWRKY genes were shown to contain at least one intron in their coding sequences. According to the structural features of the present WRKY domains, the identified RcWRKY genes were assigned to three previously defined groups (I-III). Although castor bean underwent no recent whole-genome duplication event like physic nut (Jatropha curcas L., Euphorbiaceae), comparative genomics analysis indicated that one gene loss, one intron loss and one recent proximal duplication occurred in the RcWRKY gene family. The expression of all 58 RcWRKY genes was supported by ESTs and/or RNA sequencing reads derived from roots, leaves, flowers, seeds and endosperms. Further global expression profiles with RNA sequencing data revealed diverse expression patterns among various tissues. Results obtained from this study not only provide valuable information for future functional analysis and utilization of the castor bean WRKY genes, but also provide a useful reference to investigate the gene family expansion and evolution in Euphorbiaceus plants.

  16. Trace isotope analysis of Ricinus communis seed core for provenance determination by laser ablation-ICP-MS.

    Science.gov (United States)

    Bagas, Christina K; Scadding, Rachel L; Scadding, Cameron J; Watling, R John; Roberts, Warren; Ovenden, Simon P B

    2017-01-01

    The castor bean plant, Ricinus communis, grows wild throughout many regions of Australia. The seeds of the plant contain the schedule 1 chemical agent ricin, a type II ribosomal inhibiting protein. Currently there are limited analytical techniques that can be applied in analysis of the seeds to establish attribution. In this study, laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) was used for the analysis of seeds collected from 68 plants across 38 locations around Australia. Of the 92 elemental isotopes measured, fifteen ((24)Mg, (27)Al, (44)Ca, (53)Cr, (55)Mn, (57)Fe, (60)Ni, (65)Cu, (66)Zn, (75)As, (85)Rb, (88)Sr, (98)Mo, (138)Ba and (202)Hg) yielded data that were relevant to all collection sites. Data were further analysed using multivariate statistical analysis which facilitated the potential for the identification of unique provenance isotopes. Furthermore, this analysis indicated that (59)Co was present at significant levels in Victorian and Sydney specimens only. Crown Copyright © 2016. Published by Elsevier B.V. All rights reserved.

  17. Local Perceptions about the Effects of Jatropha (Jatropha curcas and Castor (Ricinus communis Plantations on Households in Ghana and Ethiopia

    Directory of Open Access Journals (Sweden)

    Joleen A. Timko

    2014-10-01

    Full Text Available Biofuel plantations have been hyped as a means to reinvigorate Africa’s rural areas. Yet there is still apprehension about the negative environmental and social impacts of large-scale commercial biofuel production around rising food prices, land grabbing, ecological damage, and disruption of rural livelihoods. Given the extent of Jatropha curcas production in Ghana and Ethiopia and Castor bean (Ricinus communis in Ethiopia, this paper presents the results of a study that assessed the socio-economic implications of industrial Jatropha plantations on local livelihoods in Ghana, and of industrial Jatropha and Castor plantations on local livelihoods in Ethiopia. This study used primary data collected from 234 households in Ghana and 165 in Ethiopia. The cultivation of Jatropha and Castor has had several important effects on local livelihoods in the study sites, most notably decreases in household landholdings due to the arrival of industrial Jatropha or Castor plantations; and the resulting changes these plantations have caused in household socio-economic status, food security, fallow periods, and fodder availability. We consider how a lack of meaningful consultation between local people, their traditional authorities and the biofuel company managers, along with shortcomings in each country’s broader land acquisition process and poor land use information, may have contributed to these overall negative effects on local livelihoods. We conclude by suggesting several ways that emerging biofuel industries could be improved from the perspective of local people and their livelihoods.

  18. Genome-wide survey and expression profiles of the AP2/ERF family in castor bean (Ricinus communis L.).

    Science.gov (United States)

    Xu, Wei; Li, Fei; Ling, Lizhen; Liu, Aizhong

    2013-11-13

    The AP2/ERF transcription factor, one of the largest gene families in plants, plays a crucial role in the regulation of growth and development, metabolism, and responses to biotic and abiotic stresses. Castor bean (Ricinus communis L., Euphobiaceae) is one of most important non-edible oilseed crops and its seed oil is broadly used for industrial applications. The available genome provides a great chance to identify and characterize the global information on AP2/ERF transcription factors in castor bean, which might provide insights in understanding the molecular basis of the AP2/ERF family in castor bean. A total of 114 AP2/ERF transcription factors were identified based on the genome in castor bean. According to the number of the AP2/ERF domain, the conserved amino acid residues within AP2/ERF domain, the conserved motifs and gene organization in structure, and phylogenetical analysis, the identified 114 AP2/ERF transcription factors were characterized. Global expression profiles among different tissues using high-throughput sequencing of digital gene expression profiles (DGEs) displayed diverse expression patterns that may provide basic information in understanding the function of the AP2/ERF gene family in castor bean. The current study is the first report on identification and characterization of the AP2/ERF transcription factors based on the genome of castor bean in the family Euphobiaceae. Results obtained from this study provide valuable information in understanding the molecular basis of the AP2/ERF family in castor bean.

  19. Systematic comparison of oligosaccharide specificity of Ricinus communis agglutinin I and Erythrina lectins: a search by frontal affinity chromatography.

    Science.gov (United States)

    Itakura, Yoko; Nakamura-Tsuruta, Sachiko; Kominami, Junko; Sharon, Nathan; Kasai, Ken-Ichi; Hirabayashi, Jun

    2007-10-01

    Ricinus communis agglutinin I (RCA120) is considered a versatile tool for the detection of galactose-containing oligosaccharides. However, possible contamination by the highly toxic isolectin 'ricin' has become a critical issue for RCA120's continued use. From a practical viewpoint, it is necessary to find an effective substitute for RCA120. For this purpose, we examined by means of frontal affinity chromatography over 100 lectins which have similar sugar-binding specificities to that of RCA120. It was found that Erythrina cristagalli lectin (ECL) showed the closest similarity to RCA120. Both lectins prefer Gal beta1-4GlcNAc (type II) to Gal beta1-3GlcNAc (type I) structures, with increased affinity for highly branched N-acetyllactosamine-containing N-glycans. Their binding strength significantly decreased following modification of the 3-OH, 4-OH and 6-OH of the galactose moiety of the disaccharide, as well as the 3-OH of its N-acetylglucosamine residue. Several differences were also observed in the affinity of the two lectins for various other ligands, as well as effects of bisecting GlcNAc and terminal sialylation. Although six other Erythrina-derived lectins have been reported with different amino acid sequences, all showed quite similar profiles to that of ECL, and thus, to RCA120. Erythrina lectins can therefore serve as effective substitutes for RCA120, taking the above differences into consideration.

  20. Gene Structures, Evolution and Transcriptional Profiling of the WRKY Gene Family in Castor Bean (Ricinus communis L..

    Directory of Open Access Journals (Sweden)

    Zhi Zou

    Full Text Available WRKY proteins comprise one of the largest transcription factor families in plants and form key regulators of many plant processes. This study presents the characterization of 58 WRKY genes from the castor bean (Ricinus communis L., Euphorbiaceae genome. Compared with the automatic genome annotation, one more WRKY-encoding locus was identified and 20 out of the 57 predicted gene models were manually corrected. All RcWRKY genes were shown to contain at least one intron in their coding sequences. According to the structural features of the present WRKY domains, the identified RcWRKY genes were assigned to three previously defined groups (I-III. Although castor bean underwent no recent whole-genome duplication event like physic nut (Jatropha curcas L., Euphorbiaceae, comparative genomics analysis indicated that one gene loss, one intron loss and one recent proximal duplication occurred in the RcWRKY gene family. The expression of all 58 RcWRKY genes was supported by ESTs and/or RNA sequencing reads derived from roots, leaves, flowers, seeds and endosperms. Further global expression profiles with RNA sequencing data revealed diverse expression patterns among various tissues. Results obtained from this study not only provide valuable information for future functional analysis and utilization of the castor bean WRKY genes, but also provide a useful reference to investigate the gene family expansion and evolution in Euphorbiaceus plants.

  1. Dissipation of excess photosynthetic energy contributes to salinity tolerance: a comparative study of salt-tolerant Ricinus communis and salt-sensitive Jatropha curcas.

    Science.gov (United States)

    Lima Neto, Milton C; Lobo, Ana K M; Martins, Marcio O; Fontenele, Adilton V; Silveira, Joaquim Albenisio G

    2014-01-01

    The relationships between salt tolerance and photosynthetic mechanisms of excess energy dissipation were assessed using two species that exhibit contrasting responses to salinity, Ricinus communis (tolerant) and Jatropha curcas (sensitive). The salt tolerance of R. communis was indicated by unchanged electrolyte leakage (cellular integrity) and dry weight in leaves, whereas these parameters were greatly affected in J. curcas. The leaf Na+ content was similar in both species. Photosynthesis was intensely decreased in both species, but the reduction was more pronounced in J. curcas. In this species biochemical limitations in photosynthesis were more prominent, as indicated by increased C(i) values and decreased Rubisco activity. Salinity decreased both the V(cmax) (in vivo Rubisco activity) and J(max) (maximum electron transport rate) more significantly in J. curcas. The higher tolerance in R. communis was positively associated with higher photorespiratory activity, nitrate assimilation and higher cyclic electron flow. The high activity of these alternative electron sinks in R. communis was closely associated with a more efficient photoprotection mechanism. In conclusion, salt tolerance in R. communis, compared with J. curcas, is related to higher electron partitioning from the photosynthetic electron transport chain to alternative sinks. Copyright © 2013 Elsevier GmbH. All rights reserved.

  2. PENGARUH EKSTRAK ETANOL BIJI JARAK (Ricinus communis L. TERHADAP STRUKTUR HISTOLOGIS TESTIS TIKUS SAWAH (Ratus Argentiventer ROBINSON & KLOSS (The Effect of Castor-bean (Ricinus communis L. Seeds Ethanol Extract on Microscopic Structure of Testis of

    Directory of Open Access Journals (Sweden)

    Istriyati Istriyati

    2008-07-01

    Full Text Available ABSTRAK  Tikus sawah (Rattus argentivenler Robinson dan Kloss merupakan jenis hewan mammal yang menimbulkan kerugian besar di sektor pertanian. Selain daya adaptasi yang tinggi terhadap lingkungan, tikus sawah memiliki kemampuan reproduksi yang tinggi dalam waktu singkat, sehingga populasi tikus sawah dapat meningkat dengan cepat Untuk mengatasi hal ini, diperlukan suatu teknik pengendalian, dengan mempengaruhi tingkat fertilitasnya. Biji jarak (Ricinus communis L. diduga mempunyai efek antifertilitas yang diharapkan dapat mengurangi jumlah populasi tikus sawah. Tujuan penelitian ini adalah untuk mempelajari pengaruh ekstrak biji jarak terhadap struktur mikroskopis testis tikus sawah. Tiga puluh ekor tikus sawah jantan dengan rata-rata berat badan 99,4 g dibagi menjadi 6 kelompok, masing-masing 5 ekor. Satu kelompok kontrol diperlakukan dengan akuabides, 5 kelompok lainnya masing-masing diperlakukan dengan ekstrak etanol biji jarak secara oral dengan metode one way single dose 0.2 ml: 0.4 ml: 0.6 ml: 0.8 ml dan 1.0 ml/100 g bb. Setelah perlakuan tikus sawah dipelihara selama 12 hari. Kemudian tikus dikorbankan dan diambil testisnya untuk dibuat preparat dengan metode parafin, fiksasi dalam larutan Bouin, tebal sayatan 6 um, pewarnaan dengan hematoksilin dan Eosin (HE. Hasil penelitian menunjukkan struktur mikroskopis testis mengalami degenerasi. Uji statistik menunjukkan adanya penurunan secara nyata jumlah spermatogonia, spermatosit dan spermatid testis tikus sawah antara kelompok kontrol dan perlakuan. Makin tinggi dosis, makin tinggi tingkat kerusakan struktur mikroskopis dan jumlah spermatogonia, spermatosit dan spermatid makin sedikit.   ABSTRACT  Rice-field rat (Rattus argentiventer Robinson & Kloss is a mammal pest that causes serious lost on agriculture crop. Beside high adaptation, rice-field rats also have high reproduction ability in a short time, so that the population of the rats increase rapidly. To control population of rice

  3. Eficiência da seleção recorrente para redução da estatura de plantas em mamoneira (Ricinus communis L. Recurrent selection efficiency for stature reduction of castor bean (Ricinus communis L. plants

    Directory of Open Access Journals (Sweden)

    Inocencio Junior de Oliveira

    2008-08-01

    Full Text Available Realizou-se, o presente trabalho, com o objetivo de avaliar a eficiência da seleção recorrente para a redução da estatura de plantas de mamona da cultivar Guarani (Ricinus communis L., tornando-a com porte adequado para facilitar a colheita manual e/ou mecânica. Foram realizados quatro ciclos de seleção recorrente com a utilização de progênies autofecundadas na cultivar Guarani para redução da estatura das plantas, nas condições edafoclimáticas dos municípios de São Manuel - SP, Botucatu - SP e Penápolis - SP. As avaliações de estatura das plantas e de produtividade de grãos (kg.ha-1, dos quatro ciclos de seleção e do ciclo original foram realizadas nos municípios de São Manuel - SP, Botucatu - SP e Penápolis - SP na safra 2005/2006, sob um delineamento de blocos casualizados com cinco repetições e parcela útil de 30 m². A análise de variância para as características avaliadas foi feita separadamente para cada local e conjuntamente para os três locais e, posteriormente, realizada a comparação das médias pelo teste de Tukey, a 5%. Foram estimados, para as três localidades, por análise de regressão, os ganhos genéticos dos quatros ciclos de seleção para estatura de plantas. A partir dos resultados obtidos pôde-se concluir que a seleção recorrente foi eficiente para a redução da estatura de plantas e que a cultivar de mamona Guarani apresenta variabilidade genética para essa característica e que a produtividade não foi influenciada pela redução da estatura de plantas.The aim of this work was to evaluate the recurrent selection efficiency for reduction of stature of the castor bean plants of the Guarani cultivar (Ricinus communis L., turning it with appropriate strucuture to facilitate the manual and/or mechanic harvest. Four cycles of recurrent selection were accomplished through the utilization of self-pollinated progenies in the Guarani cultivar for reduction of plants stature, in

  4. Caracterización morfológica y agroproductiva de procedencias de Ricinus communis L. para la producción de aceite Morphological and agroproductive characterization of Ricinus communis L. provenances for oil production

    Directory of Open Access Journals (Sweden)

    R Machado

    2012-12-01

    Full Text Available El objetivo de este trabajo fue caracterizar dos procedencias introducidas desde Suramérica (Planta-2 y Planta-3 y tres colectadas en Cuba (SSCS-5, Colón-1 y Las Tunas, de Ricinus communis L. Para ello se consideraron indicadores morfológicos y agroproductivos. Se utilizaron parcelas de 40 m² (área vital, con diez plantas. El diseño fue totalmente aleatorizado y los datos se analizaron a partir de estadígrafos descriptivos. Planta-2 alcanzó la mayor velocidad de crecimiento (2,98 cm/día y, a los 17 meses, fue superior en cuanto a: el grosor del tallo (17,5 cm; el número de ramas primarias (45, secundarias (41 y terciarias (20; y el grosor de las ramas primarias (5,9 cm. SSCS-5, Colón-1 y Las Tunas mostraron racimos más largos, con un mayor número de frutos; pero fueron superadas por Planta-3 y Planta-2 en el peso de los frutos por racimo (134,9 y 139,0 g, respectivamente, con frutos y semillas más grandes. Las lesiones producidas por insectos y el grado de infestación por microorganismos patógenos no fueron representativos. El mayor rendimiento de semilla (95,1 kg, el de frutos por planta (5,28 kg y por área (4 398 kg/ha y el estimado de aceite por unidad de área (1 130,2 kg/ha se detectaron en Planta-2. Se concluye que estas procedencias poseen características morfoproductivas que las diferencian, y mostraron particularidades relevantes para la producción de aceite, el cual se destina no solo a la producción de biodiesel, sino a múltiples usos a partir de sus derivados. Se recomienda profundizar en estudios sobre la fitotecnia de R. communis, de forma particular en Planta-2; así como introducir tipos medianos que faciliten su cosecha.The objective of this work was to characterize two provenances introduced from South America (Planta-2 and Planta-3 and three provenances collected in Cuba (SSCS-5, Colón-1 and Las Tunas, of Ricinus communis L. For such purpose, morphological and agroproductive indicators were considered

  5. Experimental effect of feeding on Ricinus communis and Bougainvillea glabra on the development of the sand fly Phlebotomus papatasi (Diptera: Psychodidae) from Egypt.

    Science.gov (United States)

    Kaldas, Rania M; El Shafey, Azza S; Shehata, Magdi G; Samy, Abdallah M; Villinski, Jeffrey T

    2014-04-01

    Plants are promising sources of agents useful for the control of vectors of human diseases including leishmaniasis. The effect of Ricinus communis (Euphorbiaceae) and Bougainvillea glabra (Nyctaginaceae), on transmission of leishmaniasis was investigated using them as diets for Phlebotomus papatasi to monitor their effect on life-history traits. P. papatasi were allowed to feed separately on both plants then offered a blood-meal. Fed-females were observed daily for egg-laying and subsequent developmental stages. P. papatasi was able to feed on B. glabra (29.41% females and 46.30% males) and R. communis (5.80% females and 10.43% males). 34.28% of females died within 24-48 hours post-feeding on R. communis, whereas, it was 16.5% in females fed on B. glabra. Overall fecundity of surviving females was reduced compared to controls, reared on standard laboratory diet; however there was no effect on the sex ratio of progeny. Female P. papatasi in the control group had significantly longer life span compared to plant-fed group. Feeding on these plants not only decreased sand fly survival rates but incurred negative effects on fecundity. Findings indicate that planting high densities of R. communis and B. glabra in sand flies-endemic areas will reduce population sizes and reduce the risk of Leishmania major infections.

  6. CAPACIDAD ANTAGÓNICA Y QUITINOLÍTICA DE MICROORGANISMOS AISLADOS DE RESIDUOS DE HIGUERILLA (Ricinus communis

    Directory of Open Access Journals (Sweden)

    TERESA CABRA C

    2014-06-01

    Full Text Available Se ha comprobado que los fertilizantes y controladores biológicos a base de microorganismos benéficos productores de metabolitos de interés, inducen el crecimiento vegetal y actúan contra microorganismos patógenos y plagas que afectan los agroecosistemas. Por lo tanto, su uso constituye una práctica eficiente de producción limpia que ayuda a reducir el impacto ambiental causado por el uso de agroquímicos. En este trabajo se evaluó la capacidad antagónica y quitinolítica de 15 cepas bacterianas y una levaduriforme, aisladas de residuos lignocelulósicos de higuerilla (Ricinus communis. La actividad antagónica de cada cepa se determinó por la capacidad de inhibir el crecimiento del hongo fitopatógeno Fusarium equiseti, en medio de cultivo PDA. Solamente la bacteria Bacillus subtilis, presentó una inhibición significativa del crecimiento del hongo equivalente al 76,08%. Por lo tanto se demuestra que la cepa de Bacillus subtilis puede ser empleada en la formulación de inoculantes microbianos. La capacidad quitinolítica de las cepas se definió por el crecimiento del microorganismo y por la formación de halos de hidrólisis alrededor de las colonias sobre el medio de cultivo suplementado con quitina coloidal. Ninguna de las cepas evaluadas mostró capacidad para degradar quitina.

  7. Exploiting EST databases for the development and characterization of EST-SSR markers in castor bean (Ricinus communis L.).

    Science.gov (United States)

    Qiu, Lijun; Yang, Chun; Tian, Bo; Yang, Jun-Bo; Liu, Aizhong

    2010-12-16

    The castor bean (Ricinus communis L.), a monotypic species in the spurge family (Euphorbiaceae, 2n = 20), is an important non-edible oilseed crop widely cultivated in tropical, sub-tropical and temperate countries for its high economic value. Because of the high level of ricinoleic acid (over 85%) in its seed oil, the castor bean seed derivatives are often used in aviation oil, lubricants, nylon, dyes, inks, soaps, adhesive and biodiesel. Due to lack of efficient molecular markers, little is known about the population genetic diversity and the genetic relationships among castor bean germplasm. Efficient and robust molecular markers are increasingly needed for breeding and improving varieties in castor bean. The advent of modern genomics has produced large amounts of publicly available DNA sequence data. In particular, expressed sequence tags (ESTs) provide valuable resources to develop gene-associated SSR markers. In total, 18,928 publicly available non-redundant castor bean EST sequences, representing approximately 17.03 Mb, were evaluated and 7732 SSR sites in 5,122 ESTs were identified by data mining. Castor bean exhibited considerably high frequency of EST-SSRs. We developed and characterized 118 polymorphic EST-SSR markers from 379 primer pairs flanking repeats by screening 24 castor bean samples collected from different countries. A total of 350 alleles were identified from 118 polymorphic SSR loci, ranging from 2-6 per locus (A) with an average of 2.97. The EST-SSR markers developed displayed moderate gene diversity (He) with an average of 0.41. Genetic relationships among 24 germplasms were investigated using the genotypes of 350 alleles, showing geographic pattern of genotypes across genetic diversity centers of castor bean. Castor bean EST sequences exhibited considerably high frequency of SSR sites, and were rich resources for developing EST-SSR markers. These EST-SSR markers would be particularly useful for both genetic mapping and population structure

  8. Gene structure, expression pattern and interaction of Nuclear Factor-Y family in castor bean (Ricinus communis).

    Science.gov (United States)

    Wang, Yue; Xu, Wei; Chen, Zexi; Han, Bing; Haque, Mohammad E; Liu, Aizhong

    2017-11-08

    Nuclear Factor-Y transcription factors, which function in regulating seed development (including storage reservoir accumulation) and responding to abiotic stresses, were identified and characterized in castor bean. Nuclear Factor-Y (NF-Y) transcription factors in plants contain three subunits (NF-YA, NF-YB and NF-YC), and function as a heterodimer or heterotrimer complex in regulating plant growth, development and response to stresses. Castor bean (Ricinus communis, Euphorbiaceae) one of the most economically important non-edible oilseed crops, able to grow in diverse soil conditions and displays high tolerance to abiotic stresses. Due to increasing demands for its seed oils, it is necessary to elucidate the molecular mechanism underlying the regulation of growth and development. Based on the available genome data, we identified 25 RcNF-Y members including six RcNF-YAs, 12 RcNF-YBs and seven RcNF-YCs, and characterized their gene structures. Yeast two-hybrid assays confirmed the protein-protein interactions among three subunits. Using transcriptomic data from different tissues, we found that six members were highly or specifically expressed in endosperms (in particular, two LEC1-type members RcNF-YB2 and RcNF-YB12), implying their involvement in regulating seed development and storage reservoir accumulation. Further, we investigated the expression changes of RcNF-Y members in two-week-old seedlings under drought, cold, hot and salt stresses. We found that the expression levels of 20 RcNF-Y members tested were changed and three RcNF-Y members might function in response to abiotic stresses. This study is the first reported on genomic characterization of NF-Y transcription factors in the family Euphorbiaceae. Our results provide the basis for improved understanding of how NF-Y genes function in the regulation of seed development and responses to abiotic stresses in both castor bean and other plants in this family.

  9. Alternatif Pembuatan Biodiesel Melalui Transesterifikasi Minyak Castor (Ricinus communis Menggunakan Katalis Campuran Cangkang Telur Ayam dan Kaolin

    Directory of Open Access Journals (Sweden)

    Soni - Setiadji

    2017-05-01

    Full Text Available Biodiesel was produced by transesterification of castor oil (Ricinus communis using a catalyst of CaO and kaolin (CaO / kaolin had been performed. CaO was obtained from the calcination of eggshell. Castor oil is selected as biodiesel feedstock because it belongs to non-food oil and easy to cultivate. In general, the research method aims to comprise the CaO / Kaolin catalysts with a ratio of 15 mmol CaO per 1 gram of kaolin activated using impregnation method and biodiesel produced through transesterification of castor oil using the catalyst at 65 ºC for 8 hours with ratio of castor oil: methanol: catalyst (1: 15: 5% w / w. The reaction is carried out on the reflux system. The XRD analysis show the presence of silica and potassium aluminum silicate hydroxide in the catalyst. The EDS results show the catalyst-forming components CaO and silica. The FTIR analysis results show the absorption peak in the functional group forming the methyl ester compound. Based on the characterization of GC-MS, the largest methyl ester components contained in biodiesel are methyl risinoleate, methyl elaidat, methyl stearate, methyl linoleate, and methyl palmitate. The overall conversion of castor oil to methyl ester using CaO / kaolin catalyst is 97.36%. The largest component in castor oil is risinoleic acid, has been successfully converted to methyl risinoleate by 74.75%.DOI: http://dx.doi.org/10.15408/jkv.v0i0.4778

  10. Synthesis and characterization of dialkanolamides from castor oil (Ricinus communis) as nonionic surfactant

    Science.gov (United States)

    Anwar, M.; Wahyuningsih, T. D.

    2017-12-01

    Nonionic surfactant of dialkanolamide derivates was synthesized and characterized from castor oil (Ricinus comunnis). Ricinoleic acid was isolated from castor oil by hydrolysis in alkaline (KOH) condition at 65 °C. Oxidation of ricinoleic acid by dilute potassium permanganate (KMnO4) in alkaline condition at 75-90 °C gave dicarboxylic acid which was then reacted with ethanolamine at 140-160 °C for 6 hours. The product was recrystallized with isopropanol, and the structure elucidation was performed by FTIR, 1HNMR spectrometer, and GC-MS with silylation method. Characterization of surfactants was carried out by surface tension measurement (capillary rise method), Critical Micelle Concentration (CMC) based on turbidity method and calculation of Hydrophilic-Lipophilic Balance (HLB) value with Griffin method and Bancroft rule. The result showed that ricinoleic acid in castor oil is 86.19 % and it is oxidation give an azelaic acid and octanedioic acid in 53.25 %. Amidation of a dicarboxylic acid and ethanolamine at 140-160 °C for 6 hours yielded of N1,N9-bis(2-hydroxyethyl)nona diamide in 49.35 %. Surfactant characterization indicates that dialkanolamide derivates can be used as a surfactant due to its ability to reduce the surface tension of ethanol with CMC at 1.2 g/L, HLB value is 5.58 and can be used as emulsifier water in oil (W/O).

  11. Growth, tolerance efficiency and phytoremediation potential of Ricinus communis (L.) and Brassica juncea (L.) in salinity and drought affected cadmium contaminated soil.

    Science.gov (United States)

    Bauddh, Kuldeep; Singh, Rana P

    2012-11-01

    We have previously reported that Ricinus communis (castor) is more tolerant to soil cadmium (Cd) and more efficient for Cd phytoremediation than Brassica juncea (Indian mustard) (Bauddh and Singh, 2012). In the present study, R. communis was found more tolerant to salinity and drought in presence of Cd and removed more Cd in a given time than Indian mustard. R. communis produced 23 and twelve folds higher biomass in terms of fresh weight and dry weight, respectively than that in B. juncea during three months when grown in Cd contaminated soil in presence of 100mM NaCl salinity and ten day water withdrawal based drought at 90 day after sowing (DAS). Castor plants showed stronger self-protection ability in form of proline bioaccumulation (r(2)=0.949) than Indian mustard (r(2)=0.932), whereas a lower r(2) for malondialdehyde (MDA) and total soluble protein in R. communis (r(2)=0.914 and r(2)=0.915, respectively) than that of B. juncea (r(2)=0.947 and r(2)=0.927, respectively) indicated a greater damage to cell membrane in Indian mustard during the multiple stress conditions. Though, the amount of Cd accumulated in the roots and shoots of Indian mustard was higher as per unit biomass than that in castor, total removal of the metal from soil was much higher in castor on per plant basis in the same period in presence of the stresses. R. communis accumulated about seventeen and 1.5 fold higher Cd in their roots and shoots, respectively than that of B. juncea in 90 DAS under the multiple stresses. Salinity alone enhanced Cd uptake, whereas drought stress reduced its uptake in both the plants. Copyright © 2012 Elsevier Inc. All rights reserved.

  12. Cyclic electron flow, NPQ and photorespiration are crucial for the establishment of young plants of Ricinus communis and Jatropha curcas exposed to drought.

    Science.gov (United States)

    Lima Neto, M C; Cerqueira, J V A; da Cunha, J R; Ribeiro, R V; Silveira, J A G

    2017-07-01

    Although plant physiological responses to drought have been widely studied, the interaction between photoprotection, photorespiration and antioxidant metabolism in water-stressed plants is scarcely addressed. This study aimed to evaluate the physiological adjustments preserving photosynthesis and growth in two plant species with different tolerance to drought: Jatropha curcas and Ricinus communis. We measured stress indicators, gas exchange, photochemistry of PSII and PSI, antioxidant enzymes, cyclic electron flow and photorespiration. Physiological stress indicators associated with reduction in growth confirmed R. communis as sensitive and J. curcas as tolerant to drought. Drought induced loss of photosynthesis in R. communis, whereas J. curcas maintained higher leaf gas exchange and photochemistry under drought. In addition, J. curcas showed higher dissipation of excess energy and presented higher cyclic electron flow when exposed to drought. Although none of these mechanisms have been triggered in R. communis, this species showed increases in photorespiration. R. communis displayed loss of Rubisco content while the Rubisco relative abundance did not change in J. curcas under drought. Accordingly, the in vivo maximum Rubisco carboxylation rate (V cmax ) and the maximum photosynthetic electron transport rate driving RuBP regeneration (J max ) were less affected in J. curcas. Both species displayed an efficient antioxidant mechanism by increasing activities of ascorbate peroxidase (APX) and superoxide dismutase (SOD). Overall, we suggest that the modulation of different photoprotective mechanisms is crucial to mitigate the effects caused by excess energy, maintaining photosynthetic apparatus efficiency and promoting the establishment of young plants of these two species under drought. © 2017 German Botanical Society and The Royal Botanical Society of the Netherlands.

  13. Ricinus communis biocompatibility histological study in the nose of Cebus apella monkeys Avaliação histológica da biocompatibilidade do polímero da mamona no dorso nasal de macacos-pregos (Cebus apella

    Directory of Open Access Journals (Sweden)

    Paulo Cesar de Jesus Dias

    2009-06-01

    Full Text Available Bone tissue lesions can be caused by congenital and acquired factors, and result in nasal deformities with cosmetic and functional repercussion. Surgical treatment in these cases frequently requires complex reconstructions and the use of biomaterials. The polyurethane derived from castor beans (Ricinus communis has a favorable formulation in terms of ease of processing, flexibility, no emission of toxic vapors and low cost. Nonetheless, despite favorable results, studies about the use of castor beam polymer (Ricinus communis assessing tissue reaction on the nasal dorsum are still missing in the literature. AIM: the goal of the present investigation is to histologically assess the Ricinus communis polymer implant biocompatibility with the nasal dorsum. STUDY DESING: experimental. MATERIALS AND METHODS: we used four Cebus appela monkeys, in which we created a nasal dorsal defect in all the animals and there we placed the aforementioned implant. The animals were sacrificed 270 days after surgery and the samples were submitted to histological study. RESULTS: in the histology analysis we did not observe the presence of foreign body granulomas or phagocytic cells. We also observed a progressive bone formation and maturation. CONCLUSION: macroscopic and microscopic results showed that the castor oil polymer implant was biocompatible.Lesões do tecido ósseo podem ser causadas por fatores congênitos e adquiridos e resultar em deformidade nasal com repercussão estética e funcional. O tratamento cirúrgico desses casos requer reconstruções complexas e frequentemente o uso de biomateriais. O poliuretano derivado do óleo da mamona apresenta uma fórmula com aspectos favoráveis de processabilidade, flexibilidade de formulação, ausência de emissão de vapores tóxicos e baixo custo. Entretanto, a despeito dos resultados favoráveis, estudos referentes ao uso do polímero de mamona, avaliando a reação tecidual no dorso nasal, ainda não foram

  14. AVALIAÇÃO DO POTENCIAL FITORREMEDIADOR DA MAMONA (Ricinus communis L UTILIZANDO EFLUENTE SINTÉTICO CONTENDO CHUMBO.

    Directory of Open Access Journals (Sweden)

    Anita Lima

    2010-04-01

    Full Text Available Os estudos de novas formas para o tratamento de efluentes domésticos e industriais vêm aumentando gradativamente no Brasil, neste contexto destacam-se as correntes que defendem a atenuação natural e a biorremediação. Por essas razões, em anos recentes, passou-se a dar preferência a métodos in situ, os quais são mais econômicos e perturbam menos o ambiente. Uma técnica de remediação natural é a fitorremediação que, aplica-se à utilização de vegetação (árvores, arbustos, plantas rasteiras e aquáticas e de sua microbiota com o fim de remover, degradar ou isolar substâncias tóxicas ao ambiente. O presente trabalho teve como objetivo testar o capacidade de fitorremediação da mamona (Ricinus Communis L. na redução das concentrações de chumbo presente em efluente sintético, cujas características simulam aquelas encontradas em um dos principais efluentes da indústria de exploração do petróleo, a água de produção tratada. O delineamento experimental utilizado no estudo foi o de blocos inteiramente casualizado com a variação das concentrações de chumbo distribuídas em quatro tratamentos: 0 µg/L (T1, 250 µg/L (T2, 500 µg/L (T3, 1000 µg/L (T4. Na análise dos dados foi aplicado o teste estatístico ANOVA para a comparação das médias nos tratamentos. A avaliação realizada nas concentrações de chumbo no lixiviado indicou que ocorreram remoções máximas de 67,42%, 87,34% e 94,74% para os tratamentos T2, T3 e T4, respectivamente. A retenção do chumbo nos tecidos (sistema radicular, caule e folhas da mamona indicou que a planta apresentou boa capacidade de bioacumular o chumbo. PALAVRAS-CHAVE: Fitorremediação, Chumbo, Mamona.

  15. Exploiting EST databases for the development and characterization of EST-SSR markers in castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Yang Jun-Bo

    2010-12-01

    Full Text Available Abstract Background The castor bean (Ricinus communis L., a monotypic species in the spurge family (Euphorbiaceae, 2n = 20, is an important non-edible oilseed crop widely cultivated in tropical, sub-tropical and temperate countries for its high economic value. Because of the high level of ricinoleic acid (over 85% in its seed oil, the castor bean seed derivatives are often used in aviation oil, lubricants, nylon, dyes, inks, soaps, adhesive and biodiesel. Due to lack of efficient molecular markers, little is known about the population genetic diversity and the genetic relationships among castor bean germplasm. Efficient and robust molecular markers are increasingly needed for breeding and improving varieties in castor bean. The advent of modern genomics has produced large amounts of publicly available DNA sequence data. In particular, expressed sequence tags (ESTs provide valuable resources to develop gene-associated SSR markers. Results In total, 18,928 publicly available non-redundant castor bean EST sequences, representing approximately 17.03 Mb, were evaluated and 7732 SSR sites in 5,122 ESTs were identified by data mining. Castor bean exhibited considerably high frequency of EST-SSRs. We developed and characterized 118 polymorphic EST-SSR markers from 379 primer pairs flanking repeats by screening 24 castor bean samples collected from different countries. A total of 350 alleles were identified from 118 polymorphic SSR loci, ranging from 2-6 per locus (A with an average of 2.97. The EST-SSR markers developed displayed moderate gene diversity (He with an average of 0.41. Genetic relationships among 24 germplasms were investigated using the genotypes of 350 alleles, showing geographic pattern of genotypes across genetic diversity centers of castor bean. Conclusion Castor bean EST sequences exhibited considerably high frequency of SSR sites, and were rich resources for developing EST-SSR markers. These EST-SSR markers would be particularly

  16. Jatropha curcas and Ricinus communis differentially affect arbuscular mycorrhizal fungi diversity in soil when cultivated for biofuel production in a Guantanamo (Cuba) tropical system.

    Science.gov (United States)

    Alguacil, M. M.; Torrecillas, E.; Hernández, G.; Torres, P.; Roldán, A.

    2012-04-01

    The arbuscular mycorrhizal fungi (AMF) are a key, integral component of the stability, sustainability and functioning of ecosystems. In this study, we characterised the AMF biodiversity in a control soil and in a soil cultivated with Jatropha curcas or Ricinus communis, in a tropical system in Guantanamo (Cuba), in order to verify if a change of land use to biofuel plant production had any effect on the AMF communities. We also asses whether some soil properties related with the soil fertility (total N, Organic C, microbial biomass C, aggregate stability percentage, pH and electrical conductivity) were changed with the cultivation of both crop species. The AM fungal small sub-unit (SSU) rRNA genes were subjected to PCR, cloning, sequencing and phylogenetic analyses. Twenty AM fungal sequence types were identified: 19 belong to the Glomeraceae and one to the Paraglomeraceae. Two AMF sequence types related to cultured AMF species (Glo G3 for Glomus sinuosum and Glo G6 for Glomus intraradices-G. fasciculatum-G. irregulare) disappeared in the soil cultivated with J. curcas and R. communis. The soil properties (total N, Organic C and microbial biomass C) were improved by the cultivation of the two plant species. The diversity of the AMF community decreased in the soil of both crops, with respect to the control soil, and varied significantly depending on the crop species planted. Thus, R. communis soil showed higher AMF diversity than J. curcas soil. In conclusion, R. communis could be more suitable in long-term conservation and sustainable management of these tropical ecosystems.

  17. Evaluation préliminaire de l'activité larvicide des extraits aqueux des feuilles du ricin (Ricinus communis L.) et du bois de thuya (Tetraclinis articulata (Vahl) Mast.) sur les larves de quatre moustiques culicidés : Culex pipiens (Linné), Aedes caspius (Pallas), Culiseta longiareolata (Aitken) et Anopheles maculipennis (Meigen)

    OpenAIRE

    Mahari S.; Mellouki F.; Oufara S.; Aouinty B.

    2006-01-01

    Preliminary evaluation of larvicidal activity of aqueous extracts from leaves of Ricinus communis L. and from wood of Tetraclinis articulata (Vahl) Mast. on the larvae of four mosquito species: Culex pipiens (Linné), Aedes caspius (Pallas), Culiseta longiareolata (Aitken) and Anopheles maculipennis (Meigen). Aqueous extracts of Ricinus communis leaves and Tetraclinis articulata wood showed strong toxic activity against larvae of several mosquitoes. In this study, insecticide effects of these ...

  18. Organic acids, amino acids compositions in the root exudates and Cu-accumulation in castor (Ricinus communis L.) Under Cu stress.

    Science.gov (United States)

    Huang, Guoyong; Guo, Guangguang; Yao, Shiyuan; Zhang, Na; Hu, Hongqing

    2016-01-01

    Ricinus communis L. is a hyperaccumulation plant newly discovered in an abandoned land of Cu mine in China. A hydroponic experiment was then carried out to determine the root exudates in the Cu-tolerant castor (Ricinus communis L.). Plants were grown in nutrient solution with increasing level of Cu doses (0, 100, 250, 500, and 750 μmol/L Cu) in the form of CuSO4. Cu accumulation in the roots and shoots of castor, and root exudates collected from the castor were measured. The results indicated that the castor had a high Cu accumulation capacity and the Cu concentrations in the shoots and roots of the castor treated with 750 μmol/L Cu were 177.1, 14586.7 mg/kg, respectively. Tartaric was the largest in the root exudates in terms of concentrations, which reached up to 329.13 μmol/g (dry plant) in the level of 750 μmol/L Cu. There was a significantly positive linear relationship between the Cu concentration in root and the concentration of succinic (R = 0.92, P < 0.05), tartaric (R = 0.96, P < 0.01), and citric (R = 0.89, P < 0.05). These results indicated that the difference in root exudation from castor could affect their Cu tolerance. What is more, significant is that the high tartaric and citric, the low oxalic and cysteine in the root exudation of castor contributed to toleration of high Cu concentrations.

  19. Optimization of Preparation of Activated Carbon from Ricinus communis Leaves by Microwave-Assisted Zinc Chloride Chemical Activation: Competitive Adsorption of Ni2+ Ions from Aqueous Solution

    Directory of Open Access Journals (Sweden)

    M. Makeswari

    2013-01-01

    Full Text Available The preparation of activated carbon (AC from Ricinus communis leaves was investigated in this paper. Orthogonal array experimental design method was used to optimize the preparation of AC using microwave assisted zinc chloride. Optimized parameters were radiation power of 100 W, radiation time of 8 min, concentration of zinc chloride of 30% by volume, and impregnation time of 24 h, respectively. The surface characteristics of the AC prepared under optimized conditions were examined by pHZPC, SEM-EDAX, XRD, and FTIR. Competitive adsorption of Ni2+ ions on Ricinus communis leaves by microwave assisted zinc chloride chemical activation (ZLRC present in binary and ternary mixture was compared with the single metal solution. The effects of the presence of one metal ion on the adsorption of the other metal ion were investigated. The experimental results indicated that the uptake capacity of one metal ion was reduced by the presence of the other metal ion. The extent of adsorption capacity of the binary and ternary metal ions tested on ZLRC was low (48–69% as compared to single metal ions. Comparisons with the biosorption of Ni2+ ions by the biomass of ZLRC in the binary (48.98–68.41%-~Ni-Cu and 69.76–66.29%-~Ni-Cr and ternary solution (67.32–57.07%-~Ni–Cu and Cr could lead to the conclusion that biosorption of Ni2+ ions was reduced by the influence of Cu2+ and Cr3+ ions. The equilibrium data of the adsorption was well fitted to the Langmuir isotherm. The adsorption process follows the pseudo-second-order kinetic model.

  20. Ricinus communis L.

    African Journals Online (AJOL)

    Rukevwe S. Abraka

    2016-12-07

    Dec 7, 2016 ... Germinação e crescimento inicial de plântulas de euphorbia heterophylla L. e Glycine max L. Merril na presença de extratos foliares de Salvia officinalis L. Revista em Agronegocio e Meio. Ambiente 8(2):291-301. Silva C J (2013). Caracterização agronômica e divergência genética de acessos de cártamo.

  1. Ricinus communis L.

    African Journals Online (AJOL)

    Rukevwe S. Abraka

    2016-12-07

    Dec 7, 2016 ... MARA (Ministério da Agricultura e Reforma Agrária) (1992). Regras para análise de sementes. Brasília: SNDA / DNDV / CLAV. 365 p. MARA (Ministério da Agricultura e Reforma Agrária) (2009). Regras para Análise de Sementes. 499 p. MARA (Ministério da Agricultura e Reforma Agrária) (2013). Balança.

  2. Interaction Effect Between Herbivory and Plant Fertilization on Extrafloral Nectar Production and on Seed Traits: An Experimental Study With Ricinus communis (Euphorbiaceae).

    Science.gov (United States)

    De Sibio, P R; Rossi, M N

    2016-08-01

    It is known that the release of volatile chemicals by many plants can attract the natural enemies of herbivorous insects. Such indirect interactions are likely when plants produce nectar from their extrafloral nectaries, and particularly when the production of extrafloral nectar (EFN) is induced by herbivory. In the present study, we conducted experiments to test whether foliar herbivory inflicted by Spodoptera frugiperda Smith (Noctuidae) increases nectar production by extrafloral nectaries on one of its host plants, Ricinus communis L. (Euphorbiaceae). Due to the current economic importance of R. communis, we also investigated whether the following seed traits-water content, dry mass, and essential oil production-are negatively affected by herbivory. Finally, we tested whether or not nectar production and seed traits are influenced by plant fertilization (plant quality). We found that nectar production was increased after herbivory, but it was not affected by the type of fertilization. Seed dry mass was higher in plants that were subjected to full fertilization, without herbivory; plants maintained in low fertilization conditions, however, had higher seed mass when subjected to herbivory. The same inverted pattern was observed for oil production. Therefore, our results suggest that EFN production in R. communis may act as an indirect defense strategy against herbivores, and that there is a trade-off between reproduction and plant growth when low-fertilized plants are subjected to herbivory. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  3. Effet comparé des poudres de Nicotiana tabacum L, Cymbopogon citratus (D.C. Stapf et de l'huile de Ricinus communis L sur la conservation des graines de Vigna unguiculata (L Walp

    Directory of Open Access Journals (Sweden)

    Gakuru, S.

    1995-01-01

    Full Text Available Compared Effect of Nicotiana tabacum L, Cymbopogon citratus (D.C. Stapf Powders and Castor Oil Ricinus communis L. on Conservation of Cowpea Vigna Unguiculata (L. Walp Grains. The effect of powder of tobacco Nicotiana tabacum L. and citronella grass Cymbopogon citratus (D.C. Stapf and castor oil Ricinus communis L. on conservation of cowpea Vigna unguiculata (L. Walp. grains was investigated in Kisangani, Zaire. After 5 months of conservation, infestation rates by bean weevil Acanthoscelides obtectus Say were 72.5 %, 74.5 %, 49.5 % and 5 % respectively for the check, the samples treated by 1 % of citronella grass and tobacco powder and 1 % of castor oil. The powder dose of 7.5 % did not give more interesting results.

  4. Modeling Seed Germination of Ricinus communis Using Hydrothermal Time Model Developed on the Basis of Weibull Distribution

    Directory of Open Access Journals (Sweden)

    H Akbari

    2016-02-01

    Full Text Available Introduction Temperature and water potential are two of the most important environmental factors regulating the seed germination. The germination response of a population of seeds to temperature and water potential can be described on the basis of hydrothermal time (HTT model. Regardless of the wide use of HTT models to simulate germination, little research has critically examined the assumption that the base water potential within these models is normally distributed. An alternative to the normal distribution that can fit a range of distribution types is the Weibull distribution. Using germination data of Castor bean (Ricinus communis L. over a range of water potential and sub-optimal temperature, we compared the utility of the normal and Weibull distribution in estimating base water potential (b. The accuracy of their respective HTT models in predicting germination percentage across the sub-optimal temperature range was also examined. Materials and Methods Castor bean seed germination was tested across a range of water potential (0, -0.3, -0.6 and -0.9 MPa at the sub-optimal range of temperature (ranging from 10 to 35 ˚C, with 5 ˚C intervals. Osmotic solutions were prepared by dissolving polyethylene glycol 8000 in distilled water according to the Michel (1983 equation for a given temperature. Seed germination was tested on 4 replicates of 50 seeds in moist paper towels in the incubator. The HTT models, based on the normal and Weibull distributions were fitted to data from all combinations of temperatures and water potentials using the PROC NLMIXED procedure in SAS. Results and Discussion Based on both normal and Weibull distribution functions, hydrotime constant and base water potential for castor bean seed germination were declined by increasing the temperature. Reducing the values of base water potential showed the greater need to water uptake for germination at lower temperatures and reducing hydrotime constant indicated an increase

  5. Allelopatic effect of different caster bean organs (Ricinus communis L. on reducing germination and growth of dodder (Cuscuta campestris Yuncker

    Directory of Open Access Journals (Sweden)

    S.M Seyyedi

    2016-05-01

    Full Text Available Introduction Dodder (Cascuta campestris Yuncker is an annual parasitic plant from the Convolvulaceae family (Mishra et al., 2007. It wraps around many adjacent dicot and a few monocot plants, penetrates in their vascular tissue and exploits photosynthates, nutrients and water (Lanini & Kogan, 2005. Consequently, the growth, vigor and production of the host plant will be severely reduced (Nadler-Hasasr & Rubin, 2003. Dodder is not able to complete its cycle, if it is not attached to a host. Therefore, it is entirely dependent on its host for supplying water, assimilates and minerals (Mishra et al., 2007. Considering the nature of dodder habit, it is rarely possible to completely control dodder by using different chemical herbicides (Lanini & Kogan, 2005. In addition, because of increasing the environmental concerns caused by applying synthetic herbicides, there is considerable attention to alternative strategies for weeds management (Batish et al., 2002; Bowmik & Inderjit, 2003. In recent years, allelopathic plants, an alternative strategy for weed management, have received massive attention (Narwal, 2010; Jamil et al., 2009. Due to the importance of dodder as a parasitic weed, this research was conducted with the purpose of studying the allelopathic effects of aqueous extracts and decay durations of caster bean (Ricinus communis L. organs on germination and emergence of dodder. Materials and methods The current study was conducted based on three separate experiments using a completely randomized design (CRD with factorial arrangement with three replications. The first experiment was conducted in petri dishes and consisted of caster bean organs at four levels (root, stem, leaf and total plant without inflorescence and their aqueous extract concentrations at 11 levels (0, 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10%. The second experiment was conducted in pots and factors were caster bean organs at 4 levels (root, stem, leaf and total plant without

  6. Transcriptomic analysis for different sex types of Ricinus communis L. during development from apical buds to inflorescences by digital gene expression profiling

    Directory of Open Access Journals (Sweden)

    Tan eMeilian

    2016-02-01

    Full Text Available The castor plant (Ricinus communis L. is a versatile industrial oilseed crop with a diversity of sex patterns, its hybrid breeding for improving yield and high purity is still hampered by genetic instability of female and poor knowledge of sex expression mechanisms. To obtain some hints involved in sex expression and provide the basis for further insight into the molecular mechanisms of castor plant sex determination, we performed DGE analysis to investigate differences between the transcriptomes of apices and racemes derived from female (JXBM0705P and monoecious (JXBM0705M lines. A total of 18 DGE libraries were constructed from the apices and racemes of a wild monoecious line and its isogenic female derivative at three stages of apex development, in triplicate. Approximately 5.7 million clean tags per library were generated and mapped to the reference castor genome. Transcriptomic analysis showed that identical dynamic changes of gene expression were indicated in monoecious and female apical bud during its development from vegetation to reproduction, with more genes expressed at the raceme formation and infant raceme stages compare to the early leaf bud stage. More than 3 thousands of differentially expressed genes (DEGs were detected in Ricinus apices at three developmental stages between two different sex types. A number of DEGs involved in hormone response and biosynthesis, especially auxin response and transport, transcription factors, signal transduction, histone demethylation/methylation, programmed cell death, and pollination, putatively associated with sex expression and reproduction were discovered, and the selected DEGs showed consistent expression between qRT-PCR validation and the DGE patterns. Most of those DEGs were suppressed at the early leaf stage in buds of the mutant, but then activated at the following transition stage (5-7-leaf stage of buds in the mutant, and ultimately, the number of up-regulated DEGs was equal to that

  7. Effect of the extract of Ricinus communis L. on the osmotic fragility, labeling of red blood cells with Technetium-99m and morphology of the cells

    Directory of Open Access Journals (Sweden)

    Kristiana Cerqueira Mousinho

    2008-12-01

    Full Text Available The aim of this study was to evaluate the influence of the proteic extract of R. communis on the cell physiology by the osmotic fragility, labeling of the blood elements with the 99mTc and cell morphology. To evaluate the osmotic fragility, the blood samples of the Wistar rats were incubated with the concentrations of R. communis and with the solutions of NaCl (0.4; 0.7; 0.9%. In the labeling of the blood elements procedure, the rat blood was treated with a solution of Tc-99m and TCA at 5%, determining the rate of radioactivity (%ATI in the plasma (P and in the red blood cells (RBC. The soluble and insoluble fractions of the plasma were also evaluated. The cells morphology submitted to the extract was evaluated by the optical microscopy (x40. The results indicated that the rate of the hemolysis increased in the presence of 0.125 mg/mL of the extract. There was a decay of 49.69% in the rate of ATI in the insoluble fraction of the cells, with the morphological alterations in the red blood cells. These results suggested that the extract changed the capability of binding of the red blood cells due to the stannous ion oxidation, modifying the cells structure.Produtos naturais são usados freqüentemente por muitas pessoas no tratamento do câncer. O Ricinus communis L é uma Euforbiaceae que apresenta propriedades laxativas, purgativas e antitumorais. O objetivo deste trabalho é estudar a influência da fração protéica do extrato hidroalcoólico de R. communis L. na fisiologia celular através da fragilidade osmótica, da marcação de elementos sanguíneo com 99mTc e da morfologia celular. Para avaliar a fragilidade osmótica, amostras de sangue de ratos Wistar foram incubadas com concentrações de R. communis e com soluções de NaCl (0,4; 0,7; 0,9%. No procedimento de marcação de elementos sanguíneos, as amostras de sangue foram tratadas com solução de Tc-99m e TCA à 5%, determinando o percentual de radioatividade (%ATI no plasma (P e

  8. Rendimento e Características Físicas dos Óleos de Nim (Azadirachta indica e Mamona (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    Full Text Available A pesquisa objetivou avaliar o rendimento e a viscosidade de óleos de nim (Azadirachta indica e mamona (Ricinus communis. Os frutos de nim foram coletados no Núcleo de Pesquisa do Semiárido, em Patos, Paraíba, e os de mamona, às margens do Rio Espinharas, Patos e em Igaracy, Paraíba. Os frutos foram beneficiados no Laboratório de Tecnologia de Produtos Florestais, em Patos. Foram retiradas amostras de sementes para a determinação do teor de umidade e do rendimento em óleos. Os óleos foram extraídos com álcool etílico absoluto e empregados no preparo de soluções com os óleos de nim e mamona. Determinaram-se a densidade e a viscosidade das soluções. A mamona teve menor teor de umidade e rendimento em óleo que o nim. A densidade e a viscosidade do óleo de nim foram menores que o da mamona. Uma maior quantidade de óleos de mamona proporcionou aumento na densidade e na viscosidade das soluções preparadas.

  9. Life history of Neoseiulus californicus (McGregor, 1954) (Acari: Phytoseiidae) fed with castor bean (Ricinus communis L.) pollen in laboratory conditions.

    Science.gov (United States)

    Marafeli, P P; Reis, P R; Silveira, E C da; Souza-Pimentel, G C; de Toledo, M A

    2014-08-01

    The predatory mite, Neoseiulus californicus (McGregor, 1954) (Acari: Phytoseiidae) is one of the principal natural enemies of tetranychid mites in several countries, promoting efficient control of those mites in several food and ornamental crops. Pest attacks such as that of the spider mite, Tetranychus urticae Koch, 1836 (Acari: Tetranychidae), is one of the problems faced by farmers, especially in the greenhouse, due to the difficulty of its control with the use of chemicals because of the development of fast resistance making it hard to control it. The objective of this work was to study the life history of the predatory mite N. californicus as a contribution to its mass laboratory rearing, having castor bean plant [Ricinus communis L. (Euphorbiaceae)] pollen as food, for its subsequent use as a natural enemy of T. urticae on a cultivation of greenhouse rosebushes. The studies were carried out in the laboratory, at 25 ± 2°C of temperature, 70 ± 10% RH and a 14 hour photophase. The biological aspects and the fertility life table were appraised. Longevity of 32.9 days was verified for adult females and 40.4 days for males. The intrinsic rate of increase (rm) was 0.2 and the mean generation time (T) was 17.2 days. The population doubled every 4.1 days. The results obtained were similar to those in which the predatory mite N. californicus fed on T. urticae.

  10. CONSTRUCCIÓN DE UN REACTOR DISCONTINUO PARA LA OBTENCIÓN DE BIODIESEL A PARTIR DEL ACEITE DE Ricinus communis

    Directory of Open Access Journals (Sweden)

    Yolimar Fernández

    2014-01-01

    Full Text Available Se construyó un reactor discontinuo para obtener biodiesel a partir de 5 litros de extracto obtenido de la semilla de Ricinus communis. El reactor es de acero inoxidable, con longitud de 29 cm; diámetro interno de 15,24 cm y fondo cónico de 20cm de largo, espesor de la pared de 0,2cm, resistencia tubular de 1000 W y motor de 110 volt. Se extrajo y se comparó con las normas respectivas las propiedades físicas y químicas del aceite crudo. Se realizaron pruebas preliminares de transesterificación del aceite catalizadas con NaOH para constatar la viabilidad de la reacción y definir las condiciones operacionales. El biodiesel obtenido fue caracterizado y comparado con referencias presentes en la literatura. Los resultaron mostraron que es posible obtener el biocombustible en el reactor discontinuo con un grado de conversión 88%; confirmando su aplicación en reacciones de transesterificación en medio básico.

  11. Photosynthetic capacity and water use efficiency in Ricinus communis (L. under drought stress in semi-humid and semi-arid areas

    Directory of Open Access Journals (Sweden)

    CLAUDIANA M. DOS SANTOS

    2017-12-01

    Full Text Available ABSTRACT Castor bean is one of the crops with potential to provide raw material for production of oils for biodiesel. This species possess adaptive mechanisms for maintaining the water status when subjected to drought stress. A better understanding these mechanisms under field conditions can unravel the survival strategies used by this species. This study aimed to compare the physiological adaptations of Ricinus communis (L. in two regions with different climates, the semi-arid and semi-humid subject to water stress. The plants showed greater vapor pressure deficit during the driest hours of the day, which contributed to higher values of the leaf temperature and leaf transpiration, however, the VPD(leaf-air had the greatest effect on plants in the semi-arid region. In both regions, between 12:00 p.m. and 2:00 p.m., the plants presented reduction in the rates of photosynthesis and intracellular CO2 concentration in response to stomatal closure. During the dry season in the semi-arid region, photoinhibition occurred in the leaves of castor bean between 12:00 p.m. and 2:00 p.m. These results suggest that castor bean plants possess compensatory mechanisms for drought tolerance, such as: higher stomatal control and maintenance of photosynthetic capacity, allowing the plant to survive well in soil with low water availability.

  12. Mining whole genomes and transcriptomes of Jatropha (Jatropha curcas) and Castor bean (Ricinus communis) for NBS-LRR genes and defense response associated transcription factors.

    Science.gov (United States)

    Sood, Archit; Jaiswal, Varun; Chanumolu, Sree Krishna; Malhotra, Nikhil; Pal, Tarun; Chauhan, Rajinder Singh

    2014-11-01

    Jatropha (Jatropha curcas L.) and Castor bean (Ricinus communis) are oilseed crops of family Euphorbiaceae with the potential of producing high quality biodiesel and having industrial value. Both the bioenergy plants are becoming susceptible to various biotic stresses directly affecting the oil quality and content. No report exists as of today on analysis of Nucleotide Binding Site-Leucine Rich Repeat (NBS-LRR) gene repertoire and defense response transcription factors in both the plant species. In silico analysis of whole genomes and transcriptomes identified 47 new NBS-LRR genes in both the species and 122 and 318 defense response related transcription factors in Jatropha and Castor bean, respectively. The identified NBS-LRR genes and defense response transcription factors were mapped onto the respective genomes. Common and unique NBS-LRR genes and defense related transcription factors were identified in both the plant species. All NBS-LRR genes in both the species were characterized into Toll/interleukin-1 receptor NBS-LRRs (TNLs) and coiled-coil NBS-LRRs (CNLs), position on contigs, gene clusters and motifs and domains distribution. Transcript abundance or expression values were measured for all NBS-LRR genes and defense response transcription factors, suggesting their functional role. The current study provides a repertoire of NBS-LRR genes and transcription factors which can be used in not only dissecting the molecular basis of disease resistance phenotype but also in developing disease resistant genotypes in Jatropha and Castor bean through transgenic or molecular breeding approaches.

  13. Life history of Neoseiulus californicus (McGregor, 1954 (Acari: Phytoseiidae fed with castor bean (Ricinus communisL. pollen in laboratory conditions

    Directory of Open Access Journals (Sweden)

    PP Marafeli

    Full Text Available The predatory mite, Neoseiulus californicus(McGregor, 1954 (Acari: Phytoseiidae is one of the principal natural enemies of tetranychid mites in several countries, promoting efficient control of those mites in several food and ornamental crops. Pest attacks such as that of the spider mite, Tetranychus urticaeKoch, 1836 (Acari: Tetranychidae, is one of the problems faced by farmers, especially in the greenhouse, due to the difficulty of its control with the use of chemicals because of the development of fast resistance making it hard to control it. The objective of this work was to study the life history of the predatory mite N. californicus as a contribution to its mass laboratory rearing, having castor bean plant [Ricinus communis L. (Euphorbiaceae] pollen as food, for its subsequent use as a natural enemy of T. urticae on a cultivation of greenhouse rosebushes. The studies were carried out in the laboratory, at 25 ± 2°C of temperature, 70 ± 10% RH and a 14 hour photophase. The biological aspects and the fertility life table were appraised. Longevity of 32.9 days was verified for adult females and 40.4 days for males. The intrinsic rate of increase (rm was 0.2 and the mean generation time (T was 17.2 days. The population doubled every 4.1 days. The results obtained were similar to those in which the predatory mite N. californicus fed on T. urticae.

  14. Tableros de partículas de bambú (Bambusa vulgaris Schrad y resina poliuretana a base de aceite de rícino (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Flávio Januário José

    Full Text Available Esta investigación tiene como objetivo la elaboración y la evaluación de tableros de partículas homogéneas aglomeradas, utilizándose dos materiales alternativos en la búsqueda de la sustentabilidad del proceso productivo. Fueron utilizadas partículas de Bambusa vulgaris Schrad por la rapidez del ciclo de producción de esta especie de bambú. Como pegante fue utilizada la resina poliuretana a base de aceite de ricino (Ricinus communis L., por su origen parcialmente renovable, y por ser considerada no tóxica. Para la caracterización del material, fueron fabricadas, en escala de laboratorio, tableros de partículas de bambú con dimensiones inferiores al 2.4 mm, combinadas con 5%, 10% y 15% de resina en relación a la masa de partículas de bambú. Probetas fueron evaluadas de acuerdo con las especificaciones de la norma NBR 14810 - Tableros de madera aglomerada. Antes de los ensayos de compresión las probetas fueron evaluadas por medio del ensayo no destructivo por ultra-sonido. Los resultados obtenidos indicaron que los tableros con el contenido de 10% de resina no fue estadísticamente diferente al contenido de 15%, siendo ambos superiores al contenido de 5%. La mayoría de las propiedades de los tableros fueron inferiores a aquellas de los tableros comerciales. No fue posible correlacionar la velocidad del pulso de ultra-sonido con la resistencia a la compresión longitudinal.

  15. Family of Ricinus communis Monosaccharide Transporters and RcSTP1 in Promoting the Uptake of a Glucose-Fipronil Conjugate.

    Science.gov (United States)

    Mao, Gen-Lin; Yan, Yin; Chen, Yan; Wang, Bing-Feng; Xu, Fei-Fei; Zhang, Zhi-Xiang; Lin, Fei; Xu, Han-Hong

    2017-08-02

    Enhancing the systemic distribution of a bioactive compound by exploiting the vascular transport system of a plant presents a means of reducing both the volume and frequency of pesticide/fungicide application. The foliar uptake of the glucose-fipronil conjugate N-[3-cyano-1-[2,6-dichloro-4-(trifluoromethyl)phenyl]-4-[(trifluoromethyl)sulfinyl]-1H-pyrazol-5-yl]-1-(β-d-glucopyranosyl)-1H-1,2,3-triazole-4-methanamine (GTF) achieved in castor bean (Ricinus communis) and its transport via the phloem are known to be mediated by monosaccharide transporter(s) [MST(s)], although neither the identity of the key MST(s) involved nor the mechanistic basis of its movement have yet to be described. On the basis of homology with Arabidopsis thaliana sugar transporters, the castor bean genome was concluded to harbor 53 genes encoding a sugar transporter, falling into the eight previously defined subfamilies INT, PMT, VGT, STP, ERD6, pGlucT, TMT, and SUT. Transcriptional profiling identified the product of RcSTP1 as a candidate for mediating GTF uptake, because this gene was induced by exposure of the plant to GTF. When RcSTP1 was transiently expressed in onion epidermis cells, the site of RcSTP1 deposition was shown to be the plasma membrane. A functional analysis based on RcSTP1 expression in Xenopus laevis oocytes demonstrated that its product has a high affinity for GTF. The long-distance root-to-shoot transport of GTF was enhanced in a transgenic soybean chimera constitutively expressing RcSTP1.

  16. RELACIÓN ENTRE VARIABLES CLIMÁTICAS CON LA MORFOLOGÍA Y CONTENIDO DE ACEITE DE SEMILLAS DE HIGUERILLA (Ricinus communis L. DE CHIAPAS

    Directory of Open Access Journals (Sweden)

    María Antonieta Goytia-Jiménez

    2011-01-01

    Full Text Available Ciento cincuenta y un accesiones de higuerilla (Ricinus communis L., colectadas en el estado de Chiapas, México, fueron caracterizadas por contenido de aceite, forma, tamaño y peso de la semilla, con el objetivo de generar información que pueda servir de base en un programa de mejoramiento para esta especie, que podría ser una opción rentable para la producción de biodiesel y bioturbosina. De acuerdo con su distribución, se establecieron las cuatro siguientes zonas climáticas: Región 1 clima Lluvioso tropical sin estación seca; Región 2 Sabana tropical con inviernos secos; Región 3 Sabana tropical con inviernos menos secos que la Región 2, y Región 4 Lluvioso Tropical. Se encontró una amplia variación en tamaño (de 0.05 a 2.49 cm2, color, peso (desde 7 hasta 123.9 g por cada 100 semillas y contenido de aceite (desde 12.20 a 64.84 %. Las asociaciones que se establecieron entre el tamaño y peso de 100 semillas con temperatura y precipitación fueron negativas, y significativas sólo en las regiones 3 y 4. No hubo significancia para las asociaciones del contenido de aceite con temperatura y precipitación, pero la tendencia fue a ser positivas en las regiones 1 y 4, las de mayor humedad de las cuatro regiones, y negativas en las regiones 2 y 3. Se concluye que los individuos de esta especie presentan una gran adaptación a diferentes entornos y crean fenotipos especiales para cada lugar en donde se desarrollan.

  17. Irrigation of Castor Bean (Ricinus communis L. and Sunflower (Helianthus annus L. Plant Species with Municipal Wastewater Effluent: Impacts on Soil Properties and Seed Yield

    Directory of Open Access Journals (Sweden)

    Vasileios A. Tzanakakis

    2011-11-01

    Full Text Available The effects of plant species (castor bean (Ricinus communis L. versus sunflower (Helianthus annus L. and irrigation regime (freshwater versus secondary treated municipal wastewater on soil properties and on seed and biodiesel yield were studied in a three year pot trial. Plant species were irrigated at rates according to their water requirements with either freshwater or wastewater effluent. Pots irrigated with freshwater received commercial fertilizer, containing N, P, and K, applied at the beginning of each irrigation period. The results obtained in this study showed that irrigation with effluent did not result in significant changes in soil pH, soil organic matter (SOM, total kjeldahl nitrogen (TKN, and dehydrogenase activity, whereas soil available P was found to increase in the upper soil layer. Soil salinity varied slightly throughout the experiment in effluent irrigated pots but no change was detected at the end of the experiment compared to the initial value, suggesting sufficient salt leaching. Pots irrigated with effluent had higher soil salinity, P, and dehydrogenase activity but lower SOM and TKN than freshwater irrigated pots. Sunflower showed greater SOM and TKN values than castor bean suggesting differences between plant species in the microorganisms carrying out C and N mineralization in the soil. Plant species irrigated with freshwater achieved higher seed yield compared to those irrigated with effluent probably reflecting the lower level of soil salinity in freshwater irrigated pots. Castor bean achieved greater seed yield than sunflower. Biodiesel production followed the pattern of seed yield. The findings of this study suggest that wastewater effluent can constitute an important source of irrigation water and nutrients for bioenergy crop cultivations with minor adverse impacts on soil properties and seed yield. Plant species play an important role with regard to the changes in soil properties and to the related factors of

  18. Secondary seed dispersal of Ricinus communis Linnaeus (Euphorbiaceae by ants in secondary growth vegetation in Minas Gerais Dispersão secundária de sementes de Ricinus communis Linnaeus (Euphorbiaceae por formigas em vegetação secundária em Minas Gerais

    Directory of Open Access Journals (Sweden)

    Mário Marcos do Espírito Santo

    2007-12-01

    Full Text Available In this study, I tested the efficacy of ants as secondary seed dispersers of Ricinus communis in southeastern Brazil. In a natural population of 143 individuals, I determined the ballistic dispersal distance for 62 seeds and 100 additional seeds were experimentally offered to ants in groups of ten seeds along a transect of 50 m. Fifty-three seeds were removed by ants, mainly by the leafcutter Atta sexdens (90.4%. The dispersal distance by ants was high, compared to the global average (4.38 m ± 0.74 m vs. 0.96 m, but was lower than the ballistic distance (7.27 m ± 0.13 m. Ants increased the total dispersal distance (8.66 m ± 0.60 m, but the main benefit for the plant was the directed dispersal, with seed deposition on the enriched soil of ant nests.Este estudo testou a eficiência de formigas como dispersores secundários de Ricinus communis no Brasil. Em uma população natural de 143 indivíduos, a distância de dispersão balística foi determinada para 62 sementes. Além disso, 100 sementes adicionais foram oferecidas a formigas em grupos de 10, ao longo de um transecto de 50 m. Cinqüenta e três sementes foram removidas por formigas, principalmente pela formiga-cortadeira Atta sexdens (90,4%. A distância de dispersão por formigas foi alta se comparada à média global (4,38m ± 0,74 m vs. 0,96 m, porém menor que a distância de dispersão balística (7,27 m ± 0,13 m. As formigas aumentaram a distância de dispersão total (8,66 m ± 0,60 m, mas o principal benefício para a planta foi a dispersão direcionada, com a deposição das sementes no solo enriquecido encontrado nos ninhos das formigas.

  19. Growth and carbon assimilation limitations in Ricinus communis (Euphorbiaceae under soil water stress conditions Crescimento e limitações à assimilação de carbono em Ricinus communis (Euphorbiaceae sob condições de estresse hídrico do solo

    Directory of Open Access Journals (Sweden)

    Tanise Luisa Sausen

    2010-09-01

    Full Text Available Water availability may influence plant carbon gain and growth, with large impacts on plant yield. Ricinus communis (L., a drought resistant species, is a crop with increasing economic importance in Brazil, due to its use in chemical industry and for the production of biofuels. Some of the mechanisms involved in this drought resistance were analyzed in this study by imposing progressive water stress to pot-grown plants under glasshouse conditions. Water withholding for 53 days decreased soil water gravimetric content and the leaf water potential. Plant growth was negatively and significantly reduced by increasing soil water deficits. With irrigation suspension, carbon assimilation and transpiration were reduced and remained mostly constant throughout the day. Analysis of A/Ci curves showed increased stomatal limitation, indicating that limitation imposed by stomatal closure is the main factor responsible for photosynthesis reduction. Carboxylation efficiency and electron transport rate were not affected by water stress up to 15 days after withholding water. Drought resistance of castor bean seems to be related to a pronounced, early growth response, an efficient stomatal control and the capacity to keep high net CO2 fixation rates under water stress conditions.A disponibilidade hídrica pode influenciar o ganho de carbono e o crescimento, com grande impacto na produtividade das plantas. Ricinus communis (L., uma espécie resistente à seca, é uma cultura de grande importância econômica no Brasil, devido ao seu uso na indústria química e para a produção de biocombustíveis. Alguns dos mecanismos envolvidos na resistência à seca desta espécie foram analisados através de um progressivo estresse hídrico em plantas cultivadas em vasos sob condições de casa de vegetação. A suspensão da irrigação por 53 dias decresceu o conteúdo gravimétrico de água no solo e o potencial hídrico das folhas. O crescimento das plantas foi

  20. Avaliação de fungicidas, óleos essenciais e agentes biológicos no controle de Amphobotrys ricini em mamoneira (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Haroldo Antunes Chagas

    2014-03-01

    Full Text Available A mamoneira (Ricinus communis L. é uma espécie oleaginosa tropical, sendo o óleo extraído de suas sementes um dos mais versáteis da natureza e com inúmeras aplicações industriais. Embora ainda seja uma espécie rústica, ela está sujeita a diversas doenças, dentre elas o mofo-cinzento, causada pelo fungo Amphobotrys ricini. O melhoramento genético seria a melhor alternativa para o controle da doença, mas demanda tempo para se obter cultivares resistentes. Dessa maneira, o uso de métodos de controle baseado em métodos químicos, alternativos ou biológicos mostra-se viável no curto prazo. O objetivo do trabalho foi estudar a eficiência do controle do mofo-cinzento, na cultura da mamoneira, utilizando-se de métodos químico, alternativo e biológico. Assim, procurou-se avaliar, tanto in vitro, quanto in vivo a eficiência de controle do patógenos utilizando-se de fungicidas, óleos essenciais e agentes de controle biológico. Quanto a inibição do crescimento micelial do patógeno in vitro os melhores tratamentos com os óleos essenciais foram os com a base de Cymbopogon martini e Cynnamomum zeylanicum, nas cinco concentrações testadas. Em ambos os óleos, o diâmetro médio das colônias ficou em 0,7 cm contra a média de 4,79 cm da testemunha. Com os fungicidas, nas quatro concentrações testadas, os mais eficientes foram os ingredientes ativos tiofanato metílico, carbendazim, tebuconazole e iprodione. O ED50 destes fungicidas ficou < 1uL/L, atestando 100% de inibição do crescimento micelial em todas as concentrações. Quanto à inibição da germinação dos conídios de A. ricini, os fungicidas tebuconazole e clorotalonil foram os melhores em todas as concentrações testadas, sendo a média dos conídios germinados destes fungicidas de 0,0 e 0,15%, respectivamente, contra 100% da testemunha. No campo, o tratamento com o fungicida iprodione foi o melhor quanto ao controle da doença quando comparados com os

  1. Evaluation préliminaire de l'activité larvicide des extraits aqueux des feuilles du ricin (Ricinus communis L. et du bois de thuya (Tetraclinis articulata (Vahl Mast. sur les larves de quatre moustiques culicidés : Culex pipiens (Linné, Aedes caspius (Pallas, Culiseta longiareolata (Aitken et Anopheles maculipennis (Meigen

    Directory of Open Access Journals (Sweden)

    Mahari S.

    2006-01-01

    Full Text Available Preliminary evaluation of larvicidal activity of aqueous extracts from leaves of Ricinus communis L. and from wood of Tetraclinis articulata (Vahl Mast. on the larvae of four mosquito species: Culex pipiens (Linné, Aedes caspius (Pallas, Culiseta longiareolata (Aitken and Anopheles maculipennis (Meigen. Aqueous extracts of Ricinus communis leaves and Tetraclinis articulata wood showed strong toxic activity against larvae of several mosquitoes. In this study, insecticide effects of these plant extracts have been investigated on 2nd and 4th instars larvae of Culicidae insects, Culex pipiens (Linné, Aedes caspius (Pallas, Culiseta longiareolata (Aitken and Anopheles maculipennis (Meigen. After 24 hours of exposition, bioassays revealed low lethal concentrations LC50. To control mosquitoes, these plant extracts might be used as natural biocides.

  2. Cálculo del balance de energía para higuerilla (Ricinus communis L. desde las etapas de producción en campo hasta el valor energético de cada componente de la planta

    Directory of Open Access Journals (Sweden)

    Hipólito Ortíz-Laurel

    2017-01-01

    Full Text Available Introducción : Pruebas de balance de energía permiten redirigir los insumos desde las etapas de producción de un cultivo, e igualmente, precesar la cantidad de energía utilizada para cada proceso y así, verificar la eficiencia al transformar la energía contenida en el cultivo cuando debe cumplir con una función deseada. Método : la planta de higuerilla (Ricinus communis L. con propósitos de cultivo energético fue sembrada en campo y sometida a procesos de mantenimiento de l cultivo y en la cosecha, la planta completa fue colectada para análisis energético, donde cada una de sus partes inclu i das las semillas fueron evaluadas en función de su contenido de energía. Así, para determinar el balance de energía; los valores de la energía biológica de la planta fueron comparados con la energía aplicada en cada uno de los procesos técnicos y físicos para la producción del cult i vo y en su procesamiento . Resultados : La energía aplicada para producir el cultivo r esulta un 28% superior a la energía a obtener de la planta. Asimismo, la biomasa de la planta completa de higuerilla, sin contar las semillas genera el doble de energía comparado con el aceite de las semillas, por lo que, conviene utilizar toda la planta e n términos de energía . Conclusión : Es recomendable utilizar el aceite de las seillas como biomaterial, ya que el b a lance es positivo en un 15%.

  3. Análise clínica, radiológica, macroscópica e histológica do úmero de codornas domésticas (Coturnix japonica, submetido ao implante da poliuretana derivada do polímero de mamona (Ricinnus communis Clinical, radiological, macroscopical and histological analysis of domestic quail (Coturnix japonica humerus submitted to implant of polyurethane from castor oil polymer (Ricinnus communis

    Directory of Open Access Journals (Sweden)

    Juliano Bolson

    2005-10-01

    ça de trabéculas e medula óssea no interior do implante. Concluiu-se que a poliuretana derivada do polímero de mamona é biocompatível em aves, podendo ser utilizada na cirurgia ortopédica, ocorrendo osteointegração.In orthopedic surgery there are frequently situations in which the surgeon faces severe bone losses caused by high-energy trauma, tumors or infections. Repairing these losses require knowledge about filling materials. Those materials can be biological, synthetic or metallic, with emphasis in bony grafts and biomaterial implants. The increase of the use of birds as pets is leading to an increasing number of clinical and surgical cases related to this taxon, where fractures are the most commonly observed surgical problems. The objective of this study was to evaluate clinical, radiological, macroscopic and microscopic effects of the polyurethane derived from castor oil (Ricinus communis polymer, when implanted in the humerus of domestic quails (Coturnix japonica. Twenty male and female quails, were used randomly distributed in four groups of five individuals. The birds received the implants in the left humerus, being submitted to daily physical examination during the postoperative period, immediate and biweekly radiological examination, and macroscopic and microscopic evaluation at the 15th, 30th, 60th and 90th days. Clinically, there were not observed local, regional or systemic changes. Radiologically, increase in local density was observed with no signs of changes in bone or adjacent tissue, as well as in the air sacs. Macroscopic analysis revealed that the polyurethane derived from castor oil polymer was not absorbed in none of the four groups, remaining implanted within the pneumatic bone. Its resistance, however, has changed. Microscopic examination evidenced minimum inflammatory reaction, slight fibrosis around the implants, and osteo-integration with presence of trabeculi and bone marrow inside the implants. Concluding, implants of polyurethane

  4. Influência da concentração de NaCl e pH na extração de ricina em torta de mamona (Ricinus communis L. e sua caracterização por eletroforese Influence of NaCl and pH concentration on the extraction of ricin in castor bean (Ricinus communis L. and its characterization by electrophoresis

    Directory of Open Access Journals (Sweden)

    Bárbara Amorim Silva

    2012-07-01

    Full Text Available A mamoneira (Ricinus communis L. é uma oleaginosa de alto valor econômico pelo fato de apresentar um mercado bem definido para o óleo extraído de suas sementes. A torta, que é um resíduo desta extração, se destaca pelo alto teor em proteínas. Dentre as proteínas encontradas na torta destaca-se a ricina, uma citotoxina, que inviabiliza sua utilização como fonte protéica alternativa para alimentação animal. O presente trabalho tem como objetivo identificar um melhor tratamento experimental para a extração de ricina da torta de mamona, visando futuros estudos de perda de integridade da ricina, o que garantiria a inocuidade do produto. Para tanto, buscou-se identificar a solução de maior capacidade de extração de proteínas, empregando a metodologia de superfície de resposta. Um delineamento composto central rotacional foi elaborado a fim de verificar o melhor pH e concentração de NaCl para a extração. Dos cinco diferentes valores de pH (4,0; 4,6; 6,0; 7,4; 8,0 e concentração de NaCl (0,0M; 0,3M; 1,0M; 1,7M; 2,0M utilizados, o tratamento associando fosfato de potássio 0,2M/NaCl 1,7M pH 7,4 foi escolhido como o melhor. A concentração de proteína extraída neste tratamento chegou a valores quatro vezes maiores que o encontrado no de mínima extração de proteína. Pela evidenciação do gel de eletroforese não houve extração preferencial de ricina nos tratamentos testados, entretanto etapas de purificação usando diálise e precipitação com sulfato de amônio, permitiram uma evidenciação melhor das duas cadeias polipeptídicas de ricina.Castor bean (Ricinus communis L. is an oilseed crop of high economic value due to the fact of presenting a clearly defined market for the oil extracted from its seeds. Castor cake, which is a residue of oil extraction, is at the moment receiving special attention because of its high protein content. However, among the proteins found in this cake it is observed the presence of

  5. (Ricinus communis) ACCESSIONS COLLECTED FROM ENUGU ...

    African Journals Online (AJOL)

    and lectin were determined for each of the four randomly selected accessions. The potassium content was determined by the flame photometry method while phosphorus content was determined using the ascorbic acid method. The seed volume and the surface area were calculated using the method described by Jain and ...

  6. EFICIÊNCIA DOS ÓLEOS DE NIM (Azadirachta indica A. Juss. E MAMONA (Ricinus communis L. NA RESISTÊNCIA DA MADEIRA DE SUMAÚMA (Ceiba pentandra (L. Gaerth. A FUNGOS XILÓFAGOS EM SIMULADORES DE CAMPO

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    2012-01-01

    Full Text Available The research aimed to evaluate the efficiency of neem (Azadirachta indica and castor oil plant (Ricinus communis oils for the improvement of Ceiba pentandra wood resistance to xilophagous fungi in soil bed condition (field simulator. The neem and castor oil plant oils were extracted with absolute ethyl alcohol and employed in the preparation of oil solutions. Wood samples with dimensions of 1.5 x 0.5 x 15 cm (radial x tangential x longitudinal were treated to reach a nominal retention of 10 to 16 kg of solution/m³ of wood. The samples were submitted to the action of natural micro-flora of three soils; forest, agricultural use and natural pasture soils, for 180 days. Among the tested soils, the agricultural presented greater biological activity, which damaged the samples even more. Among the tested solutions, the pure neem oil provided increased protection to samples. The prepared solutions using neem and castor oil plant oils did not protect the wood from the attack of xylophagous fungi existing in the ground.

  7. Eficiência dos óleos de nim (Azadirachta indica e de mamona (Ricinus communis na proteção da madeira de sumaúma (Ceiba pentandracontra cupins xilófagos em ensaio de preferência alimentar

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    2011-06-01

    Full Text Available Esta pesquisa objetivou avaliar a eficiência dos óleos de nim (Azadirachta indica e de mamona (Ricinus communis na melhoria da resistência da madeira de sumaúma (Ceiba pentandra ao térmita xilófago Nasutitermes corniger em ensaio de preferência alimentar. Os óleos das sementes de nim e de mamona foram extraídos com álcool etílico absoluto e empregados no preparo das soluções preservativas. Amostras de madeira com dimensões de 2,0 x 10,16 x 0,64 cm (radial x longitudinal x tangencial foram tratadas para atingir uma retenção nominal de 10 a 16 kg de solução por metro cúbico de madeira, sendo parte das amostras tratadas submetida ao envelhecimento (volatilização ou lixiviação. As amostras tratadas foram submetidas à ação de cupins em ensaio de preferência alimentar. Os referidos óleos pouco contribuíram para a melhoria da resistência da madeira de sumaúma ao cupim testado. Entre as soluções testadas, o óleo de mamona puro foi o mais eficiente. O envelhecimento das amostras pouco influenciou na resistência da madeira. Os óleos de nim e de mamona puros e suas soluções, mesmo apresentando algum efeito de repelência aos cupins, não evidenciaram efeito duradouro, indicando que esses produtos não devem ser empregados no tratamento da madeira com o objetivo de melhorar sua resistência a cupins xilófagos.

  8. Eficiência dos óleos de nim (Azadirachta indica A. Juss. e mamona (Ricinus communis L. na resistência da madeira de sumaúma (Ceiba pentandra (L. Gaerth. a fungos xilófagos em simuladores de campo

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    2012-09-01

    Full Text Available http://dx.doi.org/10.5902/198050986627A pesquisa objetivou avaliar a eficiência dos óleos de nim (Azadirachta indica e de mamona (Ricinus communis na melhoria da resistência da madeira de sumaúma (Ceiba pentandra a fungos xilófagos em simulador de campo. Os óleos de nim e de mamona foram extraídos com álcool etílico absoluto e empregados no preparo das soluções preservativas. Amostras de madeira com dimensões de 1,5 x 0,5 x 15 cm (radial x tangencial x longitudinal foram tratadas para atingir uma retenção nominal de 10 a 16 kg de solução/m³ de madeira. As amostras permaneceram por 180 dias sob ação da microflora natural existente em três tipos de solos: de floresta, de uso agrícola e de pastagem natural. Entre os solos testados, o de uso agrícola apresentou maior atividade biológica, deteriorando mais as amostras. Dentre as soluções testadas, o óleo de nim puro proporcionou maior proteção à madeira. As soluções preparadas com os óleos de nim e mamona não protegeram bem a madeira do ataque de fungos xilófagos naturalmente existentes no solo de uso agrícola.

  9. Final report on the safety assessment of Ricinus Communis (Castor) Seed Oil, Hydrogenated Castor Oil, Glyceryl Ricinoleate, Glyceryl Ricinoleate SE, Ricinoleic Acid, Potassium Ricinoleate, Sodium Ricinoleate, Zinc Ricinoleate, Cetyl Ricinoleate, Ethyl Ricinoleate, Glycol Ricinoleate, Isopropyl Ricinoleate, Methyl Ricinoleate, and Octyldodecyl Ricinoleate.

    Science.gov (United States)

    2007-01-01

    The oil derived from the seed of the Ricinus communis plant and its primary constituent, Ricinoleic Acid, along with certain of its salts and esters function primarily as skin-conditioning agents, emulsion stabilizers, and surfactants in cosmetics, although other functions are described. Ricinus Communis (Castor) Seed Oil is the naming convention for castor oil used in cosmetics. It is produced by cold pressing the seeds and subsequent clarification of the oil by heat. Castor oil does not contain ricin because ricin does not partition into the oil. Castor oil and Glyceryl Ricinoleate absorb ultraviolet (UV) light, with a maximum absorbance at 270 nm. Castor oil and Hydrogenated Castor Oil reportedly were used in 769 and 202 cosmetic products, respectively, in 2002; fewer uses were reported for the other ingredients in this group. The highest reported use concentration (81%) for castor oil is associated with lipstick. Castor oil is classified by Food and Drug Administration (FDA) as generally recognized as safe and effective for use as a stimulant laxative. The Joint Food and Agriculture Organization (FAO)/World Health Organization (WHO) Expert Committee on Food Additives established an acceptable daily castor oil intake (for man) of 0 to 0.7 mg/kg body weight. Castor oil is hydrolyzed in the small intestine by pancreatic enzymes, leading to the release of glycerol and Ricinoleic Acid, although 3,6-epoxyoctanedioic acid, 3,6-epoxydecanedioic acid, and 3,6-epoxydodecanedioic acid also appear to be metabolites. Castor oil and Ricinoleic Acid can enhance the transdermal penetration of other chemicals. Although chemically similar to prostaglandin E(1), Ricinoleic Acid did not have the same physiological properties. These ingredients are not acute toxicants, and a National Toxicology Program (NTP) subchronic oral toxicity study using castor oil at concentrations up to 10% in the diet of rats was not toxic. Other subchronic studies of castor oil produced similar findings

  10. Amelioration of Anti-Nutritive Effects of Castor Oil Seed ( Ricinus ...

    African Journals Online (AJOL)

    Amelioration of Anti-Nutritive Effects of Castor Oil Seed ( Ricinus communis ) Meal in Broilers' Ration Using Natural Fermentation and Dl-Methionine ... Growth performance, coefficient of total tract apparent digestibility, serum metabolites, dressing percentage, and retail cuts were determined at the end of the study, which ...

  11. Criblage in vitro des graines d'accessions locales de ricin ( Ricinus ...

    African Journals Online (AJOL)

    Le ricin (Ricinus communis L.) est une plante peu exigeante dont la culture offre d'énormes potentialités économiques pour les exploitants agricoles sénégalais. L'identification de génotypes performants avec des rendements acceptables en conditions de stress salin constitue une des solutions pour promouvoir cette ...

  12. Anatomical studies of Juniperus communis L. ssp. communis and J. communis L. ssp. nana Syme

    NARCIS (Netherlands)

    Miller, H.J.

    1974-01-01

    The wood descriptions of Juniperus communis L. ssp. communis are compared with those of earlier authors. The average and maximum tracheid lengths and the ray height distribution frequencies offer a means of separating the wood of the erect J. communis L. ssp. communis from that of the subspecies

  13. Immunogenic Properties of Ricinus Communis Var Minor Seed on ...

    African Journals Online (AJOL)

    Prof. Ogunji

    Ringler and Newcomer 2nd Ed. 1994.San Diego, Academic Press; pp 435-448. Suckow, M A., Brammer, D W., Rush, H. G. and Chrisp, C.E. (2002). Biology and Diseases of Rabbits: Laboratory Animal Medicine, 2nd Ed, 2002 New York Academic Press. Weir, D. M. (1973). Antigens: Immunology for undergraduates 3rd Ed.

  14. Toxic effects of Ricinus communis non proteic trypsin inhibitor for ...

    African Journals Online (AJOL)

    Marcelo Haro

    2015-10-21

    Alvarez et al., 2009). Current control of S. ... al., 2009). The use of proteinase inhibitors (PIs), a class of substances involved in plant defense is an example of these new alternative. Levels of PIs in plant leaves are usually low and ...

  15. EFFECT OF CASTOR BEAN (Ricinus communis L.) AQUEOUS ...

    African Journals Online (AJOL)

    User

    potted plant studies, crude castor bean aqueous extracts and its lower concentrations of 20, 40 ... -knot nematodes in vitro and in potted-tomato plants, but this was not demonstrated in field stud- ies. Further ..... tain medicinal plant oil products.

  16. ARTICLE - Inbreeding depression in castor bean (Ricinus communis L. progenies

    Directory of Open Access Journals (Sweden)

    Milton Krieger

    2012-12-01

    Full Text Available The purpose of this study was to investigate inbreeding depression (DE in castor bean. From a population derived from the Guarani cultivar, 60 mother plants were sampled. Three types of progenies were obtained from each one: from self-pollination (AU, from crosses (CR and from open pollination (PL. Grain yield of the progenies was evaluated in two locations. There was a strong interaction of progenies x locations, which led to obtaining estimates within each location. Broad variation was observed in inbreeding depression, with mean values of 6.7% and 13.4%, comparing AU progenies with PL progenies. It was observed that the population has high potential for selecting promising inbred lines. The frequency of mother plants generating progenies with simultaneous high general combination capacity and low inbreeding depression was low. Recurrent selection will increase the occurrence of parent plants associating these two properties, which is necessary for obtaining superior synthetic varieties.

  17. Diversity of castor ( Ricinus communis L.) in Ethiopia | Alemaw ...

    African Journals Online (AJOL)

    An experiment was carried out to assess the diversity of castor germplasm in Ethiopia. A total of 102 accessions, one elite genotype and two standard varieties were characterized at Melkassa and Arsi Negelle, in the Central Rift Valley of Ethiopia using 12 traits for one during 2013 main season. Analysis of variance ...

  18. Chemical Investigations of the Castor Bean Plant Ricinus communis

    Science.gov (United States)

    2012-12-01

    manuscript outlining this work has been submitted to the journal Phytochemistry .17 2.4 Environmental Considerations 2.4.1 Greenhouse Studies An...publication in Phytochemistry .17 When applied to extracts of Australian specimens, 1H NMR based metabolomics analysis allowed for state based...17. Ovenden, S. P. B.; Pigott, E. J.; Rochfort, S.; Bourne, D. J. Phytochemistry , 2012, submitted. UNCLASSIFIED 43 UNCLASSIFIED DSTO-TR-2786

  19. EFFECT OF CASTOR BEAN (Ricinus communis L.) AQUEOUS ...

    African Journals Online (AJOL)

    User

    The soil was cov- ered with wet jute sacks to conserve steam in the chamber. Fire wood was used as the source of heat. The sterilized soil was allowed to cool ... treatments. Water served as the control. The set ups were kept on laboratory benches at room temperature. Nematicidal potential of castor bean's crude extract ... 3 ...

  20. Variations in seed traits of castor ( Ricinus communis ) accessions ...

    African Journals Online (AJOL)

    The physicochemical analysis showed that castor seed and oil had saponification value of 182.9 mg/g, moisture content of 4.4%, acid value of 3.085 mg/g, viscosity of 110.41 cP, pH of 6.11, iodine value of 8.46 mg/g, specific gravity of 0.962 and refractive index of 1.477˚C. The proximate analysis showed that moisture ...

  1. Accumulation, selection and covariation of amino acids in sieve tube sap of tansy (Tanacetum vulgare) and castor bean (Ricinus communis): evidence for the function of a basic amino acid transporter and the absence of a γ-amino butyric acid transporter.

    Science.gov (United States)

    Bauer, Susanne N; Nowak, Heike; Keller, Frank; Kallarackal, Jose; Hajirezaei, Mohamad-Reza; Komor, Ewald

    2014-09-01

    Sieve tube sap was obtained from Tanacetum by aphid stylectomy and from Ricinus after apical bud decapitation. The amino acids in sieve tube sap were analyzed and compared with those from leaves. Arginine and lysine accumulated in the sieve tube sap of Tanacetum more than 10-fold compared to the leaf extracts and they were, together with asparagine and serine, preferably selected into the sieve tube sap, whereas glycine, methionine/tryptophan and γ-amino butyric acid were partially or completely excluded. The two basic amino acids also showed a close covariation in sieve tube sap. The acidic amino acids also grouped together, but antagonistic to the other amino acids. The accumulation ratios between sieve tube sap and leaf extracts were smaller in Ricinus than in Tanacetum. Arginine, histidine, lysine and glutamine were enriched and preferentially loaded into the phloem, together with isoleucine and valine. In contrast, glycine and methionine/tryptophan were partially and γ-amino butyric acid almost completely excluded from sieve tube sap. The covariation analysis grouped arginine together with several neutral amino acids. The acidic amino acids were loaded under competition with neutral amino acids. It is concluded from comparison with the substrate specificities of already characterized plant amino acid transporters, that an AtCAT1-like transporter functions in phloem loading of basic amino acids, whereas a transporter like AtGAT1 is absent in phloem. Although Tanacetum and Ricinus have different minor vein architecture, their phloem loading specificities for amino acids are relatively similar. © 2014 Scandinavian Plant Physiology Society.

  2. Jatropha curcasand Ricinus communisdisplay contrasting photosynthetic mechanisms in response to environmental conditions

    Directory of Open Access Journals (Sweden)

    Milton Costa Lima Neto

    2015-06-01

    Full Text Available Higher plants display different adaptive strategies in photosynthesis to cope with abiotic stress. In this study, photosynthetic mechanisms and water relationships displayed byJatropha curcasL. (physic nuts andRicinus communisL. (castor bean, in response to variations in environmental conditions, were assessed.R. communis showed higher CO2 assimilation, stomatal and mesophyll conductance thanJ. curcas as light intensity and intercellular CO2 pressure increased. On the other hand,R. communis was less effective in stomatal control in response to adverse environmental factors such as high temperature, water deficit and vapor pressure deficit, indicating lower water use efficiency. Conversely,J. curcas exhibited higher photosynthetic efficiency (gas exchange and photochemistry and water use efficiency under these adverse environmental conditions.R. communisdisplayed higher potential photosynthesis, but exhibited a lowerin vivo Rubisco carboxylation rate (Vcmax and maximum electron transport rate (Jmax. During the course of a typical day, in a semiarid environment, with high irradiation, high temperature and high vapor pressure deficit, but exposed to well-watered conditions, the two studied species presented similar photosynthesis. Losing potential photosynthesis, but maintaining favorable water status and increasing non-photochemical quenching to avoid photoinhibition, are important acclimation mechanisms developed byJ. curcas to cope with dry and hot conditions. We suggest thatJ. curcas is more tolerant to hot and dry environments thanR. communis but the latter species displays higher photosynthetic efficiency under well-watered and non-stressful conditions.

  3. Protein (Viridiplantae): 389551 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available nel, putative Ricinus communis MENDPLLPYHSPRKRTPPQLPPILCPLPEDDEVSLPLSISPSELKERLIFGPSPSPNDSTPVFEALTHSLNSPRP...SCSNQEFNFHDSPRHHQQPQSWLIDPNYSWTKTNLHRSKTAPAMAVINDSLNSSHIPKPQFGSQSIVRQAFVLLILYLSFGVV

  4. Diversity of Castor (Ricinus communis L.) in Ethiopia አህፅርኦት ...

    African Journals Online (AJOL)

    Cluster analysis was used for each site separately and for combined data to group accessions based on all measured traits to study diversity. Results and Discussion. Range and mean of agronomic traits. A very wide range of values in agronomic traits was observed at both locations (Table 1). The range of values in days to ...

  5. Metal concentration in plant tissues of Ricinus communis L. (Castor oil)

    African Journals Online (AJOL)

    SLO) contaminated soil at concentrations of 1-6% (w/w, oil/soil). Plant height and stem girth were depressed by spent lubricating oil at concentrations of 2% (w/w) and above. One percent (1%) spent lubricating oil in soil promoted growth of ...

  6. Cultivar Determination of Ricinus communis via the Metabolome: a Proof of Concept Investigation

    Science.gov (United States)

    2009-08-01

    commercial (wheat, olive, wines) and forensic ( cannabis ) plant crops and has enabled either or both of cultivar and provenance to be determined.38-41...Giovachino, M.; Morrow, R.; Trabert, E., Response to a ricin incident; Guidelines for Federal, State, and Local Public Health and Medical Officials

  7. Genetic variability and traits association in castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Goodarzi Farnaz

    2015-01-01

    Full Text Available Genetic diversity of 12 castor bean accessions collected from different geographical regions of Iran was assessed in a randomized complete block design with three replications under filed condition. The data were recorded for 32 agro-morphological traits. Significant differences were observed among accessions for main stem length, main stem moist weight, main stem dry weight, 10-seeds weight on primary raceme, seed number on primary raceme, leaf area dry weight, female flower length, male flower length, secondary and tertiary raceme weight and oil percentage. A strongly positive correlation was observed between total seed weight on primary raceme as yield with seed number on primary raceme, female flower length, primary raceme length and main stem diameter. Path coefficient analysis indicated high direct effect of seed number on primary raceme (0.82 on seed yield. In addition, direct effect of primary raceme length on seed yield was negative (-0.13. Primary raceme length had the greatest indirect effect via seed number on seed yield (0.35.

  8. Effects of hexane extract of Ricinus communis L. (var. minor ) on ...

    African Journals Online (AJOL)

    ... haemoglobin values as compared to those of the control animals. The rise in the total white blood cells was progressively steady. This effect may be antimicrobial. The reduction in haemoglobin values was attributed to generalized toxicity from the extract or maybe a result of an allergic reaction to the castor bean extract.

  9. Castor (Ricinus communis L. Tolerance to Postemergence Herbicides and Weed Control Efficacy

    Directory of Open Access Journals (Sweden)

    W. James Grichar

    2012-01-01

    Full Text Available Potential US castor production is limited due to only one labeled herbicide (trifluralin. Field studies were conducted at two Texas locations during 2008 and 2009 to evaluate postemergence herbicides for castor tolerance and weed control efficacy. Clethodim and fluazifop-P-butyl caused no castor stunting while acifluorfen, bentazon, imazethapyr, and lactofen caused stunting which ranged from 5 to 46%. Imazapic and 2,4-DB caused the greatest stunting (44 to 99% and resulted in castor yields of 0 to 45% of the untreated check. Acifluorfen, imazapic, imazethapyr, lactofen, and 2,4-DB controlled at least 80% smellmelon (Cucumis melo L. var. Dudaim Naud. while clethodim and fluazifop-P-butyl controlled at least 98% Texas millet [Urochloa texana (Buckl. R.Webster]. Imazapic and imazethapyr provided 57 to 75% Texas millet control. Results suggest that castor tolerance to the graminicides, clethodim, and fluazifop-P-butyl is high; however, castor injury and yield reductions with the postemergence applications of broadleaf herbicides suggest that these herbicides should not be used in castor production.

  10. Actividad insecticida de Ricinus Communis L. sobre Plodia Interpunctella Hbn. (Lepidoptera: Phycitinae).

    OpenAIRE

    Collavino, Marcelo; Pelicano, Alicia; Giménez, Rosana A.

    2006-01-01

    La aplicación de insecticidas sintéticos como principal sistema de control de plagas de granos y productos almacenados ha originado el desarrollo de poblaciones de insectos resistentes a dichos químicos, la contaminación del medio ambiente y la acumulación de sustancias tóxicas en los alimentos. En este trabajo se evaluaron los efectos de la aplicación de molido de hojas de ricino sobre larvas de la «polilla de las harinas» (Lepidoptera: Phycitinae). Los molidos ...

  11. Proteomic profile of the nucellus of castor bean (Ricinus communis L.) seeds during development

    DEFF Research Database (Denmark)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Soares, Emanoella L

    2012-01-01

    proteins are known to have a role as storage proteins. Moreover for the first time, ricin isoforms were identified in tissues other than seed endosperm. Results are discussed in the context of the spatial and temporal distribution of the identified proteins within the nucellar cell layers....

  12. Effect of powdered castor oil seed ( Ricinus communis L.) on some ...

    African Journals Online (AJOL)

    The rats were in five groups, which were replicated three (3) times. The castor oil seed was turned to powdery form using pestle and mortal. Four feed formulations were used; powdered castor oil seed and commercial rat feed mixed in ratio 1:1, 1:2, 1:5, 1:10 and ordinary commercial rat feed, which serves as the control.

  13. Evaluation of phytoextracting cadmium and lead by sunflower, ricinus, alfalfa and mustard in hydroponic culture.

    Science.gov (United States)

    Zhi-xin, Niu; Sun, Li-na; Sun, Tie-heng; Li, Yu-shuang; Wang, Hong

    2007-01-01

    Soil contaminated with heavy metals cadmium (Cd) and lead (Pb) is hard to be remediated. Phytoremediation may be a feasible method to remove toxic metals from soil, but there are few suitable plants which can hyperaccumulate metals. In this study, Cd and Pb accumulation by four plants including sunflower (Helianthus annuus L.), mustard (Brassica juncea L.), alfalfa (Medicago sativa L.), ricinus (Ricinus communis L.) in hydroponic cultures was compared. Results showed that these plants could phytoextract heavy metals, the ability of accumulation differed with species, concentrations and categories of heavy metals. Values of BCF (bioconcentration factor) and TF (translocation factor) indicated that four species had dissimilar abilities of phytoextraction and transportation of heavy metals. Changes on the biomass of plants, pH and Eh at different treatments revealed that these four plants had distinct responses to Cd and Pb in cultures. Measurements should be taken to improve the phytoremediation of sites contaminated with heavy metals, such as pH and Eh regulations, and so forth.

  14. Review of the traditional uses, phytochemistry, pharmacology and toxicology of giant fennel (Ferula communis L. subsp. communis)

    OpenAIRE

    Maryam Akaberi; Milad Iranshahy; Mehrdad Iranshahi

    2015-01-01

    Ferula communis L., subsp. communis, namely giant fennel, has extensively been used in traditional medicine for a wide range of ailments. Fresh plant materials, crude extracts and isolated components of F. communis showed a wide spectrum of in vitro and in vivo pharmacological properties including antidiabetic, antimicrobial, antiproliferative, and cytotoxic activities. The present paper, reviews the traditional uses, botany, phytochemistry, pharmacology and toxicology of F. communis in order...

  15. Szycher's handbook of polyurethanes

    National Research Council Canada - National Science Library

    Szycher, M

    2013-01-01

    .... Filled with tables, charts, and photographs, it includes new data on green polyurethanes, automotive applications, new coatings, new manufacturing equipment, new health-care uses, and other topics...

  16. Volatile Constituents of Ferula communis L. subsp. communis Growing Spontaneously in Greece

    Directory of Open Access Journals (Sweden)

    Stavroula Manolakou

    2013-01-01

    Full Text Available The essential oils of Greek Ferula communis subsp. communis from different plant parts were obtained by hydrodistillation and analyzed by means of GC and GC-MS. Ninety three compounds were identified in the total essential oils. Sesqui terpenes were the most dominant class of compounds in the leaves and inflorescences oils, while infructescences oils were rich in monoterpenes with α-pinene (35.2-40.6% being the dominant component.

  17. [Active constituents of Commelina communis L].

    Science.gov (United States)

    Tang, X Y; Zhou, M H; Zhang, Z H; Zhang, Y B

    1994-05-01

    According to the pharmacological results five compounds were isolated from the herb of Commelina communis. Based on physico-chemical constants and spectral data, four of them were identified as n-triacontanol, p-hydroxycinnamic acid, daucosteril and D-mannitol. p-hydroxycinnamic acid shows antibacterial activity and D-mannitol shows antitussive effect.

  18. Polyurethane-Foam Maskant

    Science.gov (United States)

    Bodemeijer, R.

    1985-01-01

    Brown wax previously used to mask hardware replaced with polyurethane foam in electroplating and electroforming operations. Foam easier to apply and remove than wax and does not contaminate electrolytes.

  19. Szycher's handbook of polyurethanes

    National Research Council Canada - National Science Library

    Szycher, M

    2013-01-01

    "Written as a reference for polyurethane technologists and end users, raw materials suppliers, and students in the field, this second edition covers the technical advances in the field over the past 10 years...

  20. Polyurethanes for Medical Use

    Directory of Open Access Journals (Sweden)

    Tanja Pivec

    2017-07-01

    Full Text Available Polyurethanes are synthetic copolymers containing urethane linkages in their complex chemical structure. They consist of three monomers: a diisocyanate, a polyol and a chain extender, which enables the synthesis of an endless number of polyurethanes with diff erent physicochemical and mechanical properties. The physicochemical properties of various polyurethanes are largely dependent on the conformation of polyols, which may contain two or more different polyols, stabilisers, catalysts, liquids or solid additives and, in the case of foams, foaming agents. Depending on the structure of the polyols, i.e. the length of the chain, structure of the units (aliphatic or aromatic, ester or ether groups, or functionalisation by hydroxyl groups, polyurethanes may be fl exible or rigid, and therefore suitable for various applications. In addition to the physical and chemical structure of polyurethanes, this review paper specifi cally addresses their use in medicine, particularly in wound dressings, tissue engineering scaff olds and drug delivery with nanoparticles and nanocapsules, and provides guidelines for the development of new biodegradable polyurethane materials

  1. Polyurethane toilet seat contact dermatitis.

    Science.gov (United States)

    Turan, Hakan; Saricaoğlu, Hayriye; Turan, Ayşegül; Tunali, Sükran

    2011-01-01

    Polyurethane chemicals are produced by the reaction of isocyanates and they may cause allergic contact dermatitis or precipitate asthma attacks. Contact dermatitis to polyurethane toilet seat has not been reported before. Herein we present a case of allergic contact dermatitis to polyurethane toilet seat. © 2011 Wiley Periodicals, Inc.

  2. In vitro micropropagation of almond (Amygdalus communis L. cv ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-06-17

    Jun 17, 2008 ... This method here in described will be useful for the rapid multiplication of almond (A. communis L. cv. Nonpareil) in commercial exploitation. Key words: Amygdalus communis L.cv. Nonpareil, micropropagation, zygotic embryos, in vitro. INTRODUCTION. The almond (Prunus dulcis, syn. Prunus amygdalus ...

  3. Exotic Rickettsiae in Ixodes ricinus: fact or artifact?

    NARCIS (Netherlands)

    Tijsse-Klasen, E.; Fonville, M.; Overbeek, van L.S.; Reimerink, J.H.J.; Sprong, H.

    2010-01-01

    Several pathogenic Rickettsia species can be transmitted via Ixodes ricinus ticks to humans and animals. Surveys of I. ricinus for the presence of Rickettsiae using part of its 16S rRNA gene yield a plethora of new and different Rickettsia sequences. Interpreting these data is sometimes difficult

  4. Review of the traditional uses, phytochemistry, pharmacology and toxicology of giant fennel (Ferula communis L. subsp. communis).

    Science.gov (United States)

    Akaberi, Maryam; Iranshahy, Milad; Iranshahi, Mehrdad

    2015-11-01

    Ferula communis L., subsp. communis, namely giant fennel, has extensively been used in traditional medicine for a wide range of ailments. Fresh plant materials, crude extracts and isolated components of F. communis showed a wide spectrum of in vitro and in vivo pharmacological properties including antidiabetic, antimicrobial, antiproliferative, and cytotoxic activities. The present paper, reviews the traditional uses, botany, phytochemistry, pharmacology and toxicology of F. communis in order to reveal its therapeutic potential and future research opportunities. A bibliographic literature search was conducted in different scientific databases and search engines including Scopus, Cochrane Library, Embase, Google Scholar, Pubmed, SciFinder, and Web of science. Phytochemical studies have led to the isolation of different compounds such as sesquiterpenes from F. communis. This plant has two different chemotypes, the poisonous and non-poisonous chemotypes. Each chemotype is endowed with various constituents and different activities. The poisonous chemotype exhibits anticoagulant and cytotoxic activities with sesquiterpene coumarins as major constituents, while the non-poisonous one exhibits estrogenic and cytotoxic effects with daucane sesquiterpene esters as the main compounds. In addition, although various pharmacological properties have been reported for F. communis, anti-microbial activities of the plant have been investigated in most studies. Studies revealed that F. communis exhibits different biological activities, and contains various bioactive compounds. Although, antibacterial and cytotoxic activities are the two main pharmacological effects of this plant, further studies should focus on the mechanisms underlying these actions, as well as on those biological activities that have been reported traditionally.

  5. Review of the traditional uses, phytochemistry, pharmacology and toxicology of giant fennel (Ferula communis L. subsp. communis

    Directory of Open Access Journals (Sweden)

    Maryam Akaberi

    2015-11-01

    Full Text Available Ferula communis L., subsp. communis, namely giant fennel, has extensively been used in traditional medicine for a wide range of ailments. Fresh plant materials, crude extracts and isolated components of F. communis showed a wide spectrum of in vitro and in vivo pharmacological properties including antidiabetic, antimicrobial, antiproliferative, and cytotoxic activities. The present paper, reviews the traditional uses, botany, phytochemistry, pharmacology and toxicology of F. communis in order to reveal its therapeutic potential and future research opportunities. A bibliographic literature search was conducted in different scientific databases and search engines including Scopus, Cochrane Library, Embase, Google Scholar, Pubmed, SciFinder, and Web of science. Phytochemical studies have led to the isolation of different compounds such as sesquiterpenes from F. communis. This plant has two different chemotypes, the poisonous and non-poisonous chemotypes. Each chemotype is endowed with various constituents and different activities. The poisonous chemotype exhibits anticoagulant and cytotoxic activities with sesquiterpene coumarins as major constituents, while the non-poisonous one exhibits estrogenic and cytotoxic effects with daucane sesquiterpene esters as the main compounds. In addition, although various pharmacological properties have been reported for F. communis, anti-microbial activities of the plant have been investigated in most studies. Studies revealed that F. communis exhibits different biological activities, and contains various bioactive compounds. Although, antibacterial and cytotoxic activities are the two main pharmacological effects of this plant, further studies should focus on the mechanisms underlying these actions, as well as on those biological activities that have been reported traditionally.

  6. Review of the traditional uses, phytochemistry, pharmacology and toxicology of giant fennel (Ferula communis L. subsp. communis)

    Science.gov (United States)

    Akaberi, Maryam; Iranshahy, Milad; Iranshahi, Mehrdad

    2015-01-01

    Ferula communis L., subsp. communis, namely giant fennel, has extensively been used in traditional medicine for a wide range of ailments. Fresh plant materials, crude extracts and isolated components of F. communis showed a wide spectrum of in vitro and in vivo pharmacological properties including antidiabetic, antimicrobial, antiproliferative, and cytotoxic activities. The present paper, reviews the traditional uses, botany, phytochemistry, pharmacology and toxicology of F. communis in order to reveal its therapeutic potential and future research opportunities. A bibliographic literature search was conducted in different scientific databases and search engines including Scopus, Cochrane Library, Embase, Google Scholar, Pubmed, SciFinder, and Web of science. Phytochemical studies have led to the isolation of different compounds such as sesquiterpenes from F. communis. This plant has two different chemotypes, the poisonous and non-poisonous chemotypes. Each chemotype is endowed with various constituents and different activities. The poisonous chemotype exhibits anticoagulant and cytotoxic activities with sesquiterpene coumarins as major constituents, while the non-poisonous one exhibits estrogenic and cytotoxic effects with daucane sesquiterpene esters as the main compounds. In addition, although various pharmacological properties have been reported for F. communis, anti-microbial activities of the plant have been investigated in most studies. Studies revealed that F. communis exhibits different biological activities, and contains various bioactive compounds. Although, antibacterial and cytotoxic activities are the two main pharmacological effects of this plant, further studies should focus on the mechanisms underlying these actions, as well as on those biological activities that have been reported traditionally. PMID:26949491

  7. Entomopathogenic fungi associated with Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Kalsbeek, Vibeke; Frandsen, F.; Steenberg, Tove

    1995-01-01

    The objective of this study was to demonstrate the occurrence of entomopathogenic fungi on Ixodes ricinus ticks in relation to the tick stage, engorgement and season. Ticks were collected from the vegetation, from small rodents and from deer. All entomopathogenic fungi found belonged...... infected with fungi. Thirty-three out of 149 engorged females were infected, whereas males and engorged larvae were not infected. Throughout the season, a significantly higher proportion of ticks collected in autumn were infected. Entomopathogenic fungi may have a significant impact on the size of the I...

  8. Shape memory polyurethane nanocomposites

    Science.gov (United States)

    Cao, Feina

    Shape memory polymers are smart materials which can remember their original shapes. However, the low recovery stress and low mechanical strength limit the commercial applications of shape memory polymers. In this study, nanoclays were introduced to shape memory polyurethanes (SMPU) to augment these properties by enhance the network of SMPU. Several factors which influence the shape recovery stress were evaluated, including the nature of polymer chain by using different monomers, type of clay particles, extent of filler dispersion, clay content and deformation conditions. It was found that only reactive clay particles were well dispersed into polyurethane matrix by the tethering between --CH2CH 2OH functional groups in clay surfactants and polyurethane chains. Two different shape memory polyurethanes (Systems I & II) prepared by bulk polymerization were compared. The shape memory effect of System I was triggered by melting of the soft segment crystals, while that of System II was by glass transition of the soft segments. It was seen that the reactive clay particles dispersed well in both polyurethane matrices and augmented the recovery stress, e.g., 20% increase with 1 wt % nanoclay in System I and 40% increase with 5 wt % nanoclay in System II were observed. In System I, clay particles interfered with soft segment crystallization, and promoted phase mixing between the hard and soft segments, thus affecting the fixity and recovery ratio. Nevertheless, the soft segment crystallinity was still enough and in some cases increased due to stretching to exhibit excellent shape fixity and shape recovery ratio. The higher loading of clay particles accelerated the stress relaxation, resulting in reduction of recovery stress. In System II, no significant effect of clay particles in phase separation was observed, so there was no influence of clay on shape fixity and recovery ratio. The recovery stress increased with reactive nanoclay content. It was also found that the recovery

  9. Antibacterial activity of extracts from Myrtus communis L. (Ades) and ...

    African Journals Online (AJOL)

    Antibacterial activity of extracts from Myrtus communis L. (Ades) and Dodoneae angustifolia L.F. (Kitkita) using bioautography method. Negero Gemeda, Kelbessa Urga, Messay Getachew, Kissi Muddie, Frehiwot Teka, Ashenif Tadele, Hirut Lemma, Mulugeta Guta ...

  10. Shape memory polyurethane foams

    OpenAIRE

    Kim, B. K.; Kang, S M; Lee, S. J.

    2012-01-01

    Molded flexible polyurethane (PU) foams have been synthesized from polypropylene glycol (PPG) with different molecular weights (Mw) and functionalities (f), and 2,4/2,6-toluene diisocyanate (TDI-80) with water as blowing agent. It was found that the glassy state properties of the foam mainly depended on the urethane group content while the rubbery state properties on the crosslink density. That is, PPG of low MW and low f (more urethane groups) provided superior glass state modulus, strength,...

  11. Development of a bioassay to quantify the ricin toxin content of castor bean (Ricinus communis L. seeds=Desenvolvimento de um bioensaio para quantificar o teor da toxina ricina em sementes de mamona (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Dick Auld

    2012-10-01

    Full Text Available In this study, we developed a bioassay to quantify the ricin toxin content of castor bean seeds. Existing quantification methods do not always reflect actual toxicity of the seeds analyzed, which may present lower ricin content even though they are more toxic than seeds presenting a higher content of ricin. This is because these methods actually measure the addition of ricin RCA, which is a compound less toxic than pure ricin. We decided to use in this study, the nematode Caenorhabditis elegans, which has been widely used by the pharmaceutical industry. We tested two strains of C. elegans using different methods in 8 experiments. We examined 4 methods of extracting the ricin complex and 3 methods of exposing the nematodes. Among the nematode strains and ricin extraction methods tested, we concluded that the best strain for testing ricin toxicity was the strain called N2 and that the best method for ricin extraction was a rotating bath followed by centrifugation and exposing the nematodes in 24 well plates with a solution of nematodes extracted from the media with destilated waterexposing the nematodes in 24-well plates This method is inexpensive, quick and adequate for the selection of offspring with lower RIP content.Foi desenvolvido um bioensaio para quantificar o teor de ricina nas sementes de mamona. Os métodos de quantificação existentes não refletem a toxidez real das sementes analizadas, que pode mostrar um resultado de menor teor de ricina e ainda assim ser mais toxico do que as sementes que apresentaram teores maiores. Isto ocorre por que estes métodos medem alem da ricina a RCA, que é um composto menos tóxico que a ricina pura. Foi decidido utilizar neste estudo o nematoide Caenorhabditis elegans, que tem sido amplamente utilizado na industria farmacêutica. Foram testadas duas estirpes de C.elegans usadas em diferentes métodos contando com 8 experimentos distintos. nós examinamos 4 métodos de extração de ricina e 3 métodos de exposição do nematóide à ricina. Foi concluído que a melhor estirpe para testar ricina foram as estirpes chamadas de N2 e o melhor método de extração da toxina foi o do banho maria seguido pela centrifugação e o melhor método de exposição dos nematóides foi o que conta com uma placa de 24 poços onde o nematóide suspenso em água destilada são expostos a toxina. Este é um método barato, rápido e adequado para seleção de materiais com baixo teor de RIP.

  12. Exogenous glutamine increases lipid accumulation in developing seeds of castor bean (Ricinus communis L. cultured in vitro

    Directory of Open Access Journals (Sweden)

    Zhang Yang

    2015-01-01

    Full Text Available This report describes biomass production and compositional changes of developing castor seeds in response to change in the nitrogen resource (glutamine of the medium. During the early developmental period (24-36 days after pollination, oil was found to initially accumulate in the developing seeds. Carbohydrates and oil were inversely related after glutamine provision (35 mM, in the culture medium. [U-14C] sucrose labeling was used to investigate the effect of metabolic fluxes among different storage materials. Addition of glutamine led to a 7% increase of labeling in lipids and an inverse decrease of labeling in carbohydrates. It was postulated that changes in the glutamine concentration in the medium are likely to influence the partitioning of resources between the various storage products, especially carbohydrates and oil. These observations will contribute to a better understanding of assimilate partitioning in developing castor seeds and the development of molecular strategies to improve castor bean seed quality and plant breeding studies.

  13. Pré-condicionamento de Sementes de Ricinus communis L. Para o Teste de Tetrazólio

    Directory of Open Access Journals (Sweden)

    Jerffeson Araujo Cavalcante

    2014-08-01

    Full Text Available O teste de tetrazólio é um método rápido e eficaz para avaliação da qualidade fisiológica de sementes. O presente trabalho tem por objetivo estabelecer uma metodologia de pré-condicionamento de sementes de mamona para a avaliação da viabilidade e vigor pelo teste de tetrazólio. O trabalho foi realizado no Laboratório de Análise de Sementes e Mudas do Centro de Ciências e Tecnologia Agroalimentar da Universidade Federal de Campina Grande, campus Pombal – PB. Foram utilizados quatro lotes de sementes de mamona, BRS Nordestina, BRS Energia, IAC 80 e IAC Guarani. Para o pré-condicionamento do teste de tetrazólio, as sementes foram postas para embeber em papel germitest, umedecido com quantidade de água equivalente a 2,5 vezes o peso do papel seco, acondicionadas em câmaras do tipo BOD regulada a 30°C, durante um período de 18 horas. Após o período de embebição as sementes foram submetidas a três tipos de cortes: 1 Corte longitudinal mediano, no sentido do comprimento da semente, através do tegumento, endosperma e embrião; 2 Corte em bisel na região oposta a carúncula; 3 Remoção do tegumento e corte longitudinal mediano. Em seguida as sementes foram imersas em solução de tetrazólio a 0,1% e mantidas na ausência de luz no interior de câmara do tipo BOD regulada a 30°C, por um período de 6 horas. Os resultados obtidos foram comparados com o teste de germinação e emergência de plântulas. O corte longitudinal mediano, no sentido do comprimento da semente, através do tegumento, endosperma e embrião, favoreceu a avaliação da viabilidade e vigor das sementes de mamoneira.

  14. A review of nutritional and toxicological implications of castor bean (Ricinus communis L.) meal in animal feeding systems.

    Science.gov (United States)

    Akande, T O; Odunsi, A A; Akinfala, E O

    2016-04-01

    The nutrient-rich defatted castor meal has been tested as a potential source of protein in diets of many livestock species but has limitation due to challenges of toxins. This review was conducted to compile the relevant research information on advances in the use of raw and differently processed castor seed meal in animal feed. In this article, distribution and uses of castor and its products were identified. Research findings on the nutrients profile, principal toxins, various detoxification strategies, nutritional value and toxicity on common livestock species were compiled and reviewed. The defatted seed meal had crude protein range of 32-48%, gross energy of about 3200 kcal/kg. Ricin content was 9.3 mg/g seed, and the average RCA content was 9.9 mg/g. The meal had high activity of lectin, which produced agglutination at about 4.70 mg/ml minimum assays. Reports of detoxification strategies showed varying degrees of success but high pH, moist heating and microbial techniques appeared to exert greater effect on deactivating ricin. Detoxification strategy for the allergen component is inconclusive. Tannins and the phenolic contents were present at trace level and did not constitute notable threat. It was concluded that castor seed holds great potential as feedstuff when upgraded but such upgrading must be safe, cost-effective and labour efficient for commercial acceptability. Journal of Animal Physiology and Animal Nutrition © 2015 Blackwell Verlag GmbH.

  15. Phloem flow and sugar transport in Ricinus communis L. is inhibited under anoxic conditions of shoot or roots

    NARCIS (Netherlands)

    Peuke, A.D.; Gessler, A.; Trumbore, S.; Windt, C.W.; Homan, N.; Gerkema, E.; As, van H.

    2015-01-01

    Anoxic conditions should hamper the transport of sugar in the phloem, as this is an active process. The canopy is a carbohydrate source and the roots are carbohydrate sinks.By fumigating the shoot with N2 or flooding the rhizosphere, anoxic conditions in the source or sink, respectively, were

  16. Use of organic ligands in lead Phytoextraction by Castor bean (Ricinus communis L.)

    OpenAIRE

    Rendina, Alicia; Miniño, Hugo; Bursztyn, Amalia; Ríos, Alejandra de los; Barros, María Josefina; Wassner, Diego; Fabrizio de Iorio, Alicia Rosa

    2014-01-01

    Especies vegetales con alta producción de biomasa pueden ser utilizadas para la remoción de metales mediante la cosecha de la biomasa aérea. Sin embargo, la baja disponibilidad de los metales en el suelo, frecuentemente limitan su absorción y translocación, reduciendo la eficiencia del proceso de fitoextracción. La adición de ligandos orgánicos al suelo constituye una estrategia para aumentar la disponibilidad de los metales. Un experimento en macetas fue llevado a cabo para evaluar la fitoex...

  17. Efecto de extractos cetonicos de higuerilla (Ricinus communis linneo.) sobre el nematodo Barrenador [Radopholus similis Thorne] en condiciones in vitro

    National Research Council Canada - National Science Library

    De Jesus Arboleda, Francisco; Guzman, Oscar Adrian; Fernando Mejia, Luis

    2012-01-01

    Los nematicidas utilizados para el control de nematodos fitoparasitos son costosos y contaminan los ecosistemas terrestres y acuaticos, debido a ello se busco otra alternativa para su manejo, como fue...

  18. Effects of sowing dates and different fertilizers on yield, yield components, and oil percentage of castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    parviz rezvani moghadam

    2009-06-01

    Full Text Available In order to study the effects of sowing dates and different fertilizers on yield, yield components, and oil percentage of castor bean, an experiment was conducted at Experimental station, College of Agriculture, Ferdowsi University of Mashhad, Iran in years 2004-2005. The experimental treatments comprised all combinations of four sowing dates (11 April, 25 April, 8 May and 22 May and three different fertilizers (cow manure (30 tons/ha, compost (30 tons/ha, chemical fertilizers (100 kg/ha N and 250 kg/ha of super phosphate and no fertilizer as control. Different characteristics such as plant height, main inflorescence height, number of inflorescence per plant, number of secondary stems per plant, number of capsules per plant, number of grain per plant, grain weight per plant, 100 seed weight, grain yield, oil percentage and oil yield were recorded. A factorial arrangement based on a randomized complete block design with three replications was used. The results showed by delaying sowing date grain yield, seed oil percentage and oil yield were decreased, but there was no significant differences between 25 April, 8 May and 22 May sowing dates. Harvest index and 100 seed weight did not affect by neither sowing dates nor fertilizer treatments. The highest number of branches per plant, number of fertile inflorescences per plant, number of fertile capsules per plant, number of grain per plant, grain weight per plant and biological yield were obtained at 8 May sowing date on chemical fertilizer. Percentage of seed oil, grain yield and oil yield was higher at the first sowing date (11 April in compost and chemical fertilizer treatments. Keywords: Castor bean, sowing date, fertilizer, grain yield, oil percentage.

  19. Descriptores botánicos para caracterizar germoplasmas de Ricinus communis de diferentes zonas de Costa Rica

    Directory of Open Access Journals (Sweden)

    Paola Solera-Steller

    2015-03-01

    Los resultados mostraron valores significativos para la longitud del racimo y el número de frutos por racimo, la razón largo/ancho del fruto, peso del fruto, la razón del largo/ancho de la semilla y el peso de la semilla, con correlaciones superiores a un 45%. Sin embargo, el ACP mostró que existe una alta variabilidad entre los datos, algo muy común entre individuos silvestres, debido principalmente a su forma de dispersión y a la gran cantidad de zonas de vida muestreadas. Para la CJA, se pudieron observar tres grupos ordenados principalmente por las correlaciones entre el tamaño del racimo y el número de frutos, la razón largo/ancho y el peso del fruto y la razón largo/ancho y peso de la semilla, los cuales pueden usarse como indicadores para la caracterización morfológica de la higuerilla proveniente de todo el país.

  20. Identification of reference genes for gene expression studies during seed germination and seedling establishment Ricinus communis L.

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.; Dekkers, S.J.W.; Fernandez, L.G.; Castro, De R.D.; Ligterink, W.; Hilhorst, H.W.M.

    2014-01-01

    Reverse transcription-quantitative polymerase chain reaction (RT-qPCR) is an important technology to analyse gene expression levels during plant development or in response to different treatments. An important requirement to measure gene expression levels accurately is a properly validated set of

  1. Polyurethane synthesis reactions in asphalts

    Energy Technology Data Exchange (ETDEWEB)

    Bukowski, A.; Gretkiewicz, J.

    1982-04-01

    A series of asphalt-polyurethane composites was prepared by means of polyurethane synthesis in asphalt and carried out in melt. The applied materials were asphalts of differentiated group components content, polyester polyols of chain structure from linear to strongly branched, 2,4-tolylene diisocyanate, 4,4-methylenebis(phenyl isocyanate), and tinorganic catalyst. The asphalt components react with isocyanates to a minimal degree. The influence of the applied substrates, temperature, and polyurethane content in the system on the basic kinetic relations characterizing the process is presented. Polyurethane synthesis in asphalts does not differ in a fundamental way from the obtaining of polyurethanes, especially when their content in the composition is significant, 20 wt% and more.

  2. 21 CFR 177.1680 - Polyurethane resins.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Polyurethane resins. 177.1680 Section 177.1680 Food... of Single and Repeated Use Food Contact Surfaces § 177.1680 Polyurethane resins. The polyurethane...) For the purpose of this section, polyurethane resins are those produced when one or more of the...

  3. Babesia species in questing Ixodes ricinus, Sweden.

    Science.gov (United States)

    Karlsson, Maria E; Andersson, Martin O

    2016-02-01

    Babesiosis is an emerging tick-transmitted zoonosis in large parts of the world. In Sweden, the occurrence and diversity of Babesia species is largely unknown. In order to estimate the exposure to Babesia from infected ticks, we collected questing Ixodes ricinus from several sites across southern Sweden during two consecutive field seasons and investigated the occurrence of Babesia species. We report for the first time the occurrence of the zoonotic species Babesia venatorum in Swedish ticks, with a prevalence of 1%. We also detected B. microti (prevalence 3.2%) and B. divergens (prevalence 0.2%). The incidence of Babesia in questing ticks is substantially lower than that of several other tick-borne diseases in Sweden. Nevertheless, babesiosis should not be neglected as a possible diagnosis following tick bites in humans and animals in Sweden. Copyright © 2015 Elsevier GmbH. All rights reserved.

  4. Zum Vorkommen der Zecke Ixodes ricinus L. (Ixodoieda, Ixodidae), in der Schweiz

    OpenAIRE

    Kaltenrieder, M.; Hess, E; Aeschlimann, André

    2010-01-01

    Contribution to the presence of the tick Ixodes ricinus L. in Switzerland. — Free living ticks of the species Ixodes ricinus were collected in 76 different biotops in Western Switzerland. The frequency and the density of /. ricinus diminishes with increasing altitude, respectively with decreasing annual average temperature.

  5. Diisocyanates in polyurethane plastics applications.

    Science.gov (United States)

    Klees, J E; Ott, M G

    1999-01-01

    Diisocyanates are a group of low molecular weight aromatic and aliphatic compounds, widely used in the manufacture of polyurethanes. The most commonly used of these compounds are toluene diisocyanate (TDI), methylene diphenyl diisocyanate (MDI), and hexamethylene diisocyanate (HDI). This article presents a brief summary of the use of diisocyanates in the manufacture of polyurethane products and a review of the epidemiology, medical surveillance, and clinical diagnosis of respiratory and dermal effects of diisocyanates, with emphasis on diisocyanate asthma.

  6. Occupational urticaria from welding polyurethane

    Energy Technology Data Exchange (ETDEWEB)

    Kanerva, L.; Estlander, T.; Jolanki, R.; Laehteenmaeki, M.T.Ke.; Keskinen, H. (Institute of Occupational Health, Helsinki (Finland))

    1991-05-01

    An urticarial reaction associated with high fever developed in a welder on four occasions while he was welding steel profiles filled with polyurethane. The fumes emitted during pyrolysis of polyurethane and inhaled by the patient probably caused the urticarial reaction. Provocation tests with two pyrolysis products, 4,4-diphenylmethane diisocyanate and 4,4-diaminophenylmethane, were negative. This case demonstrates the difficulty in detecting the cause of urticaria induced by airborne chemicals.

  7. Shape memory polyurethane foams

    Directory of Open Access Journals (Sweden)

    B. K. Kim

    2012-01-01

    Full Text Available Molded flexible polyurethane (PU foams have been synthesized from polypropylene glycol (PPG with different molecular weights (Mw and functionalities (f, and 2,4/2,6-toluene diisocyanate (TDI-80 with water as blowing agent. It was found that the glassy state properties of the foam mainly depended on the urethane group content while the rubbery state properties on the crosslink density. That is, PPG of low MW and low f (more urethane groups provided superior glass state modulus, strength, density, shape fixity and glass transition temperature (Tg, while that of high Mw and high f (higher crosslink density showed high rubbery modulus and shape recovery. Consequently shape fixity of low Mw PPG decreased from 85 to 72% while shape recovery increased from 52 to 63% as the content of high Mw PPG increased from 0 to 40%.

  8. Experimental evidence against transmission of Hepatozoon canis by Ixodes ricinus.

    Science.gov (United States)

    Giannelli, Alessio; Ramos, Rafael Antonio Nascimento; Dantas-Torres, Filipe; Mencke, Norbert; Baneth, Gad; Otranto, Domenico

    2013-09-01

    Hepatozoon canis is among the most widespread tick-borne protozoa infecting domestic and wild carnivores. Its distribution is related to the occurrence of its major vector, the brown dog tick Rhipicephalus sanguineus. However, the role of Ixodes ricinus as a vector of H. canis has been hypothesized. In the present study, the development of H. canis was investigated in I. ricinus and R. sanguineus nymphs collected from a naturally infested dog. All I. ricinus ticks examined (n=133) were negative by cytological examination at days 20, 30, and 90 post collection, although H. canis DNA was detected in one nymph at day 20 and in 2 nymphs at day 30 post collection. On the other hand, H. canis sporogony was documented by cytology, and H. canis DNA was detected by PCR in R. sanguineus at day 30 post collection. These results indicate that H. canis sporogony does not occur in I. ricinus, but in R. sanguineus, suggesting that I. ricinus does not act as a vector of H. canis. Copyright © 2013 Elsevier GmbH. All rights reserved.

  9. First detection of Ixodes ricinus on beef cattle in Israel.

    Science.gov (United States)

    Erster, O; Roth, A; Hadani, Y; Shkap, V

    2013-01-31

    This is the first report of the presence of Ixodes ricinus on beef cattle in Israel. Up to now, in the Middle East this tick was considered to be confined to Turkey and northern Iran. In the present study, tick samples collected from field-grazing beef cattle in western Galilee (northern Israel) were first examined morphologically for species-specific taxonomical features and then by molecular characterization. Ticks identified morphologically as I. ricinus were then examined by PCR with four different molecular markers: 12S rRNA, 16S rRNA, COX1 and cytochrome B. The PCR products were sequenced and compared with annotated I. ricinus sequences in GenBank™ and the analyzed sequences from the collected samples shared 98-99% identity with reported I. ricinus sequences. In contrast, sequences from the collected ticks shared identity of 91% or less with annotated sequences from other Ixodes species. Multiple alignments and neighbor-joining analyses performed for each of the four markers reinforced the results obtained from pairwise alignments. These findings demonstrated for the first time the presence in Israel of the tick species I. ricinus - with results confirmed by a combination of morphological examination and molecular analyses. Copyright © 2012 Elsevier B.V. All rights reserved.

  10. Obtaining polyester from glycerin for synthesis of polyurethanes; Obtencao de poliester a partir da glicerina para sintese de poliuretanas

    Energy Technology Data Exchange (ETDEWEB)

    Breves, Rodolfo A.; Ghesti, Grace F.; Sales, Maria J.A., E-mail: eu_sou_o_rodolfo@hotmail.com [Universidade de Brasilia (LabPol/UnB), DF (Brazil). Laboratorio de Pesquisa em Polimeros; Silva, Jessica S.; Coelho, Paulo V.M.; Lopes, Roseany V.V. [Universidade de Brasilia (UnB), DF (Brazil). Faculdade do Gama; Brioude, Michel M. [Freiburg University (Germany)

    2014-07-01

    The use of renewable resources has been increasing, due to the development of materials that have viable applications that are environmentally friendly. In this paper, a polyester was synthesized from glycerin, with the addition of adipic acid in a molar ratio of 1: 1.5, with dilauryl tin catalyst, which was added in proportions of 1 to 3% obtained PUs from castor oil (Ricinus communis) and MDI (diphenyl methane diisocyanate). The materials were characterized by infrared spectroscopy (FTIR), nuclear magnetic resonance {sup 1}H NMR, thermogravimetry (TG) and derivative thermogravimetry (DTG). The reaction for obtaining the polyester was confirmed by FTIR, the absorption band between 1708-1730 cm{sup -1} and {sup 1}H NMR, in the region 1.4 to 1.8 ppm and 2.2 to 2.6 ppm. The thermal decomposition of polyester occurred with temperature above 300 ° C. PUs showed similar thermal stability. (author)

  11. Antimicrobial activity of the essential oil of Myrtus Communis L ...

    African Journals Online (AJOL)

    The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed ...

  12. In vitro micropropagation of almond ( Amygdalus communis L. cv ...

    African Journals Online (AJOL)

    An efficient in vitro propagation method was developed for almond (Amygdalus communis L. cv. Nonpareil). The effect of BA and kinetin (0.0, 0.5, 1.0, 2.0, 4.0 mgl-1) on the culture initiation of zygotic embryos isolated from mature seeds was investigated. A Murashige and Skoog (1962) (MS) medium containing 30 gl-1 ...

  13. 40 CFR 721.8095 - Silylated polyurethane.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Silylated polyurethane. 721.8095... Substances § 721.8095 Silylated polyurethane. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified generically as a silylated polyurethane (PMN P-95-1356) is...

  14. 40 CFR 721.8090 - Polyurethane polymer.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polyurethane polymer. 721.8090 Section... Substances § 721.8090 Polyurethane polymer. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified generically as a polyurethane polymer (P-94-47) is subject...

  15. Essential oil composition and antioxidant activity of two Juniperus communis L. varieties growing wild in Serbia

    Directory of Open Access Journals (Sweden)

    Rajčević Nemanja F.

    2016-01-01

    Full Text Available The genus Juniperus L. (Cupressaceae consists of ca. 67 species and 34 varieties. Juniperus communis L. grows on dry hills or mountainous tracts and is widely distributed in the northern hemisphere. A typical variety J. communis L. var. communis was collected in Deliblatska peščara (Deliblato Sands and variety J. communis L. var. saxatilis Pall. in Kopaonik Mountain. Needle essential oils were obtained using Clevenger apparatus and analyzed using GC/MS and GC/FID. Antioxidant activity of essential oils was evaluated using DPPH assay. A total of 78 compounds were detected and identified. Both oils are characterized by high abundance of monoterpenes. The main constituents of J. communis var. communis essential oil were sabinene (39.4%, α-pinene (13.3%, myrcene (4.7% and terpinen-4-ol (3.7%, while J. communis var. saxatilis essential oil had α-pinene (34.9%, sabinene (20.3%, δ-3-carene (6.4% and germacrene B (6.3% as the most abundant components. DPPH test showed IC50 values 0.66 mg/ml for J. communis var. communis and 0.32 mg/ml for J. communis var. saxatilis. Although antioxidant activity was weaker than used standards (BHT and L-ascorbic acid it is still significant.

  16. Antihepatoma Activity of Artocarpus communis Is Higher in Fractions with High Artocarpin Content

    Directory of Open Access Journals (Sweden)

    Cheng-Wei Tzeng

    2014-01-01

    Full Text Available Extracts from natural plants have been used in traditional medicine for many centuries worldwide. Artocarpus communis is one such plant that has been used to treat liver cirrhosis, hypertension, and diabetes. To our knowledge, this study is the first to investigate the antihepatoma activity of A. communis toward HepG2 and PLC/PRF/5 cells and the first to explore the relationship between antihepatoma activity and the active compound artocarpin content in different fractions of A. communis. A. communis methanol extract and fractions induced dose-dependent reduction of tumor cell viability. DNA laddering analysis revealed that A. communis extract and fractions did not induce apoptosis in HepG2 and PLC/PRF/5 cells. Instead, acridine orange staining revealed that A. communis triggered autophagic cell death in a dose-dependent manner. The antihepatoma activity of A. communis is attributable to artocarpin. The fractions with the highest artocarpin content were also the fractions with the highest antihepatoma activity in the following order: dichloromethane fraction > methanol extract > ethyl acetate fraction > n-butanol fraction > n-hexane fraction. Taken together, A. communis showed antihepatoma activity through autophagic cell death. The effect was related to artocarpin content. Artocarpin could be considered an indicator of the anticancer potential of A. communis extract.

  17. Fluorinated Polyurethanes, Synthesis and Properties

    Directory of Open Access Journals (Sweden)

    Olga Smirnova

    2016-07-01

    Full Text Available Fluorinated polyurethanes with a glass transition temperature as low as −139 °C and a decomposition onset temperature of 247–330 °C were prepared by a reaction of fluorinated alcohols with aromatic and cycloaliphatic diisocyanates in solution or melt.

  18. Fluorinated Polyurethanes, Synthesis and Properties

    OpenAIRE

    Olga Smirnova; Alexey Glazkov; Alexander Yarosh; Alexey Sakharov

    2016-01-01

    Fluorinated polyurethanes with a glass transition temperature as low as −139 °C and a decomposition onset temperature of 247–330 °C were prepared by a reaction of fluorinated alcohols with aromatic and cycloaliphatic diisocyanates in solution or melt.

  19. Additive Manufacturing of Polyurethane Materials

    Energy Technology Data Exchange (ETDEWEB)

    Kunc, Vlastimil [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Lindahl, John M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Minneci, Robert P. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Pyzik, Alek [Dow Chemical Company, Saginaw, MI (United States); Gorin, Craig [Dow Chemical Company, Midland, MI (United States); Allen, Sharon [Dow Chemical Company, Midland, MI (United States); Wilson, Keith [Dow Chemical Company, Midland, MI (United States); Howard, Kevin [Dow Chemical Company, Midland, MI (United States)

    2017-08-10

    ORNL worked with The DOW Chemical Company to validate the feasibility of 3D printing DOW’s polyurethane (PU) materials using ORNL’s equipment and know-how. This led to the development of the first directly-3D-printable PU material.

  20. Natural hybridization between Ixodes ricinus and Ixodes persulcatus ticks evidenced by molecular genetics methods.

    Science.gov (United States)

    Kovalev, S Y; Golovljova, I V; Mukhacheva, T A

    2016-02-01

    The recently shown phenomenon of natural hybridization between Ixodes persulcatus and Ixodes pavlovskyi ticks (Kovalev et al., 2015) stimulated similar studies in the sympatric zones of other tick species. In the present paper, 265 Ixodes ricinus and I. persulcatus ticks from Estonia were subjected to a search for interspecific hybrids based on nuclear (ITS2) and mitochondrial (cox1) markers as well as morphological features. Surprisingly, only 72.1% of ticks morphologically identified as I. ricinus actually were I. ricinus both at nuclear and mitochondrial markers, while the accuracy of morphological species identification for I. persulcatus was 99.3%. Among ticks morphologically identified as I. ricinus, 24.6% turned out to be interspecific hybrids and 3.3% were I. persulcatus. Generally, about 11% of the individuals studied were shown to be interspecific hybrids with different levels of nuclear DNA introgression. The analysis of hybrid populations proved the mating pair female I. ricinus×male I. persulcatus to form hybrids more efficiently, then female I. persulcatus×male I. ricinus. The same trend can be observed for backcrosses preferentially mating with I. ricinus. Hybridization between I. ricinus and I. persulcatus proved the existing view about their reproductive isolation to be untenable. Interspecific hybridization occurring between both closely (I. persulcatus and I. pavlovskyi) and more distantly (I. ricinus and I. persulcatus) related Ixodes species could introduce novel alleles that modify vector competence, host use or the ability to exploit diverse microhabitats. Copyright © 2015 Elsevier GmbH. All rights reserved.

  1. Development of polyurethanes for bone repair.

    Science.gov (United States)

    Marzec, M; Kucińska-Lipka, J; Kalaszczyńska, I; Janik, H

    2017-11-01

    The purpose of this paper is to review recent developments on polyurethanes aimed at the design, synthesis, modifications, and biological properties in the field of bone tissue engineering. Different polyurethane systems are presented and discussed in terms of biodegradation, biocompatibility and bioactivity. A comprehensive discussion is provided of the influence of hard to soft segments ratio, catalysts, stiffness and hydrophilicity of polyurethanes. Interaction with various cells, behavior in vivo and current strategies in enhancing bioactivity of polyurethanes are described. The discussion on the incorporation of biomolecules and growth factors, surface modifications, and obtaining polyurethane-ceramics composites strategies is held. The main emphasis is placed on the progress of polyurethane applications in bone regeneration, including bone void fillers, shape memory scaffolds, and drug carrier. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. High molecular weight polyurethanes and a polyurethane urea based on 1,4-butanediisocyanate

    NARCIS (Netherlands)

    Spaans, CJ; de Groot, JH; Dekens, FG; Pennings, AJ

    New biomedical polyurethanes and a polyurethane urea based on epsilon-caprolactone and 1,4-butanediisocyanate have been developed. On degradation, only non-toxic products are produced. The polyurethane urea with poly(epsilon-caprolactone) soft segments and butanediisocyanate/butanediamine hard

  3. Molecular Identification of Borrelia miyamotoi in Ixodes ricinus from Portugal.

    Science.gov (United States)

    Nunes, Mónica; Parreira, Ricardo; Lopes, Nádia; Maia, Carla; Carreira, Teresa; Sousa, Carmelita; Faria, Sofia; Campino, Lenea; Vieira, M Luísa

    2015-08-01

    Borrelia miyamotoi, a relapsing fever spirochete, has been found recently in Ixodes ricinus ticks; however, little is known about its spatial distribution and potential local impact on human health. A total of 640 ticks (447 nymphs and 193 adults) collected throughout Portugal were analyzed using two nested PCR protocols, one targeting the flagellin gene and the other the internal transcribed space region between the 5S and the 23S rRNA. As a result, B. miyamotoi was detected, for the first time, in one guesting I. ricinus nymph collected in the Lisboa district. In addition, a prevalence of 11% (71/640) for B. burgdorferi sensu lato was obtained. Even though no human relapsing fever cases due to infection by B. miyamotoi have been reported yet in Portugal, surveillance must be improved to provide better insight into the prevalence and distribution of this spirochete in ticks.

  4. New Polyurethanes with a polyurea matrix

    OpenAIRE

    Peshkov, Vladimir; Behrendt, Gerhard; Evtimova, Rozeta; Herzog, Michael

    2012-01-01

    Based on a previously published (Peshkov 2011) synthesis route of nanoscale oligourea dispersion polyols (NODP) a new type of polyurethanes with a polyurea matrix was developed. Polyurethanes with high hardness and elasticity were prepared by reacting a formulation based on the NODP’s and di- or polyisocyanates. The polyurethanes obtained as films were characterised by mechanical tests and dynamic mechanical analysis (DMA). The phase structure depends on the amount of nanoparticles present, t...

  5. Functional insights into recombinant TROSPA protein from Ixodes ricinus.

    Directory of Open Access Journals (Sweden)

    Marek Figlerowicz

    Full Text Available Lyme disease (also called borreliosis is a prevalent chronic disease transmitted by ticks and caused by Borrelia burgdorferi s. l. spirochete. At least one tick protein, namely TROSPA from I. scapularis, commonly occurring in the USA, was shown to be required for colonization of the vector by bacteria. Located in the tick gut, TROSPA interacts with the spirochete outer surface protein A (OspA and initiates the tick colonization. Ixodes ricinus is a primary vector involved in B. burgdorferi s. l. transmission in most European countries. In this study, we characterized the capacities of recombinant TROSPA protein from I. ricinus to interact with OspA from different Borrelia species and to induce an immune response in animals. We also showed that the N-terminal part of TROSPA (a putative transmembrane domain is not involved in the interaction with OspA and that reduction of the total negative charge on the TROSPA protein impaired TROSPA-OspA binding. In general, the data presented in this paper indicate that recombinant TROSPA protein retains the capacity to form a complex with OspA and induces a significant level of IgG in orally immunized rats. Thus, I. ricinus TROSPA may be considered a good candidate component for an animal vaccine against Borrelia.

  6. Anaplasma phagocytophilum in questing Ixodes ricinus ticks from Romania.

    Science.gov (United States)

    Matei, Ioana Adriana; Kalmár, Zsuzsa; Magdaş, Cristian; Magdaş, Virginia; Toriay, Hortenzia; Dumitrache, Mirabela Oana; Ionică, Angela Monica; D'Amico, Gianluca; Sándor, Attila D; Mărcuţan, Daniel Ioan; Domşa, Cristian; Gherman, Călin Mircea; Mihalca, Andrei Daniel

    2015-04-01

    Granulocytic anaplasmosis is a common vector-borne disease of humans and animals with natural transmission cycle that involves tick vectors, among which Ixodes ricinus is the most important. The present paper reports the prevalence and geographical distribution of A. phagocytophilum in 10,438 questing Ixodes ricinus ticks collected at 113 locations from 40 counties of Romania. The unfed ticks were examined for the presence of A. phagocytophilum by PCR targeting a portion of ankA gene. The overall prevalence of infection was 3.42%, with local prevalences ranging between 0.29% and 22.45%, with an average prevalence of 5.39% in the infected localities. The infection with A. phagocytophilum was detected in 72 out of 113 localities and in 34 out of 40 counties. The highest prevalence was recorded in females followed by males and nymphs. The results and the distribution model have shown a large distribution of A. phagocytophilum, covering Romania's entire territory. This study is the first large scale survey of the presence of A. phagocytophilum in questing I. ricinus ticks from Romania. Copyright © 2015 Elsevier GmbH. All rights reserved.

  7. Polyurethane adhesives in flat roofs

    Directory of Open Access Journals (Sweden)

    Bogárová Markéta

    2017-01-01

    Full Text Available It is necessary to stabilize individual layers of flat roofs, mainly because of wind suction. Apart from anchoring and surcharge, these layers can be secured by bonding. At present gluing is an indispensable and widely used stabilization method. On our market we can found many types of adhesives, most widely used are based on polyurethane. This paper focuses on problematic about stabilization thermal insulation from expanded polystyrene to vapor barrier from bitumen. One of the main issues is to calculate the exact amount of adhesive, which is required to guarantee the resistance against wind suction. In this problematic we can not find help neither in technical data sheets provided by the manufactures. Some of these data sheets contain at least information about amount of adhesive depending on location in roof plane and building height, but they do not specify the strength of such connection. It was therefore resorted to select several representatives polyurethane adhesives and their subsequent testing on specimens simulating the flat roof segment. The paper described the test methodology and results for two types of polyurethane adhesives.

  8. Surveillance of Ixodes ricinus ticks (Acari: Ixodidae) in Iceland.

    Science.gov (United States)

    Alfredsson, Matthias; Olafsson, Erling; Eydal, Matthias; Unnsteinsdottir, Ester Rut; Hansford, Kayleigh; Wint, William; Alexander, Neil; Medlock, Jolyon M

    2017-10-10

    Ixodes ricinus is a three-host tick, a principal vector of Borrelia burgdorferi (s.l.) and one of the main vectors of tick-borne encephalitis (TBE) virus. Iceland is located in the North Atlantic Ocean with subpolar oceanic climate. During the past 3-4 decades, average temperature has increased, supporting more favourable conditions for ticks. Reports of I. ricinus have increased in recent years. If these ticks were able to establish in a changing climate, Iceland may face new threats posed by tick-borne diseases. Active field surveillance by tick flagging was conducted at 111 sites around Iceland from August 2015 to September 2016. Longworth mammal traps were used to trap Apodemus sylvaticus in southwestern and southern Iceland. Surveillance on tick importation by migratory birds was conducted in southeastern Iceland, using bird nets and a Heligoland trap. Vulpes lagopus carcasses from all regions of the country were inspected for ticks. In addition, existing and new passive surveillance data from two institutes have been merged and are presented. Continental probability of presence models were produced. Boosted Regression Trees spatial modelling methods and its predictions were assessed against reported presence. By field sampling 26 questing I. ricinus ticks (7 males, 3 females and 16 nymphs) were collected from vegetation from three locations in southern and southeastern Iceland. Four ticks were found on migratory birds at their arrival in May 2016. A total of 52 A. sylvaticus were live-trapped but no ticks were found nor on 315 V. lagopus carcasses. Passive surveillance data collected since 1976, reports further 214 I. ricinus ticks from 202 records, with an increase of submissions in recent years. The continental probability of presence model correctly predicts approximately 75% of the recorded presences, but fails to predict a fairly specific category of recorded presence in areas where the records are probably opportunistic and not likely to lead to

  9. Blood feeding on large grazers affects the transmission of Borrelia burgdorferi sensu lato by Ixodes ricinus

    NARCIS (Netherlands)

    Pacilly, F.C.A.; Benning, M.E.; Jacobs, F.; Leidekker, J.; Sprong, H.; Wieren, van S.E.; Takken, W.

    2014-01-01

    The presence of Ixodes ricinus and their associated Borrelia infections on large grazers was investigated. Carcases of freshly shot red deer, mouflon and wild boar were examined for the presence of any stage of I. ricinus. Questing ticks were collected from locations where red deer and wild boar are

  10. Multi-trophic interactions driving the transmission cycle of Borrelia afzelii between Ixodes ricinus and rodents

    NARCIS (Netherlands)

    Duijvendijk, Van Gilian; Sprong, Hein; Takken, Willem

    2015-01-01

    The tick Ixodes ricinus is the main vector of the spirochaete Borrelia burgdorferi sensu lato, the causal agent of Lyme borreliosis, in the western Palearctic. Rodents are the reservoir host of B. afzelii, which can be transmitted to I. ricinus larvae during a blood meal. The infected engorged

  11. Formulation, Preparation, and Characterization of Polyurethane Foams

    Science.gov (United States)

    Pinto, Moises L.

    2010-01-01

    Preparation of laboratory-scale polyurethane foams is described with formulations that are easy to implement in experiments for undergraduate students. Particular attention is given to formulation aspects that are based on the main chemical reactions occurring in polyurethane production. This allows students to develop alternative formulations to…

  12. Polyurethane membranes for surgical gown applications

    Science.gov (United States)

    Ukpabi, Pauline Ozoemena

    The Occupational Safety and Health Administration (OSHA) recently issued a directive requiring all employers to supply personnel protective equipment to employees who are at risk of exposure to blood or other potentially infectious body fluids. For the healthcare worker, a wide variety of surgical gowns is available commercially but there are concerns over their barrier effectiveness and/or wearer comfort. To successfully create a barrier fabric which combines resistance to fluid penetration with comfort, a complete understanding of the relationship between membrane structure and functional properties is required. In this study, we investigated the surface properties of hydrophilicity and hydrophobicity in polyurethane membranes intended for use in surgical gowns. The polyurethane membranes were grafted with side chains of varying lengths, polyethylene glycol (PEG) being used for the hydrophilic modifications and perfluoroalkyl compounds (a monofunctional acid and a difunctional amino alcohol) for the hydrophobic modifications. The hydrophilic treatment was intended to improve the comfort properties of monolithic membranes without adversely affecting their barrier properties. The hydrophobic treatment, on the other hand, was intended to improve the fluid repellency and hence barrier properties of microporous membranes without adversely affecting their comfort properties. Reflection infrared spectroscopy showed that fluorine was successfully grafted onto the polyurethane backbone during the hydrophobic modification, but was not sensitive enough to detect PEG grafting in leached polyethylene glycol-treated polyurethanes. X-ray photoelectron spectroscopy showed that the perfluoroalkylated polyurethanes contained up to 40% fluorine on their surfaces and the PEG-treated polyurethanes showed an increase in their C-O content over the unmodified polyurethane. Scanning electron microscopy not only showed that perfluoroalkylation yielded polyurethane membranes with very

  13. Deep Sequencing Analysis of the Ixodes ricinus Haemocytome.

    Science.gov (United States)

    Kotsyfakis, Michalis; Kopáček, Petr; Franta, Zdeněk; Pedra, Joao H F; Ribeiro, José M C

    2015-05-01

    Ixodes ricinus is the main tick vector of the microbes that cause Lyme disease and tick-borne encephalitis in Europe. Pathogens transmitted by ticks have to overcome innate immunity barriers present in tick tissues, including midgut, salivary glands epithelia and the hemocoel. Molecularly, invertebrate immunity is initiated when pathogen recognition molecules trigger serum or cellular signalling cascades leading to the production of antimicrobials, pathogen opsonization and phagocytosis. We presently aimed at identifying hemocyte transcripts from semi-engorged female I. ricinus ticks by mass sequencing a hemocyte cDNA library and annotating immune-related transcripts based on their hemocyte abundance as well as their ubiquitous distribution. De novo assembly of 926,596 pyrosequence reads plus 49,328,982 Illumina reads (148 nt length) from a hemocyte library, together with over 189 million Illumina reads from salivary gland and midgut libraries, generated 15,716 extracted coding sequences (CDS); these are displayed in an annotated hyperlinked spreadsheet format. Read mapping allowed the identification and annotation of tissue-enriched transcripts. A total of 327 transcripts were found significantly over expressed in the hemocyte libraries, including those coding for scavenger receptors, antimicrobial peptides, pathogen recognition proteins, proteases and protease inhibitors. Vitellogenin and lipid metabolism transcription enrichment suggests fat body components. We additionally annotated ubiquitously distributed transcripts associated with immune function, including immune-associated signal transduction proteins and transcription factors, including the STAT transcription factor. This is the first systems biology approach to describe the genes expressed in the haemocytes of this neglected disease vector. A total of 2,860 coding sequences were deposited to GenBank, increasing to 27,547 the number so far deposited by our previous transcriptome studies that serves as a

  14. Deep Sequencing Analysis of the Ixodes ricinus Haemocytome.

    Directory of Open Access Journals (Sweden)

    Michalis Kotsyfakis

    2015-05-01

    Full Text Available Ixodes ricinus is the main tick vector of the microbes that cause Lyme disease and tick-borne encephalitis in Europe. Pathogens transmitted by ticks have to overcome innate immunity barriers present in tick tissues, including midgut, salivary glands epithelia and the hemocoel. Molecularly, invertebrate immunity is initiated when pathogen recognition molecules trigger serum or cellular signalling cascades leading to the production of antimicrobials, pathogen opsonization and phagocytosis. We presently aimed at identifying hemocyte transcripts from semi-engorged female I. ricinus ticks by mass sequencing a hemocyte cDNA library and annotating immune-related transcripts based on their hemocyte abundance as well as their ubiquitous distribution.De novo assembly of 926,596 pyrosequence reads plus 49,328,982 Illumina reads (148 nt length from a hemocyte library, together with over 189 million Illumina reads from salivary gland and midgut libraries, generated 15,716 extracted coding sequences (CDS; these are displayed in an annotated hyperlinked spreadsheet format. Read mapping allowed the identification and annotation of tissue-enriched transcripts. A total of 327 transcripts were found significantly over expressed in the hemocyte libraries, including those coding for scavenger receptors, antimicrobial peptides, pathogen recognition proteins, proteases and protease inhibitors. Vitellogenin and lipid metabolism transcription enrichment suggests fat body components. We additionally annotated ubiquitously distributed transcripts associated with immune function, including immune-associated signal transduction proteins and transcription factors, including the STAT transcription factor.This is the first systems biology approach to describe the genes expressed in the haemocytes of this neglected disease vector. A total of 2,860 coding sequences were deposited to GenBank, increasing to 27,547 the number so far deposited by our previous transcriptome studies

  15. Ixodes ricinus defensins attack distantly-related pathogens.

    Science.gov (United States)

    Tonk, Miray; Cabezas-Cruz, Alejandro; Valdés, James J; Rego, Ryan O M; Grubhoffer, Libor; Estrada-Peña, Agustín; Vilcinskas, Andreas; Kotsyfakis, Michalis; Rahnamaeian, Mohammad

    2015-12-01

    Antimicrobial peptides are ubiquitous components of eukaryotic innate immunity. Defensins are a well-known family of antimicrobial peptides, widely distributed in ticks, insects, plants and mammals, showing activity against bacteria, viruses, fungi, yeast and protozoan parasites. Ixodes ricinus is the most common tick species in Europe and is a vector of pathogens affecting human and animal health. Recently, six defensins (including two isoforms) were identified in I. ricinus. We investigated the evolution of the antimicrobial activity of I. ricinus defensins. Among the five unique defensins, only DefMT3, DefMT5 and DefMT6 showed in vitro antimicrobial activity. Each defensin was active against rather distantly-related bacteria (P < 0.05), significantly among Gram-negative species (P < 0.0001). These three defensins represent different clades within the family of tick defensins, suggesting that the last common ancestor of tick defensins may have had comparable antimicrobial activity. Differences in electrostatic potential, and amino acid substitutions in the β-hairpin and the loop bridging the α-helix and β-sheet may affect the antimicrobial activity in DefMT2 and DefMT7, which needs to be addressed. Additionally, the antimicrobial activity of the γ-core motif of selected defensins (DefMT3, DefMT6, and DefMT7) was also tested. Interestingly, compared to full length peptides, the γ-core motifs of these defensins were effective against less species of bacteria. However, the antifungal activity of the γ-core was higher than full peptides. Our results broaden the scope of research in the field of antimicrobial peptides highlighting the overlooked ability of arthropod defensins to act against distantly-related microorganisms. Copyright © 2015 Elsevier Ltd. All rights reserved.

  16. Functionalised polyurethane for efficient laser micromachining

    Science.gov (United States)

    Brodie, G. W. J.; Kang, H.; MacMillan, F. J.; Jin, J.; Simpson, M. C.

    2017-02-01

    Pulsed laser ablation is a valuable tool that offers a much cleaner and more flexible etching process than conventional lithographic techniques. Although much research has been undertaken on commercially available polymers, many challenges still remain, including contamination by debris on the surface, a rough etched appearance and high ablation thresholds. Functionalizing polymers with a photosensitive group is a novel way and effective way to improve the efficiency of laser micromachining. In this study, several polyurethane films grafted with different concentrations of the chromophore anthracene have been synthesized which are specifically designed for 248 nm KrF excimer laser ablation. A series of lines etched with a changing number of pulses and fluences by the nanosecond laser were applied to each polyurethane film. The resultant ablation behaviours were studied through optical interference tomography and Scanning Electron Microscopy. The anthracene grafted polyurethanes showed a vast improvement in both edge quality and the presence of debris compared with the unmodified polyurethane. Under the same laser fluence and number of pulses the spots etched in the anthracene contained polyurethane show sharp depth profiles and smooth surfaces, whereas the spots etched in polyurethane without anthracene group grafted present rough cavities with debris according to the SEM images. The addition of a small amount of anthracene (1.47%) shows a reduction in ablation threshold from unmodified polyurethane showing that the desired effect can be achieved with very little modification to the polymer.

  17. The Seasonal Activity of Ixodes ricinus Tick in Amol, Mazandaran Province, Northern Iran

    Directory of Open Access Journals (Sweden)

    Nasrollah Vahedi-Noori

    2012-12-01

    Full Text Available Background: The present study aimed to demonstrate the seasonal activities of Ixodes ricinus at the pasture level and on the host.Methods: A vast pasture in Amol countryside (Mazandaran Province, Iran which had the potential for a considerablenumber of cattle and sheep to graze was chosen. Tick sampling from the skin of 130 cattle and 130 sheep were collected every month interval. Simultaneously, the activity of the different stages of I. ricinus on the pasture was considered by dragging method. The collected ticks were placed in jars containing 70% alcohol and sent to the parasitological laboratory for identification.Results: The rate of the infestation with adult I. ricinus in cattle and sheep increases gradually with the beginning offall and reaches its peak in January, February and March while it starts to decline with the beginning of spring as theinfestation rate reach to zero in summer months. Accordingly, the highest number of adult I. ricinus existed on the cattle during January, February, and March. In addition, the results of dragging have been revealed that the active tick population in the pasture exists during November, December, January, and March.Conclusion: Ixodes ricinus is regarded a common tick species in Amol (Mazandaran. Due to the biological properties of I. ricinus which is active in the cold and humid months of the year, the prevalence of ruminant infestations with I. ricinus in this area increases from November to March but reaches to zero again with thebeginning of summer.

  18. Morphological features of Ixodes persulcatus and I. ricinus hybrids: nymphs and adults.

    Science.gov (United States)

    Bugmyrin, Sergey V; Belova, Oxana A; Bespyatova, Liubov A; Ieshko, Eugeniy P; Karganova, Galina G

    2016-07-01

    Our aim was to reveal morphological features of first-generation Ixodes persulcatus and I. ricinus hybrids (nymphs and adults) obtained under laboratory conditions for further study of natural populations of these species in sympatry foci. In 65 nymphs of three groups I. ricinus (23 specimens), I. persulcatus (21 specimens), and hybrids (21 specimens), 16 parameters were evaluated (length/width of the scutum and capitulum, length of the hypostome, palp, tarsus I, coxa I, sternal setae, and various scutal and alloscutal setae) and discrimination analysis was performed allowing differentiation of hybrid nymphs from original species. General effectiveness of classification of I. ricinus, I. persulcatus, and hybrids was >95 %. Discriminant functions are presented allowing classification of I. persulcatus, I. ricinus, and hybrid nymphs. For description of morphology, 27 adult hybrids (13 males and 14 females) were examined under a stereo microscope at 14-28× (without preparation of permanent mounts). The following morphological distinctions of hybrids from original species were described: posterior marginal groove is not clear (as in I. ricinus) and absence of syncoxa on coxa I (as in I persulcatus). In hybrid males, simultaneous absence of syncoxa on coxa I (as in I. persulcatus) and a long internal spur on coxa I (as in I. ricinus) can be used as a diagnostic feature. Based on the detected characteristics, 10 of 157 ticks collected in Karelia in I. ricinus and I. persulcatus sympatry area were classified as hybrids.

  19. Hedgehog inhibitors from Artocarpus communis and Hyptis suaveolens.

    Science.gov (United States)

    Arai, Midori A; Uchida, Kyoko; Sadhu, Samir K; Ahmed, Firoj; Koyano, Takashi; Kowithayakorn, Thaworn; Ishibashi, Masami

    2015-08-01

    The hedgehog (Hh) signaling pathway plays crucial roles in cell maintenance and proliferation during embryonic development. Naturally occurring Hh inhibitors were isolated from Artocarpus communis and Hyptis suaveolens using our previously constructed cell-based assay system. Bioactivity guided fractionation led to the isolation of 15 compounds, including seven new compounds (4, 5, 6, 7, and 9-11). The isolated compounds showed cytotoxicity against a cancer cell line (PANC1) in which Hh signaling was abnormally activated. Several compounds (12-14; GLI1 transcriptional inhibition IC50=7.6, 4.7, and 4.0 μM, respectively) inhibited Hh related protein (BCL2) expression. Moreover, compounds 1, 12, and 13 disrupted GLI1 and DNA complex formation. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Factors Driving the Abundance of Ixodes ricinus Ticks and the Prevalence of Zoonotic I. ricinus-Borne Pathogens in Natural Foci

    Science.gov (United States)

    Fernández-de-Mera, Isabel G.; Acevedo, Pelayo; Gortázar, Christian; de la Fuente, José

    2012-01-01

    Environmental factors may drive tick ecology and therefore tick-borne pathogen (TBP) epidemiology, which determines the risk to animals and humans of becoming infected by TBPs. For this reason, the aim of this study was to analyze the influence of environmental factors on the abundance of immature-stage Ixodes ricinus ticks and on the prevalence of two zoonotic I. ricinus-borne pathogens in natural foci of endemicity. I. ricinus abundance was measured at nine sites in the northern Iberian Peninsula by dragging the vegetation with a cotton flannelette, and ungulate abundance was measured by means of dung counts. In addition to ungulate abundance, data on variables related to spatial location, climate, and soil were gathered from the study sites. I. ricinus adults, nymphs, and larvae were collected from the vegetation, and a representative subsample of I. ricinus nymphs from each study site was analyzed by PCR for the detection of Borrelia burgdorferi sensu lato and Anaplasma phagocytophilum DNA. Mean prevalences of these pathogens were 4.0% ± 1.8% and 20.5% ± 3.7%, respectively. Statistical analyses confirmed the influence of spatial factors, climate, and ungulate abundance on I. ricinus larva abundance, while nymph abundance was related only to climate. Interestingly, cattle abundance rather than deer abundance was the main driver of B. burgdorferi sensu lato and A. phagocytophilum prevalence in I. ricinus nymphs in the study sites, where both domestic and wild ungulates coexist. The increasing abundance of cattle seems to increase the risk of other hosts becoming infected by A. phagocytophilum, while reducing the risk of being infected by B. burgdorferi sensu lato. Controlling ticks in cattle in areas where they coexist with wild ungulates would be more effective for TBP control than reducing ungulate abundance. PMID:22286986

  1. Anaplasma phagocytophilum in questing Ixodes ricinus ticks in southwestern Finland.

    Science.gov (United States)

    Sormunen, Jani J; Penttinen, Ritva; Klemola, Tero; Vesterinen, Eero J; Hänninen, Jari

    2016-12-01

    Anaplasma phagocytophilum is the causative agent of an emerging tick-borne disease, human granulocytic anaplasmosis. While the bacterium has been reported from questing ticks in neighboring Sweden, Norway and Russia, the few surveys regarding questing ticks in Finland have thus far been negative. In the current study, the prevalence of A. phagocytophilum in Ixodes ricinus populations was evaluated in several study localities around southwestern Finland during 2013-2014. Some of these populations were previously screened and found negative for A. phagocytophilum in 2000. A total of 3158 I. ricinus collected by blanket dragging were screened for Anaplasma spp. using qPCR. Anaplasma were detected in 9.2% of adult ticks (n = 87) and 3.1% of nymphs (n = 979). All larval samples were negative for infection. All Anaplasma-positive samples were identified as A. phagocytophilum by sequencing. This is, to the best of our knowledge, the first report of the pathogen from questing ticks in Finland. Furthermore, the pathogen was detected from several localities found negative during the previous screening 13 years earlier.

  2. Local landscape effects on population dynamics of Ixodes ricinus

    Directory of Open Access Journals (Sweden)

    Naveed Asghar

    2016-11-01

    Full Text Available Ixodes ricinus, a common tick in Europe, transmits severe tickborne pathogens (TBPs. In Sweden, both prevalence and incidence of tick-borne infections have increased during the last few decades, and a majority of the cases is reported from the area around Stockholm. Among ticks, transmission of TBPs involves co-feeding of susceptible larvae or nymphs with infected ticks on the same host. Seasonal synchrony of immature stages and total tick abundance are important factors for the probability of horizontal transmission of TBPs. We have studied the association between local landscape characteristics and population dynamics and the probability of co-occurrence of different life cycle stages of I. ricinus at different locations south of Stockholm, Sweden. We found significant spatiotemporal variation in tick activity patterns. Mean tick abundance varied with a tenfold difference among study sites. The probability of co-occurrence of larvae, nymphs and female adults was highest in June and decreased significantly with vegetation height. In addition, the amount of forest habitat and open water in the surrounding landscape of the study sites expressed significant negative effects on tick abundance and co-occurrence, indicating that environmental heterogeneity may increase the likelihood of good rodent habitats, which in turn, are suitable hosts for immature ticks.

  3. Genetic population structure of the wind-pollinated, dioecious shrub Juniperus communis in fragmented Dutch heathlands

    NARCIS (Netherlands)

    Oostermeijer, J.G.B.; de Knegt, B

    2004-01-01

    The wind-pollinated, dioecious shrub Juniperus communis L. is declining in Dutch heathlands, mainly because recruitment is scarce. Aside from ecological factors, inbreeding associated with reduced population size and isolation in the currently fragmented landscape might explain this decline.

  4. Infection of Ixodes ricinus (Acari: Ixodidae) by Borrelia burgdorferi sensu lato in North Africa

    Science.gov (United States)

    Zhioua, E.; Bouattour, A.; Hu, C.M.; Gharbi, M.; Aeschliman, A.; Ginsberg, H.S.; Gern, L.

    1999-01-01

    Free-living adult Ixodes ricinus L. were collected in Amdoun, situated in the Kroumiry mountains in northwestern Tunisia (North Africa). Using direct fluorescence antibody assay, the infection rate of field-collected I. ricinus by Borrelia burgdorferi sensu lato was 30.5% (n = 72). No difference in infection rate was observed between male and female ticks. Spirochetes that had been isolated from I. ricinus from Ain Drahim (Kroumiry Mountains) in 1988 were identified as Borrelia lusitaniae (formerly genospecies PotiB2). This is the first identification of a genospecies of Borrelia burgdorferi sensu lato from the continent of Africa.

  5. Myrtus communis L. and its application in treatment of Recurrent Aphthous Stomatitis.

    Science.gov (United States)

    Mahboubi, Mohaddese

    2016-12-04

    In Iranian Traditional Medicine, M. communis is a famous plant in treatment of oral ulcers and "Gholaa"- the ancient name of aphthous. The aim of this review is to create a bridge between the traditional claims about the application of M. communis in treatment of "Gholaa" and its prescription for aphthous, the current form of "Gholaa" in modern medicine METHODS: We extracted the information about the application of M. communis in treatment of aphthous from different resources including Google scholar, Pubmed, ScienceDirect, Springer, ethnobotanical, the traditional books from Traditional Medicine Tehran University of Medical Sciences. In Iranian traditional texts, "Gholaa" was the corrosive diseases on the surface and inner layer of mouth and tongue and divided into three types of bloody, phlegmatic and burned black bile types. Recurrent Aphthous Stomatitis (RAS) is equal to the black bile and phlegmatic types and minor aphthous type can be matched with phlegmatic type. The corrosive propagated lesions can be herpetic aphthous. In modern medicine, M. communis essential oil and its decoction decreased the average time of pain relief and decreased the size of ulcers in patients with minor RAS without any adverse effects. The number of ulcers was not the subjects of any different clinical trials. All patients were satisfied with M. communis topical essential oil (5%), and 81% patients were satisfied with M. communis topical decoctions (5%). It appears the efficacy of M. communis is related to its analgesic, anti-inflammatory, antiseptic and wound healing effects. M. communis is effective in minor RAS as its traditional claims and confirming its efficacy in major and herpetiform RAS and comparing the efficacy of its decoction topical formulations or essential oil topical ones are required more and larger experimental and clinical investigations in future. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  6. Characterization of the essential oil from cone-berries of Juniperus communis L. (Cupressaceae

    Directory of Open Access Journals (Sweden)

    Majewska Ewa

    2017-09-01

    Full Text Available Juniperus communis L. (Cupressaceae is a plant widely cultivated in the Northern hemisphere. Juniper berries, the fruit of Juniperus communis L. are a highly valued, essential oil-rich plant material used traditionally in folk medicine as antiseptic, diuretic, antirheumatic, anti-inflammatory, antibacterial and antifungicidal agent. This paper reviews information on extraction methods of the essential oil from the juniper berries, its chemical composition and antimicrobial as well as antioxidant properties.

  7. Genetic structure and diversity in Juniperus communis populations in Saxony, Germany

    Directory of Open Access Journals (Sweden)

    Reim Stefanie

    2016-06-01

    Full Text Available In recent years, land use changes led to a rapid decline and fragmentation of J. communis populations in Germany. Population isolation may lead to a restricted gene flow and, further, to negative effects on genetic variation. In this study, genetic diversity and population structure in seven fragmented J. communis populations in Saxony, Germany, were investigated using nuclear microsatellites (nSSR and chloroplast single nucleotide polymorphism (cpSNP. In all Saxony J. communis populations, a high genetic diversity was determined but no population differentiation could be detected whatever method was applied (Bayesian cluster analysis, F-statistics, AMOVA. The same was true for three J. communis out-group samples originating from Italy, Slovakia and Norway, which also showed high genetic diversity and low genetic differences regarding other J. communis populations. Low genetic differentiation among the J. communis populations ascertained with nuclear and chloroplast markers indicated high levels of gene flow by pollen and also by seeds between the sampled locations. Low genetic differentiation may also provide an indicator of Juniper survival during the last glacial maximum (LGM in Europe. The results of this study serve as a basis for the implementation of appropriate conservation measures in Saxony.

  8. Flame Retardants Used in Flexible Polyurethane Foam

    Science.gov (United States)

    The partnership project on flame retardants in furniture seeks to update the health and environmental profiles of flame-retardant chemicals that meet fire safety standards for upholstered consumer products with polyurethane foam

  9. Permeation of urea through various polyurethane membranes.

    Science.gov (United States)

    Watanabe, Atsushi; Takebayashi, Yoshihiro; Ohtsubo, Toshiro; Furukawa, Mutsuhisa

    2009-11-01

    Controlled-release systems using polymer membranes are very important in agriculture for labour-saving and effective delivery of pesticides and other agents. Polymer-coated granules are one of the most useful formulations, and a study of the factors for polymer design is necessary to achieve various release patterns. A permeation study using plain membranes was carried out in order to clarify parameters, and the results were compared with the release from polymer-coated granules. The permeation coefficient of urea through a plain polyurethane membrane decreased significantly as the urethane and alkyl side chain content increased. The glass transition temperature and crosslink density of the polyurethanes hardly influenced its permeability. The release rate from polyurethane-coated granules was also reduced by alkyl side chains. However, it was faster than that through a plain membrane because of capsule expansion by continuous water penetration and structural changes in the membrane. The release rate of urea through a polyurethane plain membrane and from polyurethane-coated granules can be controlled by changing the chemical properties of the membrane. In addition, physical properties such as the glass transition temperature T(g) or crosslink density should be considered to assess the release profile from polyurethane-coated granules. (c) 2009 Society of Chemical Industry.

  10. POLYURETHANE COMPOSITES AS DRUG CARRIERS:: RELEASE PATTERNS

    Directory of Open Access Journals (Sweden)

    M. V. Grigoreva

    2013-10-01

    Full Text Available Biodegradable polyurethanes attract interest of those developing composite materials for biomedical applications. One of their features is their ability to serve as carriers, or matrixes, for medicines and other bioactive compounds to produce a therapeutic effect in body through targeted and/or prolonged delivery of these compounds in the process of their controlled release from matrix. The review presents polyurethane composites as matrices for a number of drugs. The relation between structure of the composites and their degradability both in vitro and in vivo and the dependence of drug release kinetics on physicochemical properties of polyurethane matrix are highlighted. The release of drugs (cefazolin, naltrexone and piroxicam from the composites based on cross-linked polyurethanes (synthesized from laprols, Mw between 1,500 and 2,000 Da and toluylene diisocyanate demonstrated more or less the same pattern (about 10 days in vitro and three to five days in vivo. In contrast, the composites with dioxydine based on a linear polyurethanes (synthesized from oligotetramethilene glycol, Mw 1,000 Da, diphenylmethane-4,4’-diisocyanate and 1,4-butanediol retained their antimicrobial activity at least 30 days. They also showed a significantly higher breaking strength as compared to that of the composites based on cross-linked polyurethanes.

  11. A computational perspective of molecular interactions through virtual screening, pharmacokinetic and dynamic prediction on ribosome toxin A chain and inhibitors of Ricinus communis

    Science.gov (United States)

    Kumar, R. Barani; Suresh, M. Xavier

    2012-01-01

    Background: Ricin is considered to be one of the most deadly toxins and gained its favor as a bioweapon that has a serious social and biological impact, due to its widespread nature and abundant availability. The hazardous effects of this toxin in human being are seen in almost all parts of the organ system. The severe consequences of the toxin necessitate the need for developing potential inhibitors that can effectively block its interaction with the host system. Materials and Methods: In order to identify potential inhibitors that can effectively block ricin, we employed various computational approaches. In this work, we computationally screened and analyzed 66 analogs and further tested their ADME/T profiles. From the kinetic and toxicity studies we selected six analogs that possessed appropriate pharmacokinetic and dynamic property. We have also performed a computational docking of these analogs with the target. Results: On the basis of the dock scores and hydrogen bond interactions we have identified analog 64 to be the best interacting molecule. Molecule 64 seems to have stable interaction with the residues Tyr80, Arg180, and Val81. The pharmacophore feature that describes the key functional features of a molecule was also studied and presented. Conclusion: The pharmacophore features of the drugs provided suggests the key functional groups that can aid in the design and synthesis of more potential inhibitors. PMID:22224054

  12. The reactive surface of Castor leaf [Ricinus communis L.] powder as a green adsorbent for the removal of heavy metals from natural river water

    Science.gov (United States)

    Martins, Amanda E.; Pereira, Milene S.; Jorgetto, Alexandre O.; Martines, Marco A. U.; Silva, Rafael I. V.; Saeki, Margarida J.; Castro, Gustavo R.

    2013-07-01

    In this study, a green adsorbent was successfully applied to remove toxic metals from aqueous solutions. Dried minced castor leaves were fractionated into 63-μm particles to perform characterization and extraction experiments. Absorption bands in FTIR (Fourier Transform Infrared Spectroscopy) spectra at 1544, 1232 and 1350 cm-1 were assigned to nitrogen-containing groups. Elemental analysis showed high nitrogen and sulfur content: 5.76 and 1.93%, respectively. The adsorption kinetics for Cd(II) and Pb(II) followed a pseudo-second-order model, and no difference between the experimental and calculated Nf values (0.094 and 0.05 mmol g-1 for Cd(II) and Pb(II), respectively) was observed. The Ns values calculated using the modified Langmuir equation, 0.340 and 0.327 mmol g-1 for Cd(II) and Pb(II), respectively, were superior to the results obtained for several materials in the literature. The method proposed in this study was applied to pre-concentrate (45-fold enrichment factor) and used to measure Cd(II) and Pb(II) in freshwater samples from the Paraná River. The method was validated through a comparative analysis with a standard reference material (1643e).

  13. Effect of glycerine and essential oils (Anacardium occidentale and Ricinus communis on animal performance, feed efficiency and carcass characteristics of crossbred bulls finished in a feedlot system

    Directory of Open Access Journals (Sweden)

    Olga Teresa Barreto Cruz

    2014-11-01

    Full Text Available The effect of corn substitution by glycerine and essential oils on animal performance, apparent digestibility and red and white blood cells of crossbred bulls finished in feedlot was evaluated. Thirty bulls with average weight of 311±28.8 kg and 22±2 month-old were allocated in three diets: CON (without glycerine or essential oils, GLY (with glycerine and GEO (with glycerine and essential oils. The bulls were fed a diet of sorghum silage, cracked corn, soybean meal, urea, limestone and mineral salt. Three grams of cashew and castor oil/animal/day were included in GEO diet. Animals were kept in feedlot for 115 days and slaughtered at average weight of 467±40.6 kg. No differences (P<0.05 among diets regarding final body weight, average daily gain and feed conversion were reported. Ether extract intake was higher (P<0.05 in CON diet compared to the others. Dry matter, organic matter and crude protein digestibility was higher (P<0.05 in GLY diet compared to CON. Acid detergent fibre digestibility was higher (P<0.05 in CON compared to GLY diet. Nonfibrous carbohydrate, fibrous carbohydrate and ether extract digestibility were similar (P>0.05 among diets. No effect of glycerine and essential oil addition on total blood cholesterol, triglycerides, haemogram, leukogram and plasmatic proteins was observed. Corn replacement by glycerine and essential oils addition did not affect (P>0.05 carcass weight, dressing and conformation, carcass length and cushion thickness.

  14. Evaluation of dentin cleansing by a detergent derived from castor oil (Ricinus communis) used as root canal irrigant: a scanning electron miscroscopy study

    National Research Council Canada - National Science Library

    Letícia Molteni Aguiar; Lilian Eiko Maekawa; Adriana Chung; Maria Renata Giazzi Nassri

    2010-01-01

    ...% sodium hypochlorite (NaOCl). Material and methods: Fifteen maxillary incisors were subjected to standardized root canal instrumentation with different irrigants (n = 5): G1 - Endoquil; G2 - 0.5% NaOCl...

  15. Seasonal distribution of Borreliae in Ixodes ricinus ticks in the Belgrade region

    Directory of Open Access Journals (Sweden)

    Milutinović Marija

    2006-01-01

    Full Text Available Green areas at four localities in the Belgrade region (Ada Ciganlija, Košutnjak, Miljakovac forest, and Mt. Avala were investigated in 2004. The aim of the research was to clarify the faunistic composition, relative abundance, and population dynamics of ticks, as well as the seasonal distribution of Borrelia burgdorferi sensu lato (sl in Ixodes ricinus. Two species of ticks were detected: Ixodes ricinus and Dermacentor reticulates. Relative abundance analysis revealed that the species Ixodes ricinus was predominant (97.41 %. Out of 942 Ixodes ricinus ticks, 188 (19.96 % were infected with Borrelia burgdorferi sl. The infection rate of adults by localities ranged from 19.16% to 30.99% (Mt. Avala and Ada Ciganlija, respectively.

  16. Molecular characterization of COI gene of Ixodes ricinus (Linnaeus, 1758 from Serbia

    Directory of Open Access Journals (Sweden)

    Ćakić Sanja

    2014-01-01

    Full Text Available The Ixodes ricinus tick is common in the central part of the Balkan Peninsula. It is a vector of pathogenic agents causing diseases in humans and animals. Little is known about the genetic structure of I. ricinus in this region. We have investigated intraspecific variability of the COI gene among I. ricinus ticks collected from different regions of Serbia, and the correlation between the various types of habitat and genetic variability of ticks. The obtained COI gene sequences are the first barcoding sequences of I. ricinus ticks collected at localities in Serbia. Intraspecific variability of these COI gene sequences was very low, and there was no correlation between the various types of habitat and genetic variability of ticks. Samples from isolated localities (canyon/gorge showed no genetic differentiations from the majority of samples from open areas. [Projekat Ministarstva nauke Republike Srbije, br. ON 173006

  17. Vaccination against Bm86 Homologues in Rabbits Does Not Impair Ixodes ricinus Feeding or Oviposition.

    Directory of Open Access Journals (Sweden)

    Jeroen Coumou

    Full Text Available Human tick-borne diseases that are transmitted by Ixodes ricinus, such as Lyme borreliosis and tick borne encephalitis, are on the rise in Europe. Diminishing I. ricinus populations in nature can reduce tick exposure to humans, and one way to do so is by developing an anti-vector vaccine against tick antigens. Currently, there is only one anti-vector vaccine available against ticks, which is a veterinary vaccine based on the tick antigen Bm86 in the gut of Rhipicephalus microplus. Bm86 vaccine formulations cause a reduction in the number of Rhipicephalus microplus ticks that successfully feed, i.e. lower engorgement weights and a decrease in the number of oviposited eggs. Furthermore, Bm86 vaccines reduce transmission of bovine Babesia spp. Previously two conserved Bm86 homologues in I. ricinus ticks, designated as Ir86-1 and Ir86-2, were described. Here we investigated the effect of a vaccine against recombinant Ir86-1, Ir86-2 or a combination of both on Ixodes ricinus feeding. Recombinant Ixodes ricinus Bm86 homologues were expressed in a Drosophila expression system and rabbits were immunized with rIr86-1, rIr86-2, a combination of both or ovalbumin as a control. Each animal was infested with 50 female adults and 50 male adults Ixodes ricinus and tick mortality, engorgement weights and egg mass were analyzed. Although serum IgG titers against rIr86 proteins were elicited, no effect was found on tick feeding between the rIr86 vaccinated animals and ovalbumin vaccinated animals. We conclude that vaccination against Bm86 homologues in Ixodes ricinus is not an effective approach to control Ixodes ricinus populations, despite the clear effects of Bm86 vaccination against Rhipicephalus microplus.

  18. «CANDIDATUS MIDICHLORIA MITOCHONDRII»: A NEW MEMBER OF ORDER RICKETTSIALES, ENDOSYMBIONT OF IXODES RICINUS TICK

    Directory of Open Access Journals (Sweden)

    S. N. Shpynov

    2016-01-01

    Full Text Available «Candidatus Midichloria mitochondrii» is the sheep tick Ixodes ricinus endosymbiont. This unique bacteria can occupy and persist within the mitochondria of animals. I. ricinus is an important vector of human pathogens in natural focal of infections. «Candidatus M. mitochondrii» found in the intermembrane space of mitochondria and in the cytoplasm of ovarian cells in 100% females of I. ricinus. The bacteria contain flagella in the salivary glands of ticks. «Candidatus M. mitochondrii» has two groups of unique genes for the members of the order Rickettsiales (cbb3 cytochrome oxidase and flagellin, which allows it to play an important role in embryogenesis of the I. ricinus ticks and cause seroconversion in 58% of patients after ticks bloodsucking. This bacterium formed MALOs group (midichloria and like organisms with genetically closely related organisms which demonstrated a association with a wide range of host from arthropods to ciliates, amoebae, sponges, fish and various animals and humans. Now there is no data about replication the «Candidatus M. mitochondrii» in humans and pathogenicity of this microorganism. Although a high percentage of seropositive samples obtained from patients after bloodsucking of I. ricinus in anamnesis, this bacterium cannot yet be regarded as responsible for the pathology as known human pathogenic from order Rickettsi-ales (Rickettsia, Anaplasma and Ehrlichia spp.. Needed to reconsider the attitude to an immune response to the saliva of I. ricinus, taking into account the potential impact of «Candidatus M. mitochondrii». It is considered highly possible role of this bacterium in the immune response and immunomodulation in humans with bloodsucking of I. ricinus in anamnesis. DNA of «Candidatus M. mitochondrii» was the first time detected in I. ricinus ticks from European part of Russia.

  19. Immunoproteomic identification of antigenic salivary biomarkers detected by Ixodes ricinus-exposed rabbit sera.

    Science.gov (United States)

    Vu Hai, Vinh; Pages, Frédéric; Boulanger, Nathalie; Audebert, Stéphane; Parola, Philippe; Almeras, Lionel

    2013-09-01

    Ixodes ricinus, the primary vector of tick-borne disease in Europe, is currently expanding its distribution area and its activity in many countries. Antibody responses to tick salivary antigens have been proposed as an alternative marker of exposure to tick bites. However, the identification of the I. ricinus corresponding antigens remains elusive. Using rabbits artificially exposed to I. ricinus and 2 other European tick species (Rhipicephalus sanguineus and Dermacentor reticulatus) as controls, a cross-comparison of IgG profiles was performed against protein salivary gland extracts (pSGE) from these 3 tick species using immunoblots. Immunoblot analysis highlighted a singularity in the immune patterns according to tick species exposure and pSGE antigen source. Two protein bands were detected against I. ricinus pSGE only in rabbits exposed to I. ricinus bites. An immunoproteomic approach based on a fluorescence detection method was developed to unambiguously identify corresponding antigenic spots on 2-D gels. Among the unique I. ricinus salivary antigenic proteins detected by sera from rabbits exposed to this tick species, I. ricinus calreticulin was identified. Although tick calreticulin was previously proposed as a potential antigenic marker following exposure to ticks (particularly in North American tick species), the present study suggested that Ixodes calreticulin does not appear to be cross-recognized by the 2 other tick genera tested. Additional experiments are needed to confirm the use of I. ricinus calreticulin salivary protein as a potential discriminant antigenic biomarker to Ixodes tick exposure. Copyright © 2013 Elsevier GmbH. All rights reserved.

  20. Vaccination against Bm86 Homologues in Rabbits Does Not Impair Ixodes ricinus Feeding or Oviposition.

    Science.gov (United States)

    Coumou, Jeroen; Wagemakers, Alex; Trentelman, Jos J; Nijhof, Ard M; Hovius, Joppe W

    2014-01-01

    Human tick-borne diseases that are transmitted by Ixodes ricinus, such as Lyme borreliosis and tick borne encephalitis, are on the rise in Europe. Diminishing I. ricinus populations in nature can reduce tick exposure to humans, and one way to do so is by developing an anti-vector vaccine against tick antigens. Currently, there is only one anti-vector vaccine available against ticks, which is a veterinary vaccine based on the tick antigen Bm86 in the gut of Rhipicephalus microplus. Bm86 vaccine formulations cause a reduction in the number of Rhipicephalus microplus ticks that successfully feed, i.e. lower engorgement weights and a decrease in the number of oviposited eggs. Furthermore, Bm86 vaccines reduce transmission of bovine Babesia spp. Previously two conserved Bm86 homologues in I. ricinus ticks, designated as Ir86-1 and Ir86-2, were described. Here we investigated the effect of a vaccine against recombinant Ir86-1, Ir86-2 or a combination of both on Ixodes ricinus feeding. Recombinant Ixodes ricinus Bm86 homologues were expressed in a Drosophila expression system and rabbits were immunized with rIr86-1, rIr86-2, a combination of both or ovalbumin as a control. Each animal was infested with 50 female adults and 50 male adults Ixodes ricinus and tick mortality, engorgement weights and egg mass were analyzed. Although serum IgG titers against rIr86 proteins were elicited, no effect was found on tick feeding between the rIr86 vaccinated animals and ovalbumin vaccinated animals. We conclude that vaccination against Bm86 homologues in Ixodes ricinus is not an effective approach to control Ixodes ricinus populations, despite the clear effects of Bm86 vaccination against Rhipicephalus microplus.

  1. AUTOCLAVABLE HIGHLY CROSS-LINKED POLYURETHANE NETWORKS IN OPHTHALMOLOGY

    NARCIS (Netherlands)

    BRUIN, P; MEEUWSEN, EAJ; VANANDEL, MV; WORST, JGF; PENNINGS, AJ

    1993-01-01

    Highly cross-linked aliphatic polyurethane networks have been prepared by the bulk step reaction of low molecular weight polyols and hexamethylenediisocyanate (HDI). These polyurethane networks are optically transparent, colourless and autoclavable amorphous glassy thermosets, which are suited for

  2. New research progress of vegetable oil-based polyurethanes

    Directory of Open Access Journals (Sweden)

    Hongjie LIU

    2016-10-01

    Full Text Available This paper summarizes the latest progress for vegetable oil-based polyurethanes mainly from the view of thermoset and thermoplastic. Firstly, the modification methods for traditional thermoset polyurethane are introduced, including physical modification methods (filling and alloying and chemical modification methods (copolymerization grafting, crosslinking and interpenetrating polymer network. Materials used for physical modification mainly contain inorganic materials such as SiO2 and organic substances such as cellulose. Grafting copolymerization of styrene, acrylate and other monomers with polyurethane is the main method of chemical modification. The characteristics, preparations and application fields of thermoplastic polyurethane are reviewed, and the preparations, performances and applications of oleic acid-based thermoplastic polyurethane are chiefly presented. The development prospects of vegetable oil-based polyurethane are put forward. Surface-initiated living polymerization and other methods are used to controllable chemical modification of the traditional thermoset polyurethane and click chemistry method is uesd to promote multi-functionalization of the thermoplastic polyurethane.

  3. Antiinflammatory flavonoids from Artocarpus heterophyllus and Artocarpus communis.

    Science.gov (United States)

    Wei, Bai-Luh; Weng, Jing-Ru; Chiu, Pao-Hui; Hung, Chi-Feng; Wang, Jih-Pyang; Lin, Chun-Nan

    2005-05-18

    The antiinflammatory activities of the isolated flavonoids, including cycloartomunin (1), cyclomorusin (2), dihydrocycloartomunin (3), dihydroisocycloartomunin (4), cudraflavone A (5), cyclocommunin (6), and artomunoxanthone (7), and cycloheterohyllin (8), artonins A (9) and B (10), artocarpanone (11), artocarpanone A (12), and heteroflavanones A (13), B (14), and C (15) from Artocarpus communis and A. heterophyllus, were assessed in vitro by determining their inhibitory effects on the chemical mediators released from mast cells, neutrophils, and macrophages. Compound 4 significantly inhibited the release of beta-glucuronidase and histamine from rat peritoneal mast cells stimulated with P-methoxy-N-methylphenethylamine (compound 48/80). Compound 11 significantly inhibited the release of lysozyme from rat neutrophils stimulated with formyl-Met-Leu-Phe (fMLP). Compounds 8, 10, and 11 significantly inhibited superoxide anion formation in fMLP-stimulated rat neutrophils while compounds 2, 3, 5, and 6 evoked the stimulation of superoxide anion generation. Compound 11 exhibited significant inhibitory effect on NO production and iNOS protein expression in RAW 264.7 cells. The potent inhibitory effect of compound 11 on NO production in lipopolysaccharide (LPS)-activated macrophages, probably through the suppression of iNOS protein expression.

  4. In vitro propagation of ornamental myrtus (Myrtus communis).

    Science.gov (United States)

    Ruffoni, Barbara; Mascarello, Carlo; Savona, Marco

    2010-01-01

    The Myrtle (Myrtus communis L.) is an evergreen shrub typical of the Mediterranean area; it is an interesting plant with multipurpose use. The ornamental use takes into account the production of green cut branches for indoor decoration and production of pot plants for gardening. In this species, there is a great variability in the natural germplasm around the Mediterranean coasts for type and size of fruit, plant architecture, leaf size and internode length. Selected genotypes have been successfully sterilized and cultured in vitro. The shoots were multiplied on MS (16) salts and vitamins, with 0.5 mg/L BA and 0.2 mg/L IAA. Clones showed variation of multiplication rate and rooting percentage. IAA or IBA at 0.5 mg/L increased the rooting percentage and noticed differences in root number and length. The sucrose concentration can affect rooting, such as light intensity during the in vitro rooting phase can modulate biomass production and chlorophyll content. The combination of these factors enhanced the frequency rate of acclimatization.

  5. 40 CFR 721.8082 - Polyester polyurethane acrylate.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polyester polyurethane acrylate. 721... Substances § 721.8082 Polyester polyurethane acrylate. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified generically as polyester polyurethane acrylate...

  6. 40 CFR 721.9959 - Polyurethane polymer (generic).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polyurethane polymer (generic). 721... Substances § 721.9959 Polyurethane polymer (generic). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified generically as a polyurethane polymer (PMN P-01...

  7. High Strain Rate Compressive Behavior of Polyurethane Resin and Polyurethane/Al2O3 Hollow Sphere Syntactic Foams

    Directory of Open Access Journals (Sweden)

    Dung D. Luong

    2014-01-01

    Full Text Available Polyurethane resins and foams are finding extensive applications. Seat cushions and covers in automobiles are examples of these materials. In the present work, hollow alumina particles are used as fillers in polyurethane resin to develop closed-cell syntactic foams. The fabricated syntactic foams are tested for compressive properties at quasistatic and high strain rates. Strain rate sensitivity is an important concern for automotive applications due to the possibility of crash at high speeds. Both the polyurethane resin and the syntactic foam show strain rate sensitivity in compressive strength. It is observed that the compressive strength increases with strain rate. The energy absorbed up to 10% strain in the quasistatic regime is 400% higher for the syntactic foam in comparison to that of neat resin at the same strain rate.

  8. Performance of supercritical methanol in polyurethane degradation

    Directory of Open Access Journals (Sweden)

    Liu Lu

    2016-01-01

    Full Text Available Polyurethane is a group of block copolymer which is composed of diisocyanate, chain extender, and polyol, including polyurethane foam, polyurethane elastomer, waterborne polyurethane, etc. This research focused on thermoplastic polyurethane elastomer (TPU which is formed with 4,4’-diphenylmethane diisocyanate (MDI, poly(1,4-butanediol-hexanedioic acid diolpolyester(PBA and extended with 1,4-butanediol(BDO.The degradation of TPU was carried out with the help of methanol as the supercritical solvent. The SEM of the reaction residues revealed the process of the depolymerisation. The products were measured by GC-MS and found out to be PBA, BDO and 4,4’-methylene diphenyl carbamate(MDC which is themethylate of MDI.GC-FID, HPLC-UV and GPC were used to further analysis. The experimental results showed that supercritical methanol performed outstandingly in TPU recycling, it needed lower temperature and shorter time than regular methods. At 230°C/70min, over 90% raw materials of TPU could be recovered.

  9. Ixodes ricinus and Its Endosymbiont Midichloria mitochondrii: A Comparative Proteomic Analysis of Salivary Glands and Ovaries.

    Science.gov (United States)

    Di Venere, Monica; Fumagalli, Marco; Cafiso, Alessandra; De Marco, Leone; Epis, Sara; Plantard, Olivier; Bardoni, Anna; Salvini, Roberta; Viglio, Simona; Bazzocchi, Chiara; Iadarola, Paolo; Sassera, Davide

    2015-01-01

    Hard ticks are hematophagous arthropods that act as vectors of numerous pathogenic microorganisms of high relevance in human and veterinary medicine. Ixodes ricinus is one of the most important tick species in Europe, due to its role of vector of pathogenic bacteria such as Borrelia burgdorferi and Anaplasma phagocytophilum, of viruses such as tick borne encephalitis virus and of protozoans as Babesia spp. In addition to these pathogens, I. ricinus harbors a symbiotic bacterium, Midichloria mitochondrii. This is the dominant bacteria associated to I. ricinus, but its biological role is not yet understood. Most M. mitochondrii symbionts are localized in the tick ovaries, and they are transmitted to the progeny. M. mitochondrii bacteria have however also been detected in the salivary glands and saliva of I. ricinus, as well as in the blood of vertebrate hosts of the tick, prompting the hypothesis of an infectious role of this bacterium. To investigate, from a proteomic point of view, the tick I. ricinus and its symbiont, we generated the protein profile of the ovary tissue (OT) and of salivary glands (SG) of adult females of this tick species. To compare the OT and SG profiles, 2-DE profiling followed by LC-MS/MS protein identification were performed. We detected 21 spots showing significant differences in the relative abundance between the OT and SG, ten of which showed 4- to 18-fold increase/decrease in density. This work allowed to establish a method to characterize the proteome of I. ricinus, and to detect multiple proteins that exhibit a differential expression profile in OT and SG. Additionally, we were able to use an immunoproteomic approach to detect a protein from the symbiont. Finally, the method here developed will pave the way for future studies on the proteomics of I. ricinus, with the goals of better understanding the biology of this vector and of its symbiont M. mitochondrii.

  10. Systematic position of Neocrangon communis (Decapoda, Crangonidae) based on the features of larval morphology.

    Science.gov (United States)

    Sedova, Nina; Grigoriev, Sergey

    2014-07-07

    The present article deals with morphological comparison of four species of shrimp larvae, such as Neocrangon communis and Mesocrangon intermedia, Crangon dalli and C. septemspinosa, inhabiting the Okhotsk Sea and north-western part of the Pacific Ocean. Morphological comparison of I-V zoeal stages is discussed. The main morphological differences of the appropriate larval stages are detected. Most features of C. dalli and C. septemspinosa are similar and differ from M. intermedia and N. communis. It is shown that M. intermedia and N. communis more similar species by their origin than it is accepted to think. It is assumed that these two species should be included into one genus-Mesocrangon. The figures of I, III-V zoeal stages are presented.

  11. Structure of the fruit peel of Pyrus communis L.

    Directory of Open Access Journals (Sweden)

    Agata Konarska

    2013-04-01

    Full Text Available The peel of fruits of Pyrus communisL. cv. ‘Klapsa’,harvested at commercial maturity in September 2011, was examined using bright-field and fluorescence microscopy as well as scanning electron and transmission microscopy. The fruit peel was found to be composed of an epidermis covered by a cuticle and several layers of hypodermis. SEM observations showed that in the cuticle there were numerous microcracks of various widths, running in different directions, as well as numerous oval- or star-shaped lenticels with a diameter of approximately 130-230 µm. The microcracks ran along the cell walls and the appearance of the widest ones resembled a zipped-up zip. Crystalline wax platelets with horizontal and, more rarely, vertical orientation in relation to the surface of the organ were visible on the surface of the cuticle. The largest number of vertical wax platelets was found inside the microcracks, whereas inside the lenticels mycelium hyphae and/or fungal spores were sometimes observed. In the cross-section through the surface layer covering the fruit of Pyrus, the cells of the single- and sometimes two-layered epidermis were found to have different shapes and sizes and to be covered with a cuticular epithelium characterized by a varying structure and a thickness of about 10 µm. The cuticle covered not only the external tangential walls, but also penetrated through the anticlinal walls significantly increasing their thickness and reducing the inner diameter of the cells. TEM observations showed that inside the epidermal cells, which exhibited varying degrees of vacuolation, there was parietal cytoplasm in which cell nuclei, plastids with starch grains, and numerous mitochondria could be observed. In the hypodermis, which was composed of 3 up to 5 layers of tangential collenchyma cells with thickened tangential walls, organelles were found similar to those described in the epidermis, whereas in the vacuoles there were visible fibrous deposits

  12. Different methods evaluation of antioxidant properties of Myrtus communis extract and its fractions

    Directory of Open Access Journals (Sweden)

    Soheila Moein

    2015-09-01

    Full Text Available Myrtus communis L. is a plant traditionally used as an antiseptic and disinfectant drug. In this research, the antioxidant activity of Myrtus communis was assayed by evaluating radical scavenging activity, reducing power, FRAP method and determination of phenolic compounds. The methanolic extract of leaves of Myrtus communis was fractionated by using petroleum ether, chloroform, ethyl acetate and buthanol. In reducing power, different concentrations of samples were mixed with phosphate buffer, ferrocyanate, TCA and ferric chloride. Different concentrations of samples were mixed with DPPH and after 30 min the absorbances were measured. For determination of phenolic content, 500 μl of sample was mixed with Folin-Ciocalteu and sodium carbonate. For determination of flavonoids, 500 μl of sample was mixed with 2 ml of distilled water, NaNO2 and NaOH. In reducing power method, chloroform fraction showed the highest reducing capacity. In the DPPH radical scavenging method, the highest antioxidant capacity was found in buthanol fraction (IC50=84.42±1.8 μg/ml. In FRAP method, the highest antioxidant capacity was found in crude extract (5.4±0.3 mg/ml and buthanol fractions (5.51±0.4 mg/ml, respectively. The highest amount of phenolic compounds was detected in ethyl acetate fraction of Myrtus communis (17.5±0.001 μg/g. The highest amount of flavonoids was found in crude extract of Myrtus communis (171.9±7.3 μg/ml. Overall, we can suggest that the leaves of Myrtus communis can be used as antioxidant and as a food additives to avoid oxidative degradation of foods.

  13. Study of polyurethanes ageing offshore

    Energy Technology Data Exchange (ETDEWEB)

    Aquino, Fabio G.; Sheldrake, Terry; Clevelario, Judimar; Pires, Fabio [Wellstream International, Panama City, FL (United States); Coutinho, Fernanda M.B. [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil)

    2008-07-01

    The oil industry is one of the sectors with the highest number of production systems employing high technology. Brazil is worldwide renowned as a leader in oil and gas extraction in deep and ultra deep water. Inside the production chain, a great part the oil and gas produced is conveyed through flexible pipelines that connect the production wells to the platforms. There are two segments of these lines that receive different names according to their application characteristics. When the pipes are laid on the seabed in a static service condition, are called Flow lines and when they raise from the seabed to the platform in a dynamic service condition, are called Risers. The pipes designed for dynamic applications are equipped with Bend Stiffeners, components with conical form and in general with urethane basis, which has the function of providing a smooth stiffness transition between the flexible structure of the pipes and an extremely rigid structure, the platform, not allowing that this component infringes their minimum operation Bend Radius. According to Caire, the proper compression of curvature stiffeners and the material used in its manufacture is becoming increasingly important in industry due to its growing use and the occurrence of failures that have been recorded in recent years. This paper discusses the changes in the mechanical properties of polyurethanes by the hydrolysis during accelerated ageing, reaction of water with functional groups of the polymer chain, as well as mass variation, considering that these materials are designed for a service life exceeding twenty years for operation in water. (author)

  14. Fabrication of polyurethane and thermoplastic polyurethane nanofiber by controlling the electrospinning parameters

    Science.gov (United States)

    Emad Abdoluosefi, Homeira; Honarasa, Gholamreza

    2017-10-01

    In this study, nanofibers of polyurethane and thermoplastic polyurethane were produced by electrospinning method and the average diameters of the produced nanofibers were analyzed by the scanning electron microscopy. Then, the effect of several parameters such as applied voltage, polymer concentration, flow rate and solution temperature on the average diameter of nanofibers were explored on electrospinning process. In polyurethane nanofibers, the average diameter of 87 nm was achieved by decreasing the concentration of solution from 12% to 10% and in thermoplastic polyurethane nanofibers, the average diameter of 88 nm was achieved by increasing temperature at 10 kV. The results of this work can be used to produced ultrafine PU and TPU nanofibers and extend their applications.

  15. First detection of murine herpesvirus 68 in adult Ixodes ricinus ticks.

    Science.gov (United States)

    Kúdelová, Marcela; Jánošová, Monika; Belvončíková, Petra

    2018-01-19

    Murine herpesvirus 68 (MHV-68) is a natural pathogen that infects murid rodents, which serves as hosts for Ixodes ricinus ticks. For the first time, MHV-68 was detected in immature I. ricinus ticks feeding on Lacerta viridis lizards trapped in Slovakia, which supports the idea that ticks can acquire the virus from feeding on infected hosts. The recent discovery of MHV-68 infection and MHV-68 M3 gene transcripts in Dermacentor reticulatus ticks collected in Slovakia also supports this suggestion. Here, for the first time, we report MHV-68 infection, which was detected by nested PCR, in I. ricinus adults collected from the vegetation, and the viral load in infected ticks was determined by quantitative PCR. The viral incidence in ticks was 38.1% (21/55), and the viral load varied from 1.5 × 10 3 to 2.85 × 10 4 genome copies per tick. These results suggest that the I. ricinus ticks became infected with MHV-68 from biting infected rodents; thus, I. ricinus ticks may play a role in the spread of this virus in nature.

  16. Occurrence of Francisella spp. in Dermacentor reticulatus and Ixodes ricinus ticks collected in eastern Poland.

    Science.gov (United States)

    Wójcik-Fatla, Angelina; Zając, Violetta; Sawczyn, Anna; Cisak, Ewa; Sroka, Jacek; Dutkiewicz, Jacek

    2015-04-01

    A total of 530 questing Dermacentor reticulatus ticks and 861 questing Ixodes ricinus ticks were collected from Lublin province (eastern Poland) and examined for the presence of Francisella by PCR for 16S rRNA (rrs) and tul4 genes. Only one female D. reticulatus tick out of 530 examined (0.2%) was infected with Francisella tularensis subspecies holarctica, as determined by PCR of the rrs gene. None of 861 I. ricinus ticks were infected with F. tularensis. In contrast, the presence of Francisella-like endosymbionts (FLEs) was detected in more than half of the D. reticulatus ticks (50.4%) and 0.8% of the I. ricinus ticks. The nucleotide sequences of the FLEs detected in D. reticulatus exhibited 100% homology with the nucleotide sequence of the FLE strain FDrH detected in Hungary in D. reticulatus. In conclusion, our results suggest a low contribution of D. reticulatus and I. ricinus ticks to the circulation of F. tularensis in eastern Poland. This finding, however, needs to be confirmed by further studies in other areas. Our study confirmed the common infection of D. reticulatus with Francisella-like endosymbionts (FLEs) of unknown pathogenic potential and revealed, for the first time, a low grade of infection of I. ricinus with FLEs. Copyright © 2015 Elsevier GmbH. All rights reserved.

  17. Morphological differentiation of Ixodes persulcatus and I. ricinus hybrid larvae in experiment and under natural conditions.

    Science.gov (United States)

    Bugmyrin, Sergey V; Belova, Oxana A; Ieshko, Eugeniy P; Bespyatova, Liubov A; Karganova, Galina G

    2015-03-01

    The objective of the study was detection of hybrid larvae in Ixodes persulcatus and Ixodes ricinus cohabitation sites. To this end, the following three tasks were solved: interspecies crossing of ticks, evaluation of typical morphological signs of the hybrid larvae, and analysis of collected specimens from sites of sympatry. Under experimental conditions, hybrid larvae of I. persulcatus (female) and I. ricinus (male) were obtained that differed from the parental species by the size of setae on the scutum and alloscutum. Discriminant analysis yielded 87.5% classification accuracy for the priory set groups of I. persulcatus, I. ricinus, and hybrids. Of 88 hybrid larvae, 13 (15%) were classified as I. persulcatus and 4 (5%) as I. ricinus. We measured larvae of Ixodes ticks (n=141) collected from small mammals in 1950-1970 in Karelia in cohabitation sites of these species that were previously classified as I. persulcatus or I. ricinus. According to the results of discriminant analysis, 31 larvae (22%) were classified as hybrids with probability p≥0.52; for 10 larvae (7%), the probability of placement to the hybrid group was >0.95. Copyright © 2014 Elsevier GmbH. All rights reserved.

  18. Identification and partial characterization of a Salp15 homolog from Ixodes ricinus.

    Science.gov (United States)

    Liu, J; Renneker, S; Beyer, D; Kullmann, B; Seitzer, U; Ahmed, J; Bakheit, M A

    2014-04-01

    The immunomodulatory molecule Salp15 is originally described in Ixodes scapularis and has been shown to inhibit CD4 T cell activation. Many Salp15 homologs have been described from Ixodes species, and all were well conserved at C-terminal residues that seem to be essential for the function of the protein. In this study, a gene sequence was amplified from cDNA isolated from engorged female I. ricinus ticks, which was predicted to generate a protein of 12.3 kDa. The protein displayed distinct amino acid differences from previously described I. ricinus Salp15 homologs, with amino acid identity ranging between 46.6% and 93.9%. It was referred to as I. ricinus Salp15-like protein. The protein showed 48.1% sequence identity to I. scapularis Salp15. We analyzed the effect of the recombinant I. ricinus Salp15-like protein on the production of cytokines from human peripheral blood mononuclear cells stimulated with LPS. The recombinant protein exerted no effect on the production of TNF-α and IL-6, but the production of IL-10 was dose-dependently reduced. It can be concluded that I. ricinus Salp15-like protein exerts an immunomodulatory effect on the host. The inhibition of IL-10 production may possibly lead to a retardation of B cell activity. Copyright © 2014 Elsevier GmbH. All rights reserved.

  19. Behavioural responses of Ixodes ricinus nymphs to carbon dioxide and rodent odour.

    Science.gov (United States)

    VAN Duijvendijk, G; Gort, G; Sprong, H; Takken, W

    2017-06-01

    Many haematophagous ectoparasites use carbon dioxide (CO2 ) and host odour to detect and locate their hosts. The tick Ixodes ricinus (Linnaeus) (Ixodida: Ixodidae) walks only small distances and quests in vegetation until it encounters a host. The differential effects of CO2 and host odour on the host-finding behaviour of I. ricinus have, however, never been clarified and hence represent the subject of this study. The effects of CO2 and odour from bank voles on the activation and attraction of I. ricinus nymphs were analysed in a Y-tube olfactometer. Carbon dioxide evoked a response in the absence and presence of host odour, but did not attract nymphs. Host odour, however, did not evoke a response but did attract nymphs in the absence and presence of CO2 . The current results show that CO2 is an activator, but not an attractant, and that host odour is an attractant, but not an activator, of I. ricinus nymphs, and provide ecological insights into the host-finding behaviour of I. ricinus. © 2016 The Royal Entomological Society.

  20. Cavitation studies on whole Ricinus plants by acoustic detection.

    Science.gov (United States)

    Milburn, J A

    1973-12-01

    Acoustic detection has been used to investigate the incidence of cavitation in whole potted Ricinus plants subjected to water stress by withholding water. Cavitation proceeded rather slowly and was detectable before and during wilting. Techniques which restricted water uptake more drastically such as root cooling or overlapping cuts induced more rapid "click" production and wilting; a response already described for excised leaves. When water stress was removed by rewatering, or rewarming a cooled root system, cavitation soon ceased. This response was more sluggish of over-delayed.Cavitation in aging leaves on well watered plants has also been examined. Despite the onset of senescence over many days there was no evidence that dry patches, which often develop extensively, are a consequence of water shortage induced by xylem blockage. Leaves, falling naturally by abscission in still air, were often remarkably turgid with water potentials similar to those of healthy attached leaves. Only after losing water was cavitation apparent, as usual for excised mature leaves. Sometimes more persistent leaves did cavitate in situ, just before abscission, showing that in normal leaves xylem blockage can occasionally precede leaf fall by several hours.

  1. Rigid polyurethane and kenaf core composite foams

    Science.gov (United States)

    Rigid polyurethane foams are valuable in many construction applications. Kenaf is a bast fiber plant where the surface stem skin provides bast fibers whose strength-to-weight ratio competes with glass fiber. The higher volume product of the kenaf core is an under-investigated area in composite appli...

  2. Fluorinated polyurethane coatings with adaptable surface properties

    NARCIS (Netherlands)

    Wouters, M; van Zanten, J; Vereijken, T; Bakker, D; Klijnstra, J

    Polyurethane coatings with different network compositions were prepared in well-defined model systems as well as commercially-available formulations. The properties, such as glass-transition temperature, hardness and surface free energy, of the model network were tuned by the choice of the

  3. Nonwoven glass fiber mat reinforces polyurethane adhesive

    Science.gov (United States)

    Roseland, L. M.

    1967-01-01

    Nonwoven glass fiber mat reinforces the adhesive properties of a polyurethane adhesive that fastens hardware to exterior surfaces of aluminum tanks. The mat is embedded in the uncured adhesive. It ensures good control of the bond line and increases the peel strength.

  4. The reactive extrusion of thermoplastic polyurethane

    NARCIS (Netherlands)

    Verhoeven, Vincent Wilhelmus Andreas

    2006-01-01

    The objective of this thesis was to increase the understanding of the reactive extrusion of thermoplastic polyurethane. Overall, several issues were identified: • Using a relative simple extrusion model, the reactive extrusion process can be described. This model can be used to further investigate

  5. Borrelia miyamotoi in host-seeking Ixodes ricinus ticks in England.

    Science.gov (United States)

    Hansford, K M; Fonville, M; Jahfari, S; Sprong, H; Medlock, J M

    2015-04-01

    This paper reports the first detection of Borrelia miyamotoi in UK Ixodes ricinus ticks. It also reports on the presence and infection rates of I. ricinus for a number of other tick-borne pathogens of public health importance. Ticks from seven regions in southern England were screened for B. miyamotoi, Borrelia burgdorferi sensu lato (s.l.), Anaplasma phagocytophilum and Neoehrlichia mikurensis using qPCR. A total of 954 I. ricinus ticks were tested, 40 were positive for B. burgdorferi s.l., 22 positive for A. phagocytophilum and three positive for B. miyamotoi, with no N. mikurensis detected. The three positive B. miyamotoi ticks came from three geographically distinct areas, suggesting a widespread distribution, and from two separate years, suggesting some degree of endemicity. Understanding the prevalence of Borrelia and other tick-borne pathogens in ticks is crucial for locating high-risk areas of disease transmission.

  6. Thermal Expansion of Polyurethane Foam

    Science.gov (United States)

    Lerch, Bradley A.; Sullivan, Roy M.

    2006-01-01

    Closed cell foams are often used for thermal insulation. In the case of the Space Shuttle, the External Tank uses several thermal protection systems to maintain the temperature of the cryogenic fuels. A few of these systems are polyurethane, closed cell foams. In an attempt to better understand the foam behavior on the tank, we are in the process of developing and improving thermal-mechanical models for the foams. These models will start at the microstructural level and progress to the overall structural behavior of the foams on the tank. One of the key properties for model characterization and verification is thermal expansion. Since the foam is not a material, but a structure, the modeling of the expansion is complex. It is also exacerbated by the anisoptropy of the material. During the spraying and foaming process, the cells become elongated in the rise direction and this imparts different properties in the rise direction than in the transverse directions. Our approach is to treat the foam as a two part structure consisting of the polymeric cell structure and the gas inside the cells. The polymeric skeleton has a thermal expansion of its own which is derived from the basic polymer chemistry. However, a major contributor to the thermal expansion is the volume change associated with the gas inside of the closed cells. As this gas expands it exerts pressure on the cell walls and changes the shape and size of the cells. The amount that this occurs depends on the elastic and viscoplastic properties of the polymer skeleton. The more compliant the polymeric skeleton, the more influence the gas pressure has on the expansion. An additional influence on the expansion process is that the polymeric skeleton begins to breakdown at elevated temperatures and releases additional gas species into the cell interiors, adding to the gas pressure. The fact that this is such a complex process makes thermal expansion ideal for testing the models. This report focuses on the thermal

  7. Protein (Viridiplantae): 255574304 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 235880:9300 3987:9300 3988:9300 nutrient reservoir, putative Ricinus communis MTHHKHHKHEDPPPPPCPPPPLDPCAPPCPDSPPPPIVIVEPPPPLPLDPCVPPPPVIVYPPPPPPLDHCAPPPPIIVHPPPPPPPHHHHHHDYYYHHHHHHHH ...

  8. The toxic effect of permethrin and cypermethrin on engorged Ixodes ricinus females

    Directory of Open Access Journals (Sweden)

    Alicja Buczek

    2014-06-01

    Full Text Available introduction. [i]Ixodes ricinus[/i] tick is of great medical and veterinary importance and has a wide range of geographical distribution. The study presents the effect of permethrin (Per and cypermethrin (CM on engorged[i] I. ricinus[/i] females. materials and method. The effect of perythroids studied on engorged I. ricinus females was assessed on the basis of the pre-oviposition and oviposition period. Remote effects of Per and CM application were assessed by investigation of the length and course of embryonic development and larval hatching from eggs laid by pyrethroid-treated females. Per (Copex WP was used at doses of 0.78125–25.0 µg/1 specimen, and CM (Kordon 10WP was applied at 0.3125–10.0 µg/1 specimen. Immediately after the feeding period, I. ricinus females were sprayed with 20 µl of a pyrethroid solution and kept at 28 °C and 75%RH. results. The experiments demonstrated that CM exerted a stronger toxic effect on [i]I. ricinus[/i] females than Per. The lowest doses of CM doubled the length of the pre-oviposition period while its highest doses prolonged the period nearly three times compared with the control. The pyrethroids applied reduced the number and weight of eggs and changed the parameters of the oviposition process. Application of the tested pyrethroid doses led to disturbances in the embryonic development of[i] I. ricinus[/i], i.e. the development was prolonged, few normal larvae hatched, numerous eggs and embryos at various developmental stages died, and larval hatch was inhibited. conclusions. Knowledge about the sensitivity of engorged females to different doses of the tested pyrethroids and the remote effects of their action can be used in practice for tick control among livestock animals, and the reduction of tick population abundance in the environment.

  9. Seasonal infestation of birds with immature stages of Ixodes ricinus and Ixodes arboricola.

    Science.gov (United States)

    Kocianová, Elena; Rusňáková Tarageľová, Veronika; Haruštiaková, Danka; Špitalská, Eva

    2017-03-01

    This study assessed the parasitization of cavity-nesting birds and ground-nesting/foraging birds with larvae and nymphs of two Ixodes species, Ixodes ricinus and Ixodes arboricola. Totals of 679 (52.3%) I. ricinus and 619 (47.7%) I. arboricola ticks were collected from 15 species of passerine birds which were caught during the nesting and non-nesting periods of 2003-2006, in the south-eastern part of the Czech Republic, the Drahanská Vrchovina Uplands. In the non-nesting period from October to March, 6.8% (101/1492) of birds were infested with ticks, mainly with I. arboricola larvae. In the non-nesting period, the average intensity of infestation by I. arboricola and I. ricinus was 8.5 and 1.5 individuals per infested bird, respectively. In the nesting period from April to June, 21.6% (50/232) of birds were infested by both tick species but mainly with I. ricinus nymphs. The average intensity of infestation by I. ricinus and I. arboricola was 13.3 and 10.8 individuals per infested bird, respectively. Altogether, 23.2% of the infested birds were parasitized by both immature life stages of one or both tick species. From an enzootic perspective, co-feeding and co-infestation of I. ricinus and I. arboricola subadults on passerine birds might happen and may be important for the dissemination of tick-borne agents. Copyright © 2017 Elsevier GmbH. All rights reserved.

  10. An Ixodes ricinus Tick Salivary Lectin Pathway Inhibitor Protects Borrelia burgdorferi sensu lato from Human Complement.

    Science.gov (United States)

    Wagemakers, Alex; Coumou, Jeroen; Schuijt, Tim J; Oei, Anneke; Nijhof, Ard M; van 't Veer, Cornelis; van der Poll, Tom; Bins, Adriaan D; Hovius, Joppe W R

    2016-04-01

    We previously identified tick salivary lectin pathway inhibitor (TSLPI) in Ixodes scapularis, a vector for Borrelia burgdorferi sensu stricto (s.s.) in North America. TSLPI is a salivary protein facilitating B. burgdorferi s.s. transmission and acquisition by inhibiting the host lectin complement pathway through interference with mannose binding lectin (MBL) activity. Since Ixodes ricinus is the predominant vector for Lyme borreliosis in Europe and transmits several complement sensitive B. burgdorferi sensu lato (s.l.) strains, we aimed to identify, describe, and characterize the I. ricinus ortholog of TSLPI. We performed (q)PCRs on I. ricinus salivary gland cDNA to identify a TSLPI ortholog. Next, we generated recombinant (r)TSLPI in a Drosophila expression system and examined inhibition of the MBL complement pathway and complement-mediated killing of B. burgdorferi s.l. in vitro. We identified a TSLPI ortholog in I. ricinus salivary glands with 93% homology at the RNA and 89% at the protein level compared to I. scapularis TSLPI, which was upregulated during tick feeding. In silico analysis revealed that TSLPI appears to be part of a larger family of Ixodes salivary proteins among which I. persulcatus basic tail salivary proteins and I. scapularis TSLPI and Salp14. I. ricinus rTSLPI inhibited the MBL complement pathway and protected B. burgdorferi s.s. and Borrelia garinii from complement-mediated killing. We have identified a TSLPI ortholog, which protects B. burgdorferi s.l. from complement-mediated killing in I. ricinus, the major vector for tick-borne diseases in Europe.

  11. Identification and partial characterisation of new members of the Ixodes ricinus defensin family.

    Science.gov (United States)

    Tonk, Miray; Cabezas-Cruz, Alejandro; Valdés, James J; Rego, Ryan O M; Rudenko, Nataliia; Golovchenko, Maryna; Bell-Sakyi, Lesley; de la Fuente, José; Grubhoffer, Libor

    2014-05-01

    The hard-bodied tick Ixodes ricinus (castor bean tick) is the most common tick species in Europe. I. ricinus is a vector of the causative agents of diseases that affect humans and animals including tick-borne encephalitis, borreliosis, tick-borne fever and babesiosis. The innate immune system provides ticks with quite an efficient defence against some pathogenic microorganisms in the event of their penetration into the tick body or through the blood meal. Antimicrobial peptides (AMPs) constitute an important feature of the tick immune system. Defensins are a well-known class of AMPs. Members of the defensin family of proteins have been reported in several tick species. So far, only two defensins had been identified from I. ricinus. In this study, we report the identification of six novel putative defensins from I. ricinus at the genomic and transcriptional levels. At the genomic level they show differences with one being intronless, while others contain two introns. The expression pattern of these molecules in the salivary glands, midgut, ovary, Malpighian tubules, haemolymph and the tick cell line IRE/CTVM19 was determined. Some of them are tissue specific while others seem to be ubiquitous. Molecular and phylogenetic analyses show that these novel members of the I. ricinus defensin family differ phylogenetically and structurally; nevertheless, the cysteine pattern is highly conserved among the family members. Finally, antimicrobial-peptide prediction tools were used to predict putative antimicrobial activity of our defensins. They show putative antimicrobial activity mainly against Gram-positive bacteria. This study displays the diversity of the defensin family in the tick I. ricinus. Copyright © 2014 Elsevier B.V. All rights reserved.

  12. Molecular evidence for bacterial pathogens in Ixodes ricinus ticks infesting Shetland ponies.

    Science.gov (United States)

    Skotarczak, Bogumiła; Wodecka, Beata; Rymaszewska, Anna; Adamska, Małgorzata

    2016-06-01

    Ixodes ricinus has the potential to transmit zoonotic pathogens to humans and domestic animals. The feeding I. ricinus (n = 1737) collected from 49 Shetland ponies and questing ones from vegetation (n = 371) were tested for the presence and differentiation of the bacterial species. DNA of I. ricinus ticks was examined with PCR and sequencing analysis to identify species of Borrelia burgdorferi sensu lato (Bbsl), Anaplasma phagocytophilum and Rickettsia spp. Altogether, 24.3 % I. ricinus of the infested horses and 12.4 % ticks from vegetation carried at least one pathogen species. Horse-feeding ticks (19.2 %) were significantly more frequently infected with Borrelia spp. than questing ticks (4.8 %). Among Bbsl species, in I. ricinus infesting ponies, B. garinii, B. afzelii, B. burgdorferi sensu stricto, B. valaisiana and B. lusitanie and one species, B. miyamotoi related to relapsing fever group, were detected. The 73 flaB gene sequences of Borrelia obtained from feeding I. ricinus have been deposited in GenBank. Among Rickettsia species, two were identified: R. helvetica which was dominant and R. monacensis. Infections with more than one pathogenic species, involving mostly Bbsl and R. helvetica were detected in 6.3 % of infected ticks collected from horses. Shetland ponies may play an important role in the epidemiological cycle of Bbsl and probably could contribute to the natural cycle of A. phagocytophilum and R. helvetica as host for infected ticks. The awareness about these infectious agents in ticks from ponies might be an important criterion for the risk assessment of human diseases, especially as these animals are maintained for recreational purposes.

  13. Assessment of MALDI-TOF MS biotyping for Borrelia burgdorferi sl detection in Ixodes ricinus.

    Science.gov (United States)

    Boyer, Pierre H; Boulanger, Nathalie; Nebbak, Amira; Collin, Elodie; Jaulhac, Benoit; Almeras, Lionel

    2017-01-01

    Matrix Assisted Laser Desorption/Ionization Time-of-Flight Mass Spectrometry (MALDI-TOF MS) has been demonstrated to be useful for tick identification at the species level. More recently, this tool has been successfully applied for the detection of bacterial pathogens directly in tick vectors. The present work has assessed the detection of Borrelia burgdorferi sensu lato in Ixodes ricinus tick vector by MALDI-TOF MS. To this aim, experimental infection model of I. ricinus ticks by B. afzelii was carried out and specimens collected in the field were also included in the study. Borrelia infectious status of I. ricinus ticks was molecularly controlled using half-idiosome to classify specimens. Among the 39 ticks engorged on infected mice, 14 were confirmed to be infected by B. afzelii. For field collection, 14.8% (n = 12/81) I. ricinus ticks were validated molecularly as infected by B. burgdorferi sl. To determine the body part allowing the detection of MS protein profile changes between non-infected and B. afzelii infected specimens, ticks were dissected in three compartments (i.e. 4 legs, capitulum and half-idiosome) prior to MS analysis. Highly reproducible MS spectra were obtained for I. ricinus ticks according to the compartment tested and their infectious status. However, no MS profile change was found when paired body part comparison between non-infected and B. afzelii infected specimens was made. Statistical analyses did not succeed to discover, per body part, specific MS peaks distinguishing Borrelia-infected from non-infected ticks whatever their origins, laboratory reared or field collected. Despite the unsuccessful of MALDI-TOF MS to classify tick specimens according to their B. afzelii infectious status, this proteomic tool remains a promising method for rapid, economic and accurate identification of tick species. Moreover, the singularity of MS spectra between legs and half-idiosome of I. ricinus could be used to reinforce this proteomic identification

  14. Mitogenomes reveal diversity of the European Lyme borreliosis vector Ixodes ricinus in Italy.

    Science.gov (United States)

    Carpi, Giovanna; Kitchen, Andrew; Kim, Hie Lim; Ratan, Aakrosh; Drautz-Moses, Daniela I; McGraw, John J; Kazimirova, Maria; Rizzoli, Annapaola; Schuster, Stephan C

    2016-08-01

    In Europe, the Ixodes ricinus tick is the most important vector of the etiological agents of Lyme borreliosis and several other emerging tick-borne diseases. Because tick-borne pathogens are dependent on their vectors for transmission, understanding the vector population structure is crucial to inform public health research of pathogen dynamics and spread. However, the population structure and dynamics of this important vector species are not well understood as most genetic studies utilize short mitochondrial and nuclear sequences with little diversity. Herein we obtained and analyzed complete mitochondrial genome (hereafter "mitogenome") sequences to better understand the genetic diversity and the population structure of I. ricinus from two long-standing tick-borne disease foci in northern Italy. Complete mitogenomes of 23 I. ricinus ticks were sequenced at high coverage. Out of 23 mitogenome sequences we identified 17 unique haplotypes composed of 244 segregating sites. Phylogenetic reconstruction using 18 complete mitogenome sequences revealed the coexistence of four highly divergent I. ricinus maternal lineages despite the narrow spatial scale over which these samples were obtained (100km). Notably, the estimated coalescence time of the 18 mitogenome haplotypes is ∼427 thousand years ago (95% HPD 330, 540). This divergence between I. ricinus lineages is consistent with the mitochondrial diversity of other arthropod vector species and indicates that long-term I. ricinus populations may have been less structured and larger than previously thought. Thus, this study suggests that a rapid and accurate retrieval of full mitochondrial genomes from this disease vector enables fine-resolution studies of tick intraspecies genetic relationships, population differentiation, and demographic history. Copyright © 2016 Elsevier Inc. All rights reserved.

  15. Biodegradable polyurethane nanocomposites containing dexamethasone for ocular route

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues da Silva, Gisele [Federal University of Sao Joao Del Rei, School of Pharmacy, Divinopolis, Minas Gerais (Brazil); Silva-Cunha, Armando da [Federal University of Minas Gerais, School of Pharmacy, Belo Horizonte, Minas Gerais (Brazil); Behar-Cohen, Francine [INSERM, Physiopathology of ocular diseases: Therapeutic innovations, Institut des Cordeliers, Paris (France); Laboratoire d' Innovations Therapeutiques, Fondation Rothschild, Paris (France); Universite Rene Descartes, Hotel Dieu University Hospital, Paris (France); Ayres, Eliane [Federal University of Minas Gerais, Department of Metallurgical and Materials Engineering, Belo Horizonte, Minas Gerais (Brazil); Orefice, Rodrigo L., E-mail: rorefice@demet.ufmg.br [Federal University of Minas Gerais, Department of Metallurgical and Materials Engineering, Belo Horizonte, Minas Gerais (Brazil)

    2011-03-12

    The treatment of posterior segment ocular diseases, such as uveitis, by using eye drops and oral drugs is usually not effective due to the body's natural barriers to drug penetration. In this study, ocular implants to treat uveitis were synthesized by incorporating dexamethasone acetate, an important type of corticoid used in the treatment of some uveitis, into a biodegradable polyurethane containi clay nanoparticles. Biodegradable polyurethane nanocomposites having poly(caprolactone) oligomers as soft segments were obtained by delaminating clay particles within a polyurethane aqueous dispersion. The drug was incorporated into the polymer by dispersing it in the waterborne polyurethane followed by a drying step. Nanoparticles derived from clay were demonstrated to be able to tailor the mechanical properties of polyurethanes to achieve values that can match the properties of ocular soft tissues. Infrared spectra (FTIR) showed that the presence of clay particles was able to change the microphase separation process typical of polyurethanes. X-ray diffraction and small angle x-ray scattering (SAXS) results were explored to show that the incorporation of both dexamethasone acetate and nanocomponents derived from clay led to a less defined two-phase polyurethane. The presence of clay nanoparticles increased the rate of drug release measured in vitro. Human retinal pigment epithelial cells (ARPE-19) were cultured in contact with polyurethanes and polyurethane nanocomposites, and the viability of them (evaluated by using MTT assay after 7 days) showed that no toxic components were released from polyurethanes containing no drugs during the test.

  16. Siberian subtype tick-borne encephalitis virus in Ixodes ricinus in a newly emerged focus, Finland.

    Science.gov (United States)

    Jääskeläinen, Anu; Tonteri, Elina; Pieninkeroinen, Ilkka; Sironen, Tarja; Voutilainen, Liina; Kuusi, Markku; Vaheri, Antti; Vapalahti, Olli

    2016-02-01

    The first tick-borne encephalitis (TBE) cases in Kotka, Finland appeared in 2010. Altogether ten human cases have been diagnosed by 2014. Four had long-lasting sequelae. We collected 195 Ixodes ricinus ticks, nine rodents, and eleven shrews from the archipelago of Kotka in 2011. Three Siberian subtype TBE virus (TBEV) strains were isolated from the ticks and three mammals were positive for TBEV antibodies. The archipelago of Kotka is a newly emerged TBE focus of Siberian subtype TBEV circulating notably in I. ricinus. The patients had on average longer hospitalization than reported for the European subtype infection. Copyright © 2015 Elsevier GmbH. All rights reserved.

  17. ANTIMICROBIAL ACTIVITY OF THE ESSENTIAL OIL OF MYRTUS COMMUNIS L BERRIES GROWING WILD IN ALGERIA

    Directory of Open Access Journals (Sweden)

    M. Toauibia

    2015-02-01

    Full Text Available The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed range from 0.563 to 36 mg/ml.

  18. MORPHOLOGICAL AND ANATOMICAL STUDY OF SHOOTS OF JUNIPERUS COMMUNIS L. FROM CUPRESSACEAE FAMILY

    Directory of Open Access Journals (Sweden)

    F. K. Serebryanaya

    2015-01-01

    Full Text Available We have conducted morphological and anatomical studies of Juniperus communis, revealed diagnostic indices of the stamina, stalk, and needle. The leaf is sessile, linear awe shaped, pointed. Stalk form at cross section is cylindrical. Needles are lanceolar with one whitish vertical stripe, with paracytic stomata. 

  19. Chemical structure of algaenans from the freshwater algae Tetraedron minimum, Scenedesmus communis and Pediastrum boryanum

    NARCIS (Netherlands)

    Sinninghe Damsté, J.S.; Blokker, P.; Schouten, S.; Ende, H. van den; Hatcher, P.G.

    1998-01-01

    The cell walls of the fresh water green microalgae Tetraedron minimum, Scenedesmus communis and Pediastrum boryanum are composed of highly resistant, non-hydrolyzable aliphatic biopolymers as revealed by 13C-NMR, FTIR and thermal and chemical degradations. The biopolymers are composed of long-chain

  20. ETNOBOTÂNICA DA MALVA-BRANCA (WALTHERIA COMMUNIS A. ST.-HIL. - MALVACEAE)

    OpenAIRE

    NETO, GERMANO GUARIM

    2016-01-01

    O autor apresenta os resultados obtidos com o estudo etnobotânico realizado com Waltheria communis A. St.-Hil. da família Malvaceae, com informações sobre o uso medicinal da mesma em Mato Grosso e em outras regiões brasileiras.

  1. Produção de etanol a partir de torta de mamona (Ricinus communis L. e avaliação da letalidade da torta hidrolisada para camundongos Ethanol production from castor bean cake (Ricinus communis L. and evaluation of the lethality of the cake for mice

    Directory of Open Access Journals (Sweden)

    Walber Carvalho Melo

    2008-01-01

    Full Text Available The castor bean cake is rich in starch (48 ± 0.53% and bears a problem linked to the occurrence of a toxic protein (ricin. The chemical hydrolysis (ratio solid:liquid = 1:6; H2SO4= 0.1 mol L-1; 120 °C; 40 min generated a medium with 27 g L-1 of reducing sugars (hydrolysis efficiency= 32%. The hydrolyzed product was fermented and produced 11 g L-1 of ethanol (volumetric productivity=1.38 g L-1 h-1 and ethanol yield on substrate consumed=0.45 g g-1. In vivo experiments (DL50 revealed a reduction of roughly 240 times in the CBC toxicity (2.11 µg g-1.

  2. Survey of the castor bean production (Ricinus communis L. in a collection of producers from five counties of Bahia State. = Levantamento da produção de mamona (Ricinus communis L. em uma amostra de produtores em cinco municípios do Estado da Bahia.

    Directory of Open Access Journals (Sweden)

    Vicente de Paula Queiroga

    2011-08-01

    Full Text Available The objective of this study was to verify the situation of the culture of castor bean from a collection of producers located in five counties of Bahia state, highlighting the technical conditions of production and commercialization of the product, beyond its social aspects. Twenty-five castor bean producers were interviewed during the 2005 agricultural year by a team of researchers from the Embrapa Cotton. A present questionnaire with 15 variable questions pertaining to agro-economic and social-economic was applied to producers with the objective to diagnose the agricultural social-economic profiles of theproducers of castor bean that are used for the production of berries to be used within the energy market of the Program of Biodiesel and Ricin chemistry. Data analysis concluded that the family farmers of Bahia have the culture of castor oil as, a major source of income, but the cultivation techniques, promising cultivars, and oil content are underutilized. It was shown that a technology gap can be solved by a adopting a differential pricing policy that is based on a feasibility comprehensive recovery program that increases the ricin culture productivity throughout the production chain, reduce costs, and increase the oil content of cultivars.ResumoObjetivou-se com este estudo verificar a situação da cultura da mamona em uma amostra de produtores levantados em cinco municípios localizados no noroeste do estado da Bahia (São Gabriel, Irecê, Lapão, Ibititá e Cafarnaum, destacando-se as condições técnicas de produção e de comercialização do produto, além dos seus aspectos sociais. Um total de 25 produtores de mamona foi entrevistado no ano agrícola de 2005, por uma equipe de pesquisadores da Embrapa Algodão. Um questionário preestabelecido com 15 variáveis agronômicas e socioecononômicas foi aplicado junto aos produtores, visando o diagnóstico do perfil agrossocioeconômico dos produtores de mamona que estão destinando sua produção de bagas para atender o mercado energético do Programa de Biodiesel e de Ricinoquímica. Pela análise dos dados, concluiu-se que os produtores familiares baianos têm na cultura da mamona, uma das principais fontes de renda, cujas técnicas de cultivo, cultivares promissoras e seu teor de óleo, encontram-se subutilizados. Ficou evidenciado um atraso tecnológico que pode ser solucionado mediante uma política de preço diferencial, visando à viabilidade de um amplo programa de recuperação da ricinocultura que contemple aumento de produtividade em toda cadeia de produção, redução de custos e elevação do teor de óleo das cultivares utilizadas.

  3. Marine biofouling resistance of polyurethane with biodegradation and hydrolyzation.

    Science.gov (United States)

    Xu, Wentao; Ma, Chunfeng; Ma, Jielin; Gan, Tiansheng; Zhang, Guangzhao

    2014-03-26

    We have prepared polyurethane with poly(ε-caprolactone) (PCL) as the segments of the main chain and poly(triisopropylsilyl acrylate) (PTIPSA) as the side chains by a combination of radical polymerization and a condensation reaction. Quartz crystal microbalance with dissipation studies show that polyurethane can degrade in the presence of enzyme and the degradation rate decreases with the PTIPSA content. Our studies also demonstrate that polyurethane is able to hydrolyze in artificial seawater and the hydrolysis rate increases as the PTIPSA content increases. Moreover, hydrolysis leads to a hydrophilic surface that is favorable to reduction of the frictional drag under dynamic conditions. Marine field tests reveal that polyurethane has good antifouling ability because polyurethane with a biodegradable PCL main chain and hydrolyzable PTIPSA side chains can form a self-renewal surface. Polyurethane was also used to carry and release a relatively environmentally friendly antifoulant, and the combined system exhibits a much higher antifouling performance even in a static marine environment.

  4. Substrate chemistry regulates the surface phase separation of polyurethane films

    Science.gov (United States)

    Xing, Juan; Pan, Xianchao; Wang, Jinfeng; Luo, Yanfeng

    The effect of substrate chemistry on surface phase separation of polyurethane films were investigated by using self-assembled monolayer (SAM) with chemically different modifications, i.e. hydroxy (-OH) and methyl (-CH3) end groups. Results showed that hydrophilic (-OH) and hydrophobic end groups (-CH3) could respectively promote the aggregation of hard and soft segments at polyurethane-substrate interface, which further regulates the phase separation of polyurethane surface that contacts the substrate. The aggregation of hard segments tended to enhance the surface smoothness of polyurethane films, especially on hydrophilic substrates with hydroxy modification. Further analysis of tensile testing revealed that the regulation of surface phase separation had no effect on the shape memory effect of polyurethane films. These findings suggest that the chemical properties of the substrates could regulate the phase separation and may provide some guidance on the design of specific polyurethane with desired morphology and properties.

  5. Lignins as macromonomers for polyesters and polyurethanes

    Energy Technology Data Exchange (ETDEWEB)

    Gandini, A.; Guo, Z.X.; Montanari, S. [EFPG Martin d`Heres (France)

    1996-10-01

    Lignins of different vegetal origin and from different delignification processes bear the common essential feature of containing both phenolic and aliphatic hydroxy groups, albeit in different total amounts and relative proportions. The present study reports the use of several lignins as polyfunctional oligomers for the direct elaboration of polyesters and polyurethanes, through their condensation reactions with acid chlorides and isocyanates, respectively. In the syntheses of polyesters the reagents were aliphatic and aromatic dichlotides and oligoethylene oxide glycols of different DP`s were added as chain extenders. The conditions were optimized and the ensuing networks thoroughly characterized. Two types of polyurethanes were prepared, namely thermoplastic structures arising from the reaction of lignins with oligoethylene oxide monoisocyanates and crosslinked products obtained from similar polycondensations, but with oligoethylene oxide diisocyanates. The properties of all these materials were examined in relation to their structural peculiarities and assessed in the light of possible applications.

  6. Thermal stability of soy-based polyurethanes

    Directory of Open Access Journals (Sweden)

    Luciane L. Monteavaro

    2005-06-01

    Full Text Available New types of polyurethanes were prepared by reacting diisocyanates and formiated soy polyols with different OH functionalities. Thermal properties and degradation kinetics were investigated by TGA. All prepared PU's showed at least two-weight loss steps, the first one, around 210 °C. Thermal stability of these PUs depends strongly on urethane groups per unit volume and an increase in the weight loss was observed as a result of the increased amount of urethane groups. Degradation kinetics behavior of the soy-based polyurethanes was investigated according to the Flynn method. Different average activation energy values were obtained from isothermal and isoconversional curves, 140.6 KJ/mol and 62.8 KJ/mol, respectively, indicating the complexity of the PUs degradation process.

  7. Electrostrictive energy conversion in polyurethane nanocomposites

    Science.gov (United States)

    Guyomar, D.; Lebrun, L.; Putson, C.; Cottinet, P.-J.; Guiffard, B.; Muensit, S.

    2009-07-01

    Electrostrictive polymers have demonstrated an ability to convert mechanical energy into electrical energy and vice versa. This energy conversion has been exploited in an extensive range of applications, including sensors and actuators. Recently, electrostrictive polymers have been investigated as electroactive materials for energy harvesting. The present work aims at establishing an analytical modeling based on electrostrictive equations for predicting a current that can be obtained from the first flexural mode of a beam which was attached by the electrostrictive polymers. The study was carried out on polyurethane films, either without filler or filled with nanosized SiC or a carbon nanopowder. Experimental measurements of the harvested current have been compared to the theoretical behavior predicted by the proposed model. A good agreement was observed between the two sets of data, which consequently validated that the modeling can be used to optimize the choice of materials. It was also shown that the incorporation of nanofillers in polyurethane increased the obtained current.

  8. Crosslinked polyurethanes based on hyperbranched polymers

    Directory of Open Access Journals (Sweden)

    Vuković Jasna

    2008-01-01

    Full Text Available In this paper, two samples of polyurethane (PU crosslinked with hydroxy -functonal hyperbranched aliphatic polyester of the second pseudo generation were investigated. For the synthesis of these crosslinked PUs two different macrodiols were used: poly(tetramethyleneoxide (PTMO for PUPTMO and ethylene oxide-poly(dimethylsiloxane-ethylene oxide (PDMS-EO for PUPDMS-EO sample. Synthesized samples behave as elastomers and have yellow color. Obtained results show that swelling degree of the sample PUPDMS-EO in N-methyl-2-pyrrolidinon (NMP determined at room temperature is higher than for the sample PUPTMO. It has been also observed that thermal properties of these polyurethane networks can be changed by incorporation of siloxane sequences in their structure.

  9. Influence of meteorological parameters during the preceding fall and winter on the questing activity of nymphal Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Vollack, Ken; Sodoudi, Sahar; Névir, Peter

    2017-01-01

    Wood ticks, Ixodes ricinus L., serve as vectors for various pathogens and are ubiquitous throughout Central Europe. Survival and development of I. ricinus depend on biotic and abiotic factors. We examined whether relative humidity (RH), air (T a ) and soil temperatures (T s ), or snow depth during...... the average number of nymphs questing during spring. Our observations suggest that RH, T s , and snow cover during the preceding months affect the questing activity of nymphal I. ricinus during their first peak of activity. Snow cover serves as an insulator between the atmosphere and soil, which not only...

  10. Ultrastructure and lectin characterization of granular salivary cells from Ixodes ricinus females

    Czech Academy of Sciences Publication Activity Database

    Vancová, Marie; Zacharovová, Klára; Grubhoffer, Libor; Nebesářová, Jana

    2006-01-01

    Roč. 92, č. 3 (2006), s. 431-440 ISSN 0022-3395 R&D Projects: GA ČR GA206/03/1323 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * salivary glands * lectin labeling Subject RIV: EE - Microbiology, Virology Impact factor: 1.300, year: 2006

  11. Ixodes ricinus and Borrelia prevalence at the Arctic Circle in Norway.

    Science.gov (United States)

    Hvidsten, Dag; Stuen, Snorre; Jenkins, Andrew; Dienus, Olaf; Olsen, Renate S; Kristiansen, Bjørn-Erik; Mehl, Reidar; Matussek, Andreas

    2014-03-01

    The distribution limit of Ixodes ricinus ticks in northwestern Europe (Brønnøy, Norway, 1° south of the Arctic Circle), has been known since the 1930s. To reconfirm this finding and extend studies in the areas adjacent to the Arctic Circle (66°33' N), ticks were collected from dogs and cats in 8 districts in northern Norway from 64°56' N to 68°48' N. We detected 549 I. ricinus, 244 (44%) of them in Brønnøy district, and 305 (range 6-87 ticks) in 7 districts in the northern part of the study area. The prevalence of Borrelia in these ticks was determined by real-time PCR. In the Brønnøy district (65°28' N, 12°12' E), 29% of the I. ricinus were Borrelia spp.-positive, and the species B. afzelii was nearly twice as prevalent as B. garinii and/or B. valaisiana. In the study area north of Brønnøy district, only 12 (4%) of the collected ticks contained Borrelia spp. In conclusion, tick occurrence and Borrelia prevalence are high in the Brønnøy district. In contrast, I. ricinus occurrence and Borrelia prevalence are low further north across the Arctic Circle in Norway. Copyright © 2013 Elsevier GmbH. All rights reserved.

  12. Substrate prediction of Ixodes ricinus salivary lipocalins differentially expressed during Borrelia afzelii infection

    Science.gov (United States)

    Valdés, James J.; Cabezas-Cruz, Alejandro; Sima, Radek; Butterill, Philip T.; Růžek, Daniel; Nuttall, Patricia A.

    2016-09-01

    Evolution has provided ticks with an arsenal of bioactive saliva molecules that counteract host defense mechanisms. This salivary pharmacopoeia enables blood-feeding while enabling pathogen transmission. High-throughput sequencing of tick salivary glands has thus become a major focus, revealing large expansion within protein encoding gene families. Among these are lipocalins, ubiquitous barrel-shaped proteins that sequester small, typically hydrophobic molecules. This study was initiated by mining the Ixodes ricinus salivary gland transcriptome for specific, uncharacterized lipocalins: three were identified. Differential expression of these I. ricinus lipocalins during feeding at distinct developmental stages and in response to Borrelia afzelii infection suggests a role in transmission of this Lyme disease spirochete. A phylogenetic analysis using 803 sequences places the three I. ricinus lipocalins with tick lipocalins that sequester monoamines, leukotrienes and fatty acids. Both structural analysis and biophysical simulations generated robust predictions showing these I. ricinus lipocalins have the potential to bind monoamines similar to other tick species previously reported. The multidisciplinary approach employed in this study characterized unique lipocalins that play a role in tick blood-feeding and transmission of the most important tick-borne pathogen in North America and Eurasia.

  13. Occurrence of multiple infections with different Borrelia burgdorferi genospecies in Danish Ixodes ricinus nymphs

    DEFF Research Database (Denmark)

    Andersen, Jean Vennestrøm; Egholm, H.; Mikkelsen, Per Jensen

    2008-01-01

    The pathogen Borrelia burgdorferi causes Lyme Borreliosis in human and animals world-wide. In Europe the pathogen is transmitted to the host by the vector Ixodes ricinus. The nymph is the primary instar for transmission to humans. We here study the infection rate of five Borrelia genospecies: B...

  14. Diversity of Ixodes ricinus tick-associated bacterial communities from different forests

    NARCIS (Netherlands)

    Overbeek, van L.S.; Gassner, F.; Lombaers-van der Plas, C.H.; Kastelein, P.; Nunes da Rocha, U.; Takken, W.

    2008-01-01

    Nymphal Ixodes ricinus ticks (n=180) were collected from three different areas in the Netherlands to investigate the effect of forest composition on tick-associated microbial communities. Sampled habitats differed in thickness of leaf litter and humus layers and vegetation associations and were

  15. The ecology of Lyme borreliosis risk : interactions between lxodes ricinus, rodents and Borrelia burgdorferi sensu lato

    NARCIS (Netherlands)

    Duijvendijk, van Gilian

    2016-01-01

    The sheep tick (Ixodes ricinus) is widespread throughout Europe and can transmit Borrelia burgdorferi sensu lato (s.l.), which can cause Lyme borreliosis and B. miyamotoi, the agent of Borrelia miyamotoi disease in humans. Borrelia afzelii is the most common

  16. Behavioural responses of Ixodes ricinus nymphs to carbon dioxide and rodent odour

    NARCIS (Netherlands)

    Duijvendijk, van G.; Gort, G.; Sprong, H.; Takken, W.

    2017-01-01

    Many haematophagous ectoparasites use carbon dioxide (CO2) and host odour to detect and locate their hosts. The tick Ixodes ricinus (Linnaeus) (Ixodida: Ixodidae) walks only small distances and quests in vegetation until it encounters a host. The differential effects of CO2 and host odour on the

  17. Prevalence and diversity of Babesia spp. in questing Ixodes ricinus ticks from Norway

    Science.gov (United States)

    2012-01-01

    Background Ixodes ricinus ticks transmit Babesia species to vertebrate hosts. Using molecular tools we were able to detect the presence of this piroplasmid in its vector. The aims of this study were to investigate the prevalence and identity of Babesia species in questing ticks collected in various areas of Norway. Methods DNA from questing l. ricinus ticks were examined with a realtime PCR for the presence of Babesia. Positive samples of tick DNA were identified to species using PCR, and sequence analysis. Results From a total of 1908 questing l. ricinus ticks, 17 (0.9%) indicated the presence of Babesia spp. after realtime-PCR screening. Ixodes ricinus harbouring Babesia spp. was detected in 9 out of 22 localities. Further molecular analyses of DNA from these positive ticks indicate the presence of Babesia venatorum, B. divergens, B. capreoli and a currently undescribed Babesia in Norwegian ticks. The most prevalent was B. venatorum found in 71% of the positive ticks. Conclusions A total of 17 out of 1908 (0.9%) ticks were positive for Babesia. Our data confirm that there are several Babesia species in ticks in Norway. Babesia venatorum was the most prevalent. This species has a zoonotic potential and may cause human babesiosis following a tick bite. PMID:22862883

  18. The role of large herbivores in Ixodes ricinus and Borrelia burgdorferi s.l. dynamics

    NARCIS (Netherlands)

    Wieren, van S.E.; Hofmeester, T.R.

    2016-01-01

    Large herbivores are the most important reproduction hosts for Ixodes ricinus, and, as such, play a major role in maintaining tick populations. As one individual deer can already feed many females during the tick season, we propose that the relationship between deer density and tick density can best

  19. Prevalence and diversity of Babesia spp. in questing Ixodes ricinus ticks from Norway

    Directory of Open Access Journals (Sweden)

    Øines Øivind

    2012-08-01

    Full Text Available Abstract Background Ixodes ricinus ticks transmit Babesia species to vertebrate hosts. Using molecular tools we were able to detect the presence of this piroplasmid in its vector. The aims of this study were to investigate the prevalence and identity of Babesia species in questing ticks collected in various areas of Norway. Methods DNA from questing l. ricinus ticks were examined with a realtime PCR for the presence of Babesia. Positive samples of tick DNA were identified to species using PCR, and sequence analysis. Results From a total of 1908 questing l. ricinus ticks, 17 (0.9% indicated the presence of Babesia spp. after realtime-PCR screening. Ixodes ricinus harbouring Babesia spp. was detected in 9 out of 22 localities. Further molecular analyses of DNA from these positive ticks indicate the presence of Babesia venatorum, B. divergens, B. capreoli and a currently undescribed Babesia in Norwegian ticks. The most prevalent was B. venatorum found in 71% of the positive ticks. Conclusions A total of 17 out of 1908 (0.9% ticks were positive for Babesia. Our data confirm that there are several Babesia species in ticks in Norway. Babesia venatorum was the most prevalent. This species has a zoonotic potential and may cause human babesiosis following a tick bite.

  20. Polyurethanes from isosorbide-based diisocyanates.

    Science.gov (United States)

    Zenner, Michael D; Xia, Ying; Chen, Jason S; Kessler, Michael R

    2013-07-01

    Benign building blocks: Stereochemically pure diisocyanates were prepared on a multigram scale from succinic anhydride and isosorbide or isomannide. Characterization of polyurethanes that were produced from these diisocyanates revealed low polydispersity, high thermal stability, and stereochemistry-dependent morphology. If biobased succinic anhydride is used, then no stoichiometric petroleum-derived reagents are required in the synthesis of these materials. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Novel metallomesogenic polyurethanes: Synthesis, characterization and properties

    Energy Technology Data Exchange (ETDEWEB)

    Senthilkumar, Natarajan, E-mail: nskumar77@yahoo.com [Production Technology Research Center, Samsung Cheil Industries, 62 Pyeongyeo-dong, Yeosu-si, JeonNam 555-210 (Korea, Republic of); Narasimhaswamy, Tanneru [Polymer Laboratory, Central Leather Research Institute, Chennai 600 020 (India); Kim, Il-Jin [Production Technology Research Center, Samsung Cheil Industries, 62 Pyeongyeo-dong, Yeosu-si, JeonNam 555-210 (Korea, Republic of)

    2012-12-01

    A series of tetradentate Schiff base metallomesogenic diols were synthesized from two simple dihydroxy benzenes. The metallomesogenic diol was constructed from three ring containing mesogen linked through ester and azomethine with terminal hydroxy group. This upon complexation with copper(II) formed metallomesogenic diol with varying terminal chain length. A series of metallomesogenic polyurethanes were synthesized using these metallomesogenic diols as chain extenders for the prepolymers based on polytetramethylene glycol (PTMG) of varying molecular weight (M{sub n} = 650, 2000) and 2,4-toluene diisocyanate (TDI), or 4,4 Prime -methylene bis(phenyl isocyanate) (MDI). The molar ratio of metallomesogenic diol and PTMG were varied in the polyurethane to find their role in liquid crystalline and mechanical properties. Extensive characterization of all metallomesogenic compounds and intermediates were carried out by FT-IR, {sup 1}H and {sup 13}C NMR, EPR, VSM, Mass (EI and FAB) and UV-visible spectroscopy. Hot stage polarizing microscope and differential scanning calorimetry were used to ensure the phase characteristics such as nature of phase, melting and clearing temperatures and phase range. The appearance of enantiotropic smectic A phases indicated high molecular polarizability of the core due to the metal ion. - Highlights: Black-Right-Pointing-Pointer Design and synthesis of metallomesogenic diols. Black-Right-Pointing-Pointer Metallomesogenic polyurethanes were prepared using these diols as chain extenders. Black-Right-Pointing-Pointer Liquid crystalline and mechanical properties were studied. Black-Right-Pointing-Pointer A square pyramidal structure for the copper(II) complexes have been proposed. Black-Right-Pointing-Pointer Polyurethanes exhibited enantiotropic smectic A phases.

  2. Conical polyurethane implants: an uplifting augmentation.

    Science.gov (United States)

    Georgeu, Garrick A; Frame, James D; Frame, James D

    2013-11-01

    Polyurethane-coated conical implants were introduced by Silimed (US distributor: Sientra, Santa Barbara, California) in 2008 and offer an alternative to round or anatomically shaped implants. By their design and volume distribution, they naturally create central volume and give a reasonable fullness to the upper pole while lifting some ptotic breasts, thus avoiding the need for classical mastopexy. The authors discuss the advantages of conical implants as an alternative to conventional silicone implants for women with breast ptosis. In the 2-year period between December 2010 and December 2012, a consecutive series of 302 women underwent implant-based breast surgery procedures (236 primary augmentations, 59 revisions, and 7 mastopexy-augmentations) with conical polyurethane devices. Implant volumes ranged from 225 to 560 cc, with low- to medium-profile devices predominating. No extra-high-profile implants were used. Only 1 patient had a drain inserted on completion of a revision augmentation. There were no infections (0%) and no wound dehiscence (0%). Four cases required reoperation (1.3%). Patient satisfaction scores were universally high (average, 9.94/10). There have been no capsular contractures to date, but follow-up is short. The modern conical, polyurethane implant has many advantages over the conventional round or anatomically shaped implants and offers patients an ideal compromise between volume, natural upper pole fullness, and a lift without mastopexy scars.

  3. Synthesis and surface properties of fluorinated polyurethanes

    Energy Technology Data Exchange (ETDEWEB)

    Kim, H.J. [Kongju National University, Kongju (Korea)

    2001-01-01

    Fluorinated polyurethane elastomers were synthesized by two step polyaddition of a perfluorinated polyether diol (trade name of Fomblin ZDOL{sup R}) and diisocyanates such as 4,4' -diphenyl methane diisocyanate (MDI) and toluene 2,4-diisocyanate (TDI). In order to control the Fomblin moiety of the soft segment in the synthesized elastomers to 10{approx}50%, polyether type polyols such as polypropylene glycol (PPG) and polytetramethylene glycol (PTMG) were mixed during the Polymerization reaction. Ethylene diamine or 1,4-butane diol was used as chain extenders. The structure and average molecular weight of the produced polyurethanes were confirmed by using FT-IR, 'H-NMR, DSC, and GPC. The surface properties were analyzed by using X-ray photoelectron spectroscopy (XPS) and contact angle meter. From the results of the surface analysis it was concluded that the fluorine groups were localized on the surface rather than the inside of the polyurethane films. (author). 10 refs., 5 tabs., 8 figs.

  4. Thermoplastic Polyurethanes with Isosorbide Chain Extender

    Energy Technology Data Exchange (ETDEWEB)

    Javni, Ivan; Bilic, Olivera; Bilic, Nikola; Petrovic, Zoran; Eastwood, Eric; Zhang, Fan; Ilavsky, Jan

    2015-12-15

    Isosorbide, a renewable diol derived from starch, was used alone or in combination with butane diol (BD) as the chain extender in two series of thermoplastic polyurethanes (TPU) with 50 and 70% polytetramethylene ether glycol (PTMEG) soft segment concentration (SSC), respectively. In the synthesized TPUs, the hard segment composition was systematically varied in both series following BD/isosorbide molar ratios of 100 : 0; 75 : 25; 50 : 50; 25 : 75, and 0 : 100 to examine in detail the effect of chain extenders on properties of segmented polyurethane elastomers with different morphologies. We found that polyurethanes with 50% SSC were hard elastomers with Shore D hardness of around 50, which is consistent with assumed co-continuous morphology. Polymers with 70% SSC displayed lower Shore A hardness of 74–79 (Shore D around 25) as a result of globular hard domains dispersed in the soft matrix. Insertion of isosorbide increased rigidity, melting point and glass transition temperature of hard segments and tensile strength of elastomers with 50% SSC. These effects were weaker or non-existent in 70% SSC series due to the short hard segments and low content of isosorbide. We also found that the thermal stability was lowered by increasing isosorbide content in both series.

  5. Removal of Basic Dyes from Aqueous Solution by Chloroacetic Acid Modified Ferula Communis Based Adsorbent: Thermodynamic and Kinetic Studies

    OpenAIRE

    Salih, Shameran Jamal

    2014-01-01

    ABSTRACT: This research aimed to propose an alternative cheap and abundantly available adsorbent (Ferula communis) for the removal of basic dyes from aqueous solutions. Chloroacetic acid modified Ferula communis (MFC) shows a great potential for the removal of basic red 9 dyes (BR9) from aqueous solution with the effects of solution capacity under pH, temperature, contact time, adsorbent dosage, and initial dye concentration condition on BR9 removal were examined. The adsorption equilibrium d...

  6. Determination of the parameters of the parasitic stage in Ixodes ricinus females.

    Science.gov (United States)

    Bartosik, Katarzyna; Buczek, Alicja

    2013-01-01

    Ixodes ricinus is a tick commonly found on human and animals and of great medical and veterinary importance. The aim of the study was to determine the parameters of different stages of feeding in Ixodes ricinus females. 229 Ixodes ricinus females were collected from 102 animals--roe deer (Capreolus capreolus) and red deer (Cervus elaphus) culled in southern and south-eastern Poland in 2002. Each female was weighed and the length and width of the scutum as well as the width of the idiosoma were measured. 20 tick females were collected from vegetation growing in the region and analysed in order to compare the changes in the parameters studied to those exhibited by unengorged specimens. Three groups were identified on the basis of female body weight; group I consisted of 52 females in feeding phase I with body weight in the range of 0.0003-0.0043 g (mean 0.0019 g), group II comprised 150 females in feeding phase II with weight in the range of 0.0017-0.3075 g (mean 0.0263 g), and group III consisted of 27 females in feeding phase III with weight in the range of 0.0904-0.3122 g (mean 0.1913 g). Indices characterizing the various feeding phases, such as body index, scutal index, alloscutal index, growth index, engorgement index I and II, and the relative body mass index, were determined. The investigations demonstrated that the values of the morphometric traits in feeding phase I, II and III differe in I. ricinus females. The values of the morphometric features and indices can be helpful in identification of the parasitic stage of I. ricinus females removed from host skin, and assessment of the risk of infection of the host with various parasites injected with tick saliva at the respective feeding phases.

  7. Metagenomic profile of the bacterial communities associated with Ixodes ricinus ticks.

    Directory of Open Access Journals (Sweden)

    Giovanna Carpi

    Full Text Available Assessment of the microbial diversity residing in arthropod vectors of medical importance is crucial for monitoring endemic infections, for surveillance of newly emerging zoonotic pathogens, and for unraveling the associated bacteria within its host. The tick Ixodes ricinus is recognized as the primary European vector of disease-causing bacteria in humans. Despite I. ricinus being of great public health relevance, its microbial communities remain largely unexplored to date. Here we evaluate the pathogen-load and the microbiome in single adult I. ricinus by using 454- and Illumina-based metagenomic approaches. Genomic DNA-derived sequences were taxonomically profiled using a computational approach based on the BWA algorithm, allowing for the identification of known tick-borne pathogens at the strain level and the putative tick core microbiome. Additionally, we assessed and compared the bacterial taxonomic profile in nymphal and adult I. ricinus pools collected from two distinct geographic regions in Northern Italy by means of V6-16S rRNA amplicon pyrosequencing and community based ecological analysis. A total of 108 genera belonging to representatives of all bacterial phyla were detected and a rapid qualitative assessment for pathogenic bacteria, such as Borrelia, Rickettsia and Candidatus Neoehrlichia, and for other bacteria with mutualistic relationship or undetermined function, such as Wolbachia and Rickettsiella, was possible. Interestingly, the ecological analysis revealed that the bacterial community structure differed between the examined geographic regions and tick life stages. This finding suggests that the environmental context (abiotic and biotic factors and host-selection behaviors affect their microbiome.Our data provide the most complete picture to date of the bacterial communities present within I. ricinus under natural conditions by using high-throughput sequencing technologies. This study further demonstrates a novel detection

  8. Skeletal myotube formation enhanced by electrospun polyurethane carbon nanotube scaffolds

    Science.gov (United States)

    Sirivisoot, Sirinrath; Harrison, Benjamin S

    2011-01-01

    Background This study examined the effects of electrically conductive materials made from electrospun single- or multiwalled carbon nanotubes with polyurethane to promote myoblast differentiation into myotubes in the presence and absence of electrical stimulation. Methods and results After electrical stimulation, the number of multinucleated myotubes on the electrospun polyurethane carbon nanotube scaffolds was significantly larger than that on nonconductive electrospun polyurethane scaffolds (5% and 10% w/v polyurethane). In the absence of electrical stimulation, myoblasts also differentiated on the electrospun polyurethane carbon nanotube scaffolds, as evidenced by expression of Myf-5 and myosin heavy chains. The myotube number and length were significantly greater on the electrospun carbon nanotubes with 10% w/v polyurethane than on those with 5% w/v polyurethane. The results suggest that, in the absence of electrical stimulation, skeletal myotube formation is dependent on the morphology of the electrospun scaffolds, while with electrical stimulation it is dependent on the electrical conductivity of the scaffolds. Conclusion This study indicates that electrospun polyurethane carbon nanotubes can be used to modulate skeletal myotube formation with or without application of electrical stimulation. PMID:22072883

  9. Molecular simulation of fibronectin adsorption onto polyurethane surfaces

    Science.gov (United States)

    Polyethylene glycol-based polyurethanes have been widely used in biomedical applications, however are prone to swelling. A natural polyol, castor oil can be incorporated into these polyurethanes to control the degree of the swelling, which alters mechanical properties and protein adsorption characte...

  10. 78 FR 55641 - Polyurethane-Type Polymers; Tolerance Exemption

    Science.gov (United States)

    2013-09-11

    ... AGENCY 40 CFR Part 180 Polyurethane-Type Polymers; Tolerance Exemption AGENCY: Environmental Protection... of a tolerance for residues of polymers produced by the reaction of either 1,6-hexanediisocyanate; 2..., octadecanol, and octadec-9-enol (also known as polyurethane-type polymers), when used as an inert ingredient...

  11. Optimization of polyurethane foam cube in enhancing the ...

    African Journals Online (AJOL)

    Attachment of microalgae biomass to polyurethane foam material is believed could reduce the cost and time needed for harvesting process in making it reliable to be used in industry for biodiesel production. This paper aim to optimize the usage of polyurethane for higher attachment of microalgae biomass yield in term of it ...

  12. Functionally active silicones as modifiers of polyurethane textile ...

    African Journals Online (AJOL)

    Modification of application and service properties of polyurethane textile coatings and cast polyurethane films using polysiloxanes (functionally active silicones) have been studied. Experiments were conducted to investigate the effect of silicon additives on processing, adhesion, water repellence, and resistance to tea and ...

  13. Fluorinated Polyurethane Scaffolds for 19F Magnetic Resonance Imaging

    NARCIS (Netherlands)

    Lammers, Twan; Mertens, Marianne E.; Schuster, Philipp; Rahimi, Khosrow; Shi, Yang; Schulz, Volkmar; Kuehne, Alexander J.C.; Jockenhoevel, Stefan; Kiessling, Fabian

    2017-01-01

    Researchers used fluorinated polyurethane scaffolds for 19F magnetic resonance imaging. They generated a novel fluorinated polymer based on thermoplastic polyurethane (19F -TPU) which possesses distinct properties rendering it suitable for fluorine-based MRI. The 19F -TPU is synthesized from a

  14. A kinetic investigation of polyurethane polymerization for reactive extrusion purposes

    NARCIS (Netherlands)

    Verhoeven, VWA; Padsalgikar, AD; Ganzeveld, KJ; Janssen, LPBM

    2006-01-01

    The effects of the reaction conditions on the kinetics of two different polyurethane systems were investigated. To do so, three different kinetic methods were compared: adiabatic temperature rise (ATR), measurement kneader, and high-temperature measurements. For the first polyurethane system,

  15. Dominance of Dermacentor reticulatus over Ixodes ricinus (Ixodidae) on livestock, companion animals and wild ruminants in eastern and central Poland

    OpenAIRE

    Mierzejewska, Ewa J.; Welc-Faleciak, Renata; Karbowiak, Grzegorz; Kowalec, Maciej; Behnke, Jerzy M.; Bajer, Anna

    2015-01-01

    The most common tick species parasitizing animals in Poland are Ixodes ricinus and Dermacentor reticulatus. These tick species differ in their distribution, habitats, seasonal activity and host specificity. Ixodes ricinus is the most prevalent and widely distributed, whereas the range of D. reticulatus is limited to eastern and central parts of the country with several new foci in the middle-west and the west. However, as in many central European countries, the range of D. reticulatus is expa...

  16. Extracting Extensor Digitorum Communis Activation Patterns using High-Density Surface Electromyography

    Directory of Open Access Journals (Sweden)

    Xiaogang eHu

    2015-10-01

    Full Text Available The extensor digitorum communis muscle plays an important role in hand dexterity during object manipulations. This multi-tendinous muscle is believed to be controlled through separate motoneuron pools, thereby forming different compartments that control individual digits. However, due to the complex anatomical variations across individuals and the flexibility of neural control strategies, the spatial activation patterns of the extensor digitorum communis compartments during individual finger extension have not been fully tracked under different task conditions.The objective of this study was to quantify the global spatial activation patterns of the extensor digitorum communis using high-density (7×9 surface electromyogram (EMG recordings. The muscle activation map (based on the root mean square of the EMG was constructed when subjects performed individual four finger extensions at the metacarpophalangeal joint, at different effort levels and under different finger constraints (static and dynamic. Our results revealed distinct activation patterns during individual finger extensions, especially between index and middle finger extensions, although the activation between ring and little finger extensions showed strong covariance. The activation map was relatively consistent at different muscle contraction levels and for different finger constraint conditions. We also found that distinct activation patterns were more discernible in the proximal-distal direction than in the radial-ulnar direction. The global spatial activation map utilizing surface grid EMG of the extensor digitorum communis muscle provides information for localizing individual compartments of the extensor muscle during finger extensions. This is of potential value for identifying more selective control input for assistive devices. Such information can also provide a basis for understanding hand impairment in individuals with neural disorders.

  17. Chemical Grouting Lost-Circulation Zones with Polyurethane Foam

    Energy Technology Data Exchange (ETDEWEB)

    Mansure, A.J.; Westmoreland, J.J.

    1999-07-12

    Sandia National Laboratories is developing polyurethane foam as a chemical grout for lost circulation zones. In past work polyurethane foam was tried with limited success in laboratory tests and GDO sponsored field tests. Goals were that the foam expanded significantly and harden to a chillable firmness quickly. Since that earlier work there have been improvements in polyurethane chemistry and the causes of the failures of previous tests have been identified. Recent success in applying pure solution grouts (proper classification of polyurethane--Naudts) in boreholes encourages reevaluating its use to control lost circulation. These successes include conformance control in the oil patch (e.g. Ng) and darn remediation projects (Bruce et al.). In civil engineering, polyurethane is becoming the material of choice for sealing boreholes with large voids and high inflows, conditions associated with the worst lost circulation problems. Demonstration of a delivery mechanism is yet to be done in a geothermal borehole.

  18. Evaluation of antibacterial effect of Myrtus communis against Acinetobacter baumannii clinical strains

    Directory of Open Access Journals (Sweden)

    Venous Akhavan

    2016-09-01

    Full Text Available Because of inappropriate use of antibiotics and prevalence of resistant bacteria, there is urgent need for antibacterial drugs that have fewer side effects than antibiotics. Myrtus communis is a medicinal plant which had many uses in traditional medicine. In this study, ethanol leave extract of this plant is tested on Acinetobacter baumannii. In the case of antimicrobial evaluation of plants, one of the effecting factors on effectiveness of the microbial inhibition is extraction techniques. In the presents study, the antibacterial activity of the Ethanol, Methanol, and Ethyl acetate extracts of M. communis plant was evaluated at seven different concentrations by broth microdilution method. The results of this study showed that the antimicrobial effect of M. communis extract is concentration dependent. Different extracts were obtained by the maceration method. Extracts of the plant exhibited antibacterial activity at varied levels against A. baumannii. Obtained results from our antibacterial experiments showed that all extracts have anti-bacterial activity against tested bacterial isolates According to the results, the ethyl acetate extracted fraction showed the highest level of activity at a MIC 400 mg/ml for A. baumannii. The results of this study indicate that, different extracts had growth inhibitory effect on A. baumannii. Therefore this plant has the potential to be evaluated as an alternative or adjunct to antibiotics to treat Acinetobacter infections.

  19. Antifungal and Herbicidal Effects of Fruit Essential Oils of Four Myrtus communis Genotypes.

    Science.gov (United States)

    Kordali, Saban; Usanmaz, Ayse; Cakir, Ahmet; Komaki, Amanmohammad; Ercisli, Sezai

    2016-01-01

    The chemical composition of the essential oils isolated by hydrodistillation from the fruits of four selected Myrtus communis L. genotypes from Turkey was characterized by GC-FID and GC/MS analyses. 1,8-Cineole (29.20-31.40%), linalool (15.67-19.13%), α-terpineol (8.40-18.43%), α-pinene (6.04-20.71%), and geranyl acetate (3.98-7.54%) were found to be the major constituents of the fruit essential oils of all M. communis genotypes investigated. The oils were characterized by high amounts of oxygenated monoterpenes, representing 73.02-83.83% of the total oil compositions. The results of the fungal growth inhibition assays showed that the oils inhibited the growth of 19 phytopathogenic fungi. However, their antifungal activity was generally lower than that of the commercial pesticide benomyl. The herbicidal effects of the oils on the seed germination and seedling growth of Amaranthus retroflexus L., Chenopodium album L., Cirsium arvense (L.) Scop., Lactuca serriola L., and Rumex crispus L. were also determined. The oils completely or partly inhibited the seed germinations and seedling growths of the plants. The findings of the present study suggest that the M. communis essential oils might have potential to be used as natural herbicides as well as fungicides. Copyright © 2016 Verlag Helvetica Chimica Acta AG, Zürich.

  20. Assessment of MALDI-TOF MS biotyping for Borrelia burgdorferi sl detection in Ixodes ricinus

    Science.gov (United States)

    Boyer, Pierre H.; Boulanger, Nathalie; Nebbak, Amira; Collin, Elodie; Jaulhac, Benoit; Almeras, Lionel

    2017-01-01

    Matrix Assisted Laser Desorption/Ionization Time-of-Flight Mass Spectrometry (MALDI-TOF MS) has been demonstrated to be useful for tick identification at the species level. More recently, this tool has been successfully applied for the detection of bacterial pathogens directly in tick vectors. The present work has assessed the detection of Borrelia burgdorferi sensu lato in Ixodes ricinus tick vector by MALDI-TOF MS. To this aim, experimental infection model of I. ricinus ticks by B. afzelii was carried out and specimens collected in the field were also included in the study. Borrelia infectious status of I. ricinus ticks was molecularly controlled using half-idiosome to classify specimens. Among the 39 ticks engorged on infected mice, 14 were confirmed to be infected by B. afzelii. For field collection, 14.8% (n = 12/81) I. ricinus ticks were validated molecularly as infected by B. burgdorferi sl. To determine the body part allowing the detection of MS protein profile changes between non-infected and B. afzelii infected specimens, ticks were dissected in three compartments (i.e. 4 legs, capitulum and half-idiosome) prior to MS analysis. Highly reproducible MS spectra were obtained for I. ricinus ticks according to the compartment tested and their infectious status. However, no MS profile change was found when paired body part comparison between non-infected and B. afzelii infected specimens was made. Statistical analyses did not succeed to discover, per body part, specific MS peaks distinguishing Borrelia-infected from non-infected ticks whatever their origins, laboratory reared or field collected. Despite the unsuccessful of MALDI-TOF MS to classify tick specimens according to their B. afzelii infectious status, this proteomic tool remains a promising method for rapid, economic and accurate identification of tick species. Moreover, the singularity of MS spectra between legs and half-idiosome of I. ricinus could be used to reinforce this proteomic identification

  1. Development of segmented polyurethane elastomers with low iodine content exhibiting radiopacity and blood compatibility.

    Science.gov (United States)

    Dawlee, S; Jayabalan, Muthu

    2011-10-01

    Biofunctionally active and inherently radiopaque polymers are the emerging need for biomedical applications. Novel segmented polyurethane elastomer with inherent radiopacity was prepared using aliphatic chain extender 2,3-diiodo-2-butene-1,4-diol, polyol polytetramethylene glycol and 4,4'-methylenebis(phenyl isocyanate) (MDI) for blood compatible applications. Aliphatic polyurethane was also prepared using hexamethylene diisocyanate for comparison. X-ray analysis of the polyurethanes revealed good radiopacity even at a relatively low concentration of 3% iodine in aromatic polyurethane and 10% in aliphatic polyurethane. The polyurethanes also possessed excellent thermal stability. MDI-based polyurethane showed considerably higher tensile strength than the analogous HDI-based polyurethane. MDI-based aromatic polyurethane exhibited a dynamic surface morphology in aqueous medium, resulting in the segregation of hydrophilic domains which was more conducive to anti-thrombogenic properties. The polyurethane was cytocompatible with L929 fibroblast cells, non-hemolytic, and possessed good blood compatibility.

  2. Mechanical Characterization of Rigid Polyurethane Foams

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Wei-Yang [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Mechanics of Materials

    2014-12-01

    Foam materials are used to protect sensitive components from impact loading. In order to predict and simulate the foam performance under various loading conditions, a validated foam model is needed and the mechanical properties of foams need to be characterized. Uniaxial compression and tension tests were conducted for different densities of foams under various temperatures and loading rates. Crush stress, tensile strength, and elastic modulus were obtained. A newly developed confined compression experiment provided data for investigating the foam flow direction. A biaxial tension experiment was also developed to explore the damage surface of a rigid polyurethane foam.

  3. Diapause in ticks of the medically important Ixodes ricinus species complex

    Science.gov (United States)

    Gray, Jeremy S.; Kahl, Olaf; Lane, Robert S.; Levin, Michael L.; Tsao, Jean I.

    2017-01-01

    Four members of the Ixodes ricinus species complex, Ixodes pacificus, Ixodes persulcatus, Ixodes ricinus and Ixodes scapularis, have, between them, a worldwide distribution within the northern hemisphere. They are responsible for the transmission of several animal and human pathogens, including the causal agents of Lyme borreliosis, tick-borne encephalitis, human granulocytic anaplasmosis and human babesiosis. Despite the importance of these ticks as vectors, the knowledge and understanding of the role that diapause plays in their complex life cycles are confused and incomplete. In view of the continuing geographic spread of these tick species, as well as the effects of climate change on vector-borne diseases, it is timely encourage research on diapause phenomena to improve understanding of their biology and of pathogen transmission dynamics. In our review we seek to clarify thinking on the topic and to address gaps in our knowledge that require the attention of researchers. PMID:27263092

  4. Effect of landscape features on the relationship between Ixodes ricinus ticks and their small mammal hosts

    OpenAIRE

    Bastian, Suzanne; Agoulon, Albert; Bouju, Agnès; Durand, Axelle; Faille, Frédéric; Lebert, Isabelle; Rantier, Yann; Plantard, Olivier; Butet, Alain

    2016-01-01

    Background The consequences of land use changes are among the most cited causes of emerging infectious diseases because they can modify the ecology and transmission of pathogens. This is particularly true for vector-borne diseases which depend on abiotic (e.g. climate) and biotic conditions (i.e. hosts and vectors). In this study, we investigated how landscape features affect the abundances of small mammals and Ixodes ricinus ticks, and how they influence their relationship. Methods From 2012...

  5. De novo Ixodes ricinus salivary gland transcriptome analysis using two next-generation sequencing methodologies

    Science.gov (United States)

    Schwarz, Alexandra; von Reumont, Björn M.; Erhart, Jan; Chagas, Andrezza C.; Ribeiro, José M. C.; Kotsyfakis, Michalis

    2013-01-01

    Tick salivary gland (SG) proteins possess powerful pharmacologic properties that facilitate tick feeding and pathogen transmission. For the first time, SG transcriptomes of Ixodes ricinus, an important disease vector for humans and animals, were analyzed using next-generation sequencing. SGs were collected from different tick life stages fed on various animal species, including cofeeding of nymphs and adults on the same host. Four cDNA samples were sequenced, discriminating tick SG transcriptomes of early- and late-feeding nymphs or adults. In total, 441,381,454 pyrosequencing reads and 67,703,183 Illumina reads were assembled into 272,220 contigs, of which 34,560 extensively annotated coding sequences are disclosed; 8686 coding sequences were submitted to GenBank. Overall, 13% of contigs were classified as secreted proteins that showed significant differences in the transcript representation among the 4 SG samples, including high numbers of sample-specific transcripts. Detailed phylogenetic reconstructions of two relatively abundant SG-secreted protein families demonstrated how this study improves our understanding of the molecular evolution of hematophagy in arthropods. Our data significantly increase the available genomic information for I. ricinus and form a solid basis for future tick genome/transcriptome assemblies and the functional analysis of effectors that mediate the feeding physiology and parasite-vector interaction of I. ricinus.—Schwarz, A., von Reumont, B.M., Erhart, J., Chagas, A.C., Ribeiro, J.M.C., Kotsyfakis, M. De novo Ixodes ricinus salivary gland transcriptome analysis using two next-generation sequencing methodologies. PMID:23964076

  6. Antibiotic treatment of the hard tick Ixodes ricinus: Influence on Midichloria mitochondrii load following blood meal.

    Science.gov (United States)

    Ninio, Camille; Plantard, Olivier; Serra, Valentina; Pollera, Claudia; Ferrari, Nicola; Cafiso, Alessandra; Sassera, Davide; Bazzocchi, Chiara

    2015-07-01

    Midichloria mitochondrii is the most prevalent symbiont of the hard tick Ixodes ricinus, present in 100% of eggs and adult females of wild ticks. This bacterium is intracellular, and is the only known symbiont able to invade the mitochondria of the host cells. However, the role that M. mitochondrii plays in the host metabolism has yet to be elucidated. Multiple lines of evidence indicate the possibility of transmission of this bacterium to the vertebrate host during the tick blood meal. In order to investigate the role of M. mitochondrii in the biology of the tick host, we performed an antibiotic treatment on Ixodes ricinus individuals, with the aim of reducing/eliminating the symbiont, and to potentially observe the dynamic of bacterial infection in the tick host. We microinjected engorged adult females of I. ricinus with tetracycline, and we allowed the resulting larvae to feed on gerbils treated with the same antibiotic. The amount of M. mitochondrii was evaluated at different stages of the experiment using molecular techniques. In addition we evaluated the presence/absence of the symbiont DNA in the blood of gerbils used for the larval feeding. The performed treatments did not allow to eliminate the symbiont population from the host tick, however it allowed to reduce the multiplication that occurs after the larval blood meal. These results open the way for future experiments, using different antibiotic molecules, different administration methods and antibiotic administration on subsequent tick stages, to fulfill the goal of eliminating M. mitochondrii from the host I. ricinus, a major step in our understanding of the impact of this bacterium on ticks. Copyright © 2015 Elsevier GmbH. All rights reserved.

  7. Electrospun polyurethane membranes for Tissue Engineering applications.

    Science.gov (United States)

    Gabriel, Laís P; Rodrigues, Ana Amélia; Macedo, Milton; Jardini, André L; Maciel Filho, Rubens

    2017-03-01

    Tissue Engineering proposes, among other things, tissue regeneration using scaffolds integrated with biological molecules, growth factors or cells for such regeneration. In this research, polyurethane membranes were prepared using the electrospinning technique in order to obtain membranes to be applied in Tissue Engineering, such as epithelial, drug delivery or cardiac applications. The influence of fibers on the structure and morphology of the membranes was studied using scanning electron microscopy (SEM), the structure was evaluated by Fourier transform infrared spectroscopy (FT-IR), and the thermal stability was analyzed by thermogravimetry analysis (TGA). In vitro cells attachment and proliferation was investigated by SEM, and in vitro cell viability was studied by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assays and Live/Dead® assays. It was found that the membranes present an homogeneous morphology, high porosity, high surface area/volume ratio, it was also observed a random fiber network. The thermal analysis showed that the membrane degradation started at 254°C. In vitro evaluation of fibroblasts cells showed that fibroblasts spread over the membrane surface after 24, 48 and 72h of culture. This study supports the investigation of electrospun polyurethane membranes as biocompatible scaffolds for Tissue Engineering applications and provides some guidelines for improved biomaterials with desired properties. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. Castor Oil Based Polyurethanes: Synthesis and Characterization

    Science.gov (United States)

    Macalino, AD; Salen, VA; Reyes, LQ

    2017-09-01

    In this study, polyurethanes based on castor oil and 1,6-hexamethylene diisocyanate (HMDI) were synthesized with varying weight ratio of the castor oil and HMDI. The formation of urethane linkages was verified through the use of a fourier transform infrared spectroscopy (FTIR). The hydrophilicity of the films was evaluated through the use of a contact angle meter and it was found that the contact angle of all the films were below 90 degrees which confirms their hydrophilicity. The thermal stability of the PU films were studies through the use of a thermal gravimetric analyzer and found that all of the polyurethane films exhibited two weight loss events at elevated temperatures wherein the first weight loss event was observed to occur at 285°C to 384°C while the second weight loss event was observed at around 521°C to 551°C. The hardness, elastic modulus, and tensile elongation of the PU films were determined by using a universal testing machine (UTM) where it was found out that the hardness and the elastic modulus of the film is directly proportional with HMDI loading while the tensile elongation is inversely proportional to it. Lastly, it was known through the swelling studies of the PU films that it does not swell, this is due to the presence of unreacted triglycerides in the material, which prevents water from permeating to the films.

  9. Vector competence of the tick Ixodes ricinus for transmission of Bartonella birtlesii.

    Directory of Open Access Journals (Sweden)

    Caroline Reis

    Full Text Available Bartonella spp. are facultative intracellular vector-borne bacteria associated with several emerging diseases in humans and animals all over the world. The potential for involvement of ticks in transmission of Bartonella spp. has been heartily debated for many years. However, most of the data supporting bartonellae transmission by ticks come from molecular and serological epidemiological surveys in humans and animals providing only indirect evidences without a direct proof of tick vector competence for transmission of bartonellae. We used a murine model to assess the vector competence of Ixodes ricinus for Bartonella birtlesii. Larval and nymphal I. ricinus were fed on a B. birtlesii-infected mouse. The nymphs successfully transmitted B. birtlesii to naïve mice as bacteria were recovered from both the mouse blood and liver at seven and 16 days after tick bites. The female adults successfully emitted the bacteria into uninfected blood after three or more days of tick attachment, when fed via membrane feeding system. Histochemical staining showed the presence of bacteria in salivary glands and muscle tissues of partially engorged adult ticks, which had molted from the infected nymphs. These results confirm the vector competence of I. ricinus for B. birtlesii and represent the first in vivo demonstration of a Bartonella sp. transmission by ticks. Consequently, bartonelloses should be now included in the differential diagnosis for patients exposed to tick bites.

  10. Low prevalence of Borrelia bavariensis in Ixodes ricinus ticks in southeastern Austria.

    Science.gov (United States)

    Glatz, Martin; Muellegger, Robert R; Hizo-Teufel, Cecilia; Fingerle, Volker

    2014-10-01

    Borrelia bavariensis was recently described as a distinct genospecies among the B. burgdorferi sensu lato complex. The prevalence of B. bavariensis in Austria, a highly endemic area for tick-transmitted pathogens, is scarcely characterized. To investigate the prevalence of B. bavariensis in Ixodes ricinus ticks we reevaluated the results of a study conducted in 518 ticks from southeastern Austria collected in 2002 and 2003. The presence of B. burgdorferi s.l.-specific DNA in ticks was analyzed by a PCR for the outer surface protein A (ospA) gene. Borrelia species were differentiated by restriction fragment length polymorphism (RFLP) analysis, and samples positive for B. bavariensis were further analyzed by multilocus sequence analysis. Two of 133 (1.5%) B. burgdorferi s.l.-positive I. ricinus ticks were infected with B. bavariensis. Both specimens were coinfected with the OspA serotype 5 of B. garinii. Borrelia bavariensis is present; however, seem to be rare in I. ricinus ticks in southeastern Austria. Copyright © 2014 Elsevier GmbH. All rights reserved.

  11. Arsenophonus nasoniae and Rickettsiae Infection of Ixodes ricinus Due to Parasitic Wasp Ixodiphagus hookeri.

    Science.gov (United States)

    Bohacsova, Monika; Mediannikov, Oleg; Kazimirova, Maria; Raoult, Didier; Sekeyova, Zuzana

    2016-01-01

    Arsenophonus nasoniae, a male-killing endosymbiont of chalcid wasps, was recently detected in several hard tick species. Following the hypothesis that its presence in ticks may not be linked to the direct occurrence of bacteria in tick's organs, we identified A. nasoniae in wasps emerging from parasitised nymphs. We confirmed that 28.1% of Ixodiphagus hookeri wasps parasitizing Ixodes ricinus ticks were infected by A. nasoniae. Moreover, in examined I. ricinus nymphs, A. nasoniae was detected only in those, which were parasitized by the wasp. However, in part of the adult wasps as well as in some ticks that contained wasp's DNA, we did not confirm A. nasoniae. We also found, that in spite of reported male-killing, some newly emerged adult wasp males were also infected by A. nasoniae. Additionally, we amplified the DNA of Rickettsia helvetica and Rickettsia monacensis (known to be Ixodes ricinus-associated bacteria) in adult parasitoid wasps. This may be related either with the digested bacterial DNA in wasp body lumen or with a role of wasps in circulation of rickettsiae among tick vectors.

  12. Repellent efficacy of DEET, Icaridin, and EBAAP against Ixodes ricinus and Ixodes scapularis nymphs (Acari, Ixodidae).

    Science.gov (United States)

    Büchel, Kerstin; Bendin, Juliane; Gharbi, Amina; Rahlenbeck, Sibylle; Dautel, Hans

    2015-06-01

    Repellent efficacy of 10% EBAAP (3-[N-butyl-N-acetyl]-aminopropionic acid, ethyl ester) and 10% Icaridin ((2-(2-hydroxyethyl)-1-piperidinecarboxylic acid 1-methylpropyl ester)) were evaluated against 20% DEET (N,N-diethyl-3-methylbenzamide) in human subject trials against ticks. Responses of host-seeking nymphs of the European castor bean tick (Ixodes ricinus L.; Acari: Ixodidae) and the North American blacklegged tick (I. scapularis Say; Acari: Ixodidae) were compared. Tests were carried out according to the US-EPA standard protocol with ethanolic solutions of the active ingredients of repellents being applied to the forearm of 10 volunteers. The upward movement of ticks was monitored until repellent failure taking up to 12.5 h. Application of 20% DEET resulted in median complete protection times (CPT; Kaplan-Meier median) between 4 and 4.5 h, while 10% EBAAP yielded CPTs of 3.5-4h. No significant differences were found between the efficacies of two repellents nor between the two species tested. The median of the CPT of a 10% Icaridin solution was 5h in nymphs of I. scapularis, but 8h in those of I. ricinus (PIxodes ticks with Icaridin demonstrating particularly promising results against I. ricinus. Future research should investigate whether similar results occur when adult Ixodes ticks or other tick species are tested. Copyright © 2015 Elsevier GmbH. All rights reserved.

  13. Prevalence and phylogenetic analysis of Babesia spp. in Ixodes ricinus and Ixodes persulcatus ticks in Latvia.

    Science.gov (United States)

    Capligina, Valentina; Berzina, Inese; Bormane, Antra; Salmane, Ineta; Vilks, Karlis; Kazarina, Alisa; Bandere, Dace; Baumanis, Viesturs; Ranka, Renate

    2016-03-01

    Babesia spp. are tick-borne protozoan parasites that have been reported in many European countries and are considered to be emerging pathogens. Several Babesia spp. have been identified in ticks in Latvia. Recently, canine babesiosis cases were diagnosed for the first time in Latvia; therefore, continued studies on the prevalence and occurrence of new species are warranted. In the present study, questing tick samples collected in 2005-2007 were screened for the presence of Babesia spp.; in total, 432 Ixodes ricinus and 693 Ixodes persulcatus ticks were analyzed. Babesia spp. were detected in 1.4% of the I. ricinus ticks and in 1.9% of I. persulcatus ticks. Sequencing revealed that ixodid ticks in Latvia contained Babesia microti, Babesia capreoli, and Babesia venatorum. Babesia microti was the most prevalent species, accounting for 58% of all positive samples; moreover, two distinct B. microti genotypes were identified. Phylogenetic analysis of the full-length 18S rRNA gene of two B. capreoli/B. divergens isolates indicated a closer relationship to the B. capreoli clade than B. divergens. This is the first report of B. venatorum in I. persulcatus ticks in Latvia. Our results suggest that both I. ricinus and I. persulcatus ticks play important roles in the epidemiology of these zoonotic pathogens in Latvia.

  14. Arsenophonus nasoniae and Rickettsiae Infection of Ixodes ricinus Due to Parasitic Wasp Ixodiphagus hookeri.

    Directory of Open Access Journals (Sweden)

    Monika Bohacsova

    Full Text Available Arsenophonus nasoniae, a male-killing endosymbiont of chalcid wasps, was recently detected in several hard tick species. Following the hypothesis that its presence in ticks may not be linked to the direct occurrence of bacteria in tick's organs, we identified A. nasoniae in wasps emerging from parasitised nymphs. We confirmed that 28.1% of Ixodiphagus hookeri wasps parasitizing Ixodes ricinus ticks were infected by A. nasoniae. Moreover, in examined I. ricinus nymphs, A. nasoniae was detected only in those, which were parasitized by the wasp. However, in part of the adult wasps as well as in some ticks that contained wasp's DNA, we did not confirm A. nasoniae. We also found, that in spite of reported male-killing, some newly emerged adult wasp males were also infected by A. nasoniae. Additionally, we amplified the DNA of Rickettsia helvetica and Rickettsia monacensis (known to be Ixodes ricinus-associated bacteria in adult parasitoid wasps. This may be related either with the digested bacterial DNA in wasp body lumen or with a role of wasps in circulation of rickettsiae among tick vectors.

  15. Molecular detecting of piroplasms in feeding and questing Ixodes ricinus ticks

    Science.gov (United States)

    Adamska, Małgorzata; Skotarczak, Bogumiła

    The purpose of this study was to detect piroplasms, which are pathogens of veterinary and zoonotic importance in ticks, that were collected from ponies and field vegetation and to determine the role of Shetland ponies as potential reservoir hosts for piroplasms. A total of 1737 feeding and 371 questing Ixodes ricinus collected from horses or vegetation were tested for the presence of Babesia and Theileria DNA. Piroplasm 18S rRNA gene amplification was conducted, and the obtained amplicons were sequenced. Babesia DNA was detected in only three ticks (one tick collected from a pony and two collected from vegetation), and all of the obtained sequences had 100% similarity to B. divergens. Theileria DNA was not present in the examined ticks. Thus, the above results indicate that ponies are probably not essential hosts for the detected species of piroplasms. Piroplasm species typical for horses (Babesia caballi and Theileria equi) were not detected because I. ricinus is not their vector. The low infection rate of I. ricinus with B. divergens shows that the disease risk for the local horse population and people associated with pony horses is low, but it demonstrates their possible role as a source of human infection in northern Poland.

  16. Rickettsial infection in Ixodes ricinus ticks in urban and natural habitats of Slovakia.

    Science.gov (United States)

    Špitalská, Eva; Boldiš, Vojtech; Derdáková, Markéta; Selyemová, Diana; Rusňáková Tarageľová, Veronika

    2014-03-01

    A total of 1810 Ixodes ricinus ticks was collected from the vegetation from 2 different habitat types: urban and natural. Urban habitats were represented by cemeteries and public parks in the following towns: Bratislava, Malacky, and Martin at 150 m and 400 m above sea level. Natural habitats were selected in the mountain forest of the Martinské hole Mts. in Central Slovakia at 3 different altitudinal levels, i.e. 600 m, 800 m and 1000 ma.s.l. All ticks were tested for the presence of spotted fever group rickettsiae. The DNA of Rickettsia spp. was identified in 9% of all tested ticks. Rickettsia-infected ticks were present in both, urban and sylvatic sites at all studied altitudes. Four different species of Rickettsia were present in positive I. ricinus ticks. Rickettsia helvetica was identified in 77 out of 87 Rickettsia-positive I. ricinus ticks, followed by 8 samples that belonged to Rickettsia monacensis and 2 of the positive ticks were infected with different unidentified Rickettsia spp. Due to the association of R. helvetica and R. monacensis with human infections, it is essential to understand which species of Rickettsia circulate in the natural foci of Slovakia. Circulation of pathogenic rickettsiae in urban as well as natural habitats at different altitudinal levels in Slovakia emphasizes that infection risk is very common throughout this Central European country. Copyright © 2013 Elsevier GmbH. All rights reserved.

  17. Development of genomic resources for the tick Ixodes ricinus: isolation and characterization of single nucleotide polymorphisms.

    Science.gov (United States)

    Quillery, E; Quenez, O; Peterlongo, P; Plantard, O

    2014-03-01

    Assessing the genetic variability of the tick Ixodes ricinus-an important vector of pathogens in Europe-is an essential step for setting up antitick control methods. Here, we report the first identification of a set of SNPs isolated from the genome of I. ricinus, by applying a reduction in genomic complexity, pyrosequencing and new bioinformatics tools. Almost 1.4 million of reads (average length: 528 nt) were generated with a full Roche 454 GS FLX run on two reduced representation libraries of I. ricinus. A newly developed bioinformatics tool (DiscoSnp), which isolates SNPs without requiring any reference genome, was used to obtain 321 088 putative SNPs. Stringent selection criteria were applied in a bioinformatics pipeline to select 1768 SNPs for the development of specific primers. Among 384 randomly SNPs tested by Fluidigm genotyping technology on 464 individuals ticks, 368 SNPs loci (96%) exhibited the presence of the two expected alleles. Hardy-Weinberg equilibrium tests conducted on six natural populations of ticks have shown that from 26 to 46 of the 384 loci exhibited significant heterozygote deficiency. © 2013 John Wiley & Sons Ltd.

  18. Borrelia burgdorferi sensu lato-infected Ixodes ricinus collected from vegetation near the Arctic Circle.

    Science.gov (United States)

    Hvidsten, Dag; Stordal, Frode; Lager, Malin; Rognerud, Bjørg; Kristiansen, Bjørn-Erik; Matussek, Andreas; Gray, Jeremy; Stuen, Snorre

    2015-09-01

    This is the first study to determine the density of questing Ixodes ricinus in northern Norway. It was performed at two sites in Brønnøy, which has been known for its tick permissive habitats for decades and is one of the northernmost habitats with an abundant I. ricinus population in the world. From April to November 2011, all stages of host-seeking I. ricinus were collected from the two sites. The overall prevalence of nymphs infected with Borrelia burgdorferi sensu lato was 21% and that of adult ticks 46%. The rates of the genospecies Borrelia afzelii, Borrelia garinii, and Borrelia valaisiana were similar to findings in most other studies in Scandinavia, with B. afzelii by far the most prevalent at 76%. The high Borrelia-infection prevalence in ticks from Brønnøy may explain the high incidence rate of reported Lyme borreliosis in the municipality. Copyright © 2015 The Authors. Published by Elsevier GmbH.. All rights reserved.

  19. Contrasting patterns of genetic divergence in two sympatric pseudo-metallophytes: Rumex acetosa L. and Commelina communis L.

    Directory of Open Access Journals (Sweden)

    Ye M

    2012-06-01

    Full Text Available Abstract Background Patterns of genetic divergence between populations of facultative metallophytes have been investigated extensively. However, most previous investigations have focused on a single plant species making it unclear if genetic divergence shows common patterns or, conversely, is species-specific. The herbs Rumex acetosa L. and Commelina communis L. are two pseudo-metallophytes thriving in both normal and cupriferous soils along the middle and lower reaches of the Yangtze River in China. Their non-metallicolous and metallicolous populations are often sympatric thus providing an ideal opportunity for comparative estimation of genetic structures and divergence under the selective pressure derived from copper toxicity. Results In the present study, patterns of genetic divergence of R. acetosa and C. communis , including metal tolerance, genetic structure and genetic relationships between populations, were investigated and compared using hydroponic experiments, AFLP, ISSR and chloroplast genetic markers. Our results show a significant reduction in genetic diversity in metallicolous populations of C. communis but not in R. acetosa . Moreover, genetic differentiation is less in R. acetosa than in C. communis , the latter species also shows a clustering of its metallicolous populations. Conclusions We propose that the genetic divergences apparent in R. acetosa and C. communis , and the contrasting responses of the two species to copper contamination, might be attributed to the differences in their intrinsic physiological and ecological properties. No simple and generalised conclusions on genetic divergence in pseudo-metallophytes can thus be drawn.

  20. Synthesis and characterization of waterborne polyurethane and polyurethane-urea towards eco-friendly materials by cellulose nanocrystals and plant extracts incorporation

    OpenAIRE

    Santamaría Echart, Arantzazu

    2017-01-01

    327 p. In this work, environmentally friendly anionic waterborne polyurethane and polyurethane-urea dispersions were synthesized in order to prepare films by casting. The effect of molar composition and synthesis route were analyzed on the waterborne polyurethane and polyurethane-urea dispersions, as well as the properties of films. Furthermore, these dispersions were used for the preparation of new eco-friendly materials. In this way, cellulose nanocrystals were isolated for the preparati...

  1. Gamma-ray irradiation, autoclave and ethylene oxide sterilization to thermosetting polyurethane: Sterilization to polyurethane

    Science.gov (United States)

    Hirata, Noriko; Matsumoto, Ken-Ichi; Inishita, Takashi; Takenaka, Yoshinori; Suma, Yasunori; Shintani, Hideharu

    1995-09-01

    Thermosetting polyurethane (PU) is widely used in a large variety of medical devices. 4,4'-methylenedianiline (MDA) was produced from PU by sterilization and it was studied for the relationship between urethane components or polymer characteristics and formation of MDA upon sterilization, using the commercially available dialyzers fabricated with different combination of isocyanate and polyol. We confirmed that the molecular-weight of polyol influenced the production of MDA upon sterilization.

  2. Synthesis of a Novel Biodegradable Polyurethane with Phosphatidylcholines

    Science.gov (United States)

    Cao, Jun; Chen, Niancao; Chen, Yuanwei; Luo, Xianglin

    2010-01-01

    A novel polyurethane was successfully synthesized by chain-extension of biodegradable poly (l-lactide) functionalized phosphatidylcholine (PC) with hexamethylene diisocyanate (HDI) as chain extender (PUR-PC). The molecular weights, glass transition temperature (Tg) increased significantly after the chain-extension. The hydrophilicity of PUR-PC was better than the one without PC, according to a water absorption test. Moreover, the number of adhesive platelets and anamorphic platelets on PUR-PC film were both less than those on PUR film. These preliminary results suggest that this novel polyurethane might be a better scaffold than traditional biodegradable polyurethanes for tissue engineering due to its better blood compatibility. Besides, this study also provides a new method to prepare PC-modified biodegradable polyurethanes. PMID:20480047

  3. New biomedical polyurethane ureas with high tear strengths

    NARCIS (Netherlands)

    deGroot, JH; deVrijer, R; Wildeboer, BS; Spaans, CS; Pennings, AJ

    Biodegradable polyurethanes ureas (PUU) were synthesized by a two step polymerization. First a poly (epsilon-caprolactone) prepolymer was terminated with three different diisocyanates: lysinediisocyanate (LDI), 1,6-hexanediisocyanate (HDI) and 1,4-butanediisocyanate (BDI). Second the prepolymers

  4. Glass fiber and silica reinforced rigid polyurethane foams

    National Research Council Canada - National Science Library

    M W Kim; S H Kwon; H Park; B K Kim

    2017-01-01

    Ternary composites of rigid polyurethane foam (RPUF)/glass fiber/silica as well as RPUF/glass fiber have been fabricated from glass fiber, silica, polymeric 4,4'-di-phenylmethane diisocyanate (PMDI...

  5. Synthesis of a Novel Biodegradable Polyurethane with Phosphatidylcholines

    Directory of Open Access Journals (Sweden)

    Xianglin Luo

    2010-04-01

    Full Text Available A novel polyurethane was successfully synthesized by chain-extension of biodegradable poly (L-lactide functionalized phosphatidylcholine (PC with hexamethylene diisocyanate (HDI as chain extender (PUR-PC. The molecular weights, glass transition temperature (Tg increased significantly after the chain-extension. The hydrophilicity of PUR-PC was better than the one without PC, according to a water absorption test. Moreover, the number of adhesive platelets and anamorphic platelets on PUR-PC film were both less than those on PUR film. These preliminary results suggest that this novel polyurethane might be a better scaffold than traditional biodegradable polyurethanes for tissue engineering due to its better blood compatibility. Besides, this study also provides a new method to prepare PC-modified biodegradable polyurethanes.

  6. New Flexible FR Polyurethane Foams for Energy Absorption Applications Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Development of new polyurethane (PU) insulation foams through a non-toxic environmentally friendly composite approach. Target FR foams will exhibit high heat flow...

  7. New Flexible FR Polyurethane Foams for Energy Absorption Applications Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Project involves development of new flexible FR polyurethane (PU)insulation foams through a non-toxic environmentally friendly composite approach. Foams have...

  8. Mechanical Properties of Stainless Steel Cellular Materials with Polyurethane

    National Research Council Canada - National Science Library

    KISHIMOTO, Satoshi; SHIMIZU, Toru; NAITO, Kimiyoshi; KAGAWA, Yutaka

    2011-01-01

    .... The mechanical properties of this material were measured. The results of the compressive tests showed that the stainless steel cellular material containing the polyurethane has different stress-strain curves from that without any polymer...

  9. Soy-based UV resistant polyurethane pultruded composites.

    Science.gov (United States)

    2012-02-01

    Aliphatic polyurethane (PU) nanocomposites were synthesized using organically modified nanoclays. X-Ray diffraction results : confirmed good exfoliation of nanoclay particles in the PU resin system. With the addition of just 1% of nanoclay in the bas...

  10. Prevalence of tick-borne pathogens in questing Ixodes ricinus ticks in urban and suburban areas of Switzerland.

    Science.gov (United States)

    Oechslin, Corinne P; Heutschi, Daniel; Lenz, Nicole; Tischhauser, Werner; Péter, Olivier; Rais, Olivier; Beuret, Christian M; Leib, Stephen L; Bankoul, Sergei; Ackermann-Gäumann, Rahel

    2017-11-09

    Throughout Europe, Ixodes ricinus transmits numerous pathogens. Its widespread distribution is not limited to rural but also includes urbanized areas. To date, comprehensive data on pathogen carrier rates of I. ricinus ticks in urban areas of Switzerland is lacking. Ixodes ricinus ticks sampled at 18 (sub-) urban collection sites throughout Switzerland showed carrier rates of 0% for tick-borne encephalitis virus, 18.0% for Borrelia burgdorferi (sensu lato), 2.5% for Borrelia miyamotoi, 13.5% for Rickettsia spp., 1.4% for Anaplasma phagocytophilum, 6.2% for "Candidatus Neoehrlichia mikurensis", and 0.8% for Babesia venatorum (Babesia sp., EU1). Site-specific prevalence at collection sites with n > 45 ticks (n = 9) significantly differed for B. burgdorferi (s.l.), Rickettsia spp., and "Ca. N. mikurensis", but were not related to the habitat type. Three hundred fifty eight out of 1078 I. ricinus ticks (33.2%) tested positive for at least one pathogen. Thereof, about 20% (71/358) were carrying two or three different potentially disease-causing agents. Using next generation sequencing, we could detect true pathogens, tick symbionts and organisms of environmental or human origin in ten selected samples. Our data document the presence of pathogens in the (sub-) urban I. ricinus tick population in Switzerland, with carrier rates as high as those in rural regions. Carriage of multiple pathogens was repeatedly observed, demonstrating the risk of acquiring multiple infections as a consequence of a tick bite.

  11. First evidence of Babesia venatorum and Babesia capreoli in questing Ixodes ricinus ticks in the Czech Republic.

    Science.gov (United States)

    Venclikova, Kristyna; Mendel, Jan; Betasova, Lenka; Hubalek, Zdenek; Rudolf, Ivo

    2015-01-01

    Ixodes ricinus is the most common tick species occurring in Central Europe and it serves as a principal vector of emerging human pathogens. The aim of this study was to determine the prevalence of Babesia spp. in host-seeking I. ricinus in urban and natural habitats. PCR was applied on samples to assess prevalence of Babesia spp. in questing ixodid ticks. Sequencing was used for Babesia species determination. 1,473 I. ricinus ticks (1,294 nymphs, 99 males and 80 females) were examined for the presence of Babesia spp. at the two study sites. Minimum infection rate for Babesia spp. was found to be 0.5% (infected I. ricinus nymphs were only detected in the natural ecosystem). Two Babesia species were identified by sequencing: B. venatorum (formerly called Babesia sp. EU1) and B. capreoli. The results obtained represent the first evidence of the occurrence of B. venatorum and B. capreoli in host-seeking I. ricinus ticks in the Czech Republic.

  12. Phytosynthesis of Silver Nanoparticles Using Myrtus communis L. Leaf Extract and Investigation of Bactericidal Activity

    Science.gov (United States)

    Ajdari, M. R.; Tondro, G. H.; Sattarahmady, N.; Parsa, A.; Heli, H.

    2017-12-01

    Silver nanoparticles have been synthesized using only Myrtus communis L. leaf extract by a facile procedure without other reagents. The extract played the roles of both reducing and capping agent. The nanoparticles were characterized using field-emission scanning microscopy, and remained stable for at least 3 weeks. Antibacterial activity of the nanoparticles was evaluated toward Escherichia coli, Bacillus subtilis, Pseudomonas aeruginosa, Staphylococcus aureus, methicillin-resistant Staphylococcus aureus, and Enterococcus faecalis based on inhibition zone disk diffusion assays. The minimum inhibitory and bactericidal concentrations of the nanoparticles were obtained. Mechanisms for the antibacterial activity were proposed.

  13. Gregarine Cephaloidophora communis mawrodiadi, 1908 in the barnacle Euraphia rhyzophorae, Oliveira, 1940 from Brazil

    Directory of Open Access Journals (Sweden)

    Lacombe Dyrce

    2002-01-01

    Full Text Available The gregarine Cephaloidophora communis was observed for the first time in Brazil in the barnacles Euraphia rhyzophorae collected in Angra dos Reis, Rio de Janeiro, Brazil, between 1990 and 1996. Histological studies showed growth phases of the parasite in specific parts of the digestive system. The intracellular forms occurred in the vacuoles of the intestinal cells. Syzygy was frequent, and the most common form following syzygy was cylindrical, with a single membrane. The cytoplasm of the gregarines was always irregular, dense, and occasionally presenting a dark stoch area.

  14. Phytosynthesis of Silver Nanoparticles Using Myrtus communis L. Leaf Extract and Investigation of Bactericidal Activity

    Science.gov (United States)

    Ajdari, M. R.; Tondro, G. H.; Sattarahmady, N.; Parsa, A.; Heli, H.

    2017-09-01

    Silver nanoparticles have been synthesized using only Myrtus communis L. leaf extract by a facile procedure without other reagents. The extract played the roles of both reducing and capping agent. The nanoparticles were characterized using field-emission scanning microscopy, and remained stable␣for at least 3 weeks. Antibacterial activity of the nanoparticles was evaluated toward Escherichia coli, Bacillus subtilis, Pseudomonas aeruginosa, Staphylococcus aureus, methicillin-resistant Staphylococcus aureus, and Enterococcus faecalis based on inhibition zone disk diffusion assays. The minimum inhibitory and bactericidal concentrations of the nanoparticles were obtained. Mechanisms for the antibacterial activity were proposed.

  15. Polyurethane nanofibers containing copper nanoparticles as future materials

    DEFF Research Database (Denmark)

    Sheikh, Faheem A.; Kanjwal, Muzafar Ahmed; Saran, Saurabh

    2011-01-01

    In the present study, we aimed to represent a novel approach to fabricate polyurethane nanofibers containing copper nanoparticles (NPs) by simple electrospinning process. A simple method, not depending on additional foreign chemicals, has been employed to utilize prepared copper NPs in polyurethane...... the antimicrobial efficacy of these nanofiber mats. Subsequently, antimicrobial tests have indicated that the prepared nanofibers do posses good bactericidal effect. Accordingly, it is noted that the obtained nanofiber mats can be used as future filter membranes with good antimicrobial activities....

  16. Polyurethane elastomers from morphology to mechanical aspects

    CERN Document Server

    Prisacariu, Cristina

    2011-01-01

    A comprehensive account of the physical / mechanical behaviour of polyurethanes (PU´s) elastomers, films and blends of variable crystallinity. Aspects covered include the elasticity and inelasticity of amorphous to crystalline PUs, in relation to their sensitivity to chemical and physical structure. A study is made of how aspects of the constitutive responses of PUs vary with composition: the polyaddition procedure, the hard segment, soft segment and chain extender (diols and diamines) are varied systematically in a large number of systems of model and novel crosslinked andthermoplastic PUs. Results will be related to: microstructural changes, on the basis of evidence from x-ray scattering (SAXS and WAXS), and also dynamic mechanical analyses (DMA), differential scanning calorimetry (DSC) and IR dichroism. Inelastic effects will be investigated also by including quantitative correlations between the magnitude of the Mullins effect and the fractional energy dissipation by hysteresis under cyclic straining, g...

  17. Degradation characteristics of waste polyurethane by radiation

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong Seok; Ahn, Sung Jun; Gwon Hui Jeong; Jeong, Sung In; Nho, Young Chang; Lim, Youn Mook [Research Division for Industry and Environment, Korea Atomic Energy Research Institute, Jeongeup (Korea, Republic of)

    2017-06-15

    Polyurethane (PU) is a very popular polymer that is used in a variety of applications due to its good mechanical, thermal, and chemical properties. However, waste PU recycling has received significant attention due to environmental issues. The aim of this work was to investigate the degradation characteristics of waste PU to recycle. Degradation of waste PU was carried out using a radiation techniques. Waste PUs were exposed to a gamma {sup 60}Co sources. To verify degradation, the irradiated PUs were characterized using FT-IR, gel permeation chromatography (GPC), and their thermal/mechanical properties are reported. When the radiation dose was 500 kGy, the molecular weight of the waste PU drastically decreased. Also, the mechanical properties of waste PU were approximately 4 times lower than those of non-irradiated PU. This study has confirmed the possibility of making fine particle of waste PU for recycling through radiation degradation techniques.

  18. Polyurethane Coatings Reinforced by Halloysite Nanotubes

    Directory of Open Access Journals (Sweden)

    Diethelm Johannsmann

    2013-01-01

    Full Text Available The pencil hardness of a two-component polyurethane coating was improved by adding halloysite nanotubes to the recipe at a weight fraction of less than 10%. The pencil hardness was around F for the unfilled coating and increased to around 2H upon filling. It was important to silanize the surface of the filler in order to achieve good coupling to the matrix. Sonicating the sample during drying also improved the hardness. Scanning electron micrographs suggest that the nanotubes are always well immersed into the bulk of the film. With a thickness between 10 and 20 µm, the optical clarity was good enough to clearly read letters through the film. The films can be used in applications where transparency is required.

  19. Nitrosomonas communis strain YNSRA, an ammonia-oxidizing bacterium, isolated from the reed rhizoplane in an aquaponics plant.

    Science.gov (United States)

    Tokuyama, Tatsuaki; Mine, Atsusi; Kamiyama, Kaoru; Yabe, Ryuichi; Satoh, Kazuo; Matsumoto, Hirotoshi; Takahashi, Reiji; Itonaga, Koji

    2004-01-01

    An ammonia-oxidizing bacterium (strain YNSRA) was isolated from the rhizoplane of the reed (Phragmites communis) used in an aquaponics plant which is a wastewater treatment plant. Strain YNSRA was identified as Nitrosomonas communis by taxonomic studies. The hydroxylamine-cytochrome c reductase (HCR) of strain YNSRA was found to have a higher activity (25.60 u/mg) than that of Nitrosomonas europaea ATCC25978T (8.94 u/mg). Ribulose-1,5-bisphosphate carboxylase (RubisCO) activity was detected at very low levels in strain YNSRA, whereas strain ATCC25978T had definite activity.

  20. Preparation and Characterization of Fluorinated Hydrophobic UV-Crosslinkable Thiol-Ene Polyurethane Coatings

    Directory of Open Access Journals (Sweden)

    Wenjing Xia

    2017-08-01

    Full Text Available The polyurethane prepolymer terminated with a double bond was synthesized using isophorone diisocyanate (IPDI, hydroxyl terminated polybutadiene (HTPB, 1,4-butanediol (BDO, and 2-hydroxyethyl acrylate (HEA. Then, a series of innovative UV-curable polyurethane coatings were prepared by blending ene-terminated polyurethane, fluoroacrylate monomer, and multifunctional thiol crosslinker upon UV exposure. The incorporation of fluoroacrylate monomer and multifunctional thiols into polyurethane coatings significantly enhanced the hydrophobic property, mechanical property, pencil hardness, and glossiness of the polyurethane coatings. This method of preparing UV crosslinkable, hydrophobic polyurethane coatings based on thiol-ene chemistry exhibited numerous advantages over other UV photocuring systems.

  1. Polyurethane foam-covered breast implants: a justified choice?

    Science.gov (United States)

    Scarpa, C; Borso, G F; Vindigni, V; Bassetto, F

    2015-01-01

    Even if the safety of the polyurethane prosthesis has been the subject of many studies and professional and public controversies. Nowadays, polyurethane covered implants are very popular in plastic surgery for the treatment of capsular contracture. We have identified 41 papers (1 is a communication of the FDA) by using search browsers such as Pubmed, Medline, and eMedicine. Eleven manuscripts have been used for an introduction, and the remaining thirty have been subdivided into three tables whose results have been summarized in three main chapters: (1) capsular formation and contracture, (2) complications, (3) biodegradation and cancer risk. (1) The polyurethanic capsule is a well defined foreign body reaction characterized by synovial metaplasia, a thin layer of disarranged collagen fibers and a high vascularization. These features make possible a "young" capsule and a low occurrence of capsular contracture even over a long period (10 years); (2) the polyurethane implants may be difficult to remove but there is no evidence that they cause an increase in the other complications; (3) there is no evidence of polyurethane related cancer in long-term studies (after 5 years). Polyurethane foam covered breast implants remain a valid choice for the treatment of capsular contracture even if it would be very useful to verify the ease of removal of the prosthesis and to continue investigations on biodegradation products.

  2. Hydrophilic polyurethane matrix promotes chondrogenesis of mesenchymal stem cells.

    Science.gov (United States)

    Nalluri, Sandeep M; Krishnan, G Rajesh; Cheah, Calvin; Arzumand, Ayesha; Yuan, Yuan; Richardson, Caley A; Yang, Shuying; Sarkar, Debanjan

    2015-09-01

    Segmental polyurethanes exhibit biphasic morphology and can control cell fate by providing distinct matrix guided signals to increase the chondrogenic potential of mesenchymal stem cells (MSCs). Polyethylene glycol (PEG) based hydrophilic polyurethanes can deliver differential signals to MSCs through their matrix phases where hard segments are cell-interactive domains and PEG based soft segments are minimally interactive with cells. These coordinated communications can modulate cell-matrix interactions to control cell shape and size for chondrogenesis. Biphasic character and hydrophilicity of polyurethanes with gel like architecture provide a synthetic matrix conducive for chondrogenesis of MSCs, as evidenced by deposition of cartilage-associated extracellular matrix. Compared to monophasic hydrogels, presence of cell interactive domains in hydrophilic polyurethanes gels can balance cell-cell and cell-matrix interactions. These results demonstrate the correlation between lineage commitment and the changes in cell shape, cell-matrix interaction, and cell-cell adhesion during chondrogenic differentiation which is regulated by polyurethane phase morphology, and thus, represent hydrophilic polyurethanes as promising synthetic matrices for cartilage regeneration. Copyright © 2015 Elsevier B.V. All rights reserved.

  3. Hydroxyapatite-silver nanoparticles coatings on porous polyurethane scaffold.

    Science.gov (United States)

    Ciobanu, Gabriela; Ilisei, Simona; Luca, Constantin

    2014-02-01

    The present paper is focused on a study regarding the possibility of obtaining hydroxyapatite-silver nanoparticle coatings on porous polyurethane scaffold. The method applied is based on a combined strategy involving hydroxyapatite biomimetic deposition on polyurethane surface using a Supersaturated Calcification Solution (SCS), combined with silver ions reduction and in-situ crystallization processes on hydroxyapatite-polyurethane surface by sample immersing in AgNO3 solution. The morphology, composition and phase structure of the prepared samples were characterized by scanning electron microscopy coupled with energy dispersive X-ray spectroscopy (SEM-EDX), X-ray diffraction (XRD), UV-Vis spectroscopy and X-ray photoelectron spectroscopy (XPS) measurements. The data obtained show that a layer of hydroxyapatite was deposited on porous polyurethane support and the silver nanoparticles (average size 34.71 nm) were dispersed among and even on the hydroxyapatite crystals. Hydroxyapatite/polyurethane surface acts as a reducer and a stabilizing agent for silver ions. The surface plasmon resonance peak in UV-Vis absorption spectra showed an absorption maximum at 415 nm, indicating formation of silver nanoparticles. The hydroxyapatite-silver polyurethane scaffolds were tested against Staphylococcus aureus and Escherichia coli and the obtained data were indicative of good antibacterial properties of the materials. © 2013.

  4. The occurrence of Ixodes ricinus ticks and important tick-borne pathogens in areas with high tick-borne encephalitis prevalence in different altitudinal levels of the Czech Republic Part I. Ixodes ricinus ticks and tick-borne encephalitis virus.

    Science.gov (United States)

    Daniel, M; Danielová, V; Kříž, B; Růžek, D; Fialová, A; Malý, M; Materna, J; Pejčoch, M; Erhart, J

    The aim of the three-year study (2011-2013) was to monitor population density of Ixodes ricinus ticks and its infection rate with the tick-borne encephalitis virus in areas with a high incidence of tick-borne encephalitis as reported in the previous decade 2001-2010. Such a comprehensive and long-term study based on existing epidemiolo-gical findings has not previously been conducted in Europe. In the areas of the Ústí nad Labem Region, Olomouc Region, South Bohemian Region, and Highlands Region, 600 m2 plots were selected in the local optimal I. ricinus habitats where tick flagging was performed every year in the spring-summer and autumn seasons of the questing activity. In total, 18,721 I. ricinus ticks (1448 females, 1425 males, and 15,848 nymphs) were collected and investigated. The results have shown that the differences in the infection rate of I. ricinus observed between regions are driven by variation in the density of the local I. ricinus populations which is influenced by the characteris-tics of the whole local biocenosis. The overall prevalence estimate of TBE virus in Ixodes ricinus ticks at the altitudes below 600 m a.s.l. was 0.096 % (95% CI 0.055-0.156) for nymphs, and 0.477 % (95% CI 0.272-0.773) for adults. The dynamics of the seasonal variation in I. ricinus populations, depending primarily on the climatic factors, are behind the interyear differences in the infection rate of ticks and, consequently, in the epidemiological situation of tick-borne encephalitis. The nymph to adult ratio was 5.5 on average but showed great interregional variability (from 10.3 in the Ústí nad Labem Region to 1.8 in the Highlands Region). It might be used in the future as one of the indicators of the composition of the local I. ricinus population and of the level of the circulation of tick-borne pathogens in zoonotic sphere and also for use in the health risk assessment in a given area. Despite the permanent expansion of ticks and tick-borne pathogens in higher

  5. Integration of Ixodes ricinus genome sequencing with transcriptome and proteome annotation of the naïve midgut.

    Science.gov (United States)

    Cramaro, Wibke J; Revets, Dominique; Hunewald, Oliver E; Sinner, Regina; Reye, Anna L; Muller, Claude P

    2015-10-28

    In Europe, Ixodes ricinus ticks are the most important vectors of diseases threatening humans, livestock, wildlife and companion animals. Nevertheless, genomic sequence information is missing and functional annotation of transcripts and proteins is limited. This lack of information is restricting studies of the vector and its interactions with pathogens and hosts. Here we present and integrate the first analysis of the I. ricinus genome with the transcriptome and proteome of the unfed I. ricinus midgut. Whole genome sequencing was performed on I. ricinus ticks and the sequences were de novo assembled. In parallel, I. ricinus ticks were dissected and the midgut transcriptome sequenced. Both datasets were integrated by transcript discovery analysis to identify putative genes and genome contigs were screened for homology. An alignment-based and a motif-search-based approach were combined for the annotation of the midgut transcriptome. Additionally, midgut proteins were identified and annotated by mass spectrometry with public databases and the in-house built transcriptome database as references and results were cross-validated. The de novo assembly of 1 billion DNA sequences to a reference genome of 393 Mb length provides an unprecedented insight into the I. ricinus genome. A homology search revealed sequences in the assembled genome contigs homologous to 89% of the I. scapularis genome scaffolds indicating coverage of most genome regions. We identified moreover 6,415 putative genes. More than 10,000 transcripts from naïve midgut were annotated with respect of predicted function and/or cellular localization. By combining an alignment-based with a motif-search-based annotation approach, we doubled the number of annotations throughout all functional categories. In addition, 574 gel spots were significantly identified by mass spectrometry (pricinus, paving the way for further in-depth analysis of the most important European disease vector and its interactions with

  6. Antimicrobial activities of the methanol extract and compounds from Artocarpus communis (Moraceae

    Directory of Open Access Journals (Sweden)

    Ngadjui Bonaventure T

    2011-05-01

    Full Text Available Abstract Background Artocarpus communis is used traditionally in Cameroon to treat several ailments, including infectious and associated diseases. This work was therefore designed to investigate the antimicrobial activities of the methanol extract (ACB and compounds isolated from the bark of this plant, namely peruvianursenyl acetate C (1, α-amyrenol or viminalol (2, artonin E (4 and 2-[(3,5-dihydroxy-(Z-4-(3-methylbut-1-enylphenyl]benzofuran-6-ol (5. Methods The liquid microdilution assay was used in the determination of the minimal inhibitory concentration (MIC and the minimal microbicidal concentration (MMC, against seven bacterial and one fungal species. Results The MIC results indicated that ACB as well as compounds 4 and 5 were able to prevent the growth of all tested microbial species. All other compounds showed selective activities. The lowest MIC value of 64 μg/ml for the crude extract was recorded on Staphylococcus aureus ATCC 25922 and Escherichia coli ATCC 8739. The corresponding value of 32 μg/ml was recorded with compounds 4 and 5 on Pseudomonas aeruginosa PA01 and compound 5 on E. coli ATCC 8739, their inhibition effect on P. aeruginosa PA01 being more than that of chloramphenicol used as reference antibiotic. Conclusion The overall results of this study provided supportive data for the use of A. communis as well as some of its constituents for the treatment of infections associated with the studied microorganisms.

  7. Development of an energy-protein for animal food based crop residues pear (Pyrus communis

    Directory of Open Access Journals (Sweden)

    Néstor Julián Pulido-Suárez,

    2016-01-01

    Full Text Available Pear (Pyrus communis is a fruit from the species of deciduous, widely consumed worldwide for its high quality energ y. However, pear itself does not provide the amount of protein required for cattle feeding, so alternatives to improve its nutritional quality have been studied. On these grounds, the objective of this study was to evaluate the parameters of solid state fermentation, and compositional energ y value of a protein food based on pears (Pyrus communis with apparent physical damage. A completely random design was used to evaluate three treatments; these correspond to percentages of inclusion of calcium carbonate (0.25, 0.50, 0.75 formulation based on already established (40 % pear, 25 % rice flour, 25 % wheat bran and 10 % urea, the parameters evaluated were: pH, ashes (CZ, crude protein (CP and crude fiber (CF, and they were recorded at 0, 24, 48 and 72 hours. As a result, it was found that the pH dropped gradually for each treatment and at each sampling period; however, there were no significant differences. The lower value at the end of the process is recorded T2 (0.25 with 4.66, followed by T3 (0.50 with 4.50, the ash reached values of up to 6 % with T3, and T2 (0.50 reached the highest percentages in fiber and crude protein. Finally, decreasing the fermentation variables ensures a food with no presence of undesirable microorganisms and stable over time.

  8. Review of pharmacological effects of Myrtus communis L. and its active constituents.

    Science.gov (United States)

    Alipour, Ghazal; Dashti, Saeedeh; Hosseinzadeh, Hossein

    2014-08-01

    Myrtle (Myrtus communis L., Myrtaceae) is a medicinal herb used worldwide in traditional medicine. A large number of components have been isolated from this herb. Polyphenols, myrtucommulone (MC), semimyrtucommulone (S-MC), 1,8-cineole, α-pinene, myrtenyl acetate, limonene, linalool and α-terpinolene are among the compounds considered to be the main biologically active components. Various parts of this herb such as its berries, leaves and fruits have been used extensively as a folk medicine for several centuries. The herb is used traditionally for the treatment of disorders such as diarrhea, peptic ulcer, hemorrhoid, inflammation, pulmonary and skin diseases, although clinical and experimental studies suggest that it possesses a broader spectrum of pharmacological and therapeutic effects such as antioxidative, anticancer, anti-diabetic, antiviral, antibacterial, antifungal, hepatoprotective and neuroprotective activity. The present review attempts to give an overview on the phytochemical, pharmacological, toxicological and clinical studies of total extracts and the most relevant active ingredients of M. communis. Copyright © 2014 John Wiley & Sons, Ltd.

  9. Neuroprotective Effect of Juniperus communis on Chlorpromazine Induced Parkinson Disease in Animal Model

    Directory of Open Access Journals (Sweden)

    Souravh Bais

    2015-01-01

    Full Text Available We evaluated anti-Parkinson’s activity of methanolic extract of Juniperus communis (MEJC leaves in chlorpromazine (CPZ induced experimental animal model. In this study effects of Juniperus communis (100 and 200 mg/kg, i.p. were studied using various behavior parameters like catalepsy (bar test, muscle rigidity (rotarod test, and locomotor activity (actophotometer and its effect on neurochemical parameters (TBARS, GSH, nitrite, and total protein in rats. The experiment was designed, by giving chlorpromazine (3 mg/kg, i.p. for 21 days to induce Parkinson’s disease-like symptoms. Chlorpromazine significantly induced motor dysfunctions (catalepsy, muscle rigidity, and hypolocomotion in a period of 21 days. The MEJC significantly (P<0.001 reduced catalepsy and muscle rigidity and significantly (P<0.001 increased locomotor activity in rats. The maximum reduction was observed on the 21st day at a dose of 200 mg/kg (i.p.. The MEJC extract also showed an increase in the level of reduced gutathione (GSH (P<0.001 and total protein (P<0.001 and decreased the elevated levels of TBARS (P<0.001 and nitrite (P<0.001 preferably at a higher dose (200 mg/kg as compared to chlorpromazine group. Thus the present study showed the neuroprotective effect of MEJC against CPZ induced Parkinson’s disease-like symptoms or anti-Parkinson’s activity.

  10. Evaluation of Sebostatic Activity of Juniperus communis Fruit Oil and Pelargonium graveolens Oil Compared to Niacinamide

    Directory of Open Access Journals (Sweden)

    Justyna Kozlowska

    2017-09-01

    Full Text Available As a facial skin condition, oily skin causes cosmetic problems, such as large pores, shiny appearance, and the feeling of greasiness and heaviness. Furthermore, extensive sebum production leads to common skin disorders such as acne vulgaris or seborrheic dermatitis. This study investigated the efficacy of sebum control tonics containing Juniperus communis fruit oil, Pelargonium graveolens oil, or niacinamide. The effects of Juniperus communis fruit oil, Pelargonium graveolens oil, and niacinamide on sebum excretion rates were investigated using Sebumeter®. Sebum measurements (Sebumeter® SM 815, Courage & Khazaka®, Köln, Germany were made on the skin surface in three places by applying the sebumeter probe to the forehead after 10, 60, and 120 min from application of the tonic. The results indicated that the application of the tonic maintained a lower sebum secretion 10 min and 60 min after the application of the cosmetic, compared to those before it. However, a visible sebum-reducing efficacy after 2 h was reported only for tonic containing 0.25% Pelargonium graveolens oil and for the tonic with the addition of 3% niacinamide. After 2 h, the values of sebum measurements were 44 ± 5.13 a.u. and 58 ± 9.07 a.u., respectively. Our results show that the tonic with the addition of 0.25% Pelargonium graveolens oil is the most effective in reducing sebum production.

  11. Genome scaffolding and annotation for the pathogen vector Ixodes ricinus by ultra-long single molecule sequencing.

    Science.gov (United States)

    Cramaro, Wibke J; Hunewald, Oliver E; Bell-Sakyi, Lesley; Muller, Claude P

    2017-02-08

    Global warming and other ecological changes have facilitated the expansion of Ixodes ricinus tick populations. Ixodes ricinus is the most important carrier of vector-borne pathogens in Europe, transmitting viruses, protozoa and bacteria, in particular Borrelia burgdorferi (sensu lato), the causative agent of Lyme borreliosis, the most prevalent vector-borne disease in humans in the Northern hemisphere. To faster control this disease vector, a better understanding of the I. ricinus tick is necessary. To facilitate such studies, we recently published the first reference genome of this highly prevalent pathogen vector. Here, we further extend these studies by scaffolding and annotating the first reference genome by using ultra-long sequencing reads from third generation single molecule sequencing. In addition, we present the first genome size estimation for I. ricinus ticks and the embryo-derived cell line IRE/CTVM19. 235,953 contigs were integrated into 204,904 scaffolds, extending the currently known genome lengths by more than 30% from 393 to 516 Mb and the N50 contig value by 87% from 1643 bp to a N50 scaffold value of 3067 bp. In addition, 25,263 sequences were annotated by comparison to the tick's North American relative Ixodes scapularis. After (conserved) hypothetical proteins, zinc finger proteins, secreted proteins and P450 coding proteins were the most prevalent protein categories annotated. Interestingly, more than 50% of the amino acid sequences matching the homology threshold had 95-100% identity to the corresponding I. scapularis gene models. The sequence information was complemented by the first genome size estimation for this species. Flow cytometry-based genome size analysis revealed a haploid genome size of 2.65Gb for I. ricinus ticks and 3.80 Gb for the cell line. We present a first draft sequence map of the I. ricinus genome based on a PacBio-Illumina assembly. The I. ricinus genome was shown to be 26% (500 Mb) larger than the genome of its

  12. Prevalence of tick-borne encephalitis virus in Ixodes ricinus ticks in northern Europe with particular reference to Southern Sweden

    Science.gov (United States)

    2014-01-01

    Background In northern Europe, the tick-borne encephalitis virus (TBEV) of the European subtype is usually transmitted to humans by the common tick Ixodes ricinus. The aims of the present study are (i) to obtain up-to-date information on the TBEV prevalence in host-seeking I. ricinus in southern and central Sweden; (ii) to compile and review all relevant published records on the prevalence of TBEV in ticks in northern Europe; and (iii) to analyse and try to explain how the TBE virus can be maintained in natural foci despite an apparently low TBEV infection prevalence in the vector population. Methods To estimate the mean minimum infection rate (MIR) of TBEV in I. ricinus in northern Europe (i.e. Denmark, Norway, Sweden and Finland) we reviewed all published TBEV prevalence data for host-seeking I. ricinus collected during 1958–2011. Moreover, we collected 2,074 nymphs and 906 adults of I. ricinus from 29 localities in Sweden during 2008. These ticks were screened for TBEV by RT-PCR. Results The MIR for TBEV in nymphal and adult I. ricinus was 0.28% for northern Europe and 0.23% for southern Sweden. The infection prevalence of TBEV was significantly lower in nymphs (0.10%) than in adult ticks (0.55%). At a well-known TBEV-endemic locality, Torö island south-east of Stockholm, the TBEV prevalence (MIR) was 0.51% in nymphs and 4.48% in adults of I. ricinus. Conclusions If the ratio of nymphs to adult ticks in the TBEV-analysed sample differs from that in the I. ricinus population in the field, the MIR obtained will not necessarily reflect the TBEV prevalence in the field. The relatively low TBEV prevalence in the potential vector population recorded in most studies may partly be due to: (i) inclusion of uninfected ticks from the ‘uninfected areas’ surrounding the TBEV endemic foci; (ii) inclusion of an unrepresentative, too large proportion of immature ticks, compared to adult ticks, in the analysed tick pools; and (iii) shortcomings in the laboratory

  13. Prevalence of tick-borne encephalitis virus in Ixodes ricinus ticks in northern Europe with particular reference to Southern Sweden.

    Science.gov (United States)

    Pettersson, John H-O; Golovljova, Irina; Vene, Sirkka; Jaenson, Thomas G T

    2014-03-11

    In northern Europe, the tick-borne encephalitis virus (TBEV) of the European subtype is usually transmitted to humans by the common tick Ixodes ricinus. The aims of the present study are (i) to obtain up-to-date information on the TBEV prevalence in host-seeking I. ricinus in southern and central Sweden; (ii) to compile and review all relevant published records on the prevalence of TBEV in ticks in northern Europe; and (iii) to analyse and try to explain how the TBE virus can be maintained in natural foci despite an apparently low TBEV infection prevalence in the vector population. To estimate the mean minimum infection rate (MIR) of TBEV in I. ricinus in northern Europe (i.e. Denmark, Norway, Sweden and Finland) we reviewed all published TBEV prevalence data for host-seeking I. ricinus collected during 1958-2011. Moreover, we collected 2,074 nymphs and 906 adults of I. ricinus from 29 localities in Sweden during 2008. These ticks were screened for TBEV by RT-PCR. The MIR for TBEV in nymphal and adult I. ricinus was 0.28% for northern Europe and 0.23% for southern Sweden. The infection prevalence of TBEV was significantly lower in nymphs (0.10%) than in adult ticks (0.55%). At a well-known TBEV-endemic locality, Torö island south-east of Stockholm, the TBEV prevalence (MIR) was 0.51% in nymphs and 4.48% in adults of I. ricinus. If the ratio of nymphs to adult ticks in the TBEV-analysed sample differs from that in the I. ricinus population in the field, the MIR obtained will not necessarily reflect the TBEV prevalence in the field. The relatively low TBEV prevalence in the potential vector population recorded in most studies may partly be due to: (i) inclusion of uninfected ticks from the 'uninfected areas' surrounding the TBEV endemic foci; (ii) inclusion of an unrepresentative, too large proportion of immature ticks, compared to adult ticks, in the analysed tick pools; and (iii) shortcomings in the laboratory techniques used to detect the virus that may be

  14. Nanoclay Dispersion and its Effect on Properties of Waterborne Polyurethanes

    Directory of Open Access Journals (Sweden)

    H. Honarkar

    2014-01-01

    Full Text Available In recent years, waterborne polyurethanes as in coatings and adhesives formulations have attracted considerable attention because they are non-toxic, non-flammable and friendly to environment. Besides environmental management, the flexibility, low temperature property, high tensile strength, good adhesion and improved rheological property are specific properties of waterborne polyurethanes. Also low production cost of water borne polyurethanes over solvent-borne polyurethanes is also a reason for their applications. However, these materials have some defects such as weak water resistance and low adhesion in the moisture environment due to sensitivity of their hydrophilic ionic bonds, ether groups, urethane and ester groups to hydrolysis which need to be improved. Also, low heat resistance of these materials is due to a relatively low crystalline melting point or glass transition temperature of hard segments. One of the ways to solve this problem and improve its properties for different applications is the addition of inorganic fillers especially nano-sized layered silicates within polyurethane matrix. In this way water resistance, heat resistance, mechanical properties and modulus increase simultaneously. In this research, waterborne polyurethane nanocomposites with PTMG polyol, IPDI, DMPA (internal emulsifier, TEA (neutralizer and 1, 3 and 5weight % of Cloisite 30B as reinforcement were synthesized and characterized. Polarity of the samples was investigated by contact angle test and dispersion of nano particles in the samples was characterized by X-Ray and TEM, Thermal properties and dynamic mechanical properties were measured by TGA and DMTA, respectively. The results showed that incorporation of clay into polyurethanes did reduce water absorption and increased heat resistance, modulus, particle size and contact angle.In recent years, waterborne polyurethanes including coatings and adhesives have attracted considerable attention because they

  15. Infections and Coinfections of Questing Ixodes ricinus Ticks by Emerging Zoonotic Pathogens in Western Switzerland

    Science.gov (United States)

    Lommano, Elena; Bertaiola, Luce; Dupasquier, Christèle

    2012-01-01

    In Europe, Ixodes ricinus is the vector of many pathogens of medical and veterinary relevance, among them Borrelia burgdorferi sensu lato and tick-borne encephalitis virus, which have been the subject of numerous investigations. Less is known about the occurrence of emerging tick-borne pathogens like Rickettsia spp., Babesia spp., “Candidatus Neoehrlichia mikurensis,” and Anaplasma phagocytophilum in questing ticks. In this study, questing nymph and adult I. ricinus ticks were collected at 11 sites located in Western Switzerland. A total of 1,476 ticks were analyzed individually for the simultaneous presence of B. burgdorferi sensu lato, Rickettsia spp., Babesia spp., “Candidatus Neoehrlichia mikurensis,” and A. phagocytophilum. B. burgdorferi sensu lato, Rickettsia spp., and “Candidatus Neoehrlichia mikurensis” were detected in ticks at all sites with global prevalences of 22.5%, 10.2%, and 6.4%, respectively. Babesia- and A. phagocytophilum-infected ticks showed a more restricted geographic distribution, and their prevalences were lower (1.9% and 1.5%, respectively). Species rarely reported in Switzerland, like Borrelia spielmanii, Borrelia lusitaniae, and Rickettsia monacensis, were identified. Infections with more than one pathogenic species, involving mostly Borrelia spp. and Rickettsia helvetica, were detected in 19.6% of infected ticks. Globally, 34.2% of ticks were infected with at least one pathogen. The diversity of tick-borne pathogens detected in I. ricinus in this study and the frequency of coinfections underline the need to take them seriously into consideration when evaluating the risks of infection following a tick bite. PMID:22522688

  16. Blood feeding on large grazers affects the transmission of Borrelia burgdorferi sensu lato by Ixodes ricinus.

    Science.gov (United States)

    Pacilly, F C A; Benning, M E; Jacobs, F; Leidekker, J; Sprong, H; Van Wieren, S E; Takken, W

    2014-10-01

    The presence of Ixodes ricinus and their associated Borrelia infections on large grazers was investigated. Carcases of freshly shot red deer, mouflon and wild boar were examined for the presence of any stage of I. ricinus. Questing ticks were collected from locations where red deer and wild boar are known to occur. Presence of Borrelia burgdorferi s.l. DNA was examined in a fraction of the collected ticks. Larvae, nymphs and adult ticks were found on the three large grazers. Red deer had the highest tick burden, with many of the nymphs and adult females attached for engorgement. Most larvae had not attached. The mean number of ticks on the animals varied from 13 to 67. Ticks were highly aggregated amongst the animals: some animals had no ticks, while others had high numbers. Larvae and nymphs were mostly found on the ears, while adult ticks were attached to the axillae. The Borrelia infection rate of questing nymphs was 8.5%. Unengorged wandering nymphs on deer had a Borrelia infection rate of 12.5%, while only 0.9% of feeding nymphs carried a Borrelia infection. The infection rate of unengorged adult male ticks was 4.5%, and that of feeding female ticks was 0.7%. The data suggest that ticks feeding on red deer and wild boar lose their Borrelia infections. The implications of the results are discussed with respect to Borrelia epidemiology and maintenance of a Borrelia reservoir as well as the role of reproductive hosts for Ixodes ricinus. Copyright © 2014 Elsevier GmbH. All rights reserved.

  17. Experimental Study on the Performance of Polyurethane-Steel Sandwich Structure under Debris Flow

    National Research Council Canada - National Science Library

    Peizhen Li; Shutong Liu; Zheng Lu

    2017-01-01

    Polyurethane-steel sandwich structure, which creatively uses the polyurethane-steel sandwich composite as a structural material, is proposed to strengthen the impact resistance of buildings under debris flow...

  18. IDENTIFICATION OF CFC AND HCFC SUBSTITUTES FOR BLOWING POLYURETHANE FOAM INSULATION PRODUCTS

    Science.gov (United States)

    The report gives results of a cooperative effort to identiry chlorofluorocarbons and hydrochlorofluorocarbon substitutes for blowing polyurethane foam insulation products. The substantial ongoing effort is identifying third-generation blowing agets for polyurethane foams to repla...

  19. Biobased composites from thermoplastic polyurethane elastomer and cross-linked acrylated-epoxidized soybean oil

    Science.gov (United States)

    Soybean oil is an important sustainable material. Crosslinked acrylated epoxidized soybean oil (AESO) is brittle without flexibility and the incorporation of thermoplastic polyurethane improves its toughness for industrial applications. The hydrophilic functional groups from both oil and polyurethan...

  20. IrFC - An Ixodes ricinus injury-responsive molecule related to Limulus Factor C

    Czech Academy of Sciences Publication Activity Database

    Urbanová, Veronika; Hartmann, David; Grunclová, Lenka; Šíma, Radek; Flemming, Tina; Hajdušek, Ondřej; Kopáček, Petr

    2014-01-01

    Roč. 46, č. 2 (2014), s. 439-447 ISSN 0145-305X R&D Projects: GA ČR GAP506/10/2136; GA ČR GP13-27630P; GA ČR GP13-12816P; GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : Complement * Innate immunity * Limulus Clotting Factor C * Phagocytosis * RNA interference * Tick Ixodes ricinus Subject RIV: EC - Immunology Impact factor: 2.815, year: 2014

  1. Ixodes ricinus tick lipocalins: identification, cloning, phylogenetic analysis and biochemical characterization.

    Directory of Open Access Journals (Sweden)

    Jérôme Beaufays

    Full Text Available BACKGROUND: During their blood meal, ticks secrete a wide variety of proteins that interfere with their host's defense mechanisms. Among these proteins, lipocalins play a major role in the modulation of the inflammatory response. METHODOLOGY/PRINCIPAL FINDINGS: Screening a cDNA library in association with RT-PCR and RACE methodologies allowed us to identify 14 new lipocalin genes in the salivary glands of the Ixodes ricinus hard tick. A computational in-depth structural analysis confirmed that LIRs belong to the lipocalin family. These proteins were called LIR for "Lipocalin from I. ricinus" and numbered from 1 to 14 (LIR1 to LIR14. According to their percentage identity/similarity, LIR proteins may be assigned to 6 distinct phylogenetic groups. The mature proteins have calculated pM and pI varying from 21.8 kDa to 37.2 kDa and from 4.45 to 9.57 respectively. In a western blot analysis, all recombinant LIRs appeared as a series of thin bands at 50-70 kDa, suggesting extensive glycosylation, which was experimentally confirmed by treatment with N-glycosidase F. In addition, the in vivo expression analysis of LIRs in I. ricinus, examined by RT-PCR, showed homogeneous expression profiles for certain phylogenetic groups and relatively heterogeneous profiles for other groups. Finally, we demonstrated that LIR6 codes for a protein that specifically binds leukotriene B4. CONCLUSIONS/SIGNIFICANCE: This work confirms that, regarding their biochemical properties, expression profile, and sequence signature, lipocalins in Ixodes hard tick genus, and more specifically in the Ixodes ricinus species, are segregated into distinct phylogenetic groups suggesting potential distinct function. This was particularly demonstrated by the ability of LIR6 to scavenge leukotriene B4. The other LIRs did not bind any of the ligands tested, such as 5-hydroxytryptamine, ADP, norepinephrine, platelet activating factor, prostaglandins D2 and E2, and finally leukotrienes B4 and C

  2. Genome Sequence of Nitrosomonas communis Strain Nm2, a Mesophilic Ammonia-Oxidizing Bacterium Isolated from Mediterranean Soil.

    Science.gov (United States)

    Kozlowski, Jessica A; Kits, K Dimitri; Stein, Lisa Y

    2016-01-14

    The complete genome sequence of Nitrosomonas communis strain Nm2, a mesophilic betaproteobacterial ammonia oxidizer isolated from Mediterranean soils in Corfu, Greece, is reported here. This is the first genome to describe a cluster 8 Nitrosomonas species and represents an ammonia-oxidizing bacterium commonly found in terrestrial ecosystems. Copyright © 2016 Kozlowski et al.

  3. Genome Sequence of Nitrosomonas communis Strain Nm2, a Mesophilic Ammonia-Oxidizing Bacterium Isolated from Mediterranean Soil

    OpenAIRE

    Kozlowski, Jessica A.; Kits, K. Dimitri; Stein, Lisa Y.

    2016-01-01

    The complete genome sequence of Nitrosomonas communis strain Nm2, a mesophilic betaproteobacterial ammonia oxidizer isolated from Mediterranean soils in Corfu, Greece, is reported here. This is the first genome to describe a cluster 8 Nitrosomonas species and represents an ammonia-oxidizing bacterium commonly found in terrestrial ecosystems.

  4. COMMUNI-CARE: Assessment tool for reactions and behaviours of patients with dementia in a multisensory stimulation environment.

    Science.gov (United States)

    Lopez, José Javier Blanco; Bolívar, Juan Carlos Cejudo; Perez, Manuel Sánchez

    2016-07-01

    The 'Snoezelen' is an approach based on stimulation and sensory stimulation proposals, giving priority to the notion of caretaking. The aim of this paper is to present the creation and validation of the COMMUNI-CARE scale. This is a new tool that allows for an evaluation of the psycho-emotional well-being that the patient with dementia shows in a 'Snoezelen' multisensory stimulation environment. In total 429 evaluations in 143 multisensory stimulation interventions were made using the COMMUNI-CARE scale, in 16 patients between 53 and 85 years of age, diagnosed with moderate to severe dementia. The goal was to evaluate the psycho-emotional well-being the patients present. The tool's internal consistency showed a Crombach alpha of 0.90. The concurrent validity between the COMMUNI-CARE scale and the Clinical Global Impression (CGI) was of r = -0.961. The Kappa index used to determine the reliability between evaluators was of K = 0.87. The COMMUNI-CARE scale fulfills the basic principles of classic psychometrics of construct, and criterion validity and reliability. It does so while showing a clear idea, through its five subscales (anxiety, communication, pleasure, adaptation to the surroundings and affection), of the degree of well-being that the patient with dementia shows during such interventions. This scale embodies, through psychometrics, a very subjective human experience with a tool unavailable to date. © The Author(s) 2014.

  5. First Report of Stem Rot on Asiatic Dayflower (Commelina communis L.) Caused by Sclerotium rolfsii in Korea.

    Science.gov (United States)

    Choi, Okhee; Kwon, Jin-Hyeuk; Min, Yongsik; Kim, Jinwoo

    2011-03-01

    Stem rot was found for the first time on the Asiatic dayflower plant (Commelina communis L.) in Korea. A detailed description of this Korean specimen is given, along with its rDNA internal transcribed spacer sequence. The fungus was identified as Sclerotium rolfsii Saccardo based on mycological characteristics and molecular data.

  6. Antimicrobial Activity of Untenospongin B, a Metabolite from the Marine Sponge Hippospongia communis collected from the Atlantic Coast of Morocco

    Science.gov (United States)

    Rifai, Saida; Fassouane, Aziz; Kijjoa, Anake; Van Soest, Rob

    2004-01-01

    (−)-Untenospongin B isolated from the marine sponge Hippospongia communis has been tested for its antimicrobial activity against bacteria and human pathogenic fungi using agar disk method and was found to possess a broad and strong activity toward the test organisms. Its antifungal activity was further characterized by determination of the minimum inhibitory concentration (MIC) against five fungal species using broth microdilution method.

  7. Comparative Antimicrobial Efficacy of Eucalyptus Galbie and Myrtus Communis L. Extracts, Chlorhexidine and Sodium Hypochlorite against Enterococcus Faecalis.

    Science.gov (United States)

    Nourzadeh, Mahdieh; Amini, Arezu; Fakoor, Farzaneh; Raoof, Maryam; Sharififar, Fariba

    2017-01-01

    The aim of this study was to evaluate the antimicrobial effect of Eucalyptusgalbie and Myrtus communis L. methanolic extracts, chlorhexidine (CHX) and sodium hypochlorite (NaOCl) on Enterococcus faecalis (E. faecalis) as the predominant species isolated from infected root canals. One hundred twenty mandibular premolars were randomly divided into 8 groups: Eucalyptusgalbie (E. galbie) 12.5 mg/mL, Myrtus communis L. (M. communis L.) 6.25 mg/mL, 0.2% CHX, %2 CHX, 2.5% NaOCl, 5.25% NaOCl, positive and negative control group. Sampling was performed using paper points (from the root canal space lumen) and Gates-Glidden drills (from the dentinal tubules); then colony forming units (CFU) were counted and analyzed using the Kruskal-Wallis test, followed by Mann Whitney U test. The level of significance was set at 0.05. All irrigants reduced more than 99% of bacteria in root canal. In the presence of M. communis L. and E. galbie, the bacterial count in dentin were significantly more than CHX and NaOCl groups (P0.05). Although 5.25% NaOCl was the most effective irrigant, all agents exerted acceptable antimicrobial activity against E. faecalis.

  8. A transcriptome approach towards understanding the development of ripening capacity in European pears (Pyrus communis L. cv Bartlett)

    Science.gov (United States)

    The capacity of European pear fruit (Pyrus communis L.) to ripen after harvest develops during the final stages of growth on the tree. The objective of this study was to characterize changes in ‘Bartlett’ pear fruit physico-chemical properties and transcription profiles during fruit maturation leadi...

  9. First report of Neofabraea kienholzii causing bull’s eye rot on pear (Pyrus communis) in the Netherlands

    NARCIS (Netherlands)

    Wenneker, M.; Pham, K.T.K.; Boekhoudt, L.C.; Boer, de F.A.; Leeuwen, van P.J.; Hollinger, T.C.; Thomma, B.P.H.J.

    2017-01-01

    Pear (Pyrus communis L.) is an important fruit crop in the Netherlands, with a total production of 349,000 tons in 2014, and ‘Conference’ is the main cultivar. In the Netherlands, pears are kept in controlled atmosphere cold storage up to 11 months after harvest. Symptoms of bull’s eye rot were

  10. Polyurethane Organosilicate Nanocomposites as Blood Compatible Coatings

    Directory of Open Access Journals (Sweden)

    Johnson H. Y. Chung

    2012-02-01

    Full Text Available Polymer clay nanocomposites (NCs show remarkable potential in the field of drug delivery due to their enhanced barrier properties. It is hypothesised that well dispersed clay particles within the polymer matrix create a tortuous pathway for diffusing therapeutic molecules, thereby resulting in more sustained release of the drug. As coatings for medical devices, these materials can simultaneously modulate drug release and improve the mechanical performance of an existing polymer system without introducing additional materials with new chemistries that can lead to regulatory concerns. In this study, polyurethane organosilicate nanocomposites (PUNCs coated onto stainless steel wires were evaluated for their feasibility as blood compatible coatings and as drug delivery systems. Heparin was selected as the model drug to examine the impact of silicate loading and modifier chain length in modulating release. Findings revealed that better dispersion was achieved from samples with lower clay loadings and longer alkyl chains. The blood compatibility of PUNCs as assessed by thrombin generation assays showed that the addition of silicate particles did not significantly decrease the thrombin generation lag time (TGT, p = 0.659 or the peak thrombin (p = 0.999 of polyurethane (PU. PUNC coatings fabricated in this research were not cytotoxic as examined by the cell growth inhibition assay and were uniformly intact, but had slightly higher growth inhibition compared to PU possibly due to the presence of organic modifiers (OM. The addition of heparin into PUNCs prolonged the TGT, indicating that heparin was still active after the coating process. Cumulative heparin release profiles showed that the majority of heparin released was from loosely attached residues on the surface of coils. The addition of heparin further prolonged the TGT as compared to coatings without added heparin, but a slight decrease in heparin activity was observed in the NCs

  11. Component composition of essential oils and ultrastructure of secretory cells of resin channel needles Juniperus communis (Cupressaceae

    Directory of Open Access Journals (Sweden)

    N. V. Gerling

    2015-12-01

    Full Text Available The results of determining the qualitative and quantitative composition of essential oil Juniperus communis, growing under the canopy of spruce blueberry sphagnum subzone middle taiga. Juniperus communis essential oil is liquid light yellow color. The content of essential oil was 0.46 % in shoots with needles. 37 substances of components identified. Mass fraction of components in the essential oil of Juniperus communis reached 89 %. The highest percentage of occupied fraction of monoterpenes (82.3 %, the proportion of sesquiterpenes less than 0.5 % of the total composition of essential oils, alcohols 3.5 and 0.7 % esters. In monoterpenes fraction predominant α-pinene (24.5–32.6 %, β-pinene (15–20.3 % and α-phellandrene (6.4–8.8 %. Essential oil of Juniperus communis is characterized by high content of monoterpenoids in contrast to other conifers of the taiga zone. All stages of biosynthesis essential oils occur in the epithelial cells of the resin channel (terpenoidogennyh cells. An oval shape have epithelial cells of the resin channel needles in transverse sections the Juniperus communis, which is situated vacuole in the center. Large number of lipid globules (up to 40 noted in the hyaloplasm of explored cells. Leucoplasts surrounded by membranes of smooth endoplasmic reticulum in cross sections of epithelial cells in resin channel of juniper. Endoplasmic reticulum is poorly developed in epithelial cells, which corresponds to the low content of sesquiterpenes in the needles during the study period. Development of large leucoplasts and large number of mitochondria associated with predominance of synthesis monoterpenoids the in the epithelium cells resin channel.

  12. Range expansion of Ixodes ricinus to higher altitude, and co-infestation of small rodents with Dermacentor marginatus in the Northern Apennines, Italy.

    Science.gov (United States)

    Martello, Elisa; Mannelli, Alessandro; Ragagli, Charlotte; Ambrogi, Cecilia; Selmi, Marco; Ceballos, Leonardo A; Tomassone, Laura

    2014-10-01

    Immature ticks (Ixodes ricinus and Dermacentor marginatus) were collected from small rodents (Apodemus spp. and Myodes glareolus), in the Northern Apennines, Italy, at an altitude up to 1650 m above sea level (a.s.l.), from 2009 through 2012. While D. marginatus had been found at the same location in studies carried out in 1994, I. ricinus was very rare or absent. Prevalence (95% confidence interval) of infestation by I. ricinus larvae on Apodemus spp. was 54.4% (47.5, 61.2), and it was greater than prevalence of D. marginatus larvae on the same hosts (23.3%, 17.8, 29.5). The mean (standard deviation) numbers of I. ricinus and D. marginatus larvae per individual Apodemus spp. were similar: 2.3 (4.1) and 2.1 (9.8), respectively. The monthly infestation pattern of the two tick species on Apodemus spp. were different. I. ricinus larvae were more frequent in June and September, than in July-August. I. ricinus nymphs were generally rare, and were most frequently found in July. The prevalence of D. marginatus larvae peaked in July-August, whereas nymphs were mostly active in August-September. Increasing population densities of roe deer (Capreolus capreolus), and increasing temperatures, in the last decades, in the Apennine area might have contributed to the observed range expansion of I. ricinus. Copyright © 2014 Elsevier GmbH. All rights reserved.

  13. 40 CFR 721.8079 - Isophorone diisocyanate neopentyl glycol adipate polyurethane prepolymer.

    Science.gov (United States)

    2010-07-01

    ... glycol adipate polyurethane prepolymer. 721.8079 Section 721.8079 Protection of Environment ENVIRONMENTAL... adipate polyurethane prepolymer. (a) Chemical substance and significant new uses subject to reporting. (1... polyurethane prepolymer (PMN P-94-1743) is subject to reporting under this section for the significant new uses...

  14. 40 CFR 63.1293 - Standards for slabstock flexible polyurethane foam production.

    Science.gov (United States)

    2010-07-01

    ... polyurethane foam production. 63.1293 Section 63.1293 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... CATEGORIES National Emission Standards for Hazardous Air Pollutants for Flexible Polyurethane Foam Production § 63.1293 Standards for slabstock flexible polyurethane foam production. Each owner or operator of a...

  15. 40 CFR 63.1300 - Standards for molded flexible polyurethane foam production.

    Science.gov (United States)

    2010-07-01

    ... polyurethane foam production. 63.1300 Section 63.1300 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... CATEGORIES National Emission Standards for Hazardous Air Pollutants for Flexible Polyurethane Foam Production § 63.1300 Standards for molded flexible polyurethane foam production. Each owner or operator of a new...

  16. 40 CFR 63.1294 - Standards for slabstock flexible polyurethane foam production-diisocyanate emissions.

    Science.gov (United States)

    2010-07-01

    ... polyurethane foam production-diisocyanate emissions. 63.1294 Section 63.1294 Protection of Environment... Flexible Polyurethane Foam Production § 63.1294 Standards for slabstock flexible polyurethane foam... that does not remain in diisocyanate service. (2) Delay of repair for valves and connectors is also...

  17. Polyurethanes for potential use in transparent armour investigated using DSC and DMA

    NARCIS (Netherlands)

    Ekeren, P.J. van; Carton, E.P.

    2011-01-01

    A material combination that may be applied as transparent armour is glass-clad polyurethane. These are comprised of a relatively thin glass strike face and a relatively thick (transparent) polyurethane backing layer. Three transparent polyurethane samples were investigated using differential

  18. Rheokinetics and effect of shear rate on the kinetics of linear polyurethane formation

    NARCIS (Netherlands)

    Navarchian, AH; Picchioni, F; Janssen, LPBM

    In this article, the rheokinetics of polyurethane formation and the influence of shear rate on its kinetics have been studied. Two different linear polyurethane systems with 0% and 100% hard segments are examined in a cone and plate rheometer. The isothermal increase of viscosity during polyurethane

  19. Response of Polyurethane to Shock Waves: An Experimental Investigation

    Science.gov (United States)

    Jayaram, V.; Rao, Keshava Subba; Thanganayaki, N.; Kumara, H. K. T.; Reddy, K. P. J.

    Formation of polyurethane (PU) in vacuum environment and controlling density of polyurethane foams are the present day challenges. Polyurethane exists in numerous forms ranging from flexible to rigid and lightweight foams to tough, stiff elastomers [1]. PU can be used to produce lightweight foams for insulation or hard rubber used as wheels to transport heavy loads and it can be used in high pressure applications. The largest volumes of commercial PU elastomers are made from toluene diisocyanate (TDI) or diphenylmethane-4, 4'-diisocyanate (MDI) [2]. Linear polyurethanes can be processed into final products by any of the standard thermoplastic processes (injection molding, extrusion, thermoforming) as well as by low pressure cast processes in presence of catalysts. Tin, tetrabutyl titanate and zirconium chelates are few effective catalysts used to produce polyurethane for particular application [3]. Thermoset elastomers are formed due to irreversible cross-links, when polymers are chemically cured. Highly porous biodegradable PU was synthesized by thermally induced phase separation technique used in tissue engineering and also in bio-degradable based fluids [4]. Properties of PU like hardness, stress/strain modulus, tear strength etc, was determine using ASTM (American Society for Testing and Materials) standard methods. PU possesses extremely high mechanical properties, excellent abrasion, tear and extrusion resistance. It has outstanding low-temperature limit (-600C) and high temperature limit up to (1500C).

  20. Unified Creep Plasticity Damage (UCPD) Model for Rigid Polyurethane Foams.

    Energy Technology Data Exchange (ETDEWEB)

    Neilsen, Michael K. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Lu, Wei-Yang [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Scherzinger, William M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hinnerichs, Terry D. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Lo, Chi S. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-06-01

    Numerous experiments were performed to characterize the mechanical response of several different rigid polyurethane foams (FR3712, PMDI10, PMDI20, and TufFoam35) to large deformation. In these experiments, the effects of load path, loading rate, and temperature were investigated. Results from these experiments indicated that rigid polyurethane foams exhibit significant volumetric and deviatoric plasticity when they are compressed. Rigid polyurethane foams were also found to be very strain-rate and temperature dependent. These foams are also rather brittle and crack when loaded to small strains in tension or to larger strains in compression. Thus, a new Unified Creep Plasticity Damage (UCPD) model was developed and implemented into SIERRA with the name Foam Damage to describe the mechanical response of these foams to large deformation at a variety of temperatures and strain rates. This report includes a description of recent experiments and experimental findings. Next, development of a UCPD model for rigid, polyurethane foams is described. Selection of material parameters for a variety of rigid polyurethane foams is then discussed and finite element simulations with the new UCPD model are compared with experimental results to show behavior that can be captured with this model.

  1. Efficacy of Myrtus communis L. and Descurainia sophia L. Versus Salicylic Acid for Wart Treatment.

    Science.gov (United States)

    Ghadami Yazdi, Elham; Minaei, Mohamad Bagher; Hashem Dabaghian, Fataneh; Ebrahim Zadeh Ardakani, Mohamad; Ranjbar, Ali Mohammad; Rastegari, Mohamad; Ghadami Yazdi, Ali

    2014-10-01

    Wart is a skin disease with circular appendages, which is called "suloul" in Iranian traditional medicine (ITM). According to ITM literature, warts have different types and causes. The most important mechanism is excretion of materials (Khelt) from body to skin and mucus; its causative material is often phlegm, black bile or a combination of them. To treat warts, it is necessary to consider the patient's life style, modify his dietary intake and moisturize his temperament. This study aimed to compare Myrtus communis L. and Descurainia sophia L. as a method of ITM, versus salicylic acid in treatment of wart. In this study, conducted in Yazd, Iran, 100 patients were selected and randomly divided into four groups. Group 1) salicylic acid, group 2) salicylic acid and D. sophia L. group 3) M. communis L. group 4) M. communis L. and D. sophia L. Numbers, sizes of lesions and symptoms, on days 0, 20, 40 and 90 were examined and analyzed. The relapse rate was investigated three months after. Changes of sizes and numbers of warts in each period of time in each group, compared to baseline, were assessed by Wilcoxon Signed Rank test. To compare these changes between the groups, Kruskal Wallis test was used. In this study 100 patients participated, 69% of which were female. Compared to baseline, mean ± SD of changes for the number of warts in day 40 were 1.12 ± 4.2, 0.96 ± 2.5, 1.32 ± 5.1 and 0.04 ± 0.2 respectively in the four groups (P = 0.02). Mean ± SD of changes for the number of warts in day 90 were 1.84 ± 4.5, 1.56 ± 2.8, 1.24 ± 5.1 and 0.04 ± 0.6 respectively in the four groups (P = 0.03). In addition mean ± SD of changes for the size of warts in day 40 were 0.96 ± 1.8, 1.03 ± 2.4, 2.47 ± 3.0 and 0.45 ± 1.7 respectively in the four groups (P sophia L. can modify the digestion process and patients can excrete large amounts of the substance that causes warts. Therefore, it is better to use it more than 40 days. According to our investigation, in ITM

  2. Melt electrospinning of biodegradable polyurethane scaffolds

    Science.gov (United States)

    Karchin, Ari; Simonovsky, Felix I.; Ratner, Buddy D.; Sanders, Joan E.

    2014-01-01

    Electrospinning from the melt, in contrast to from solution, is an attractive tissue engineering scaffold manufacturing process as it allows for the formation of small diameter fibers while eliminating potentially cytotoxic solvents. Despite this, there is a dearth of literature on scaffold formation via melt electrospinning. This is likely due to the technical challenges related to the need for a well-controlled high temperature setup and the difficulty in developing an appropriate polymer. In this paper, a biodegradable and thermally stable polyurethane (PU) is described specifically for use in melt electrospinning. Polymer formulations of aliphatic PUs based on (CH2)4-content diisocyanates, polycaprolactone (PCL), 1,4-butanediamine and 1,4-butanediol (BD) were evaluated for utility in the melt electrospinning process. The final polymer formulation, a catalyst-purified PU based on 1,4-butane diisocyanate, PCL and BD in a 4/1/3 molar ratio with a weight-average molecular weight of about 40 kDa, yielded a nontoxic polymer that could be readily electrospun from the melt. Scaffolds electrospun from this polymer contained point bonds between fibers and mechanical properties analogous to many in vivo soft tissues. PMID:21640853

  3. Biodegradation of Polyester Polyurethane by Endophytic Fungi▿

    Science.gov (United States)

    Russell, Jonathan R.; Huang, Jeffrey; Anand, Pria; Kucera, Kaury; Sandoval, Amanda G.; Dantzler, Kathleen W.; Hickman, DaShawn; Jee, Justin; Kimovec, Farrah M.; Koppstein, David; Marks, Daniel H.; Mittermiller, Paul A.; Núñez, Salvador Joel; Santiago, Marina; Townes, Maria A.; Vishnevetsky, Michael; Williams, Neely E.; Vargas, Mario Percy Núñez; Boulanger, Lori-Ann; Bascom-Slack, Carol; Strobel, Scott A.

    2011-01-01

    Bioremediation is an important approach to waste reduction that relies on biological processes to break down a variety of pollutants. This is made possible by the vast metabolic diversity of the microbial world. To explore this diversity for the breakdown of plastic, we screened several dozen endophytic fungi for their ability to degrade the synthetic polymer polyester polyurethane (PUR). Several organisms demonstrated the ability to efficiently degrade PUR in both solid and liquid suspensions. Particularly robust activity was observed among several isolates in the genus Pestalotiopsis, although it was not a universal feature of this genus. Two Pestalotiopsis microspora isolates were uniquely able to grow on PUR as the sole carbon source under both aerobic and anaerobic conditions. Molecular characterization of this activity suggests that a serine hydrolase is responsible for degradation of PUR. The broad distribution of activity observed and the unprecedented case of anaerobic growth using PUR as the sole carbon source suggest that endophytes are a promising source of biodiversity from which to screen for metabolic properties useful for bioremediation. PMID:21764951

  4. Nano-Aramid Fiber Reinforced Polyurethane Foam

    Science.gov (United States)

    Semmes, Edmund B.; Frances, Arnold

    2008-01-01

    Closed cell polyurethane and, particularly, polyisocyanurate foams are a large family of flexible and rigid products the result of a reactive two part process wherein a urethane based polyol is combined with a foaming or "blowing" agent to create a cellular solid at room temperature. The ratio of reactive components, the constituency of the base materials, temperature, humidity, molding, pouring, spraying and many other processing techniques vary greatly. However, there is no known process for incorporating reinforcing fibers small enough to be integrally dispersed within the cell walls resulting in superior final products. The key differentiating aspect from the current state of art resides in the many processing technologies to be fully developed from the novel concept of milled nano pulp aramid fibers and their enabling entanglement capability fully enclosed within the cell walls of these closed cell urethane foams. The authors present the results of research and development of reinforced foam processing, equipment development, strength characteristics and the evolution of its many applications.

  5. Carboxylated Polyurethanes Containing Hyperbranched Polyester Soft Segments

    Directory of Open Access Journals (Sweden)

    Žigon, M.

    2006-09-01

    Full Text Available hyperbranched polyester soft segments (HB PU with functional carboxylic groups in order to enable the preparation of stable HB PU dispersions. Carboxylated hyperbranched polyurethanes were synthesized using a hyperbranched polyester based on 2,2-bis(methylolpropionic acid of the fourth pseudo-generation (Boltorn H40 and hexamethylene (HDI or isophorone diisocyanate (IPDI. The reactivity of hyperbranched polyester with HDI was lower than expected, possibly due to the presence of less reactive hydroxyl groups in the linear repeat units. A gel was formed at mole ratios rNCO/OH = 1:2 or 1:4. The synthesis of HB PU was performed with partly esterified hyperbranched polyester with lowered hydroxyl functionality. The carboxyl groups were incorporated in the HB PU backbone by reaction of residual hydroxyl groups with cis-1,2-cyclohexanedicarboxylic anhydride. HB PU aqueous dispersions were stable at least for two months, although their films were brittle. The tensile strength and Young's modulus of blends of linear and HB PU decreased with increasing content of HB PU whereas elongation at break remained nearly constant, which was explained in terms of looser chain packing due to more open tree-like hyperbranched structures.

  6. Biodegradation of polyester polyurethane by endophytic fungi.

    Science.gov (United States)

    Russell, Jonathan R; Huang, Jeffrey; Anand, Pria; Kucera, Kaury; Sandoval, Amanda G; Dantzler, Kathleen W; Hickman, DaShawn; Jee, Justin; Kimovec, Farrah M; Koppstein, David; Marks, Daniel H; Mittermiller, Paul A; Núñez, Salvador Joel; Santiago, Marina; Townes, Maria A; Vishnevetsky, Michael; Williams, Neely E; Vargas, Mario Percy Núñez; Boulanger, Lori-Ann; Bascom-Slack, Carol; Strobel, Scott A

    2011-09-01

    Bioremediation is an important approach to waste reduction that relies on biological processes to break down a variety of pollutants. This is made possible by the vast metabolic diversity of the microbial world. To explore this diversity for the breakdown of plastic, we screened several dozen endophytic fungi for their ability to degrade the synthetic polymer polyester polyurethane (PUR). Several organisms demonstrated the ability to efficiently degrade PUR in both solid and liquid suspensions. Particularly robust activity was observed among several isolates in the genus Pestalotiopsis, although it was not a universal feature of this genus. Two Pestalotiopsis microspora isolates were uniquely able to grow on PUR as the sole carbon source under both aerobic and anaerobic conditions. Molecular characterization of this activity suggests that a serine hydrolase is responsible for degradation of PUR. The broad distribution of activity observed and the unprecedented case of anaerobic growth using PUR as the sole carbon source suggest that endophytes are a promising source of biodiversity from which to screen for metabolic properties useful for bioremediation.

  7. 2-hydroxyethyl methacrylate-terminated polyurethane/polyurethane interpenetrating polymer networks.

    Science.gov (United States)

    Liu, C J; Hsieh, K H; Ho, K S; Hsieh, T T

    1997-02-01

    The interpenetrating polymer networks (INPs) of polyurethane (PU) and 2-hydroxyethyl methacrylate (MEHA)-terminated polyurethane (HPU) were prepared by solution polymerization. PU prepolymer was synthesized from 4,4-diphenyl methane diisocyanate (MDI) and poly(propylene oxide) glycol (PPG). HPU prepolymer was synthesized from MDI, poly(tetramethylene oxide) glycol and HEMA. Dynamic mechanical analysis showed that the resultant IPN membranes have good compatibility between their constituents. As the HPU content increased, the tensile strength of the IPNs first increased and then decreased. For the highest tensile strength, the optimum HPU content was about 25 wt %. The value of surface tension of IPNs varied from 44.4 to 50.5 dyne/cm, and polarity ranged from 0.59 to 0.91. The relative index of platelet adhesion (RIPA) of the IPN membranes was measured by the dynamic thrombosis test at constant shaking speed and temperature. By the criteria of this test, the IPN membranes with HPU content of about 25 wt% to the minimum platelet adhesion. When measured by the angular dependent ESCA technique on the surface of IPN samples, the variation in the RIPA correlated to the change in the surface soft segment to hard segment ratio. Higher HPU content resulted in more migration of soft segments toward the surface. The platelet adhesion was observed to be minimized when the surface O/N ratio was around 12.

  8. Functional characterization of two defensin isoforms of the hard tick Ixodes ricinus

    Directory of Open Access Journals (Sweden)

    Růžek Daniel

    2011-04-01

    Full Text Available Abstract Background The immune system of ticks is stimulated to produce many pharmacologically active molecules during feeding and especially during pathogen invasion. The family of cationic peptides - defensins - represents a specific group of antimicrobial compounds with six conserved cysteine residues in a molecule. Results Two isoforms of the defensin gene (def1 and def2 were identified in the European tick Ixodes ricinus. Expression of both genes was induced in different tick organs by a blood feeding or pathogen injection. We have tested the ability of synthetic peptides def1 and def2 to inhibit the growth or directly kill several pathogens. The antimicrobial activities (expressed as minimal inhibition concentration and minimal bactericidal concentration values against Gram positive bacteria were confirmed, while Gram negative bacteria, yeast, Tick Borne Encephalitis and West Nile Viruses were shown to be insensitive. In addition to antimicrobial activities, the hemolysis effect of def1 and def2 on human erythrocytes was also established. Conclusions Although there is nothing known about the realistic concentration of defensins in I. ricinus tick body, these results suggest that defensins play an important role in defence against different pathogens. Moreover this is a first report of a one amino acid substitution in a defensins molecule and its impact on antimicrobial activity.

  9. Prevalence and Diversity among Anaplasma phagocytophilum Strains Originating from Ixodes ricinus Ticks from Northwest Norway

    Directory of Open Access Journals (Sweden)

    Ann-Kristin Tveten

    2014-01-01

    Full Text Available The tick-borne pathogen Anaplasma phagocytophilum causes great concern for livestock farmers. Tick-borne fever is a widespread disease in Norway, and antibodies have been produced amongst sheep, roe deer, red deer, and moose. The main vector Ixodes ricinus is found along the Norwegian coastline as far north as the Arctic Circle. A total number of 1804 I. ricinus ticks were collected and the prevalence of the pathogen was determined by species-specific qPCR. The overall infection rate varied from 2.83% to 3.32%, but there were no significant differences (p=0.01 in the overall infection rate in 2010, 2011, or 2012. A multilocus sequencing analysis was performed to further characterise the isolates. The genotyping of 27 strains resulted in classification into 19 different sequences types (ST, none of which was found in the MLST database. The nucleotide diversity was for every locus <0.01, and the number of SNPs was between 1 and 2.8 per 100 bp. The majority of SNPs were synonymous. A goeBURST analysis demonstrated that the strains from northwest Norway cluster together with other Norwegian strains in the MLST database and the strains that are included in this study constitute clonal complexes (CC 9, 10, and 11 in addition to the singleton.

  10. Prevalence of pathogenic bacteria in Ixodes ricinus ticks in Central Bohemia.

    Science.gov (United States)

    Klubal, Radek; Kopecky, Jan; Nesvorna, Marta; Sparagano, Olivier A E; Thomayerova, Jana; Hubert, Jan

    2016-01-01

    Bacteria associated with the tick Ixodes ricinus were assessed in specimens unattached or attached to the skin of cats, dogs and humans, collected in the Czech Republic. The bacteria were detected by PCR in 97 of 142 pooled samples including 204 ticks, i.e. 1-7 ticks per sample, collected at the same time from one host. A fragment of the bacterial 16S rRNA gene was amplified, cloned and sequenced from 32 randomly selected samples. The most frequent sequences were those related to Candidatus Midichloria midichlori (71% of cloned sequences), followed by Diplorickettsia (13%), Spiroplasma (3%), Rickettsia (3%), Pasteurella (3%), Morganella (3%), Pseudomonas (2%), Bacillus (1%), Methylobacterium (1%) and Phyllobacterium (1%). The phylogenetic analysis of Spiroplasma 16S rRNA gene sequences showed two groups related to Spiroplasma eriocheiris and Spiroplasma melliferum, respectively. Using group-specific primers, the following potentially pathogenic bacteria were detected: Borellia (in 20% of the 142 samples), Rickettsia (12%), Spiroplasma (5%), Diplorickettsia (5%) and Anaplasma (2%). In total, 68% of I. ricinus samples (97/142) contained detectable bacteria and 13% contained two or more putative pathogenic groups. The prevalence of tick-borne bacteria was similar to the observations in other European countries.

  11. Variability and action mechanism of a family of anticomplement proteins in Ixodes ricinus.

    Directory of Open Access Journals (Sweden)

    Bernard Couvreur

    Full Text Available BACKGROUND: Ticks are blood feeding arachnids that characteristically take a long blood meal. They must therefore counteract host defence mechanisms such as hemostasis, inflammation and the immune response. This is achieved by expressing batteries of salivary proteins coded by multigene families. METHODOLOGY/PRINCIPAL FINDINGS: We report the in-depth analysis of a tick multigene family and describe five new anticomplement proteins in Ixodes ricinus. Compared to previously described Ixodes anticomplement proteins, these segregated into a new phylogenetic group or subfamily. These proteins have a novel action mechanism as they specifically bind to properdin, leading to the inhibition of C3 convertase and the alternative complement pathway. An excess of non-synonymous over synonymous changes indicated that coding sequences had undergone diversifying selection. Diversification was not associated with structural, biochemical or functional diversity, adaptation to host species or stage specificity but rather to differences in antigenicity. CONCLUSIONS/SIGNIFICANCE: Anticomplement proteins from I. ricinus are the first inhibitors that specifically target a positive regulator of complement, properdin. They may provide new tools for the investigation of role of properdin in physiological and pathophysiological mechanisms. They may also be useful in disorders affecting the alternative complement pathway. Looking for and detecting the different selection pressures involved will help in understanding the evolution of multigene families and hematophagy in arthropods.

  12. Transport of Babesia venatorum-infected Ixodes ricinus to Norway by northward migrating passerine birds

    Directory of Open Access Journals (Sweden)

    Røed Knut H

    2011-06-01

    Full Text Available Abstract Background Bovine babesiosis is regarded as a limited health problem for Norwegian cows, and the incidence has decreased markedly since the 1930s. Rare cases of babesiosis in splenectomised humans from infection with Babesia divergens and B.venatorum have been described. The objective of this study was to determine whether birds can introduce Babesia-infected ticks. There are between 30 and 85 million passerine birds that migrate to Norway every spring. Methods Passerine birds were examined for ticks at four bird observatories along the southern Norwegian coast during the spring migrations of 2003, 2004 and 2005. The presence of Babesia was detected in the nymphs of Ixodes ricinus by real-time PCR. Positive samples were confirmed using PCR, cloning and phylogenetic analyses. Results Of 512 ticks examined, real-time PCR revealed five to be positive (1.0%. Of these, four generated products that indicated the presence of Babesia spp.; each of these were confirmed to be from Babesia venatorum (EU1. Two of the four B. venatorum-positive ticks were caught from birds having an eastern migratory route (P Conclusions Birds transport millions of ticks across the North Sea, the Skagerrak and the Kattegat every year. Thus, even with the low prevalence of Babesia-infected ticks, a substantial number of infected ticks will be transported into Norway each year. Therefore, there is a continuous risk for introduction of new Babesia spp. into areas where I. ricinus can survive.

  13. Fourier transform infrared spectroscopy of DNA from Borrelia burgdorferi sensu lato and Ixodes ricinus ticks

    Science.gov (United States)

    Muntean, Cristina M.; Stefan, Razvan; Bindea, Maria; Cozma, Vasile

    2013-06-01

    In this work we present a method for detection of motile and immotile Borrelia burgdorferi genomic DNA, in relation with infectious and noninfectious spirochetes. An FT-IR study of DNA isolated from B. burgdorferi sensu lato strains and from positive and negative Ixodes ricinus ticks, respectively, is reported. Motile bacterial cells from the species B. burgdorferi sensu stricto, Borrelia garinii and Borrelia afzelii were of interest. Also, FT-IR absorbance spectra of DNA from immotile spirochetes of B. burgdorferi sensu stricto, in the absence and presence of different antibiotics (doxycycline, erythromycin, gentamicin, penicillin V or phenoxymethylpenicillin, tetracycline, respectively) were investigated. FT-IR spectra, providing a high molecular structural information, have been analyzed in the wavenumber range 400-1800 cm-1. FT-IR signatures, spectroscopic band assignments and structural interpretations of these DNAs are reported. Spectral differences between FT-IR absorbances of DNAs from motile bacterial cells and immotile spirochetes, respectively, have been found. Particularly, alterations of the sugar-phosphate B-form chain in the case of DNA from Borrelia immotile cells, as compared with DNA from B. burgdorferi sensu lato motile cells have been observed. Based on this work, specific B. burgdorferi sensu lato and I. ricinus DNA-ligand interactions, respectively, might be further investigated using Fourier transform infrared spectroscopy.

  14. Multi-criteria Decision Analysis to Model Ixodes ricinus Habitat Suitability.

    Science.gov (United States)

    Rousseau, Raphaël; McGrath, Guy; McMahon, Barry J; Vanwambeke, Sophie O

    2017-09-01

    Tick-borne diseases present a major threat to both human and livestock health throughout Europe. The risk of infection is directly related to the presence of its vector. Thereby it is important to know their distribution, which is strongly associated with environmental factors: the presence and availability of a suitable habitat, of a suitable climate and of hosts. The present study models the habitat suitability for Ixodes ricinus in Ireland, where data on tick distribution are scarce. Tick habitat suitability was estimated at a coarse scale (10 km) with a multi-criteria decision analysis (MCDA) method according to four different scenarios (depending on the variables used and on the weights granted to each of them). The western part of Ireland and the Wicklow mountains in the East were estimated to be the most suitable areas for I. ricinus in the island. There was a good level of agreement between results from the MCDA and recorded tick presence. The different scenarios did not affect the spatial outputs substantially. The current study suggests that tick habitat suitability can be mapped accurately at a coarse scale in a data-scarce context using knowledge-based methods. It can serve as a guideline for future countrywide sampling that would help to determine local risk of tick presence and refining knowledge on tick habitat suitability in Ireland.

  15. Seroprevalence of seven pathogens transmitted by the Ixodes ricinus tick in forestry workers in France.

    Science.gov (United States)

    Rigaud, E; Jaulhac, B; Garcia-Bonnet, N; Hunfeld, K-P; Féménia, F; Huet, D; Goulvestre, C; Vaillant, V; Deffontaines, G; Abadia-Benoist, G

    2016-08-01

    In order to assess the level of occupational exposure to the main pathogens transmitted by the Ixodes ricinus tick, a seroprevalence study was performed on serum samples collected in 2003 from 2975 forestry workers of northeastern France. The global seroprevalence estimated for the seven pathogens studied was 14.1% (419/2975) for Borrelia burgdorferi sl, 5.7% (164/2908) for Francisella tularensis, 2.3% (68/2941) for tick-borne encephalitis virus, 1.7% (50/2908) for Anaplasma phagocytophilum and 1.7% (48/2908) for Bartonella henselae. The seroprevalences of Babesia divergens and Babesia microti studied in a subgroup of participants seropositive for at least one of these latter pathogens were 0.1% (1/810) and 2.5% (20/810), respectively. Borrelia burgdorferi sl seroprevalence was significantly higher in Alsace and Lorraine and F. tularensis seroprevalence was significantly higher in Champagne-Ardenne and Franche-Comté. The results of this survey also suggest low rates of transmission of Bartonella henselae and F. tularensis by ticks and a different west/east distribution of Babesia species in France. The frequency and potential severity of these diseases justify continued promotion of methods of prevention of I. ricinus bites. Copyright © 2016 European Society of Clinical Microbiology and Infectious Diseases. Published by Elsevier Ltd. All rights reserved.

  16. Deconstructing Ixodes ricinus: a partial matrix model allowing mapping of tick development, mortality and activity rates.

    Science.gov (United States)

    Estrada-Peña, A; Estrada-Sánchez, D

    2014-03-01

    A stage-structured Leslie matrix model of a partial, discrete population of Ixodes ricinus (Linnaeus) (Ixodida: Ixodidae) ticks was developed to elucidate the impact of climate trends on the distribution and phenology of this species in the western Palaearctic. The model calculates development and mortality rates for each instar and evaluates recruitment rates based on the development of the tick population. The model captures the changes in development and mortality rates, providing a coherent index of performance correlated with the tick's geographic range. Maximum development rates are recorded for latitudes south of 36 °N and are spatially correlated with sites of maximum temperature, highest saturation deficit and highest mortality. The maximum available developmental time (the total annual time during which temperature allows development) for I. ricinus in the western Palaearctic is < 45% of the total year. North of 60 °N, available developmental time decreases sharply to only 15% of the year. The latitudinal boundary at which survival rates sharply drop is 43-46 °N, clearly delimiting the classically recognized extent of the main tick populations. The pattern of activity for larval-nymphal synchrony shows a clear west-east pattern. The model demonstrates the impact of climate according to tick stage and geographic location, and provides a practical framework for testing how the tick's lifecycle is affected by climate change. © 2013 The Royal Entomological Society.

  17. Genetic diversity of Salp15 in the Ixodes ricinus complex (Acari: Ixodidae.

    Directory of Open Access Journals (Sweden)

    Xin Wang

    Full Text Available Salp15, a 15-kDa tick salivary gland protein, is both essential for ticks to successfully obtain host blood and also facilitates transmission of Lyme borreliosis. To determine whether the Salp15 gene is expressed in Ixodes persulcatus and Ixodes sinensis, principle vectors of Lyme borreliosis in China, we studied transcriptions of this gene in semi-engorged larvae, nymph and adults of these two species. A total of eight Salp15 homologues, five in I. persulcatus and three in I. sinensis, were identified by reverse transcriptase-polymerase chain reaction (RT-PCR. Interestingly, the intra-species similarity of Salp15 is approximately equal to its interspecies similarity and more than one Salp15 protein is expressed in a certain tick developmental stage. Comparison of DNA and proteins with other available tick Salp15 homologues suggests that the Salp15 superfamily is genetically conserved and diverse in the Ixodes ricinus complex. These findings indicate that Salp15 proteins in the I. ricinus complex may play an essential role in interacting with the host immune system and transmission of Borrelia genospecies.

  18. Rickettsiaceae and Anaplasmataceae infections in Ixodes ricinus ticks from urban and natural forested areas of Poland

    Science.gov (United States)

    2014-01-01

    Background Ixodes ricinus is a major vector for a range of microbial pathogens and the most prevalent and widely distributed tick species on the European continent, occurring in both natural and urban habitats. Nevertheless, little is known about the relative density of ticks in these two ecologically distinct habitats and the diversity of tick-borne pathogens that they carry. Methods We compared densities of questing I. ricinus nymphs and adults in urban and natural habitats in Central and Northeastern Poland, assessed the prevalence and rate of co-infection with A. phagocytophilum, Rickettsia, Ehrlichia and ‘Ca. Neoehrlichia spp.’ in ticks, and compared the diversity of tick-borne pathogens using molecular assays (PCR). Results Of the 1325 adults and nymphs, 6.2% were infected with at least one pathogen, with 4.4%, 1.7% and less than 0.5% being positive for the DNA of Rickettsia spp., A. phagocytophilum, Ehrlichia spp. and Ca. N. mikurensis, respectively. Although tick abundance was higher in natural habitats, the prevalence of the majority of pathogens was higher in urban forested areas. Conclusion We conclude that: (i) zoonotic genetic variants of A. phagocytophilum are widely distributed in the Polish tick population, (ii) although the diversity of tick borne pathogens was higher in natural habitats, zoonotic species/strains were detected only in urban forests, (iii) and we provide the first description of Ca. N. mikurensis infections in ticks in Poland. PMID:24661311

  19. Genetic Diversity of Salp15 in the Ixodes ricinus Complex (Acari: Ixodidae)

    Science.gov (United States)

    Wang, Xin; Huang, Yong; Niu, Si-bo; Jiang, Bao-Gui; Jia, Na; van der Geest, Leo; Ni, Xue-bing; Sun, Yi; Cao, Wu-Chun

    2014-01-01

    Salp15, a 15-kDa tick salivary gland protein, is both essential for ticks to successfully obtain host blood and also facilitates transmission of Lyme borreliosis. To determine whether the Salp15 gene is expressed in Ixodes persulcatus and Ixodes sinensis, principle vectors of Lyme borreliosis in China, we studied transcriptions of this gene in semi-engorged larvae, nymph and adults of these two species. A total of eight Salp15 homologues, five in I. persulcatus and three in I. sinensis, were identified by reverse transcriptase–polymerase chain reaction (RT-PCR). Interestingly, the intra-species similarity of Salp15 is approximately equal to its interspecies similarity and more than one Salp15 protein is expressed in a certain tick developmental stage. Comparison of DNA and proteins with other available tick Salp15 homologues suggests that the Salp15 superfamily is genetically conserved and diverse in the Ixodes ricinus complex. These findings indicate that Salp15 proteins in the I. ricinus complex may play an essential role in interacting with the host immune system and transmission of Borrelia genospecies. PMID:24714063

  20. Coexistence of emerging bacterial pathogens in Ixodes ricinus ticks in Serbia*

    Directory of Open Access Journals (Sweden)

    Tomanović S.

    2010-09-01

    Full Text Available The list of tick-borne pathogens is long, varied and includes viruses, bacteria, protozoa and nematodes. As all of these agents can exist in ticks, their co-infections have been previously reported. We studied co-infections of emerging bacterial pathogens (Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum and Francisella tularensis in Ixodes ricinus ticks in Serbia. Using PCR technique, we detected species-specific sequences, rrf-rrl rDNA intergenic spacer for B. burgdorferi s.l., p44/msp2 paralogs for A. phagocytophilum, and the 17 kDa lipoprotein gene, TUL4, for F. tularensis, respectively, in total DNA extracted from the ticks. Common infections with more than one pathogen were detected in 42 (28.8 % of 146 infected I. ricinus ticks. Co-infections with two pathogens were present in 39 (26.7 % of infected ticks. Simultaneous presence of A. phagocytophilum and different genospecies of B. burgdorferi s.l. complex was recorded in 16 ticks, co-infection with different B. burgdorferi s. l. genospecies was found in 15 ticks and eight ticks harbored mixed infections with F. tularensis and B. burgdorferi s.l. genospecies. Less common were triple pathogen species infections, detected in three ticks, one infected with A. phagocytophilum / B. burgdorferi s.s. / B. lusitaniae and two infected with F. tularensis / B. burgdorferi s.s. / B. lusitaniae. No mixed infections of A. phagocytophilum and F. tularensis were detected.

  1. Histomorphological evaluation of Compound bone of Granulated Ricinus in bone regeneration in rabbits

    Science.gov (United States)

    Pavan Mateus, Christiano; Orivaldo Chierice, Gilberto; Okamoto, Tetuo

    2011-09-01

    Histological evaluation is an effective method in the behavioral description of the qualitative and quantitative implanted materials. The research validated the performance of Compound bone of Granulated Ricinus on bone regeneration with the histomorphological analysis results. Were selected 30 rabbits, females, divided into 3 groups of 10 animals (G1, G2, G3) with a postoperative time of 45, 70 and 120 days respectively. Each animal is undergone 2 bone lesions in the ilium, one implemented in the material: Compound bone of Granulated Ricinus and the other for control. After the euthanasia, the iliac bone was removed, identified and subjected to histological procedure. The evaluation histological, histomorphological results were interpreted and described by quantitative and qualitative analysis based facts verified in the three experimental groups evaluating the rate of absorption of the material in the tissue regeneration, based on the neo-bone formation. The histomorphologic results classified as a material biocompatible and biologically active. Action in regeneration by bone resorption occurs slowly and gradually. Knowing the time and rate of absorption and neo-formation bone biomaterial, which can be determined in the bone segment applicable in the clinical surgical area.

  2. Deer presence rather than abundance determines the population density of the sheep tick, Ixodes ricinus, in Dutch forests

    NARCIS (Netherlands)

    Hofmeester, Tim R.; Sprong, Hein; Jansen, Patrick A.; Prins, Herbert H.T.; Wieren, Van Sipke E.

    2017-01-01

    Background: Understanding which factors drive population densities of disease vectors is an important step in assessing disease risk. We tested the hypothesis that the density of ticks from the Ixodes ricinus complex, which are important vectors for tick-borne diseases, is determined by the density

  3. Differential diagnosis of three common Ixodes spp. ticks infesting songbirds of Western Europe: Ixodes arboricola, I. frontalis and I. ricinus.

    Science.gov (United States)

    Heylen, Dieter; De Coninck, Eliane; Jansen, Famke; Madder, Maxime

    2014-10-01

    The three most common Ixodes spp. ticks found on songbirds in Western Europe are Ixodes frontalis, I. arboricola and I. ricinus. As the latter species is a generalist, it shares several avian hosts with the two strictly ornithophilic species. Infestations of the three species can overlap in time and space, implying that tick-borne pathogens maintained by the ornithophilic ticks and their hosts could be bridged by I. ricinus to non-avian hosts. Whereas the endophilic Ixodes arboricola only occurs in cavities, I. frontalis has been collected frequently by flagging methods from understory vegetation, which is also the habitat of the field-dwelling I. ricinus. As the latter two species have rather similar morphological characteristics, they can easily be confused with each other. In this study, we present scanning electron photomicrographs of all developmental stages of I. arboricola and I. frontalis, and provide a differential diagnosis key to distinguish the ornithophilic ticks from I. ricinus. In addition, we interpreted their phylogenetic associations based on mitochondrial 16S rDNA with other Ixodes spp. ticks (I. lividus, I. turdus, I. brunneus, I. vespertilionis, I. trianguliceps, I. hexagonus, I. scapularis). Copyright © 2014 Elsevier GmbH. All rights reserved.

  4. Presence of host-seeking Ixodes ricinus and their infection with Borrelia burgdorferi sensu lato in the Northern Apennines, Italy.

    Science.gov (United States)

    Ragagli, Charlotte; Mannelli, Alessandro; Ambrogi, Cecilia; Bisanzio, Donal; Ceballos, Leonardo A; Grego, Elena; Martello, Elisa; Selmi, Marco; Tomassone, Laura

    2016-06-01

    Host-seeking ticks were collected in the Northern Apennines, Italy, by dragging at 35 sites, at altitudes ranging from 680 and 1670 m above sea level (asl), from April to November, in 2010 and 2011. Ixodes ricinus (4431 larvae, 597 nymphs and 12 adults) and Haemaphysalis punctata (11,209 larvae, 313 nymphs, and 25 adults) were the most abundant species, followed by Haemaphysalis sulcata (20 larvae, five nymphs, and 13 adults), Dermacentor marginatus (42 larvae and two adults) and Ixodes hexagonus (one nymph). Greatest numbers of ticks were collected at locations characterised by southern exposure and limestone substratum, at altitudes ricinus was most abundant in Turkey oak (Quercus cerris) wood, whereas H. punctata was mostly collected in hop hornbeam (Ostrya carpinifolia) wood and on exposed rocks. Ixodes ricinus was also found up to 1670 m asl, in high stand beech (Fagus sylvatica) wood. The overall prevalence of Borrelia burgdorferi sensu lato (sl) in 294 host-seeking I. ricinus nymphs was 8.5 %. Borrelia garinii was the most frequently identified genospecies (64.0 % of positive nymphs), followed by B. valaisiana, B. burgdorferi sensu stricto, B. afzelii, and B. lusitaniae. Based upon the comparison with the results of previous studies at the same location, these research findings suggest the recent invasion of the study area by the tick vector and the agents of Lyme borreliosis.

  5. Transmission differentials for multible pathogens as inferred from their prevalence in larva, nymph and sult of Ixodes ricinus (Acari: Ixodidae)

    DEFF Research Database (Denmark)

    Jensen, Per M.; Christoffersen, Christian S.; Moutailler, Sara

    2017-01-01

    Ixodes ricinus serves as vector for a range of microorganisms capable of causing clinical illness in humans. The microorganisms occur in the same vector populations and are generally affected by the same tick-host interactions. Still, the instars have different host preferences which should manif...

  6. Starch based polyurethanes: A critical review updating recent literature.

    Science.gov (United States)

    Zia, Fatima; Zia, Khalid Mahmood; Zuber, Mohammad; Kamal, Shagufta; Aslam, Nosheen

    2015-12-10

    Recent advancements in material science and technology made it obvious that use of renewable feed stock is the need of hour. Polymer industry steadily moved to get rid of its dependence on non-renewable resources. Starch, the second largest occurring biomass (renewable) on this planet provides a cheap and eco-friendly way to form huge variety of materials on blending with other biodegradable polymers. Specific structural versatility design for individual application and tailor-made properties have established the polyurethane (PU) as an important and popular class of synthetic biodegradable polymers. Blending of starch with polyurethane is relatively a developing area in PU chemistry but with lot of attraction for researchers. Herein, various starch based polyurethane materials including blends, grafts, copolymers, composites and nano-composites, as well as the prospects and latest developments are discussed. Additionally, an overview of starch based polymeric materials, including their potential applications are presented. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. Performance behavior of modified cellulosic fabrics using polyurethane acrylate copolymer.

    Science.gov (United States)

    Zuber, Mohammad; Shah, Sayyed Asim Ali; Jamil, Tahir; Asghar, Muhammad Irfan

    2014-06-01

    The surface of the cellulosic fabrics was modified using self-prepared emulsions of polyurethane acrylate copolymers (PUACs). PUACs were prepared by varying the molecular weight of polycaprolactone diol (PCL). The PCL was reacted with isophorone diisocyanate (IPDI) and chain was extended with 2-hydroxy ethyl acrylate (HEA) to form vinyl terminated polyurethane (VTPU) preploymer. The VTPU was further co-polymerized through free radical polymerization with butyl acrylate in different proportions. The FT-IR spectra of monomers, prepolymers and copolymers assured the formation of proposed PUACs structure. The various concentrations of prepared PUACs were applied onto the different fabric samples using dip-padding techniques. The results revealed that the application of polyurethane butyl acrylate copolymer showed a pronounced effect on the tear strength and pilling resistance of the treated fabrics. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Thermal Properties of Anionic Polyurethane Composition for Leather Finishing

    Directory of Open Access Journals (Sweden)

    Olga KOVTUNENKO

    2016-09-01

    Full Text Available Thermal properties of anionic polyurethane composition mixed with collagen product and hydrophilic sodium form of montmorillonite for use in the finishing of leather were studied by thermogravimetric method. The thermal indices of processes of thermal and thermo-oxidative destruction depending on the polyurethane composition were determined. The influence of anionic polyurethane composition on thermal behavior of chromium tanned gelatin films that imitate the leather were studied. APU composition with natural compounds increases their thermal stability both in air and in nitrogen atmosphere due to the formation of additional bonds between active groups of APU, protein and chrome tanning agent as the result of chemical reactions between organic and inorganic parts with the new structure formation.DOI: http://dx.doi.org/10.5755/j01.ms.22.3.10043

  9. Direct transfer of graphene films for polyurethane substrate

    Energy Technology Data Exchange (ETDEWEB)

    Vilani, C.; Romani, E.C.; Larrudé, D.G. [Departamento de Física, Pontifícia Universidade Católica do Rio de Janeiro, 22451-900 Rio de Janeiro, RJ (Brazil); Barbosa, Gelza M. [Diretoria de Sistemas de Armas da Marinha, Marinha do Brasil, 20010-00 Rio de Janeiro, RJ (Brazil); Freire, F.L., E-mail: lazaro@vdg.fis.puc-rio.br [Departamento de Física, Pontifícia Universidade Católica do Rio de Janeiro, 22451-900 Rio de Janeiro, RJ (Brazil); Centro Brasileiro de Pesquisas Físicas, 22290-180 Rio de Janeiro, RJ (Brazil)

    2015-11-30

    Highlights: • Graphene was prepared by CVD using copper foils as substrates. • Monolayer, bilayer and multilayer graphene were transferred to PU. • Samples were characterized by Raman and optical spectroscopies. • PU/monolayer graphene has transmittance around 80% in visible range. - Abstract: We have proposed the direct transfer of large-area graphene films grown by chemical vapor deposition to polymeric substrate by evaporating of solvents of polyurethane/tetrahydrofurane solution. The graphene films on polyurethane substrates were characterized by Raman spectroscopy, optical and atomic force microscopies and UV–vis spectroscopy measurements. The Raman spectra revealed that it is possible to transfer in a controlled manner monolayer, bilayer and multilayer graphene films over polyurethane substrate.

  10. Synthesis and Characterization of Polyurethane-Nanoclay Composites

    Directory of Open Access Journals (Sweden)

    Manasa Nayani

    2013-01-01

    Full Text Available In this study polyurethane (PUR-nanoclay composites were synthesized using methylene diphenyl diisocyanate, polyol, and hectorite clay. The weight percentage of hectorite clay was varied at three different levels to study its effect on the properties of the thermoplastic polyurethane nanocomposite. The nanocomposite polyurethane foam was synthesized in a 2-step reaction process. The first step involved the addition and dispersion of nanoclay into the isocyanate. The mixture was then mixed with the polyol, and the foam was cast in a preheated closed mold. The PUR-nanocomposite foams were analyzed for cell structure, physical, mechanical, and thermal properties. The composite foam showed significant increase in tensile and flexural strengths, abrasion resistance, and thermal properties.

  11. The influence of red deer space use on the distribution of Ixodes ricinus ticks in the landscape.

    Science.gov (United States)

    Qviller, Lars; Viljugrein, Hildegunn; Loe, Leif Egil; Meisingset, Erling L; Mysterud, Atle

    2016-10-13

    Many wingless ectoparasites have a limited capacity for active movement and are therefore primarily dependent on hitchhiking on their hosts for transportation. The distribution of the tick Ixodes ricinus is expected to depend mainly on transportation by hosts and tick subsequent survival in areas where they drop off. In Europe, the most important hosts of adult female I. ricinus are cervids. The extensive space use of large hosts provides a much larger dispersal potential for I. ricinus than that of smaller mammalian hosts. We aim to determine the contribution of red deer (Cervus elaphus) space use on the spatial distribution of I. ricinus, after accounting for landscape factors. We analysed the spatial distribution of I. ricinus with generalised mixed effects models (GLMMs) based on data from extensive field surveys of questing density in two coastal regions in Norway, from which home range data from 73 red deer with GPS collars were available. Red deer home ranges were derived using the kernel method to identify areas most frequently used by deer. We first fitted a baseline model with tick questing densities relative to landscape features that are likely to affect local climate conditions and hence, survival. We then added deer space use variables to the baseline model with only landscape variables to test whether areas more frequently used by red deer had higher questing tick densities. Questing I. ricinus density was predicted by several landscape features, such as elevation, distance to the fjord and topographic slope. In addition, we found that areas more heavily used within the red deer home ranges, correlated with higher questing tick densities. Increased effects of deer space use were additive to the landscape model, suggesting that correlations were more than just shared landscape preferences between deer and ticks. Our results imply that the distribution of I. ricinus is controlled by a complex set of factors that include both local conditions related to

  12. Effect of zinc and benzalkonium chloride on Nitrosomonas communis and potential nitrification in soil.

    Science.gov (United States)

    Frühling, W; Rönnpagel, K; Ahlf, W

    2001-10-01

    A bacterial contact assay is described which uses a chemoautotrophic microorganism, Nitrosomonas communis (strain Nm2) to evaluate the biological effect of contaminated soils. The effects of two toxicants on the ammonium oxidation activity of the autochthonous microbial population in the soil are compared with inhibition of the same biological response in the new monospecies bioassay. Experiments were performed using soil samples dosed with organic and inorganic contaminants (benzalkonium chloride and zinc) to demonstrate the mode of operation and the sensitivity of the bioassay. The EC50 values of zinc and benzalkonium chloride were calculated to be 171 and 221 mg kg-1 soil, respectively. The toxic response provided by the bioassay can thus predict the effect of soil pollutants on the autochthonous nitrifying bacteria.

  13. Karakteristik Cookies Berbahan Dasar Tepung Sukun (Artocarpus communis Bagi Anak Penderita Autis

    Directory of Open Access Journals (Sweden)

    Dede Sukandar

    2017-03-01

    Full Text Available Abstrak Tepung sukun (Artocarpus communis merupakan tepung yang bebas gluten sehingga baik digunakan sebagai alternatif dalam pembuatan cookies untuk anak penderita autis. Penelitian ini bertujuan mengetahui tingkat kesukaan panelis terhadap cookies sukun dan berbagai formulasinya dibandingkan dengan cookies berbahan dasar tepung lain yang meliputi pengaruh penambahan bahan tambahan terhadap sifat kimia, fisika, daya terima cookies sukun, kadar kalsium dan fosforus cookies sukun, dan mengetahui cookies sukun tersukai memenuhi standar mutu cookies menurut SNI 01-2973-1992 atau tidak. Uji organoleptik dilakukan untuk mengetahui tingkat kesukaan dan penerimaan panelis terhadap cookies sukun dibandingkan dengan cookies berbahan dasar tepung lain (terigu, beras, sagu dan cookies sukun dalam berbagai formulasi. Parameter yang digunakan meliputi warna, aroma, tekstur, rasa dan penerimaan keseluruhan. Uji kadar kalsium dilakukan menggunakan spektroskopi serapan atom pada λ 422.7 nm dan kadar fosforus menggunakan spektroskopi UV-Vis pada λ 880 nm. Data yang diperoleh dianalisis menggunakan analisis sidik ragam anova dan analisis Duncan. Cookies sukun memiliki penerimaan yang rendah dibandingkan cookies tepung lain berdasarkan penerimaan rasa dan penerimaan umum. Formulasi cookies sukun memperbaiki sifat fisik (aroma, rasa, warna, dan tekstur dan daya terima cookies sukun oleh panelis. Cookies sukun tersukai adalah formulasi 718 dengan bahan tambahan susu kedelai.  Mutu cookies sukun tersukai formulasi 718 sesuai dengan SNI 01-2973-1992 kecuali kadar protein yang masih rendah 8.05% dan terdapat kandungan tembaga dengan sebesar 1.56 ppm. Cookies sukun tersukai memiliki kadar kalsium dan fosforus tertinggi dibandingkan dengan tepung sukun dan cookies komersil untuk anak penderita autis sehingga cookies sukun tersukai sangat baik dikonsumsi oleh anak penderita autis. Kata kunci : Artocarpus communis, autis, cookies sukun, organoleptik, kalsium, fosforus

  14. Sodium Copper Chlorophyllin Immobilization onto Hippospongia communis Marine Demosponge Skeleton and Its Antibacterial Activity

    Directory of Open Access Journals (Sweden)

    Małgorzata Norman

    2016-09-01

    Full Text Available In this study, Hippospongia communis marine demosponge skeleton was used as an adsorbent for sodium copper chlorophyllin (SCC. Obtained results indicate the high sorption capacity of this biomaterial with respect to SCC. Batch experiments were performed under different conditions and kinetic and isotherms properties were investigated. Acidic pH and the addition of sodium chloride increased SCC adsorption. The experimental data were well described by a pseudo-second order kinetic model. Equilibrium adsorption isotherms were determined and the experimental data were analyzed using both Langmuir and Freundlich isotherms. The effectiveness of the process was confirmed by 13C Cross Polarization Magic Angle Spinning Nuclear Magnetic Resonance (13C CP/MAS NMR, Fourier transform infrared spectroscopy (FTIR, energy-dispersive X-ray spectroscopy (EDS and thermogravimetric analysis (TG. This novel SCC-sponge-based functional hybrid material was found to exhibit antimicrobial activity against the gram-positive bacterium Staphylococcus aureus.

  15. Myrtus communis essential oil: chemical composition and antimicrobial activities against food spoilage pathogens.

    Science.gov (United States)

    Ben Hsouna, Anis; Hamdi, Naceur; Miladi, Ramzi; Abdelkafi, Slim

    2014-04-01

    Myrtus communis is a typical plant of the Mediterranean area, which is mainly used as animal and human food and, in folk medicine, for treating some disorders. In the present study, we evaluated in vitro antibacterial and antifungal properties of the essential oils of Myrtus communis (McEO), as well as its phytochemical composition. The GC/MS analysis of the essential oil revealed 17 compounds. Myrtenyl acetate (20.75%), 1,8-cineol (16.55%), α-pinene (15.59%), linalool (13.30%), limonene (8.94%), linalyl acetate (3.67%), geranyl acetate (2.99%), and α-terpineol (2.88%) were the major components. The antimicrobial activity of the essential oil was also investigated on several microorganisms. The inhibition zones and minimal inhibitory concentration (MIC) values of bacterial strains were in the range of 16-28 mm and 0.078-2.5 mg/ml, respectively. The inhibitory activity of the McEO against Gram-positive bacteria was significantly higher than against Gram-negative. It also exhibited remarkable activity against several fungal strains. The investigation of the mode of action of the McEO by the time-kill curve against Listeria monocytogenes (food isolate) showed a drastic bactericidal effect after 5 min using a concentration of 312 μg/ml. These results evidence that the McEO possesses antimicrobial properties, and it is, therefore, a potential source for active ingredients for food and pharmaceutical industries. Copyright © 2014 Verlag Helvetica Chimica Acta AG, Zürich.

  16. Fabrication and characterization of cellulose nanocrystal based transparent electroactive polyurethane

    Science.gov (United States)

    Ko, Hyun-U.; Kim, Hyun Chan; Kim, Jung Woong; Zhai, Lindong; Jayaramudu, Tippabattini; Kim, Jaehwan

    2017-08-01

    This paper reports cellulose nanocrystal (CNC) based transparent and electroactive polyurethane (CPPU), suitable for actively tunable optical lens. CNC is used for high dielectric filler to improve electromechanical behavior of CPPU. For high transparency and homogeneous distribution of CNC in polyurethane, CNC-poly[di(ethylene glycol) adipate] is used to play a role of polyol and isocyanate salt. The fabricated CPPU exhibits high transparency (>90%) and 10% of electromechanical strain under 3 V μm-1 electric field. Mechanical, dielectric properties as well as physical and chemical characteristics are investigated to prove the electromechanical behavior of CPPU.

  17. The physicochemical properties of polyurethane membranes determined by swelling measurements

    Science.gov (United States)

    Ciobanu, Gabriela; Carja, Gabriela; Apostolescu, Gabriela; Apostolescu, Nicolae

    2009-01-01

    In this work, we have dispersed SAPO-5 zeolite particles in polyurethane matrix for preparation of porous mixed matrix membranes. The goal of work is the determination of the cohesive energy density for unfilled- and zeolite - filled polyurethane membranes. Experimental determination of cohesive energy density values for the prepared membranes is obtained by measuring the swelling coefficients in water and several alcohols (methanol, ethanol, propanol and butanol). The solubility parameters of the membranes are also calculated. For the unfilled membranes the corresponded values of cohesive energy density and solubility parameter increase in comparison to those of the filled membranes. All the tested membranes show a tendency to swell with ethanol.

  18. Synthesis and characterization of isophorone diisocyanate based polyurethanes

    Science.gov (United States)

    Mirčeva, A.; Malavašič, T.; Osredkar, U.

    1990-03-01

    Polyurethane ionomers based on polycaprolactone glycol or polyoxytetramethylene glycol with isophorone diisocyanate and chain extenders 1,4-butanediol, 2,2'(dihydroxymethyl) propionic acid and in some cases water, were synthesized in solution. Stable aqueous dispersions from the ionomers were obtained when the concentration of ionic groups was at least 30 mmol per 100 g of polyurethane. Higher concentration of hard segments in the structure produced elastic and transparent films. Hard-soft segment interactions in a series of model compounds were estimated by Fourier transform infrared spectroscopy. Thermal properties of the films were determined by differential scanning calorimetry and by FTIR as well.

  19. The integration of multiple independent data reveals an unusual response to Pleistocene climatic changes in the hard tick Ixodes ricinus.

    Science.gov (United States)

    Porretta, Daniele; Mastrantonio, Valentina; Mona, Stefano; Epis, Sara; Montagna, Matteo; Sassera, Davide; Bandi, Claudio; Urbanelli, Sandra

    2013-03-01

    In the last few years, improved analytical tools and the integration of genetic data with multiple sources of information have shown that temperate species exhibited more complex responses to ice ages than previously thought. In this study, we investigated how Pleistocene climatic changes affected the current distribution and genetic diversity of European populations of the tick Ixodes ricinus, an ectoparasite with high ecological plasticity. We first used mitochondrial and nuclear genetic markers to investigate the phylogeographic structure of the species and its Pleistocene history using coalescent-based methods; then we used species distribution modelling to infer the climatic niche of the species at last glacial maximum; finally, we reviewed the literature on the I. ricinus hosts to identify the locations of their glacial refugia. Our results support the scenario that during the last glacial phase, I. ricinus never experienced a prolonged allopatric divergence in separate glacial refugia, but persisted with interconnected populations across Southern and Central Europe. The generalist behaviour in host choice of I. ricinus would have played a major role in maintaining connections between its populations. Although most of the hosts persisted in separate refugia, from the point of view of I. ricinus, they represented a continuity of 'bridges' among populations. Our study highlights the importance of species-specific ecology in affecting responses to Pleistocene glacial-interglacial cycles. Together with other cases in Europe and elsewhere, it contributes to setting new hypotheses on how species with wide ecological plasticity coped with Pleistocene climatic changes. © 2013 Blackwell Publishing Ltd.

  20. Biodegradation of polyester polyurethane by Aspergillus tubingensis.

    Science.gov (United States)

    Khan, Sehroon; Nadir, Sadia; Shah, Zia Ullah; Shah, Aamer Ali; Karunarathna, Samantha C; Xu, Jianchu; Khan, Afsar; Munir, Shahzad; Hasan, Fariha

    2017-06-01

    The xenobiotic nature and lack of degradability of polymeric materials has resulted in vast levels of environmental pollution and numerous health hazards. Different strategies have been developed and still more research is being in progress to reduce the impact of these polymeric materials. This work aimed to isolate and characterize polyester polyurethane (PU) degrading fungi from the soil of a general city waste disposal site in Islamabad, Pakistan. A novel PU degrading fungus was isolated from soil and identified as Aspergillus tubingensis on the basis of colony morphology, macro- and micro-morphology, molecular and phylogenetic analyses. The PU degrading ability of the fungus was tested in three different ways in the presence of 2% glucose: (a) on SDA agar plate, (b) in liquid MSM, and (c) after burial in soil. Our results indicated that this strain of A. tubingensis was capable of degrading PU. Using scanning electron microscopy (SEM), we were able to visually confirm that the mycelium of A. tubingensis colonized the PU material, causing surface degradation and scarring. The formation or breakage of chemical bonds during the biodegradation process of PU was confirmed using Attenuated Total Reflectance Fourier Transform Infrared (ATR-FTIR) spectroscopy. The biodegradation of PU was higher when plate culture method was employed, followed by the liquid culture method and soil burial technique. Notably, after two months in liquid medium, the PU film was totally degraded into smaller pieces. Based on a comprehensive literature search, it can be stated that this is the first report showing A. tubingensis capable of degrading PU. This work provides insight into the role of A. tubingensis towards solving the dilemma of PU wastes through biodegradation. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Combined treatment of Thymus vulgaris L., Rosmarinus officinalis L. and Myrtus communis L. essential oils against Salmonella typhimurium: Optimization of antibacterial activity by mixture design methodology.

    Science.gov (United States)

    Fadil, Mouhcine; Fikri-Benbrahim, Kawtar; Rachiq, Saad; Ihssane, Bouchaib; Lebrazi, Sara; Chraibi, Marwa; Haloui, Taoufik; Farah, Abdellah

    2017-06-03

    To increase the sensibility of Salmonella typhimurium strain, a mixture of Thymus vulgaris L. (T. vulgaris L.), Rosmarinus officinalis L. (R. officinalis L.) and Myrtus communis L. (M. communis L.) essential oils (EOs) was used in combined treatment by experimental design methodology (mixture design). The chemical composition of EOs was firstly identified by GC and GC/MS and their antibacterial activity was evaluated. The results of this first step have shown that thymol and borneol were the major compounds in T. vulgaris and M. communis L. EOs, respectively, while 1,8-cineole and α-pinene were found as major compounds in R. officinalis L. The same results have shown a strong antibacterial activity of T. vulgaris L. EO followed by an important power of M. communis L. EO against a moderate activity of R. officinalis L. EO. Besides, 1/20 (v/v) was the concentration giving a strain response classified as sensitive. From this concentration, the mixture design was performed and analyzed. The optimization of mixtures antibacterial activities has highlighted the synergistic effect between T. vulgaris L. and M. communis L. essential oils. A formulation comprising 55% of T. vulgaris L. and 45% of M. communis L. essential oils, respectively, can be considered for the increase of Salmonella typhimurium sensibility. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. The phytochemical and genetic survey of common and dwarf juniper (Juniperus communis and Juniperus nana) identifies chemical races and close taxonomic identity of the species.

    Science.gov (United States)

    Filipowicz, Natalia; Piotrowski, Arkadiusz; Ochocka, J Renata; Asztemborska, Monika

    2006-07-01

    Juniperus communis L. (= J. communis var. communis) and Juniperus nana Willd. (= J. communis var. SAXATILIS) are subspecies of juniper. J. communis grows widely in both hemispheres, primarily in lower elevations while J. nana is mainly observed in high mountains. Although they can be distinguished by morphological features, it is not known whether they are genetically and phytochemically distinct entities. We aimed to check whether it is possible to distinguish these two plants (i) by pharmaceutically important chemical traits and (ii) on the basis of intraspecifically highly polymorphic fragment of chloroplast DNA. We used GC with achiral as well as with enantioselective stationary phase columns to identify the main monoterpenes of the essential oil. Sequence analysis of the TRNL (UAA)- TRNF (GAA) intergenic spacer of the chloroplast genome was used as a genetic marker of taxonomic identity between these two subspecies. The chromatographic analysis showed the existence of three chemical races - the alpha-pinene type, the sabinene type and one with intermediate contents of these terpenes among both J. communis and J. nana. Surprisingly, sequence analysis of TRNL (UAA)- TRNF (GAA) revealed 100 % similarity between the common and the dwarf juniper. Thus, the monoterpene pattern is related to geographical origin, and not to the species identity. We suggest that the three chemical races identified in the present study should be considered as separate sources of pharmaceutical raw material. Our results demonstrate that the contents of alpha-pinene and sabinene may be applied as a quick diagnostic test for preliminary evaluation of plant material.

  3. The speed of kill of fluralaner (Bravecto™) against Ixodes ricinus ticks on dogs.

    Science.gov (United States)

    Wengenmayer, Christina; Williams, Heike; Zschiesche, Eva; Moritz, Andreas; Langenstein, Judith; Roepke, Rainer K A; Heckeroth, Anja R

    2014-11-18

    Pathogens that are transmitted by ticks to dogs, such as Anaplasma phagocytophilum, Babesia spp., Borrelia burgdorferi sensu latu, and Ehrlichia canis, are an increasing problem in the world. One method to prevent pathogen transmission to dogs is to kill the ticks before transmission occurs. Fluralaner (Bravecto™) is a novel isoxazoline insecticide and acaricide that provides long persistent antiparasitic activity following systemic administration. This study investigated the speed of kill of fluralaner against Ixodes ricinus ticks on dogs. A total of 48 dogs were randomized to 8 groups of 6 dogs and each dog was infested with 50 female and 10 male I. ricinus ticks. Two days later (day 0), 4 groups received a single treatment of 25 mg fluralaner/kg body weight as Bravecto™ chewable tablets; the dogs in the other 4 groups were left untreated. Separate control and treatment groups were paired at each time point (4, 8, 12, or 24 hours after treatment) for assessment of tick-killing efficacy. At 4, 8, and 12 weeks after treatment, all dogs were re-infested with 50 female I. ricinus ticks and subsequently assessed for live or dead ticks at either 4, 8, 12, or 24 hours after re-infestation. Efficacy was calculated for each assessment time point by comparison of the treatment group with the respective control group. Tick-killing efficacy was 89.6% at 4 hours, 97.9% at 8 hours, and 100% at 12 and 24 hours after treatment. Eight hours after re-infestation, efficacy was 96.8%, 83.5%, and 45.8% at 4, 8, and 12 weeks after treatment, respectively. At least 98.1% tick-killing efficacy was demonstrated 12 and 24 hours after re-infestation over the entire 12 week study period. Fluralaner kills ticks rapidly after treatment at 4 hours, and over its entire 12-week period of efficacy, it achieves an almost complete killing effect within 12 hours after tick infestation. The rapid tick-killing effect together with the long duration of efficacy enables fluralaner to aid

  4. História de vida de Neoseiulus californicus(McGregor, 1954) (Acari: Phytoseiidae), alimentado com pólen de mamoneira (Ricinus communis L.) em condição de laboratório

    OpenAIRE

    PP Marafeli; PR, Reis; EC. da Silveira; GC Souza-Pimentel; MA. de Toledo

    2014-01-01

    The predatory mite, Neoseiulus californicus(McGregor, 1954) (Acari: Phytoseiidae) is one of the principal natural enemies of tetranychid mites in several countries, promoting efficient control of those mites in several food and ornamental crops. Pest attacks such as that of the spider mite, Tetranychus urticaeKoch, 1836 (Acari: Tetranychidae), is one of the problems faced by farmers, especially in the greenhouse, due to the difficulty of its control with the use of chemicals because of the de...

  5. A case of massive infestation of a male green lizard Lacerta viridis/bilineata by castor bean tick Ixodes ricinus (Linnaeus, 1758):

    OpenAIRE

    Carretero, Miguel A.; Gomes, Veronika; Žagar, Anamarija

    2013-01-01

    Infestation by ticks affects several vertebrate groups, including reptiles. Castor bean tick Ixodes ricinus is the most widespread tick species. Here we report an impressive tick infestation of a male green lizard Lacerta viridis/bilineata found in 2012 in the vicinity of Bilpa cave in the Kolpa valley, Slovenia. Lizards as tick hosts can play an important role in the life cycle of I. ricinus and may also be potential vectors of Lyme disease. Zaprarazitiranost s klopi je pogost pojav pri v...

  6. Cell–material interactions on biphasic polyurethane matrix

    Science.gov (United States)

    Dicesare, Patrick; Fox, Wade M.; Hill, Michael J.; Krishnan, G. Rajesh; Yang, Shuying; Sarkar, Debanjan

    2013-01-01

    Cell–matrix interaction is a key regulator for controlling stem cell fate in regenerative tissue engineering. These interactions are induced and controlled by the nanoscale features of extracellular matrix and are mimicked on synthetic matrices to control cell structure and functions. Recent studies have shown that nanostructured matrices can modulate stem cell behavior and exert specific role in tissue regeneration. In this study, we have demonstrated that nanostructured phase morphology of synthetic matrix can control adhesion, proliferation, organization and migration of human mesenchymal stem cells (MSCs). Nanostructured biodegradable polyurethanes (PU) with segmental composition exhibit biphasic morphology at nanoscale dimensions and can control cellular features of MSCs. Biodegradable PU with polyester soft segment and hard segment composed of aliphatic diisocyanates and dipeptide chain extender were designed to examine the effect polyurethane phase morphology. By altering the polyurethane composition, morphological architecture of PU was modulated and its effect was examined on MSC. Results show that MSCs can sense the nanoscale morphology of biphasic polyurethane matrix to exhibit distinct cellular features and, thus, signifies the relevance of matrix phase morphology. The role of nanostructured phases of a synthetic matrix in controlling cell–matrix interaction provides important insights for regulation of cell behavior on synthetic matrix and, therefore, is an important tool for engineering tissue regeneration. PMID:23255285

  7. Molecular simulation of fibronectin adsorption onto polyurethane surfaces.

    Science.gov (United States)

    Panos, Melisa; Sen, Taner Z; Ahunbay, M Göktuğ

    2012-08-28

    Poly(ethylene glycol)-based polyurethanes have been widely used in biomedical applications; however, they are prone to swelling. A natural polyol, castor oil, can be incorporated into these polyurethanes to control the degree of the swelling, which alters mechanical properties and protein adsorption characteristic of the polymers. In this work, we modeled poly(ethylene glycol) and castor oil copolymers of hexamethylene diisocyanate-based polyurethanes (PEG-HDI and CO-HDI, respectively) and compared their mechanisms for fibronectin adsorption using molecular mechanics and molecular dynamics simulations. Results showed that the interplay between the hydrophobic residues concentrated at the N-terminal end of the protein, the surface roughness, and the hydrophilicity of the polymer surface determine the overall protein adsorption affinity. Incorporating explicit water molecules in the simulations results in higher affinity for fibronectin adsorption to more hydrophobic surface of CO-HDI surfaces, emphasizing the role that water molecules play during adsorption. We also observed that the strain energies that are indicative of flexibility and consequently entropy are significantly affected by the changes in the patterns of β-sheet formation/breaking. Our study lends supports to the view that while castor oil controls the degree of swelling, it increases the adsorption of fibronectin to a limited extent due to the interplay between its hydrophobicity and its surface roughness, which needs to be taken into account during the design of polyurethane-based biomaterials.

  8. Novel Nanocomposites Based on Polyurethane and Micro Fibrillated Cellulose

    OpenAIRE

    Seydibeyoğlu, M. Özgür; Oksman, Kristiina

    2008-01-01

    Novel Nanocomposites Based on Polyurethane and Micro Fibrillated Cellulose correspondence: Corresponding author. (Oksman, Kristiina) (Oksman, Kristiina) Department of Materials Science and Engineering, Istanbul Technical University - Istanbul--> - TURKEY (Seydibeyo?lu, M. Ozgur) Division of Manufacturing and Design of Wood and Bionanocomposites, Lule? University of Technology - Skellefte?--> - SW...

  9. Hyaluronan Immobilized Polyurethane as a Blood Contacting Material

    Directory of Open Access Journals (Sweden)

    Feirong Gong

    2010-01-01

    Full Text Available Hyaluronan (hyaluronic acid, HA was immobilized onto the surface of amino-functionalized polyurethane films with the goal of obtaining a novel kind of biomaterial which had the potential in blood-contacting applications. The amino-functionalized polyurethane was prepared by synthesized acidic polyurethane whose pendant carboxyl groups were treated with an excess amount of 1,3-diaminopropane in the presence of N,N-carbonyldiimidazole (CDI. Attenuated total reflection Fourier transform infrared spectroscopy (ATR-FTIR, Raman spectroscopy (RS, scanning electron microscopy (SEM, and water contact angle measurement were used to confirm the surface changes at each step of treatment, both in morphologies and chemical compositions. APTT and PT results showed that HA immobilization could prolong the blood coagulation time, thus HA-immobilized polyurethane (PU-HA exhibited improved blood compatibility. Cytotoxicity analysis showed that the PU-HA films synthesized in this study were cytocompatible and could support human vein endothelial cells (HUVECs adhesion and proliferation.

  10. Structure and properties of triolein-based polyurethane networks.

    Science.gov (United States)

    Zlatanić, Alisa; Petrović, Zoran S; Dusek, Karel

    2002-01-01

    Polyurethane networks based on vegetable oils have very heterogeneous composition, and it is difficult to find a close correlation between their structure and properties. To establish benchmark structure-properties relationships, we have prepared model polyurethane networks based on triolein and 4,4'-diphenylmethane diisocyanate (MDI). Cross-linking in the middle of fatty acid chains leaves significant parts of the triglyceride as dangling chains. To examine their effect on properties, we have synthesized another polyurethane network using triolein without dangling chains (removed by metathesis). The structure of polyols was studied in detail since it affects the structure of polyurethane networks. The network structure was analyzed from swelling and mechanical measurements and by applying network and rubber elasticity theories. The cross-linking density in both networks was found to be close to theoretical. The triolein-based model network displayed modulus (around 6 MPa), tensile strength (8.7 MPa), and elongation at break (136%), characteristic of hard rubbers. Glass transition temperatures of the networks from triolein and its metathesis analogue were 25 and 31.5 degrees C, respectively.

  11. Bioactivity of polyurethane-based scaffolds coated with Bioglass (registered)

    Energy Technology Data Exchange (ETDEWEB)

    Bil, M [Faculty of Materials Science and Engineering, Warsaw University of Technology, Woloska141, 02-507 Warsaw (Poland); Ryszkowska, J [Faculty of Materials Science and Engineering, Warsaw University of Technology, Woloska141, 02-507 Warsaw (Poland); Roether, J A [Department of Materials, Imperial College London, London SW7 2BP (United Kingdom); Bretcanu, O [Department of Materials, Imperial College London, London SW7 2BP (United Kingdom); Boccaccini, A R [Department of Materials, Imperial College London, London SW7 2BP (United Kingdom)

    2007-06-01

    Polyurethane (PUR) and polyurethane/poly(d, l-lactide) acid (PUR/PDLLA) based scaffolds coated with Bioglass (registered) particles for application in bone tissue engineering were fabricated. The slurry-dipping method was used for coating preparation. The homogeneous structure of the Bioglass (registered) coatings on the surface of the PUR and PUR/PDLLA foams indicated a good adhesion of the bioactive glass particles to polyurethane without any additional surface treatment. In vitro studies in simulated body fluid (SBF) were performed to study the influence of Bioglass (registered) coating on biodegrability and bioactivity of PUR-based scaffolds. The surface of Bioglass (registered) -coated samples was covered by a layer of carbonate-containing apatite after 7 days of immersion in SBF, while in uncoated polymer samples apatite crystals were not detected even after 21 days of immersion in SBF. The apatite layer was characterized by scanning electron microscopy (SEM), EDS analysis and attenuated total reflectance-Fourier transform infrared spectrometry (FTIR-ATR). Weight loss measurements showed that the in vitro degradation rate of the composite scaffolds in SBF was higher in comparison to uncoated polyurethane samples. PUR and PUR/PDLLA foams with Bioglass (registered) coating have potential to be used as bioactive, biodegradable scaffolds in bone tissue engineering.

  12. Improved primer for bonding polyurethane adhesives to metals

    Science.gov (United States)

    Constanza, L. J.

    1969-01-01

    Primer ensures effective bonding integrity of polyurethane adhesives on metal surfaces at temperatures ranging from minus 423 degrees to plus 120 degrees F. It provides greater metal surface protection and bond strengths over this temperature range than could be attained with other adhesive systems.

  13. Characterization of Novel Castor Oil-Based Polyurethane Polymer Electrolytes

    Directory of Open Access Journals (Sweden)

    Salmiah Ibrahim

    2015-04-01

    Full Text Available Castor oil-based polyurethane as a renewable resource polymer has been synthesized for application as a host in polymer electrolyte for electrochemical devices. The polyurethane was added with LiI and NaI in different wt% to form a film of polymer electrolytes. The films were characterized by using attenuated total reflectance-Fourier transform infrared spectroscopy, dynamic mechanical analysis, electrochemical impedance spectroscopy, linear sweep voltammetry and transference number measurement. The highest conductivity of 1.42 × 10−6 S cm−1 was achieved with the addition of 30 wt% LiI and 4.28 × 10−7 S·cm−1 upon addition of 30 wt% NaI at room temperature. The temperature dependence conductivity plot indicated that both systems obeyed Arrhenius law. The activation energy for the PU-LiI and PU-NaI systems were 0.13 and 0.22 eV. Glass transition temperature of the synthesized polyurethane decreased from −15.8 °C to ~ −26 to −28 °C upon salts addition. These characterizations exhibited the castor oil-based polyurethane polymer electrolytes have potential to be used as alternative membrane for electrochemical devices.

  14. Recycling Waste Polyurethane as a Carbon Resource in Ironmaking ...

    African Journals Online (AJOL)

    Globally, major avenues available for dealing with waste Poly-Urethane (PU) are disposal at landfill sites and incineration. However, PU contains high levels of carbon and hydrogen that can be recovered for use as reductant in metal extraction processes. In this work the use of post-consumer PU as reductant for the ...

  15. WEATHERING DEGRADATION OF A POLYURETHANE COATING. (R828081E01)

    Science.gov (United States)

    The degradation of polyurethane topcoat over a chromate pigmented epoxy primer was examined by atomic force microscopy (AFM), scanning electronic microscopy (SEM), X-ray photo-electron spectroscopy (XPS) and Fourier transform infra-red spectroscopy (FTIR) after the coated pane...

  16. Reinforcement of silica aerogels using silane-end-capped polyurethanes.

    Science.gov (United States)

    Duan, Yannan; Jana, Sadhan C; Lama, Bimala; Espe, Matthew P

    2013-05-21

    Proper selection of silane precursors and polymer reinforcements yields more durable and stronger silica aerogels. This paper focuses on the use of silane-end-capped urethane prepolymer and chain-extended polyurethane for reinforcement of silica aerogels. The silane end groups were expected to participate in silica network formation and uniquely determine the amounts of urethanes incorporated into the aerogel network as reinforcement. The aerogels were prepared by one-step sol-gel process from mixed silane precursors tetraethoxysilane, aminopropyltriethoxysilane (APTES), and APTES-end-capped polyurethanes. The morphology and mechanical and surface properties of the resultant aerogels were investigated in addition to elucidation of chemical structures by solid-state (13)C and (29)Si nuclear magnetic resonance. Modification by 10 wt % APTES-end-capped chain-extended polyurethane yielded a 5-fold increase in compressive modulus and 60% increase in density. APTES-end-capped chain-extended polyurethane was found to be more effective in enhancement of mechanical properties and reduction of polarity.

  17. Recycling of polyurethane foams: A strategy in waste management ...

    African Journals Online (AJOL)

    Recycling ·of polymer materials such as polyurethane foam is one of the needed strategies to combat the menace of pollution in our environment. Pollution has been a consequence of ever-increasing massive quantity of wastes generated from household and industrial activities, posing a global challenge to man and the ...

  18. Synthesis and characterization of castor oil based polyurethane ...

    Indian Academy of Sciences (India)

    A series of interpenetrating polymer networks (IPNs) of castor oil based polyurethane/polyacrylonitrile (PU/PAN: 80/20, 60/40, 50/50, 40/60 and 20/80) were synthesized by condensation reaction of castor oil with methylene diisocyanate and acrylonitrile, employing benzoyl peroxide (BPO) and ethylene glycol ...

  19. Polyurethanes elastomers with amide chain extenders of uniform length

    NARCIS (Netherlands)

    van der Schuur, J.M.; Noordover, B.A.J.; Noordover, Bart; Gaymans, R.J.

    2006-01-01

    Toluene diisocyanate based polyurethanes with amide extenders were synthesized poly(propylene oxide) with a number average molecular weight of 2000 and endcapped with toluene diisocyanate was used as the polyether segment. The chain extenders were based on poly(hexamethylene terephthalamide):

  20. The use of polyurethane in coastal engineering models

    NARCIS (Netherlands)

    Verhagen, H.J.

    2014-01-01

    In physical model tests there is often a need of preventing stones from moving. This can be achieved by gluing the stones. Applying PBA (Polyurethane Bonded Agregate, e.g. Elastocoast) guarantees no moving stones, a normal permeability and a transportable model.

  1. Controlled release of 5-flurouracil from biomedical polyurethanes

    Indian Academy of Sciences (India)

    Administrator

    kles on their surfaces. The release of 5-FU through the microspheres was investigated in pH 7⋅4- phosphate buffer. An increase in release rate was observed with increasing molar ratio of PLF68 with respect to castor oil. Keywords. Biomedical polyurethane; controlled release; 5-flurouracil; drug delivery. 1. Introduction.

  2. Synthesis and characterization of bio-based polyurethane from ...

    Indian Academy of Sciences (India)

    Benzoylated tannin prepared by benzoylation of cashewnut husk tannin, was treated with hexame-thylenediisocyanate in the presence of 1,4-butanediol as an extender to prepare thermosetting polyurethane. The sample was characterized using FT–IR and 13C NMR spectra. Thermal, morphological, physico-chemical and ...

  3. Study of the Antibacterial Activity of Methanolic and Aqueous Extracts of Myrtus communis on Pathogenic Strains Causing Infection

    Directory of Open Access Journals (Sweden)

    Behrooz Alizadeh Behbahani

    2016-02-01

    Full Text Available Background Medicine plants have been used as sources of medicine in virtually all cultures. During the last decade, the use of traditional medicine (TM has been expanded globally and is gaining popularity. Objectives The antimicrobial activities of methanol and water extracts of Myrtus communis L. leaves were evaluated in this study. Materials and Methods In this experimental study, the tests were carried out using disk agar diffusion method at four extract concentrations (5, 10, 15 and 20 mg/mL. The MICs and MBCs of the extracts of M. communis were determined by agar dilution method. Average results were reported as the mean and standard error (mean ± SE and SPSS-18 statistical software, oneway ANOVA followed by Turkey’s test were used to do inter-group comparison, while considering P ≤ 0.05 as the significance level. Results Methanol extract of M. communis exhibited significant antibacterial activity in the concentration of 20 mg/mL (P ≤ 0.05 against Staphylococcus epidermidis and Enterococcus faecalis with a greater inhibition zone of 20 mm, while a 14 mm zone of inhibition was observed in Escherichia coli and Shigella flexneri. The minimum inhibitory concentration (MIC of the extracts ranged between 2 mg/mL and 128 mg/mL while the minimum bactericidal concentration (MBC ranged between 4 mg/mL and 256 mg/mL. Conclusions The study showed that species, strains and concentrations of M. communis extract are of those factors that may influence the sensitivity of the tested bacteria. A significant correlation was observed between zone of inhibition and concentration of extract.

  4. Detection and identification of Anaplasma phagocytophilum, Borrelia burgdorferi, and Rickettsia helvetica in Danish Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Skarphédinsson, Sigurdur; Lyholm, Birgitte Fjendbo; Ljungberg, Marianne

    2007-01-01

    Borreliosis is an endemic infection in Denmark. Recent serosurveys have indicated that human anaplasmosis may be equally common. The aim of this study was to look for Anaplasma phagocytophilum and related pathogens in Ixodes ricinus ticks and estimate their prevalence, compared to Borrelia, using...... Jutland and Funen, while 11% were positive for Borrelia burgdorferi. The Borrelia genotype B. afzelii was most prevalent, followed by B. valaisiana, B. burgdorferi s.s. and B. garinii.A. phagocytophilum was found in 14.5% of nymphs and 40.5% of adult ticks, while Borrelia was found in 13% of nymphs and 8......% of adult ticks. The difference in prevalence between Anaplasma and Borrelia in adult ticks supports the idea that their maintenance cycles in nature may be different. Ticks were also infected with Rickettsia helvetica. Our study indicates that A. phagocytophilum prevalence in ticks in Denmark is as high...

  5. Seasonal changes in the fatty acid profile of the tick Ixodes ricinus (Acari, Ixodidae).

    Science.gov (United States)

    Cuber, Piotr; Urbanek, Aleksandra; Naczk, Aleksandra; Stepnowski, Piotr; Gołębiowski, Marek

    2016-06-01

    Fatty acids (FAs) from nymphs, females and males of Ixodes ricinus were analysed by gas chromatography/mass spectrometry. Ticks were collected from May to October 2013. The most abundant FAs were 18:1, 18:0, 16:0 and 18:2 which are also dominant FAs of insects. Adults contained higher concentrations of FAs in general than nymphs because they contain more fat body and probably a thicker layer of epicuticular lipids. Larger quantities of FAs > 20 carbon atoms in the carboxylic chain were present in females, which generally show higher content of lipids essential for oogenesis, whereas there were similar amounts of 14-18 in both sexes. In September and October, ticks contained large concentrations of the majority of FAs except for 18:1, the most abundant one in ticks collected from May through August. Thus, most FAs, especially those with more than 20 C atoms, tend to increase at lower temperatures.

  6. Auxetic polyurethane foam: Manufacturing and processing analysis

    Science.gov (United States)

    Jahan, Md Deloyer

    Materials with negative Poisson's ratio are referred to as auxetic materials. They are different from conventional materials in their deformation behavior when responding to external stresses. The cross-section of the materials widens in the lateral direction when being stretched in the longitudinal direction and becomes narrower when being compressed longitudinally. While a number of natural auxetic materials exist, most auxetic materials are synthetic. They show interesting properties and have potential in several important applications. Auxetic materials exhibit better mechanical properties than conventional materials such as enhanced indentation resistance, shear resistance, toughness, damping and energy absorption capacity, sound absorption, variable permeability and capability of producing complex curvature. These properties are beneficial in a wide range of applications including personal protective equipments, sound absorbers, packaging, smart filtration, drug delivery, tissue scaffolding, seat cushioning, etc. A wide range of auxetic materials has been synthesized. They include different polymers, metals, composites and ceramics. Among these, auxetic polyurethane (PU) foam is one of the most widely studied types of auxetic materials. Auxetic PU foams are usually fabricated by altering the microstructure of conventional foams and the unusual mechanical properties originate from the deformation characteristics of the microstructures. Three most important processing parameters in fabricating auxetic PU foam that dictate auxetic behavior are processing temperature, heating time and volumetric compression ratio. This study addresses several important issues in the manufacturing and characterization of auxetic PU foam. First, an improved automatic measuring technique has been developed to determine Poisson's ratio of auxetic PU foam. The technique involves development of a Matlab based image processing program. The second part of the study includes an

  7. Multi-source analysis reveals latitudinal and altitudinal shifts in range of Ixodes ricinus at its northern distribution limit

    Directory of Open Access Journals (Sweden)

    Kristoffersen Anja B

    2011-05-01

    Full Text Available Abstract Background There is increasing evidence for a latitudinal and altitudinal shift in the distribution range of Ixodes ricinus. The reported incidence of tick-borne disease in humans is on the rise in many European countries and has raised political concern and attracted media attention. It is disputed which factors are responsible for these trends, though many ascribe shifts in distribution range to climate changes. Any possible climate effect would be most easily noticeable close to the tick's geographical distribution limits. In Norway- being the northern limit of this species in Europe- no documentation of changes in range has been published. The objectives of this study were to describe the distribution of I. ricinus in Norway and to evaluate if any range shifts have occurred relative to historical descriptions. Methods Multiple data sources - such as tick-sighting reports from veterinarians, hunters, and the general public - and surveillance of human and animal tick-borne diseases were compared to describe the present distribution of I. ricinus in Norway. Correlation between data sources and visual comparison of maps revealed spatial consistency. In order to identify the main spatial pattern of tick abundance, a principal component analysis (PCA was used to obtain a weighted mean of four data sources. The weighted mean explained 67% of the variation of the data sources covering Norway's 430 municipalities and was used to depict the present distribution of I. ricinus. To evaluate if any geographical range shift has occurred in recent decades, the present distribution was compared to historical data from 1943 and 1983. Results Tick-borne disease and/or observations of I. ricinus was reported in municipalities up to an altitude of 583 metres above sea level (MASL and is now present in coastal municipalities north to approximately 69°N. Conclusion I. ricinus is currently found further north and at higher altitudes than described in

  8. Dominance of Dermacentor reticulatus over Ixodes ricinus (Ixodidae) on livestock, companion animals and wild ruminants in eastern and central Poland.

    Science.gov (United States)

    Mierzejewska, Ewa J; Welc-Faleciak, Renata; Karbowiak, Grzegorz; Kowalec, Maciej; Behnke, Jerzy M; Bajer, Anna

    2015-05-01

    The most common tick species parasitizing animals in Poland are Ixodes ricinus and Dermacentor reticulatus. These tick species differ in their distribution, habitats, seasonal activity and host specificity. Ixodes ricinus is the most prevalent and widely distributed, whereas the range of D. reticulatus is limited to eastern and central parts of the country with several new foci in the middle-west and the west. However, as in many central European countries, the range of D. reticulatus is expanding, and some authors have correlated this expansion with an increasing number of available hosts. The aim of the present study was to determine the tick fauna on domestic and livestock animals in two areas endemic for I. ricinus and D. reticulatus and to compare the risk of infestation with different tick species in open and forest areas. Over a 14 month period, 732 ticks were collected from five host species including domestic animals (dogs and cats), livestock (cows and horses) and wildlife (European bison) in two areas, central and NE Poland, endemic for D. reticulatus. Three tick species were recorded: D. reticulatus (623 individuals; 85.1% of all collected ticks), I. ricinus (106 individuals; 14.5%) and three females of Ixodes hexagonus (0.4%) from a dog. Dermacentor reticulatus was the dominant tick species found on four host species and constituted 86, 81, 97 and 100% of all ticks from dogs, horses, cows and bison, respectively, and was collected from animals throughout the year, including during the winter. The common tick, I. ricinus, was the dominant tick collected from cats (94%). Fully-engorged, ready-for-reproduction females of D. reticulatus were collected from all host species. In May 2012, questing ticks were collected by dragging in forest or open habitats. The density of adult marsh ticks in open areas was around 2 ticks/100 m(2) in the majority of locations, with a maximum of 9.5 ticks/100 m(2). The density of adult I. ricinus was much lower in its typical

  9. Effects of global changes on the climatic niche of the tick Ixodes ricinus inferred by species distribution modelling

    Science.gov (United States)

    2013-01-01

    Background Global climate change can seriously impact on the epidemiological dynamics of vector-borne diseases. In this study we investigated how future climatic changes could affect the climatic niche of Ixodes ricinus (Acari, Ixodida), among the most important vectors of pathogens of medical and veterinary concern in Europe. Methods Species Distribution Modelling (SDM) was used to reconstruct the climatic niche of I. ricinus, and to project it into the future conditions for 2050 and 2080, under two scenarios: a continuous human demographic growth and a severe increase of gas emissions (scenario A2), and a scenario that proposes lower human demographic growth than A2, and a more sustainable gas emissions (scenario B2). Models were reconstructed using the algorithm of “maximum entropy”, as implemented in the software Maxent 3.3.3e; 4,544 occurrence points and 15 bioclimatic variables were used. Results In both scenarios an increase of climatic niche of about two times greater than the current area was predicted as well as a higher climatic suitability under the scenario B2 than A2. Such an increase occurred both in a latitudinal and longitudinal way, including northern Eurasian regions (e.g. Sweden and Russia), that were previously unsuitable for the species. Conclusions Our models are congruent with the predictions of range expansion already observed in I. ricinus at a regional scale and provide a qualitative and quantitative assessment of the future climatically suitable areas for I. ricinus at a continental scale. Although the use of SDM at a higher resolution should be integrated by a more refined analysis of further abiotic and biotic data, the results presented here suggest that under future climatic scenarios most of the current distribution area of I. ricinus could remain suitable and significantly increase at a continental geographic scale. Therefore disease outbreaks of pathogens transmitted by this tick species could emerge in previous non

  10. Chemical composition and in vitro activity of plant extracts from Ferula communis and Dittrichia viscosa against postharvest fungi.

    Science.gov (United States)

    Mamoci, Erjon; Cavoski, Ivana; Simeone, Vito; Mondelli, Donato; Al-Bitar, Lina; Caboni, Pierluigi

    2011-03-22

    F. communis and D. viscosa are perennial Mediterranean weeds that have been used for different therapeutic purposes in traditional pharmacopeia. Plant extracts were obtained from air dried D. viscosa young shoots (DvA) and F. communis aerial part (FcA) and roots (FcR) with n-hexane. The chemical compositions of the extracts were analyzed by HPLC-DAD, LC-MS (ESI) and LC-Q-TOF techniques. Two sesquiterpene lactones (inuviscolide, tomentosin) and three sesquiterpene acids (costic acid, hydroxycostic acid, ilicic acid) were identified from the D. viscosa extract, while in F. communis extracts three daucane sesquiterpenes (acetoxyferutinin, oxojaeskeanadioyl anisate, fertidin) and one coumarin (ferulenol) derivates were found. Biological activities of plant extracts were studied in in vitro experiments on the colonies and conidia of Botryotinia fuckeliana, Penicillium digitatum, P. expansum, Monilinia laxa, M. fructigena and Aspergillus spp. Extracts showed varying degree of antifungal activities on colony growth and conidia germination. The extract from FcA showed the least effect, while DvA extract had the strongest fungitoxic effects. FcR extract presented a fungitoxic effect on the colony growth, but it was not able to inhibit the conidia germination. These distinctions can be attributed to the differences in chemical composition of plant extracts.

  11. Chemical Composition and In Vitro Activity of Plant Extracts from Ferula communis and Dittrichia viscosa against Postharvest Fungi

    Directory of Open Access Journals (Sweden)

    Donato Mondelli

    2011-03-01

    Full Text Available F. communis and D. viscosa are perennial Mediterranean weeds that have been used for different therapeutic purposes in traditional pharmacopeia. Plant extracts were obtained from air dried D. viscosa young shoots (DvA and F. communis aerial part (FcA and roots (FcR with n-hexane. The chemical compositions of the extracts were analyzed by HPLC-DAD, LC-MS (ESI and LC-Q-TOF techniques. Two sesquiterpene lactones (inuviscolide, tomentosin and three sesquiterpene acids (costic acid, hydroxycostic acid, ilicic acid were identified from the D. viscosa extract, while in F. communis extracts three daucane sesquiterpenes (acetoxyferutinin, oxojaeskeanadioyl anisate, fertidin and one coumarin (ferulenol derivates were found. Biological activities of plant extracts were studied in in vitro experiments on the colonies and conidia of Botryotinia fuckeliana, Penicillium digitatum, P. expansum, Monilinia laxa, M. fructigena and Aspergillus spp. Extracts showed varying degree of antifungal activities on colony growth and conidia germination. The extract from FcA showed the least effect, while DvA extract had the strongest fungitoxic effects. FcR extract presented a fungitoxic effect on the colony growth, but it was not able to inhibit the conidia germination. These distinctions can be attributed to the differences in chemical composition of plant extracts.

  12. Driving forces for changes in geographical distribution of Ixodes ricinus ticks in Europe

    Directory of Open Access Journals (Sweden)

    Medlock Jolyon M

    2013-01-01

    Full Text Available Abstract Many factors are involved in determining the latitudinal and altitudinal spread of the important tick vector Ixodes ricinus (Acari: Ixodidae in Europe, as well as in changes in the distribution within its prior endemic zones. This paper builds on published literature and unpublished expert opinion from the VBORNET network with the aim of reviewing the evidence for these changes in Europe and discusses the many climatic, ecological, landscape and anthropogenic drivers. These can be divided into those directly related to climatic change, contributing to an expansion in the tick’s geographic range at extremes of altitude in central Europe, and at extremes of latitude in Scandinavia; those related to changes in the distribution of tick hosts, particularly roe deer and other cervids; other ecological changes such as habitat connectivity and changes in land management; and finally, anthropogenically induced changes. These factors are strongly interlinked and often not well quantified. Although a change in climate plays an important role in certain geographic regions, for much of Europe it is non-climatic factors that are becoming increasingly important. How we manage habitats on a landscape scale, and the changes in the distribution and abundance of tick hosts are important considerations during our assessment and management of the public health risks associated with ticks and tick-borne disease issues in 21st century Europe. Better understanding and mapping of the spread of I. ricinus (and changes in its abundance is, however, essential to assess the risk of the spread of infections transmitted by this vector species. Enhanced tick surveillance with harmonized approaches for comparison of data enabling the follow-up of trends at EU level will improve the messages on risk related to tick-borne diseases to policy makers, other stake holders and to the general public.

  13. Driving forces for changes in geographical distribution of Ixodes ricinus ticks in Europe

    Science.gov (United States)

    2013-01-01

    Many factors are involved in determining the latitudinal and altitudinal spread of the important tick vector Ixodes ricinus (Acari: Ixodidae) in Europe, as well as in changes in the distribution within its prior endemic zones. This paper builds on published literature and unpublished expert opinion from the VBORNET network with the aim of reviewing the evidence for these changes in Europe and discusses the many climatic, ecological, landscape and anthropogenic drivers. These can be divided into those directly related to climatic change, contributing to an expansion in the tick’s geographic range at extremes of altitude in central Europe, and at extremes of latitude in Scandinavia; those related to changes in the distribution of tick hosts, particularly roe deer and other cervids; other ecological changes such as habitat connectivity and changes in land management; and finally, anthropogenically induced changes. These factors are strongly interlinked and often not well quantified. Although a change in climate plays an important role in certain geographic regions, for much of Europe it is non-climatic factors that are becoming increasingly important. How we manage habitats on a landscape scale, and the changes in the distribution and abundance of tick hosts are important considerations during our assessment and management of the public health risks associated with ticks and tick-borne disease issues in 21st century Europe. Better understanding and mapping of the spread of I. ricinus (and changes in its abundance) is, however, essential to assess the risk of the spread of infections transmitted by this vector species. Enhanced tick surveillance with harmonized approaches for comparison of data enabling the follow-up of trends at EU level will improve the messages on risk related to tick-borne diseases to policy makers, other stake holders and to the general public. PMID:23281838

  14. Dynamics of digestive proteolytic system during blood feeding of the hard tick Ixodes ricinus.

    Science.gov (United States)

    Franta, Zdeněk; Frantová, Helena; Konvičková, Jitka; Horn, Martin; Sojka, Daniel; Mareš, Michael; Kopáček, Petr

    2010-12-14

    Ticks are vectors of a wide variety of pathogens causing severe diseases in humans and domestic animals. Intestinal digestion of the host blood is an essential process of tick physiology and also a limiting factor for pathogen transmission since the tick gut represents the primary site for pathogen infection and proliferation. Using the model tick Ixodes ricinus, the European Lyme disease vector, we have previously demonstrated by genetic and biochemical analyses that host blood is degraded in the tick gut by a network of acidic peptidases of the aspartic and cysteine classes. This study reveals the digestive machinery of the I. ricinus during the course of blood-feeding on the host. The dynamic profiling of concentrations, activities and mRNA expressions of the major digestive enzymes demonstrates that the de novo synthesis of peptidases triggers the dramatic increase of the hemoglobinolytic activity along the feeding period. Overall hemoglobinolysis, as well as the activity of digestive peptidases are negligible at the early stage of feeding, but increase dramatically towards the end of the slow feeding period, reaching maxima in fully fed ticks. This finding contradicts the established opinion that blood digestion is reduced at the end of engorgement. Furthermore, we show that the digestive proteolysis is localized intracellularly throughout the whole duration of feeding. Results suggest that the egressing proteolytic system in the early stage of feeding and digestion is a potential target for efficient impairment, most likely by blocking its components via antibodies present in the host blood. Therefore, digestive enzymes are promising candidates for development of novel 'anti-tick' vaccines capable of tick control and even transmission of tick-borne pathogens.

  15. Borrelia burgdorferi sensu lato in Ixodes ricinus ticks collected from migratory birds in Southern Norway

    Directory of Open Access Journals (Sweden)

    Skarpaas Tone

    2010-11-01

    Full Text Available Abstract Background Borrelia burgdorferi sensu lato (s.l. are the causative agent for Lyme borreliosis (LB, the most common tick-borne disease in the northern hemisphere. Birds are considered important in the global dispersal of ticks and tick-borne pathogens through their migration. The present study is the first description of B. burgdorferi prevalence and genotypes in Ixodes ricinus ticks feeding on birds during spring and autumn migration in Norway. Methods 6538 migratory birds were captured and examined for ticks at Lista Bird Observatory during the spring and the autumn migration in 2008. 822 immature I. ricinus ticks were collected from 215 infested birds. Ticks were investigated for infection with B. burgdorferi s.l. by real-time PCR amplification of the 16S rRNA gene, and B. burgdorferi s.l. were thereafter genotyped by melting curve analysis after real-time PCR amplification of the hbb gene, or by direct sequencing of the PCR amplicon generated from the rrs (16S-rrl (23S intergenetic spacer. Results B. burgdorferi s.l. were detected in 4.4% of the ticks. The most prevalent B. burgdorferi genospecies identified were B. garinii (77.8%, followed by B.valaisiana (11.1%, B. afzelii (8.3% and B. burgdorferi sensu stricto (2.8%. Conclusion Infection rate in ticks and genospecies composition were similar in spring and autumn migration, however, the prevalence of ticks on birds was higher during spring migration. The study supports the notion that birds are important in the dispersal of ticks, and that they may be partly responsible for the heterogeneous distribution of B. burgdorferi s.l. in Europe.

  16. Diversity of viruses in Ixodes ricinus, and characterization of a neurotropic strain of Eyach virus

    Directory of Open Access Journals (Sweden)

    S. Moutailler

    2016-05-01

    Full Text Available Ticks transmit more pathogens—including bacteria, parasites and viruses—than any other arthropod vector. Although the epidemiological status of many tick-borne bacteria is very well characterized, tick-borne viruses are still relatively under-studied. Recently, several novel tick-borne viruses have been isolated from human febrile illnesses following tick bites, indicating the existence of other potential new and unknown tick-borne viruses. We used high-throughput sequencing to analyse the virome of Ixodes ricinus, the main vector of tick-borne pathogens in Europe. The majority of collected viral sequences were assigned to two potentially novel Nairovirus and Phlebovirus viruses, with prevalence rates ranging from 3.95% to 23.88% in adults and estimated to be between 0.14% and 72.16% in nymphs. These viruses could not be isolated from the brains of inoculated immunocompromised mice, perhaps indicating that they are unable to infect vertebrates. Within the I. ricinus virome, we also identified contigs with >90% identity to the known Eyach virus. Initially isolated in the 1980s, this virus was indirectly associated with human disease, but had never been extensively studied. Eyach virus prevalence varied between 0.07% and 5.26% in ticks from the French Ardennes and Alsace regions. Eyach virus was successfully isolated following intracerebral inoculation of immunocompromised mice with Eyach virus-positive tick extracts. This virus was also able to multiply and persist in the blood of immunocompetent mice inoculated by intraperitoneal injection, and caused brain infections in three of nine juveniles, without any obvious deleterious effects.

  17. Dynamics of digestive proteolytic system during blood feeding of the hard tick Ixodes ricinus

    Directory of Open Access Journals (Sweden)

    Sojka Daniel

    2010-12-01

    Full Text Available Abstract Background Ticks are vectors of a wide variety of pathogens causing severe diseases in humans and domestic animals. Intestinal digestion of the host blood is an essential process of tick physiology and also a limiting factor for pathogen transmission since the tick gut represents the primary site for pathogen infection and proliferation. Using the model tick Ixodes ricinus, the European Lyme disease vector, we have previously demonstrated by genetic and biochemical analyses that host blood is degraded in the tick gut by a network of acidic peptidases of the aspartic and cysteine classes. Results This study reveals the digestive machinery of the I. ricinus during the course of blood-feeding on the host. The dynamic profiling of concentrations, activities and mRNA expressions of the major digestive enzymes demonstrates that the de novo synthesis of peptidases triggers the dramatic increase of the hemoglobinolytic activity along the feeding period. Overall hemoglobinolysis, as well as the activity of digestive peptidases are negligible at the early stage of feeding, but increase dramatically towards the end of the slow feeding period, reaching maxima in fully fed ticks. This finding contradicts the established opinion that blood digestion is reduced at the end of engorgement. Furthermore, we show that the digestive proteolysis is localized intracellularly throughout the whole duration of feeding. Conclusions Results suggest that the egressing proteolytic system in the early stage of feeding and digestion is a potential target for efficient impairment, most likely by blocking its components via antibodies present in the host blood. Therefore, digestive enzymes are promising candidates for development of novel 'anti-tick' vaccines capable of tick control and even transmission of tick-borne pathogens.

  18. [Mapping of parasitological environmental data: the tick Ixodes ricinus--a case of study].

    Science.gov (United States)

    Kiewra, Dorota; Lonc, Elzbieta; Rydzanicz, Katarzyna

    2009-01-01

    While the mapping of health data is not new for epidemiologists the incorporation of differentiated environmental factors, e.g., temperature, rainfall, humidity, elevation, vegetation type, host abundance and distribution, zoonotic reservoirs of infection can create a new opportunities for parasitologists. Suitable tools for spatial modeling of health problems and pathogen occurrence in space and time are provided by geographic information system (GIS). It is computer-based system which integrates, storages, edits, analyses, shares and displays information. This software system is based on connection between information--data and their location. GIS applications allow users to create interactive queries, analyze spatial information, edit data and maps. GIS is very useful to define the habitats of parasites, especially for the ticks which are strong depended on environmental conditions. Mapping not only enables to create maps based on field monitoring but also to create forecasting maps for prevention and control strategies on small and large scale. Up to now ticks and tick-borne diseases (TBD) having strong relationship with the ecosystem are highly amenable to predictive mapping. The aim of study is the characterization of procedural steps with regard to entering field environmental data to GIS database and their visualization on digital maps. The field date of tick monitoring conducted in April 2008 in the Wrocław area (the Osobowicki Forest) made possible to create digital database. ArcView as one of three separate software products of ArcGIS (a scalable framework for implementing GIS) was used to create an interactive maps. Visualization of the data which are stored in tables of attributes made possible to show legibly the distribution of I. ricinus on the analysed area. Mapping of I. ricinus occurrence on digital maps enable to indicate areas of the highest risk of biting and potential tick-borne diseases.

  19. IrFC - An Ixodes ricinus injury-responsive molecule related to Limulus Factor C.

    Science.gov (United States)

    Urbanová, Veronika; Hartmann, David; Grunclová, Lenka; Šíma, Radek; Flemming, Tina; Hajdušek, Ondřej; Kopáček, Petr

    2014-10-01

    Limulus Clotting Factor C is a multi-domain serine protease that triggers horseshoe crab hemolymph clotting in the presence of trace amounts of bacterial lipopolysaccharides. Here we describe and functionally characterize an homologous molecule, designated as IrFC, from the hard tick Ixodes ricinus. Tick Factor C consists of an N-terminal cysteine-rich domain, four complement control protein (sushi) modules, an LCCL domain, a truncated C-lectin domain and a C-terminal trypsin-type domain. Developmental expression profiling by quantitative real-time PCR revealed that the irfc mRNA is expressed in all stages including eggs. In tissues dissected from adult I. ricinus females, the irfc mRNA is present mainly in tick hemocytes and accordingly, indirect immunofluorescence microscopy localized IrFC intracellularly, in tick hemocytes. Irfc mRNA levels were markedly increased upon injection of sterile saline, or different microbes, demonstrating that the irfc gene transcription occurs in response to injury. This indicates a possible role of IrFC in hemolymph clotting and/or wound healing, although these defense mechanisms have not been yet definitely demonstrated in ticks. RNAi silencing of irfc expression resulted in a significant reduction in phagocytic activity of tick hemocytes against the Gram-negative bacteria Chryseobacterium indologenes and Escherichia coli, but not against the yeast, Candida albicans. This result suggests that IrFC plays a role in the tick primordial complement system and as such possibly mediates transmission of tick-borne pathogens. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. Insight into the sialome of the castor bean tick, Ixodes ricinus

    Directory of Open Access Journals (Sweden)

    Valenzuela Jesus G

    2008-05-01

    Full Text Available Abstract Background In recent years, there have been several sialome projects revealing transcripts expressed in the salivary glands of ticks, which are important vectors of several human diseases. Here, we focused on the sialome of the European vector of Lyme disease, Ixodes ricinus. Results In the attempt to describe expressed genes and their dynamics throughout the feeding period, we constructed cDNA libraries from four different feeding stages of Ixodes ricinus females: unfed, 24 hours after attachment, four (partially fed and seven days (fully engorged after attachment. Approximately 600 randomly selected clones from each cDNA library were sequenced and analyzed. From a total 2304 sequenced clones, 1881 sequences forming 1274 clusters underwent subsequent functional analysis using customized bioinformatics software. Clusters were sorted according to their predicted function and quantitative comparison among the four libraries was made. We found several groups of over-expressed genes associated with feeding that posses a secretion signal and may be involved in tick attachment, feeding or evading the host immune system. Many transcripts clustered into families of related genes with stage-specific expression. Comparison to Ixodes scapularis and I. pacificus transcripts was made. Conclusion In addition to a large number of homologues of the known transcripts, we obtained several novel predicted protein sequences. Our work contributes to the growing list of proteins associated with tick feeding and sheds more light on the dynamics of the gene expression during tick feeding. Additionally, our results corroborate previous evidence of gene duplication in the evolution of ticks.

  1. Novel route of synthesis for cellulose fiber-based hybrid polyurethane

    Science.gov (United States)

    Ikhwan, F. H.; Ilmiati, S.; Kurnia Adi, H.; Arumsari, R.; Chalid, M.

    2017-07-01

    Polyurethanes, obtained by the reaction of a diisocyanate compound with bifunctional or multifunctional reagent such as diols or polyols, have been studied intensively and well developed. The wide range modifier such as chemical structures and molecular weight to build polyurethanes led to designs of materials that may easily meet the functional product demand and to the extraordinary spreading of these materials in market. Properties of the obtained polymer are related to the chemical structure of polyurethane backbone. A number polyurethanes prepared from biomass-based monomers have been reported. Cellulose fiber, as a biomass material is containing abundant hydroxyl, promising material as chain extender for building hybrid polyurethanes. In previous researches, cellulose fiber was used as filler in synthesis of polyurethane composites. This paper reported a novel route of hybrid polyurethane synthesis, which a cellulose fiber was used as chain extender. The experiment performed by reacting 4,4’-Methylenebis (cyclohexyl isocyanate) (HMDI) and polyethylene glycol with variation of molecular weight to obtained pre-polyurethane, continued by adding micro fiber cellulose (MFC) with variation of type and composition in the mixture. The experiment was evaluated by NMR, FTIR, SEM and STA measurement. NMR and FTIR confirmed the reaction of the hybrid polyurethane. STA showed hybrid polyurethane has good thermal stability. SEM showed good distribution and dispersion of sorghum-based MFC.

  2. Synthesis of polyurethane/clay nanocomposites based palm oil polyol coating

    Directory of Open Access Journals (Sweden)

    Teuku Rihayat

    2015-12-01

    Full Text Available In this study, we investigated the Polyurethane paint based on palm oil with the addition of nanoparticles montmorillonite as a heat-resistant. The composites with 1 wt%, 3 wt% and 5 wt% of bentonite filler content obtained by synthesizing in situ were investigated and compared to the neat polyurethane matrix material. The processing of bentonite for montmorillonite was done through several stages including: sedimentation, ultrasonication, dried, sieved with a 200 mesh sieve, then characterized. Untreated MMT were isolated and modified with CTAB. The addition of MMT into polyurethane, as much as 5% wt, can increase the heat as evidenced by the TGA test. The TGA results indicated an enhanced thermal stability, as compared to the neat polyurethane. The onset degradation of neat polyurethane and weight reduction began at a temperature of 50-150°C and completely decomposed at the temperatures of 380°C and for PU MKS-MMT reduction, the initial weight started at a temperature of 150-200°C in 5 %wt and decomposed in the end at a temperature of 490°C. In this research, we also tested the gloss adhesive polyurethane with the addition of MMT; the result stated that the addition of 5%wt MMT can improve the adhesion of polyurethane. The addition of MMT in polyurethane can also enhance the gloss polyurethane compared with polyurethane coated without the addition of MMT.

  3. The Modification of Polyurethane Foams Using New Boroorganic Polyols (II) Polyurethane Foams from Boron-Modified Hydroxypropyl Urea Derivatives

    Science.gov (United States)

    2014-01-01

    The work focuses on research related to determination of application possibility of new, ecofriendly boroorganic polyols in rigid polyurethane foams production. Polyols were obtained from hydroxypropyl urea derivatives esterified with boric acid and propylene carbonate. The influence of esterification type on properties of polyols and next on polyurethane foams properties was determined. Nitrogen and boron impacts on the foams' properties were discussed, for instance, on their physical, mechanical, and electric properties. Boron presence causes improvement of dimensional stability and thermal stability of polyurethane foams. They can be applied even at temperature 150°C. Unfortunately, introducing boron in polyurethanes foams affects deterioration of their water absorption, which increases as compared to the foams that do not contain boron. However, presence of both boron and nitrogen determines the decrease of the foams combustibility. Main impact on the decrease combustibility of the obtained foams has nitrogen presence, but in case of proper boron and nitrogen ratio their synergic activity on the combustibility decrease can be easily seen. PMID:24587721

  4. The Modification of Polyurethane Foams Using New Boroorganic Polyols (II Polyurethane Foams from Boron-Modified Hydroxypropyl Urea Derivatives

    Directory of Open Access Journals (Sweden)

    Iwona Zarzyka

    2014-01-01

    Full Text Available The work focuses on research related to determination of application possibility of new, ecofriendly boroorganic polyols in rigid polyurethane foams production. Polyols were obtained from hydroxypropyl urea derivatives esterified with boric acid and propylene carbonate. The influence of esterification type on properties of polyols and next on polyurethane foams properties was determined. Nitrogen and boron impacts on the foams’ properties were discussed, for instance, on their physical, mechanical, and electric properties. Boron presence causes improvement of dimensional stability and thermal stability of polyurethane foams. They can be applied even at temperature 150°C. Unfortunately, introducing boron in polyurethanes foams affects deterioration of their water absorption, which increases as compared to the foams that do not contain boron. However, presence of both boron and nitrogen determines the decrease of the foams combustibility. Main impact on the decrease combustibility of the obtained foams has nitrogen presence, but in case of proper boron and nitrogen ratio their synergic activity on the combustibility decrease can be easily seen.

  5. Solvent-free fabrication of micro-porous polyurethane amide and polyurethane-urea scaffolds for repair and replacement of the knee-joint meniscus

    NARCIS (Netherlands)

    Spaans, C.J; Belgraver, V.W.; Rienstra, O.; de Groot, J.H; Veth, R.P.H.; Penning, J.P

    2000-01-01

    New porous polyurethane urea and polyurethane amide scaffolds for meniscal reconstruction have been developed in a solvent-free process. As soft segments, copolymers of 50/50 L-lactide/epsilon-caprolactone have been used. After terminating the soft segment with diisocyanates, chain extension was

  6. Gradients of turgor, osmotic pressure, and water potential in the cortex of the hypocotyl of growing ricinus seedlings : effects of the supply of water from the xylem and of solutes from the Phloem.

    Science.gov (United States)

    Meshcheryakov, A; Steudle, E; Komor, E

    1992-03-01

    To evaluate the possible role of solute transport during extension growth, water and solute relations of cortex cells of the growing hypocotyl of 5-day-old castor bean seedlings (Ricinus communis L.) were determined using the cell pressure probe. Because the osmotic pressure of individual cells (pi(i)) was also determined, the water potential (psi) could be evaluated as well at the cell level. In the rapidly growing part of the hypocotyl of well-watered plants, turgor increased from 0.37 megapascal in the outer to 1.04 megapascal in the inner cortex. Thus, there were steep gradients of turgor of up to 0.7 megapascal (7 bar) over a distance of only 470 micrometer. In the more basal and rather mature region, gradients were less pronounced. Because cell turgor approximately pi(i) and psi approximately 0 across the cortex, there were also no gradients of psi across the tissue. Gradients of cell turgor and pi(i) increased when the endosperm was removed from the cotyledons, allowing for a better water supply. They were reduced by increasing the osmotic pressure of the root medium or by cutting off the cotyledons or the entire hook. If the root was excised to interrupt the main source for water, effects became more pronounced. Gradients completely disappeared and turgor fell to 0.3 megapascal in all layers within 1.5 hours. When excised hypocotyls were infiltrated with 0.5 millimolar CaCl(2) solution under pressure via the cut surface, gradients in turgor could be restored or even increased. When turgor was measured in individual cortical cells while pressurizing the xylem, rapid responses were recorded and changes of turgor exceeded that of applied pressure. Gradients could also be reestablished in excised hypocotyls by abrading the cuticle, allowing for a water supply from the wet environment. The steep gradients of turgor and osmotic pressure suggest a considerable supply of osmotic solutes from the phloem to the growing tissue. On the basis of a new theoretical

  7. Protein (Viridiplantae): 407549 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 77:3021 ... 235629:3021 ... 235880:3021 ... 3987:3021 ... 3988:3021 ... conserved hypothetical protein Ricinus communis MGRRQNDQESSRFTFLTLLLVGFISC...ALVYTVLSLILNPNITFINSDSKYLAMEGKSFKSKDDGECCRGINNLELWGPAVKW

  8. Modelling of the mechanical behavior of a polyurethane finger interphalangeal joint endoprosthesis after surface modification by ion implantation

    Science.gov (United States)

    Beliaev, A.; Svistkov, A.; Iziumov, R.; Osorgina, I.; Kondyurin, A.; Bilek, M.; McKenzie, D.

    2016-04-01

    Production of biocompatible implants made of polyurethane treated with plasma is very perspective. During plasma treatment the surface of polyurethane acquires unique physic-chemical properties. However such treatment may change the mechanical properties of polyurethane which may adversely affect the deformation behaviour of the real implant. Therefore careful study of the mechanical properties of the plasma-modified polyurethane is needed. In this paper, experimental observations of the elastic characteristics of plasma treated polyurethane and modelling of the deformation behaviour of polyurethane bio-implants are reported.

  9. A comparison of performance between Teflon and polyurethane safety cannulae at extremes of operating temperatures.

    Science.gov (United States)

    Jeyanathan, J; Webster, B B; Hawksley, O J; Mellor, A J

    2012-06-01

    In the United Kingdom, approximately eight million peripheral cannulations are performed each year. Intravenous cannulae are made from either polytetrafluoroethylene (Teflon) or polyurethane. Polyurethane has a lower incidence of thrombophlebitis, however the physical characteristics of polyurethane may make the cannulae difficult to use at higher ambient temperatures. This effect maybe of importance to those involved in cannulation in extreme environments and especially for military doctors deployed in current theatres of operations. In a randomised single blinded study we investigated the different characteristics of Teflon and polyurethane cannulae (Vasofix Safety Cannulae, B Braun) at three different temperatures (-10 degrees C, 21 degrees C and 40 degrees C). There is no statistically significant difference in the ease or speed of cannulation of either polyurethane or Teflon safety cannulae in extremes of temperature. This study provides evidence that performance of polyurethane safety cannulae are not impaired by temperature extremes.

  10. Europe-Wide Meta-Analysis of Borrelia burgdorferi Sensu Lato Prevalence in Questing Ixodes ricinus Ticks

    Czech Academy of Sciences Publication Activity Database

    Strnad, Martin; Hönig, Václav; Růžek, Daniel; Grubhoffer, Libor; Rego, Ryan O. M.

    2017-01-01

    Roč. 83, č. 15 (2017), č. článku e00609-17. ISSN 0099-2240 EU Projects: European Commission(XE) 278976 - ANTIGONE; European Commission(XE) 602272 - ANTIDotE Institutional support: RVO:60077344 Keywords : Borrelia burgdorferi sensu lato * tick * Ixodes ricinus * genospecies * meta-analysis * Lyme borreliosis * Lyme disease Subject RIV: EE - Microbiology, Virology Impact factor: 3.807, year: 2016

  11. Ixodes ricinus ticks are reservoir hosts for Rickettsia helvetica and potentially carry flea-borne Rickettsia species

    Directory of Open Access Journals (Sweden)

    Gaasenbeek Cor

    2009-09-01

    Full Text Available Abstract Background Hard ticks have been identified as important vectors of rickettsiae causing the spotted fever syndrome. Tick-borne rickettsiae are considered to be emerging, but only limited data are available about their presence in Western Europe, their natural life cycle and their reservoir hosts. Ixodes ricinus, the most prevalent tick species, were collected and tested from different vegetation types and from potential reservoir hosts. In one biotope area, the annual and seasonal variability of rickettsiae infections of the different tick stages were determined for 9 years. Results The DNA of the human pathogen R. conorii as well as R. helvetica, R. sp. IRS and R. bellii-like were found. Unexpectedly, the DNA of the highly pathogenic R. typhi and R. prowazekii and 4 other uncharacterized Rickettsia spp. related to the typhus group were also detected in I. ricinus. The presence of R. helvetica in fleas isolated from small rodents supported our hypothesis that cross-infection can occur under natural conditions, since R. typhi/prowazekii and R. helvetica as well as their vectors share rodents as reservoir hosts. In one biotope, the infection rate with R. helvetica was ~66% for 9 years, and was comparable between larvae, nymphs, and adults. Larvae caught by flagging generally have not yet taken a blood meal from a vertebrate host. The simplest explanation for the comparable prevalence of R. helvetica between the defined tick stages is, that R. helvetica is vertically transmitted through the next generation with high efficiency. The DNA of R. helvetica was also present in whole blood from mice, deer and wild boar. Conclusion Besides R. helvetica, unexpected rickettsiae are found in I. ricinus ticks. We propose that I. ricinus is a major reservoir host for R. helvetica, and that vertebrate hosts play important roles in the further geographical dispersion of rickettsiae.

  12. Coexistence of Borrelia burgdorferi s.l. genospecies within Ixodes ricinus ticks from central and eastern Poland.

    Science.gov (United States)

    Sytykiewicz, Hubert; Karbowiak, Grzegorz; Chorostowska-Wynimko, Joanna; Szpechciński, Adam; Supergan-Marwicz, Marta; Horbowicz, Marcin; Szwed, Magdalena; Czerniewicz, Paweł; Sprawka, Iwona

    2015-12-01

    The purpose of the study was to assess the prevalence and coinfection rates of Borrelia burgdorferi sensu lato genotypes in Ixodes ricinus (L.) ticks sampled from diverse localities in central and eastern regions of Poland. In years 2009-2011, questing nymphs and adults of I. ricinus were collected using a flagging method at 18 localities representing distinct ecosystem types: urban green areas, suburban forests and rural woodlands. Molecular detection of B. burgdorferi s.l. genospecies was based on amplification of a fla gene using nested PCR technique, subsequent PCR-RFLP analysis and bidirectional sequencing. It was revealed that 45 samples (2.1%) harboured two different B. burgdorferi s.l. genospecies, whereas triple infections with various spirochetes was found in 11 (0.5%) individuals. Generally, the highest average coinfection rates were evidenced in arachnids gathered at rural woodlands, intermediate at suburban forests, while the lowest were recorded at urban green areas. Overall, single spirochete infections were noted in 16.3% (n = 352/2,153) ticks. Importantly, it is the first report evidencing the occurrence of Borrelia miyamotoi (0.3%, n = 7/2153) in I. ricinus populations within central Poland. Circumstantial variability of B. burgdorferi s.l. genospecies in the common tick individuals sampled at various habitat types in central and eastern Poland was displayed. The coexistence of two or three different spirochete genospecies in single adult ticks, as well as the presence of B. miyamotoi were demonstrated. Therefore, further studies uncovering the co-circulation of the tested bacteria and other human pathogens in I. ricinus ticks are required.

  13. A Density Map of the Tick-Borne Encephalitis and Lyme Borreliosis Vector Ixodes ricinus (Acari: Ixodidae) for Germany.

    Science.gov (United States)

    Brugger, Katharina; Boehnke, Denise; Petney, Trevor; Dobler, Gerhard; Pfeffer, Martin; Silaghi, Cornelia; Schaub, Günter A; Pinior, Beate; Dautel, Hans; Kahl, Olaf; Pfister, Kurt; Süss, Jochen; Rubel, Franz

    2016-11-01

    The castor bean tick Ixodes ricinus (L.) is the principal vector for a variety of viral, bacterial, and protozoan pathogens causing a growing public-health issue over the past decades. However, a national density map of I. ricinus is still missing. Here, I. ricinus nymphs in Germany were investigated by compiling a high-resolution map depicting the mean annually accumulated nymphal density, as observed by monthly flagging an area of 100 m(2) Input data comprise ticks collected at 69 sampling sites. The model domain covers an area of about 357,000 km(2) (regional scale). Two negative binomial regression models were fitted to the data to interpolate the tick densities to unsampled locations using bioclimatic variables and land cover, which were selected according to their significance by the Akaike information criterion (AIC). The default model was fitted to the complete dataset resulting in AIC = 842. An optimized model resulted in a significantly better value of AIC = 732. Tick densities are very low in urban (green) areas. Maximum annual densities up to 1,000 nymphs per 100 m(2) are observed in broad-leaved forests. The tick maps were verified by leave-one-out cross-validation. Root mean square errors of RMSE = 137 and RMSE = 126 nymphs per 100 m(2) were estimated for the two models, respectively. These errors are of the order of the interannual variation of the tick densities. The compilation of a high-resolution density map of unfed nymphal I. ricinus for Germany provides a novel, nationwide insight into the distribution of an important disease vector. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  14. Ixodes ricinus abundance and its infection with the tick-borne pathogens in urban and suburban areas of Eastern Slovakia

    OpenAIRE

    Pangr?cov?, Lucia; Derd?kov?, Mark?ta; Pek?rik, Ladislav; Hvi??ov?, Ivana; V?chov?, Bronislava; Stanko, Michal; Hlavat?, Helena; Pe?ko, Branislav

    2013-01-01

    Background Raising abundance of ticks and tick-borne diseases in Europe is the result of multiple factors including climate changes and human activities. Herein, we investigated the presence and seasonal activity of Ixodes ricinus ticks from 10 urban and suburban sites in two different geographical areas of southeastern and northeastern Slovakia during 2008?2010. Our aim was to study the abundance of ticks in correlation with the environmental factors and their infection with Borrelia burgdor...

  15. Synanthropic Birds Influence the Distribution of Borrelia Species: Analysis of Ixodes ricinus Ticks Feeding on Passerine Birds ▿ †

    Science.gov (United States)

    Dubska, Lenka; Literak, Ivan; Kocianova, Elena; Taragelova, Veronika; Sverakova, Veronika; Sychra, Oldrich; Hromadko, Miloslav

    2011-01-01

    Ixodes ricinus ticks collected from 835 birds and from vegetation in the Czech Republic were analyzed. Host-seeking ticks (n = 427) were infected predominantly by Borrelia afzelii (25%). Ticks (n = 1,012) from songbirds (Passeriformes) were infected commonly by Borrelia garinii (12.1%) and Borrelia valaisiana (13.4%). Juveniles of synanthropic birds, Eurasian blackbirds (Turdus merula) and song thrushes (Turdus philomelos), were major reservoir hosts of B. garinii. PMID:21148704

  16. Asynchronous development of stigmatic receptivity in the pear (Pyrus communis; Rosaceae) flower.

    Science.gov (United States)

    Sanzol, Javier; Rallo, Pilar; Herrero, María

    2003-01-01

    While stigma anatomy is well documented for a good number of species, little information is available on the acquisition and cessation of stigmatic receptivity. The aim of this work is to characterize the development of stigma receptivity, from anthesis to stigma degeneration, in the pentacarpellar pear (Pyrus communis) flower. Stigma development and stigmatic receptivity were monitored over two consecutive years, as the capacity of the stigmas to offer support for pollen germination and pollen tube growth. In an experiment where hand pollinations were delayed for specified times after anthesis, three different stigmatic developmental stages could be observed: (1) immature stigmas, which allow pollen adhesion but not hydration; (2) receptive stigmas, which allow proper pollen hydration and germination; and (3) degenerated stigmas, in which pollen hydrates and germinates properly, but pollen tube growth is impaired soon after germination. This developmental characterization showed that stigmas in different developmental stages coexist within a flower and that the acquisition and cessation of stigmatic receptivity by each carpel occur in a sequential manner. In this way, while the duration of stigmatic receptivity for each carpel is rather short, the flower has an expanded receptive period. This asynchronous period of receptivity for the different stigmas of a single flower is discussed as a strategy that could serve to maximize pollination resources under unreliable pollination conditions.

  17. Deoxypodophyllotoxin isolated from Juniperus communis induces apoptosis in breast cancer cells.

    Science.gov (United States)

    Benzina, Sami; Harquail, Jason; Jean, Stephanie; Beauregard, Annie-Pier; Colquhoun, Caitlyn D; Carroll, Madison; Bos, Allyson; Gray, Christopher A; Robichaud, Gilles A

    2015-01-01

    The study of anticancer properties from natural products has regained popularity as natural molecules provide a high diversity of chemical structures with specific biological and medicinal activity. Based on a documented library of the most common medicinal plants used by the indigenous people of North America, we screened and isolated compounds with anti-breast cancer properties from Juniperus communis (common Juniper). Using bioassay-guided fractionation of a crude plant extract, we identified the diterpene isocupressic acid and the aryltetralin lignan deoxypodophyllotoxin (DPT) as potent inducers of caspase-dependent programmed cell death (apoptosis) in malignant MB231 breast cancer cells. Further elucidation revealed that DPT, in contrast to isocupressic acid, also concomitantly inhibited cell survival pathways mediated by the MAPK/ERK and NFκB signaling pathways within hours of treatment. Our findings emphasize the potential and importance of natural product screening for new chemical entities with novel anticancer activities. Natural products research complemented with the wealth of information available through the ethnobotanical and ethnopharmacological knowledge of the indigenous peoples of North America can provide new candidate entities with desirable bioactivities to develop new cancer therapies.

  18. Apomixis and the problem of obtaining haploids and homozygote diploids in pear (Pyrus communis L.

    Directory of Open Access Journals (Sweden)

    Є. О. Долматов

    2013-02-01

    Full Text Available The article highlights results of research over simulative apomixes in pear and its utilization for obtaining haploids and homozygote diploids. It has been established that over 50% pear varieties with failed remote hybridization are capable of generating seeds of apomictic origin producing diploid plants. Genotypes displaying maximal inclination to apomixes have been singled out. Apomictic pear seedlings obtained from foreign pollination within the limits of the same combination are inherent in profound morphological diversity. Fruit-bearing apomicts originated from one and the same maternal plant differ to the same extent as hybrid seedlings of the same family. Genetic markers have enabled to establish that these are embryo sacs in which meiosis has completed that give rise to apomictic seeds. In vitro method as used for the purpose of increasing apomictic plants output has been illustrated. The greatest induction of apomictic shoots in vitro has been reached by alternation of BAP cytokinin at concentration of 1mg/l and 2 mg/l on the background of GA3 amounting to 1,5 mg/l. Grafting with shoots in vitro on non-sterile rootstocks of pear (Pyrus communis has increased the output of plants up to 80%. A cytological assessment of 9 apomictic samples is provided. The cytological analysis of samples of apomictic forms has certified the presence of simulative haploid parthenogenesis in pear.

  19. The batch fractionation of Juniperus communis L. essential oil: experimental study, mathematical simulation and process economy

    Directory of Open Access Journals (Sweden)

    Svetomir Ž. Milojević

    2010-07-01

    Full Text Available The separation in a batch vacuum column of the essential oil of common juniper berries (Juniperus communis L., from the southern part of Serbia was analyzed. The main goal of the analyzed separation process was to isolate several fractions from the essential oil which mainly contained α-pinene, sabinene and myrcene. These compounds contain about 65 mass% of the essential oil produced by hydrodistillation from the juniper berries originated from the southern part of Serbia. The results of experimental work in a laboratory column with 36 theoretical stages under vacuum (8.0-3.35 kPa was simulated using Aspen software, and a proposed mathematical model was used to analyze some other operating conditions for fractionation of juniper berry’s oil (number of plates: 25, 36 and 45 and reflux ratio: 2-10. According to the results of performed simulations, the most acceptable separation procedure which takes into account the prices of raw materials and distillate (α-pinene as well as consumed energy was proposed.

  20. Using juniper berry ( Juniperus communis as a supplement in Japanese quail diets

    Directory of Open Access Journals (Sweden)

    Hakan Inci

    2016-05-01

    Full Text Available ABSTRACT The present study was conducted to determine the effects of supplemented juniper berry (Juniperus communis on fattening performance and some carcass traits of quails. A total of 150 one-day-old Japanese quail chicks were randomly divided into five groups (one control and four treated groups with three replicates. Four different juniper berry levels (0.5, 1, 1.5, and 2% and a control treatment (0% were added to the diet. Juniper berry supplementation to the diets initiated at the end of the 1st week and sustained for seven weeks. Live weight, feed intake, and feed conversion ratio during the trial and some carcass traits after slaughter were determined. Juniper berry supplementation in the diet during seven weeks of growing period significantly increased body weight, cumulative feed intake, and feed conversion ratio of the treated groups. Carcass weight, carcass yield, and breast yield were also significantly increased by supplemented juniper berry. No significant difference was observed between viability of different groups. Supplementation of 0.5-1% juniper berry in quail diets has positive impacts on fattening performance and carcass traits.

  1. The Effect of Plant Growth Regulators on Callus Induction and Regeneration of Amygdalus communis

    Directory of Open Access Journals (Sweden)

    Naimeh SHARIFMOGHADAM

    2011-08-01

    Full Text Available The Almond (Amygdalus communis is one of the most important and oldest commercial nut crops, belonging to the Rosaceae family. Almond has been used as base material in pharmaceutical, cosmetic, hygienically and food industry. Propagation by tissue culture technique is the most important one in woody plants. In the current research, in vitro optimization of tissue culture and mass production of almond was investigated. In this idea, explants of actively growing shoots were collected and sterilized, then transferred to MS medium with different concentrations and combinations of plant growth regulators. The experiment was done in completely randomized blocks design, with 7 treatment and 30 replications. After 4 weeks, calli induction, proliferation, shoot length and number of shoot per explants were measured. Results showed that the best medium for shoot initiation and proliferation was MS + 0.5 mg/l IAA (Indol-3-Acetic Acid + 1 mg/l BA (Benzyl Adenine. Autumn was the best season for collecting explants. The shoots were transferred to root induction medium with different concentrations of plant growth regulators. The best root induction medium was MS + 0.5 mg/l IBA (Indol Butyric Acid.

  2. Antioxidant activities and fatty acid composition of wild grown myrtle (Myrtus communis L.) fruits

    Science.gov (United States)

    Serce, Sedat; Ercisli, Sezai; Sengul, Memnune; Gunduz, Kazim; Orhan, Emine

    2010-01-01

    The fruits of eight myrtles, Myrtus communis L. accessions from the Mediterranean region of Turkey were evaluated for their antioxidant activities and fatty acid contents. The antioxidant activities of the fruit extracts were determined by using 2,2-diphenyl-1-picrylhydrazyl (DPPH) and β-carotene-linoleic acid assays. The fatty acid contents of fruits were determined by using gas chromatography. The methanol extracts of fruits exhibited a high level of free radical scavenging activity. There was a wide range (74.51-91.65%) of antioxidant activity among the accessions in the β-carotene-linoleic acid assay. The amount of total phenolics (TP) was determined to be between 44.41-74.44 μg Gallic acid equivalent (GAE)/mg, on a dry weight basis. Oleic acid was the dominant fatty acid (67.07%), followed by palmitic (10.24%), and stearic acid (8.19%), respectively. These results suggest the future utilization of myrtle fruit extracts as food additives or in chemoprevention studies. PMID:20548930

  3. Corrosion Inhibition of Mild Steel in HCl by Isolated Compounds of Riccinus Communis (L.

    Directory of Open Access Journals (Sweden)

    Rinki Goel

    2010-01-01

    Full Text Available We have isolated three pyridine base alkaloids namely ricinine (C1, N-demethylricinine (C2 and 4-methoxy pyridine-3-carboxylic acid (C3 from methanolic extract of Riccinus Communis leaves and investigated corrosion inhibition effect on mild steel in 0.5 HCl solution using the weight loss and electrochemical techniques (Galvanostatic polarization and EIS. Polarization resistances calculated from the EIS measurements are in good agreement with those obtained from alternating current (AC polarization measurements. The mild steel samples were also analyzed by Scanning Electron Microscopy (SEM. The results show that C1 is an excellent inhibitor for mild steel in acid medium. The inhibition was assumed to occur via adsorption of the inhibitor molecule on the metal surface. In the 298- 308 K temperature range, the C1, C2 and C3 adsorption follows Langmuir isotherm model. The protection efficiency increases with increasing the inhibitor concentration in the range of 250-1000 ppm but slightly decreases with increasing temperature.

  4. Leptospirosis as a tick-borne disease? Detection of Leptospira spp. in Ixodes ricinus ticks in eastern Poland.

    Science.gov (United States)

    Wójcik-Fatla, Angelina; Zając, Violetta; Cisak, Ewa; Sroka, Jacek; Sawczyn, Anna; Dutkiewicz, Jacek

    2012-01-01

    A total of 836 unfed Ixodes ricinus ticks were collected from 2 forested areas of the Lublin region in eastern Poland. Of these, 540 ticks were collected in area 'A', exposed to flooding from the Vistula river, while the remaining 296 ticks were collected in suburban area 'B', not exposed to flooding. Ticks were examined by nested-PCR for the presence of DNA of Leptospira spp. and of Borrelia burgdorferi sensu lato, including its genospecies. The presence of the Leptospira spp. DNA was found in the examined specimens of Ixodes ricinus. The infection rate was much greater in area 'A' exposed to flooding, compared to unexposed area 'B' (15.6% vs. 1.4%, pticks amounted to 24.3%. Altogether, the genospecies Borrelia burgdorferi sensu stricto was detected most often. No correlation was found to exist between the presence of Leptospira spp. and B. burgdorferi sensu lato in the examined ticks, which indicates that the detection of Leptospira in ticks was not due to a false-positive cross-reaction with DNA of B. burgdorferi. In conclusion, this study shows for the first time the presence of Leptospira spp. in Ixodes ticks and marked frequency of the occurrence of these bacteria in ticks. This finding has significant epidemiological implications by indicating the possibility of the transmission of leptospirosis by Ixodes ricinus, the commonest tick species in Europe and most important vector of numerous pathogens.

  5. Multilocus sequence typing using mitochondrial genes (mtMLST) reveals geographic population structure of Ixodes ricinus ticks.

    Science.gov (United States)

    Dinnis, Ruth E; Seelig, Frederik; Bormane, Antra; Donaghy, Michael; Vollmer, Stephanie A; Feil, Edward J; Kurtenbach, Klaus; Margos, Gabriele

    2014-03-01

    The hard tick Ixodes ricinus is the principal vector of Lyme borreliosis (LB) group spirochaetes in Europe, but it also transmits a large number of other microbial pathogens that are of importance to animal and human health. Here, we characterise geographically distinct populations of this important ectoparasite based on multilocus sequence typing (MLST) of multiple mitochondrial (mt) genes (mtMLST). Internal fragments of approximately 500 bp were amplified and sequenced for 6 protein-encoding and ribosomal genes (atp6, coi, coii, coiii, cytB, and 12s). The samples analysed consisted of 506 questing nymphs collected in Britain and Latvia in 2006-2008 and in Latvia in 2002. Although little genetic structure has previously been observed in I. ricinus ticks among Europe, our data could clearly differentiate these 2 populations. Here, we argue that this novel scheme provides additional phylogenetic resolution which is important for understanding the genetic and geographic structure of I. ricinus populations. This in turn will benefit monitoring and management of tick-borne diseases. Copyright © 2013 Elsevier GmbH. All rights reserved.

  6. Tissue- and time-dependent transcription in Ixodes ricinus salivary glands and midguts when blood feeding on the vertebrate host

    Science.gov (United States)

    Kotsyfakis, Michalis; Schwarz, Alexandra; Erhart, Jan; Ribeiro, José M. C.

    2015-01-01

    Ixodes ricinus is a tick that transmits the pathogens of Lyme and several arboviral diseases. Pathogens invade the tick midgut, disseminate through the hemolymph, and are transmitted to the vertebrate host via the salivary glands; subverting these processes could be used to interrupt pathogen transfer. Here, we use massive de novo sequencing to characterize the transcriptional dynamics of the salivary and midgut tissues of nymphal and adult I. ricinus at various time points after attachment on the vertebrate host. Members of a number of gene families show stage- and time-specific expression. We hypothesize that gene expression switching may be under epigenetic control and, in support of this, identify 34 candidate proteins that modify histones. I. ricinus-secreted proteins are encoded by genes that have a non-synonymous to synonymous mutation rate even greater than immune-related genes. Midgut transcriptome (mialome) analysis reveals several enzymes associated with protein, carbohydrate, and lipid digestion, transporters and channels that might be associated with nutrient uptake, and immune-related transcripts including antimicrobial peptides. This publicly available dataset supports the identification of protein and gene targets for biochemical and physiological studies that exploit the transmission lifecycle of this disease vector for preventative and therapeutic purposes. PMID:25765539

  7. Isolation and propagation of a Spiroplasma sp. from Slovakian Ixodes ricinus ticks in Ixodes spp. cell lines.

    Science.gov (United States)

    Bell-Sakyi, Lesley; Palomar, Ana M; Kazimirova, Maria

    2015-07-01

    Ixodes spp. ticks are known to occasionally harbour spiroplasmas - helical mycoplasmas in the class Mollicutes; a previous study in Slovakia reported an overall prevalence of Spiroplasma ixodetis of 3% in Ixodes ricinus. In the present study, extracts of unfed adult I. ricinus ticks collected from vegetation in south-western Slovakia were added to a panel of cell lines derived from I. ricinus and Ixodes scapularis embryos. The cultures were monitored by preparation and examination of Giemsa-stained cytocentrifuge smears at intervals over the subsequent 16-18 months. Spiroplasma-like microorganisms were detected in cultures of both tick species after 2-3 months and subcultured onto fresh, uninfected cells of the appropriate cell line up to seven times. Molecular analysis using PCR assays targeting fragments of the 16S rRNA, ITS and rpoB genes confirmed the identity of the microorganisms as a Spiroplasma sp., with between 98.9% and 99.5% similarity to S. ixodetis. The sequences of the spiroplasmas isolated from three different pools of ticks collected on two different occasions were identical for all three genes tested. Copyright © 2015 The Authors. Published by Elsevier GmbH.. All rights reserved.

  8. Comparison of tick-borne microorganism communities in Ixodes spp. of the Ixodes ricinus species complex at distinct geographical regions.

    Science.gov (United States)

    Movila, Alexandru; Dubinina, Helen V; Sitnicova, Natalia; Bespyatova, Liubov; Uspenskaia, Inga; Efremova, Galina; Toderas, Ion; Alekseev, Andrey N

    2014-05-01

    Characterizing the tick-borne microorganism communities of Ixodes ricinus (sheep tick) and Ixodes persulcatus (taiga tick) from the I. ricinus species complex in distinct geographical regions of Eastern Europe and European Russia, we demonstrated differences between the two ticks. Taiga ticks were more frequently mono- and co-infected than sheep ticks: 24.4 % (45/184 tested ticks) versus 17.5 % (52/297) and 4.3 % (8/184) versus 3.4 % (10/297), respectively. Ginsberg co-infection index values were significant at the various sites. Diversity of the tick-borne microorganism communities was estimated by the Shannon index, reaching values of 1.71 ± 0.46 and 1.20 ± 0.15 at the sheep-tick and the taiga-tick harbored sites, respectively. Richness of the tick-borne microorganism community in the sheep tick collection sites was about twice the value of the taiga tick collection sites. Future investigations are warranted to further characterize the peculiarities of the tick-borne microorganism communities among the ticks of the Ixodes ricinus complex.

  9. Bio-Based Polyurethane Containing Isosorbide for Use in Composites and Coatings

    Science.gov (United States)

    2015-04-01

    ARL-TR-7259 ● APR 2015 US Army Research Laboratory Bio-Based Polyurethane Containing Isosorbide for Use in Composites and...copyright notation hereon. ARL-TR-7259 ● APR 2015 US Army Research Laboratory Bio-Based Polyurethane Containing Isosorbide for Use...4. TITLE AND SUBTITLE Bio-Based Polyurethane Containing Isosorbide for Use in Composites and Coatings 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c

  10. The effect of moisture absorption on the physical properties of polyurethane shape memory polymer foams

    OpenAIRE

    Yu, Ya-Jen; Hearon, Keith; Wilson, Thomas S.; Maitland, Duncan J.

    2011-01-01

    The effect of moisture absorption on the glass transition temperature (Tg) and stress/strain behavior of network polyurethane shape memory polymer (SMP) foams has been investigated. With our ultimate goal of engineering polyurethane SMP foams for use in blood contacting environments, we have investigated the effects of moisture exposure on the physical properties of polyurethane foams. To our best knowledge, this study is the first to investigate the effects of moisture absorption at varying ...

  11. Presence of Candidatus Neoehrlichia mikurensis and Babesia microti in rodents and two tick species (Ixodes ricinus and Ixodes trianguliceps) in Slovakia.

    Science.gov (United States)

    Blaňarová, Lucia; Stanko, Michal; Miklisová, Dana; Víchová, Bronislava; Mošanský, Ladislav; Kraljik, Jasna; Bona, Martin; Derdáková, Markéta

    2016-03-01

    Rodents are important reservoir hosts of many tick-borne pathogens. Their importance in the circulation of the emerging bacterial agent, Candidatus Neoehrlichia mikurensis and the intraerythrocytic protozoan parasite, Babesia microti has been recently proposed. The aim of the present study was to identify the presence and genetic diversity of Candidatus N. mikurensis and B. microti circulating in the natural foci among rodents and two species of ixodid ticks (Ixodes ricinus and Ixodes trianguliceps). In 2011-2013, rodents were captured at sampling sites in Eastern Slovakia. A total of 997 rodents (324 Apodemus agrarius, 350 Apodemus flavicollis, 271 Myodes glareolus, and 52 other rodent species), 788 feeding ticks from rodents, and 1375 questing ticks were investigated for the presence of pathogens by molecular methods followed by DNA sequencing. Candidatus N. mikurensis was detected in 2.4% of questing I. ricinus nymphs and 2.6% of questing adult I. ricinus ticks, spleens of rodents (1.6%), as well as in feeding larval I. ricinus (0.3%) and feeding larval I. trianguliceps ticks (3.3%). The 16S rRNA and gltA gene sequences of Candidatus N. mikurensis obtained in this study confirmed a high degree of genetic identity of this bacterium in Europe. DNA of B. microti was found in ear (0.6%) and spleen biopsies of rodents (1.9%), in rodent foetus (3.8%) and feeding larval (5.2%) and nymphal (8.7%) I. ricinus, in questing nymphal I. ricinus (0.5%) and questing adult I. ricinus ticks (0.3%). None of the 112 I. trianguliceps ticks were infected. B. microti was represented by two different genotypes: 92% of the positive samples belonged to the zoonotic type strain from Jena (Germany). The results of this study underline the importance of rodents in the circulation of both emerging pathogens in natural foci. Copyright © 2015 Elsevier GmbH. All rights reserved.

  12. Morpho-anatomical, physiological and biochemical adjustments in response to root zone salinity stress and high solar radiation in two Mediterranean evergreen shrubs, Myrtus communis and Pistacia lentiscus.

    Science.gov (United States)

    Tattini, Massimiliano; Remorini, Damiano; Pinelli, Patrizia; Agati, Giovanni; Saracini, Erica; Traversi, Maria Laura; Massai, Rossano

    2006-01-01

    Salt- and light-induced changes in morpho-anatomical, physiological and biochemical traits were analysed in Myrtus communis and Pistacia lentiscus with a view to explaining their ecological distribution in the Mediterranean basin. In plants exposed to 20 or 100% solar radiation and supplied with 0 or 200 mm NaCl, measurements were conducted for ionic and water relations and photosynthetic performance, leaf morpho-anatomical and optical properties and tissue-specific accumulation of tannins and flavonoids. Net carbon gain and photosystem II (PSII) efficiency decreased less in P. lentiscus than in M. communis when exposed to salinity stress, the former having a superior ability to use Na(+) and Cl(-) for osmotic adjustment. Morpho-anatomical traits also allowed P. lentiscus to protect sensitive targets in the leaf from the combined action of salinity stress and high solar radiation to a greater degree than M. communis. Salt and light-induced increases in carbon allocated to polyphenols, particularly to flavonoids, were greater in M. communis than in P. lentiscus, and appeared to be related to leaf oxidative damage. Our data may conclusively explain the negligible distribution of M. communis in open Mediterranean areas suffering from salinity stress, and suggest a key antioxidant function of flavonoids in response to different stressful conditions.

  13. Evaluation of Thermal Endurance Characteristics of Flexible Polyurethane Foams by Dynamic Compression Modulus

    National Research Council Canada - National Science Library

    Adachi, Hiromasa; Hasegawa, Teruo

    2005-01-01

      For evaluation of thermal endurance in foamed plastics, temperature and time dependence of compression dynamic modulus of four flexible polyurethane foams was investigated by dynamic viscoelastic measurements...

  14. Study on thermal properties of synthetic and bio-based polyurethane

    Directory of Open Access Journals (Sweden)

    Šercer Mladen

    2015-01-01

    Full Text Available Polymers that are created by the chemical polymerization of naturally occurring monomers are attracting considerable commercial interest in the last few years because of their non-toxicity, biodegradability and biocompatibility and use of feedstock that is renewable. The development of specialized lignin compounds, such as electrically conducting polymers, engineering plastics and polyurethane, is an area of highest interest and growth. The paper will present the comparison of the mechanical and thermal properties of conventional polyurethane and bio-based polyurethane, i.e. polyurethane based on polyols produced by liquefaction of waste wood biomass.

  15. Vegetable oils: a source of polyols for polyurethane materials

    Directory of Open Access Journals (Sweden)

    Maisonneuve Lise

    2016-09-01

    Full Text Available This manuscript is dedicated to the literature on vegetable oil-based polyurethanes via the isocyanate/alcohol route. A lot of efforts have been made to replace petroleum-based resources. Among renewable resources, vegetable oils present various advantages going from their availability to the large range of possible chemical modifications they permit. Firstly, the vegetable oil chemical composition and the main commercially available vegetable oil precursors are exposed. Concerning vegetable oils-based polyurethanes, research groups first focused on cross-linked systems directly from triglycerides then on thermoplastic ones from fatty acids or fatty acid methyl esters. This manuscript focuses on thermoplastic PUs and underlines the literature about the introduction of hydroxyl groups and isocyanate functions onto triglycerides and fatty acid derivatives. Besides, in a view to the isocyanate/alcohol approach, vegetable oil-based thermoplastic PUs and corresponding diols and diisocyanates are described in details.

  16. The small angle neutron scattering study on the segmented polyurethane

    Energy Technology Data Exchange (ETDEWEB)

    Sudirman; Gunawan; Prasetyo, S.M.; Karo Karo, A.; Lahagu, I.M.; Darwinto, Tri [Materials Science Research Center, National Nuclear Energy Agency, Serpong, Tangerang (Indonesia)

    1999-10-01

    The distance between hard segment (HS) and soft segment (SS) of segmented polyurethane have been determined using the Small Angle Neutron Scattering (SANS) technique. The segmented Polyurethanes (SPU) are linear multiblock copolymers, which include elastomer thermoplastic. SPU consist of hard segment and soft segment, each has tendency to make a group with similar type to form a domain. The soft segments used were polypropylene glycol (PPG) and 4,4 diphenylmethane diisocyanate (MDI), while l,4 butanediol (BD) was used as hard segment. The characteristic of SPU depends on its phase structure which is affected by several factors, such as type of chemical formula and the composition of the HS and SS, solvent as well as the synthesizing process. The samples used in this study were SPU56 and SPU68. Based on the appearance of SANS profile, it was obtained that domain distances are 12.32 nm for the SPU56 and 19 nm for the SPU68. (author)

  17. Structure-property relationships of flexible polyurethane foams

    Science.gov (United States)

    Aneja, Ashish

    This study examined several features of flexible polyurethane foams from a structure-property perspective. A major part of this dissertation addresses the issue of connectivity of the urea phase and its influence on mechanical and viscoelastic properties of flexible polyurethane foams and their plaque counterparts. Lithium salts (LiCl and LiBr) were used as additives to systematically alter the phase separation behavior, and hence the connectivity of the urea phase at different scale lengths. Macro connectivity, or the association of the large scale urea rich aggregates typically observed in flexible polyurethane foams was assessed using SAXS, TEM, and AFM. These techniques showed that including a lithium salt in the foam formulation suppressed the formation of the urea aggregates and thus led to a loss in the macro level connectivity of the urea phase. WAXS and FTIR were used to demonstrate that addition of LiCl or LiBr systematically disrupted the local ordering of the hard segments within the microdomains, i.e., it led to a reduction of micro level connectivity or the regularity in segmental packing of the urea phase. Based on these observations, the interaction of the lithium salt was thought to predominantly occur with the urea hard segments, and this hypothesis was confirmed using quantum mechanical calculations. Another feature of this research investigated model trisegmented polyurethanes based on monofunctional polyols, or "monos", with water-extended toluene diisocyanate (TDI) based hard segments. The formulations of the monol materials were maintained similar to those of flexible polyurethane foams with the exceptions that the conventional polyol was substituted by an oligomeric monofunctional polyether of ca. 1000 g/mol molecular weight. Plaques formed from these model systems were shown to be solid materials even at their relatively low molecular weights of 3000 g/mol and less, AFM phase images, for the first time, revealed the ability of the hard

  18. Development of bacterially resistant polyurethane for coating medical devices.

    Science.gov (United States)

    Roohpour, Nima; Moshaverinia, Alireza; Wasikiewicz, Jaroslaw M; Paul, Deepen; Wilks, Mark; Millar, Michael; Vadgama, Pankaj

    2012-02-01

    Polyurethanes have been widely used in medicine for coating and packaging implantable and other medical devices. Polyether-urethanes, in particular, have superior mechanical properties and are biocompatible, but in common with other medical materials they are susceptible to microbial film formation. In this study, polyether-urethane was end-capped with silver lactate and silver sulfadiazine functional groups to produce a bacterially resistant polymer without sacrificing the useful mechanical properties of the polyether-polyurethane. The silver ions were covalently incorporated into the polymer during chain extension of the prepolymer. The functionalized polymers were structurally characterized by light scattering, electron microscopy, NMR, FTIR and Raman spectroscopy. Mechanical properties, hydrophilicity, in vitro stability and antibacterial action of polymers were also investigated. Results indicate that both silver salts were successfully incorporated into the polymer structure without significant effect on mechanical properties, whilst conferring acceptable bacterial resistance.

  19. Gamma radiation effect on sisal / polyurethane composites without coupling agents

    Directory of Open Access Journals (Sweden)

    Marina Cardoso Vasco

    Full Text Available Abstract Natural fibers and polyurethane based composites may present chemical bonding between the components of the polymer and the lignin of the fiber. The incidence of radiation can cause degradation of the polymeric material and alter its mechanical properties. The objective of this study was to obtain and characterize cold pressed composites from polyurethane derived from castor oil and sisal fibers, without coupling agents, through thermogravimetric and mechanical tests, before and after the incidence of 25 kGy dose of gamma radiation. Woven composites that were not irradiated had maximum values of 4.40 GPa for flexural elastic modulus on three point flexural test and dispersed fiber composite that were not irradiated had maximum values of 2.25 GPa. These materials are adequate for use in non-structural applications in radiotherapy and radiodiagnostic rooms.

  20. Biomimetic Superhydrophobic Biobased Polyurethane-Coated Fertilizer with Atmosphere "Outerwear".

    Science.gov (United States)

    Xie, Jiazhuo; Yang, Yuechao; Gao, Bin; Wan, Yongshan; Li, Yuncong C; Xu, Jing; Zhao, Qinghua

    2017-05-10

    The development of efficient biobased controlled-release fertilizers has captured much research attention because of the environmental concerns and food scarcity problems. In this work, a biomimetic superhydrophobic biobased polyurethane-coated fertilizer (SBPF) was successfully fabricated by increasing surface roughness and reducing surface energy of polyurethane (PU) coating. The green PU coating was synthesized from low-cost, biodegradable, and renewable cottonseed oil. The nutrient release longevity of SBPF revealed 2-fold enhancement compared with the normal biobased PU-coated fertilizer (BPF). The significant improvement of nutrient release characteristics can be attributed to the atmosphere "outerwear" which ensured the nonwetting contact of water with superhydrophobic surfaces in gas state instead of in liquid state. The new concept introduced in this study can inform the development of the next generation of biobased controlled release fertilizers.