
Sample records for rich-nursing-studie die studie

  1. Die Hervormde Teologiese Studies na vyftig jaar

    African Journals Online (AJOL)

    INLEIDEND. In die tweede helfte van die jaar 1943 het die Hervormde Teologiese Studies die eerste maal verskyn. Dit was die produk van lang besinning en beplanning. Die dryfkrag agter die totstandkoming was prof dr S P Engeibrecht, 'n man wie se idealisme en toewyding aan die kerk groot dinge vir die kerk en ook die ...

  2. Studie: Die Generation Y und deren organisatorische Implikationen


    Klein, Helmut


    Die vorliegende Studie betrifft die Gen. Y und ihre spezifischen Anforderungen an die Unternehmensorganisation. Im Ergebnis einer durchgeführten Befragung ist festzuhalten, dass die Gen. Y die Kernkompetenzen eines Managers verstärkt einfordert und eine hohe Betreuungsintensität verlangt. Dies hat Auswirkungen auf die Führungsspanne, Planung und Kontrolle von Aufgaben, die Gestaltung der vertikalen und horizontalen Prozesse sowie die Zusammensetzung von Teamarbeitsformen. Projektarbeit sowie ...

  3. Patristiek en die studie van die Nuwe Testament | Stander | HTS ...

    African Journals Online (AJOL)

    Patristics and the study of the New Testament This article consists of two main parts. In the first part the importance of the study of Patristics is discussed. The author underscores Outler's logion that 'by itself, the New Testament is not a field of inquiry'. The heading of the second part is Instrumenta Studiorum. In this section ...

  4. De-tabooing dying control - a grounded theory study (United States)


    Background Dying is inescapable yet remains a neglected issue in modern health care. The research question in this study was “what is going on in the field of dying today?” What emerged was to eventually present a grounded theory of control of dying focusing specifically on how people react in relation to issues about euthanasia and physician-assisted suicide (PAS). Methods Classic grounded theory was used to analyze interviews with 55 laypersons and health care professionals in North America and Europe, surveys on attitudes to PAS among physicians and the Swedish general public, and scientific literature, North American discussion forum websites, and news sites. Results Open awareness of the nature and timing of a patient’s death became common in health care during the 1960s in the Western world. Open dying awareness contexts can be seen as the start of a weakening of a taboo towards controlled dying called de-tabooing. The growth of the hospice movement and palliative care, but also the legalization of euthanasia and PAS in the Benelux countries, and PAS in Montana, Oregon and Washington further represents de-tabooing dying control. An attitude positioning between the taboo of dying control and a growing taboo against questioning patient autonomy and self-determination called de-paternalizing is another aspect of de-tabooing. When confronted with a taboo, people first react emotionally based on “gut feelings” - emotional positioning. This is followed by reasoning and label wrestling using euphemisms and dysphemisms - reflective positioning. Rarely is de-tabooing unconditional but enabled by stipulated positioning as in soft laws (palliative care guidelines) and hard laws (euthanasia/PAS legislation). From a global perspective three shapes of dying control emerge. First, suboptimal palliative care in closed awareness contexts seen in Asian, Islamic and Latin cultures, called closed dying. Second, palliative care and sedation therapy, but not euthanasia

  5. 'n Verkennende studie met die oog op die identifísering en ...

    African Journals Online (AJOL)

    De Klerk 1977:74-75). ... de leermodel bepaalde gevolgtrekkings gemaak. ..... Maslow word die basiese vraag tot die leerproses - hoekom leer mense, ... Gagne se piramide van leervorme bied inderdaad 'n werkbare en sinvolle integrasie.

  6. die kerk, maatskappy en vrye verenigings: 'n studie van die kerkorde ...

    African Journals Online (AJOL)

    Engelhard en Hofman 2001; PKN 2003). Die begrip “moderne gedifferensieerde samelewing”, saamgelees met 'n selfstandigheid in eie bevoegdheid, kom net so van Dooyeweerd af (1957:379; 1963:81). NGK-KO 1962 neem vorm aan in 'n tyd waarin. Dooyeweerd akademies op die kruin van die golf is – gemeet aan sy.

  7. Die topkwark

    Directory of Open Access Journals (Sweden)

    R. Tegen


    Full Text Available ’n Oorsig van die belangrikheid van die onlangs ontdekte topkwark by Fermilab in Chicago word gegee. Daar word aangetnon dat die topkwark belangrik is in fisika van die Oerknal, oftewel "Big Bang", en in die Standaard Model van Elementêredeeltjie-fisika. Toepaslike literatuur vir verdere studie kan van die lys van verwysings in hierdie kort, nietegniese artikel, nagegaan word.

  8. Numerical Studies of Low Cycle Fatigue in Forward Extrusion Dies

    DEFF Research Database (Denmark)

    Pedersen, Thomas Ø


    of describing the elastic-plastic material behaviour under cyclic loadings is used to study the effects of different pre-stressing concepts on the accumulation of plastic strain and the development of fatigue damage. The results show, that the accumulation of plastic strain in the critical region can......Forward extrusion dies typically fail due to transverse fatigue cracks or wear. Fatigue cracks are initiated in regions where the material is subjected to repeated plastic deformations, e.g. the transition radius in a forward extrusion die, in the present work, a material model capable...... be controlled by means of the pre-stressing system or the geometry of the die insert. (C) 2000 Elsevier Science B.V. All rights reserved....

  9. Ontwikkelingsekonomie — Bestek en metode vir die studie daarvan

    Directory of Open Access Journals (Sweden)

    H.J. Weber


    Full Text Available Kennis van die probleme van onderontwikkelde gebiede is baie oud. Sodra verskille in ontwikkeldheid, hetsy op militêre, ekonomiese of ander gebiede duidelik word, en as sodanig erken word, wys die probleme van die minderontwikkelde gebiede hulself uit. Die ekonomiese geskiedenis is vol sodanige erkende verskille o.a. Hellenistiese kultuursentra, Imperiale Rome, Byzantium en sy florerende stadstaat; Noord- en Wes- Europa na die ontdekking van die nuwe wêreld en die vasstelling van effektiewe marinekommunikasie tussen Wes- Europa, Amerika en Oos-Asië.

  10. Wie bewerten die Fluggäste den Klimaeinsatz und die Klimakommunikation von Fluggesellschaften? - eine empirische Studie der Haltungen deutscher und dänischer Flugreisenden

    DEFF Research Database (Denmark)

    Larsen, Aase Voldgaard

    . Wittmer (2010) hat die Haltung der Fluggäste der SWISS quantitativ untersucht und festgestellt, dass der Klimaeinsatz die Fluggäste anspricht und die Kommunikation darüber positiv auf das Image einwirkt. Diese Studie trägt jedoch den bei Larsen & Pedersen (2010) aufgedeckten Unterschieden nicht Rechnung......, sind: - Inwieweit unterscheiden sich die Passagierhaltungen bezüglich der Klimakommunikation und der erwarteten Klima-Einsatzgebiete? - Inwieweit beeinflusst die Klimakommunikation der Fluggesellschaften ihr Image und ihre Identität? Die auf bisherigen Untersuchungen gegründete Hypothese ist, dass die...

  11. 'n Redaksionele voonvoord tot die Hervorrade Teologiese Studies ...

    African Journals Online (AJOL)

    Hy is nie net 'n geëerde oud-redaksielid nie, maar was self vanaf 1957 tot 1971 verantwoordelik vir die versorging van die tydskrif en het ook vanaf 1982 tot 1985 as redaksiesekretaris opgetree. Hierbenewens is prof Pont dié medewerker wat verreweg die meeste artikels in HTS laat publiseer het, te wete ses en sestig tot ...

  12. Die meting van neurolinguistiese programmering se verteenwoordigende stelsels: 'n Eksploratiewe studie

    Directory of Open Access Journals (Sweden)

    P. C. Bester


    Opsomming 'n Oorsig van die Sielkunde-literatuur wys daarop dat verskeie outeurs saamstem oor die bestaan van Neurolinguistiese Programmering (NLP se verteenwoordigende stelsels. Tot onlangs toe is geen studie oor die bestaan van n omvattende meetinstrument vir NLP se verteenwoordigende stelsels in die literatuur gerapporteer nie. Die hoofdoel van die onderhawige studie was om vas te stel of dit wenslik is om NLP se verteenwoordigende stelsels met 'n omvattende normatiewe vraelys te meet. Drie konstrukte is voorveronderstel en 'n "Vraelys oor Sensoriese Modaliteite", bestaande uit 84 items, is gekonstrueer. Hierdie vraelys is afgeneem op studente (N=338 van drie verskillende tersiere instellings. hTweede faktorontleding op die 18 subtellings van n eerste faktorontleding, het twee faktore opgelewer wat nie die drie verteenwoordigende stelsels suiwer weergee nie. Die implikasies van hierdie bevindinge word bespreek.

  13. Older people dying with dementia: a nationwide study

    NARCIS (Netherlands)

    Meeussen, K.; van den Block, L.; Echteld, M.; Boffin, N.; Bilsen, J.; van Casteren, V.; Deliens, L.


    Background: Large-scale nationwide data describing the end-of-life characteristics of older people with dementia are lacking. This paper describes the dying process and end-of-life care provided to elderly people with mild or severe dementia in Belgium. It compares with elderly people dying without

  14. Why do older people oppose physician-assisted dying? A qualitative study. (United States)

    Malpas, Phillipa J; Wilson, Maria K R; Rae, Nicola; Johnson, Malcolm


    Physician-assisted dying at the end of life has become a significant issue of public discussion. While legally available in a number of countries and jurisdictions, it remains controversial and illegal in New Zealand. The study aimed to explore the reasons some healthy older New Zealanders oppose physician-assisted dying in order to inform current debate. Recorded interviews were transcribed and analysed by the authors after some edits had been made by respondents. In all, 11 older participants (over 65 years) who responded to advertisements placed in Grey Power magazines and a University of Auckland email list were interviewed for around 1 h and asked a number of open-ended questions. Four central themes opposing physician-assisted dying were identified from the interviews: one's personal experience with health care and dying and death, religious reasoning and beliefs, slippery slope worries and concern about potential abuses if physician-assisted dying were legalised. An important finding of the study suggests that how some older individuals think about physician-assisted dying is strongly influenced by their past experiences of dying and death. While some participants had witnessed good, well-managed dying and death experiences which confirmed for them the view that physician-assisted dying was unnecessary, those who had witnessed poor dying and death experiences opposed physician-assisted dying on the grounds that such practices could come to be abused by others.

  15. A comparative evaluation of linear dimensional accuracy of the dies obtained using three conceptually different die systems in the fabrication of implant prosthesis: An in vitro study

    Directory of Open Access Journals (Sweden)

    Manawar Ahmad


    Purpose: The purpose of the study was to evaluate the linear dimensional accuracy between the implant master die and three conceptually different die systems such as Pindex system, Accu-trac precision die system, and Conventional brass dowel pin system. Materials and Methods: Thirty impressions of implant master die were made with polyether impression material. Ten experimental implant casts were fabricated for each of the three different die systems tested: Accu-trac precision die tray system, Pindex system, and conventional brass dowel pin system. The solid experimental casts were sectioned and then removed from the die system 30 times. Linear distances between all six possible distances were measured from one centre of the transfer coping to the other, using a co-ordinate measuring machine in millimeters up to accuracy of 0.5 microns. Data were tabulated and statistically analyzed by Binomial non parametric test using SPSS version 15. Results: Significant differences were found for distance A-B (P = 0.002, A-C ( P = 0.002, A-D (P value = 0.002, and B-D ( P = 0.021 in Conventional Dowel pin system however for Accu-trac precision die tray system, it was significant only for distance A-D (P = 0.002 but for Pindex system it was non-significant for all the distances measured. Conclusion: Within the limitations of this study, use of Pindex system is recommended when sectioned dies are needed for a multi implant retained prosthesis.

  16. Die subtiele aanleg en moontlikhede van die nominale styl: 'n Studie in Nuwe-Testamentiese Grieks

    Directory of Open Access Journals (Sweden)

    P. B. Boshoff


    Full Text Available The subtle nature and possibilities of the nominal style: A study New Testament Greek Nominalization as a figure of speech in the New Testament Greek, or any other literature has not yet come to its full value. Nominatization occurs when events in the deep structure are presented in the aurface structuring in nominal form. The nominal form is chosen for the sake of certain fed. The method used to determine the specific contribution of the nominal form is to compare the nominal form with its verbal variant. Five functions of style have been determined for the nominal form: Acceptance ation, Spatialization, Degrading, Manifestation of courtesy and Profiling.

  17. Quality of dying in nursing home residents dying with dementia: does advanced care planning matter? A nationwide postmortem study.

    Directory of Open Access Journals (Sweden)

    An Vandervoort

    Full Text Available Advance care planning is considered a central component of good quality palliative care and especially relevant for people who lose the capacity to make decisions at the end of life, which is the case for many nursing home residents with dementia. We set out to investigate to what extent (1 advance care planning in the form of written advance patient directives and verbal communication with patient and/or relatives about future care and (2 the existence of written advance general practitioner orders are related to the quality of dying of nursing home residents with dementia.Cross-sectional study of deaths (2010 using random cluster-sampling. Representative sample of nursing homes in Flanders, Belgium. Deaths of residents with dementia in a three-month period were reported; for each the nurse most involved in care, GP and closest relative completed structured questionnaires.We identified 101 deaths of residents with dementia in 69 nursing homes (58% response rate. A written advance patient directive was present for 17.5%, GP-orders for 56.7%. Controlling for socio-demographic/clinical characteristics in multivariate regression analyses, chances of having a higher mean rating of emotional well-being (less fear and anxiety on the Comfort Assessment in Dying with Dementia scale were three times higher with a written advance patient directive and more specifically when having a do-not-resuscitate order (AOR 3.45; CI,1.1-11 than for those without either (AOR 2.99; CI,1.1-8.3. We found no association between verbal communication or having a GP order and quality of dying.For nursing home residents with dementia there is a strong association between having a written advance directive and quality of dying. Where wishes are written, relatives report lower levels of emotional distress at the end of life. These results underpin the importance of advance care planning for people with dementia and beginning this process as early as possible.

  18. Study on interfacial heat transfer coefficient at metal/die interface during high pressure die casting process of AZ91D alloy

    Directory of Open Access Journals (Sweden)

    GUO Zhi-peng


    Full Text Available The high pressure die casting (HPDC process is one of the fastest growing and most efficient methods for the production of complex shape castings of magnesium and aluminum alloys in today’s manufacturing industry.In this study, a high pressure die casting experiment using AZ91D magnesium alloy was conducted, and the temperature profiles inside the die were Measured. By using a computer program based on solving the inverse heat problem, the metal/die interfacial heat transfer coefficient (IHTC was calculated and studied. The results show that the IHTC between the metal and die increases right after the liquid metal is brought into the cavity by the plunger,and decreases as the solidification process of the liquid metal proceeds until the liquid metal is completely solidified,when the IHTC tends to be stable. The interfacial heat transfer coefficient shows different characteristics under different casting wall thicknesses and varies with the change of solidification behavior.

  19. P. J. N. Smal, Die Universalisme in die Psalms. Academisch ...

    African Journals Online (AJOL)


    dat die historiese element in Israel se Godsopenbaring en daarmee die insig in sy betekenis te kort gedoen word. Die betekenis van die studie vir die historia revelationis is daardeur gering; as duidelike „tydlose” sistematisering van Outestamentiese gegewens oor die betrokke onder- werpe, soos die laaste hoofstuk, bl.

  20. die rol van die unieverdedigingsmag in die onderdrukking van die

    African Journals Online (AJOL)

    agv regeringsoptrede nie.39. Siotsom. In die geskiedenis van die Unieverdedigings- mag word die gebeure random die 1914-staking oorskadu deur die Rebellie en Suid-Afrika se deelname aan die Eerste Wereldoorlog. Tog was dit 'n belangrike mylpaal in die geskiedenis van die organisasie, omdat dit sy eerste optrede ...

  1. Study of radial die-wall pressure changes during pharmaceutical powder compaction. (United States)

    Abdel-Hamid, Sameh; Betz, Gabriele


    In tablet manufacturing, less attention is paid to the measurement of die-wall pressure than to force-displacement diagrams. Therefore, the aim of this study was to investigate radial stress change during pharmaceutical compaction. The Presster(TM), a tablet-press replicator, was used to characterize compaction behavior of microcrystalline cellulose (viscoelastic), calcium hydrogen phosphate dihydrate (brittle), direct compressible mannitol (plastic), pre-gelatinized starch (plastic/elastic), and spray dried lactose monohydrate (plastic/brittle) by measuring radial die-wall pressure; therefore powders were compacted at different (pre) compaction pressures as well as different speeds. Residual die-wall pressure (RDP) and maximum die-wall pressure (MDP) were measured. Various tablet physical properties were correlated to radial die-wall pressure. With increasing compaction pressure, RDP and MDP (P compaction behavior of materials and detecting friction phenomena in the early stage of development.

  2. Die gebruik van parallelplaatreologie vir die bepaling van die intrinsieke viskositeit van poli-etileentereftalaat

    Directory of Open Access Journals (Sweden)

    O. C. Vorster


    Full Text Available Die bepaling van die intrinsieke viskositeit van poli-etileentereftalaat word bemoeilik deur die feit dat daar tans slegs twee metodes in gebruik is. In die eerste metode word die bepaling deur middel van oplossingsviskometrie gedoen, maar die toksisiteit van die oplosmiddel, asook die tydperk wat dit neem om die bepaling te doen, is ’n probleem. Die tweede metode word beperk deur die kompleksiteit en beskikbaarheid van die apparatuur in Suid-Afrika. In hierdie studie word ’n alternatiewe metode, gebaseer op parallelplaatreologie, voorgestel wat albei hierdie probleme oorkom en die resultate sodoende verkry, word vergelyk met dié wat met bestaande metodes verkry is.

  3. Determinants of care outcomes for patients who die in hospital in Ireland: a retrospective study.

    LENUS (Irish Health Repository)

    McKeown, Kieran


    More people die in hospital than in any other setting which is why it is important to study the outcomes of hospital care at end of life. This study analyses what influenced outcomes in a sample of patients who died in hospital in Ireland in 2008\\/9. The study was undertaken as part of the Irish Hospice Foundation\\'s Hospice Friendly Hospitals Programme (2007-2012).

  4. Dutch pediatricians' views on the use of neuromuscular blockers for dying neonates: a qualitative study

    NARCIS (Netherlands)

    ten Cate, K.; van de Vathorst, S.


    To assess Dutch pediatricians' views on neuromuscular blockers for dying neonates. Qualitative study involving in-depth interviews with 10 Dutch pediatricians working with severely ill neonates. Data were analyzed using appropriate qualitative research techniques. Participants explained their view

  5. ʼn Studie van die gesondheid van die Olifantsrivier soos weerspieël deur die makro-invertebraatbiodiversiteit en geselekteerde abiotiese faktore

    Directory of Open Access Journals (Sweden)

    M. Kemp


    Full Text Available Riviere in Suid-Afrika is ‘n belangrike waterbron en onderhou ‘n ryk biodiversiteit van fauna en flora. Toenemende druk op hierdie riviere en hulle opvanggebiede kan ʼn enorme impak op die lewe wat hulle onderhou, uitoefen.

  6. A study on die wear model of warm and hot forgings (United States)

    Kang, J. H.; Park, I. W.; Jae, J. S.; Kang, S. S.


    Factors influencing service lives of tools in warm and hot forging processes are wear, mechanical fatigue, plastic deformation and thermal fatigue, etc. Wear is the predominant factor for tool failure among these. To predict tool life by wear, Archard's model where hardness is considered as constant or function of temperature is generally applied. Usually hardness of die is a function of not only temperature but operating time of die. To consider softening of die by repeated operation it is necessary to express hardness of die by a function of temperature and time. In this study wear coefficients were measured for various temperatures and heat treatment for H13 tool steel. Also by experiment of reheating of die, die softening curves were obtained. From experimental results, relationships between tempering parameters and hardness were established to investigate effects of hardness decrease by the effect of temperatures and time. Finally modified Archard's wear model in which hardness is considered to be a function of main tempering curve was proposed. And finite element analyses were conducted by adopting suggested wear model. By comparisons of simulations and real profiles of worn die, proposed wear model was verified.

  7. Die binding van die konfessie

    Directory of Open Access Journals (Sweden)

    P. J. Coetzee


    Full Text Available Ons moet waak teen twee uiterstes. Aan die een kant het die dogma as onversoenlike vyand die dogmatisme en aan die ander kant die antidogmatisme — dit hou enersyds die gevaar in van verabsolutering (oorskatting, en ander- syds die gevaar van relativisme (onderskatting.

  8. Traditional and Contemporary Lakota Death, Dying, Grief, and Bereavement Beliefs and Practices: A Qualitative Study


    Stone, Joseph B.


    Bereavement beliefs and practices in the modern, American culture have been well documented. However, virtually no research has been conducted on traditional and contemporary death, dying, grief, and bereavement beliefs and practices among native tribes, such as the Lakota. The present study was conducted with the Lakota, and fulfilled two goals. iii First, the contemporary and traditional death, dying, grief, and bereavement beliefs and practices of the Lakota were documented and summariz...

  9. Der Einfluss von Mixed Emotions auf die Werbewirkung : eine experimentelle Studie


    Bauer, Hans H.; Donnevert, Tobias; Exler, Stefanie; Hobusch, Sonja


    Emotionale Appelle haben heutzutage einen festen Platz in der Werbung. Neben rein positiven sowie rein negativen Emotionen werden auch Mixed Emotions verstärkt eingesetzt. Die Erforschung der konsumentenverhaltensrelevanten Wirkungen von Mixed Emotions, die das gleichzeitige oder sequentielle Erleben gegensätzlicher Emotionen bezeichnen, steckt jedoch noch in den Kinderschuhen. In der vorliegenden Studie wird daher der Einfluss von Mixed Emotions auf zentrale psychographische Werbewirku...

  10. Die Region braucht die Kultur - die Kultur braucht die Region


    Klemm, Ulrich


    Die Region braucht die Kultur - die Kultur braucht die Region. - In: Region in Aktion - oder: Region im Abseits? - Boxberg-Wölchingen : Eigenständige Regionalentwicklung Baden-Württemberg, 1995. - S. 25 f.

  11. Nurses attitudes towards death, dying patients and euthanasia: A descriptive study. (United States)

    Ay, Melike Ayça; Öz, Fatma


    Attitudes of nurses towards death and related concepts influence end-of-life care. Determining nurses' views and attitudes towards these concepts and the factors that affect them are necessary to ensure quality end-of-life care. The purpose of this study was to determine nurses' views and attitudes about death, dying patient, euthanasia and the relationships between nurses' characteristics. Participants consist of the nurses who volunteered to take part in this descriptive study from 25 hospitals (n = 340) which has a paediatric or adult intensive care unit and located within the boundaries of Ankara, Turkey. 'Nurse Information Form' and 'Attitude Scale about Euthanasia, Death and Dying Patients (DAS)' were used as data collection tool. Ethical consideration: Written permissions were received from the 'Noninterventional Clinical Researches Ethics Board' of authors' university and education councils of each hospital. Informed consent was obtained from participants. It is found that there are statistically significant difference among the factors of marital status, having a child, years of experience, bereavement experience, affected by working with dying patient, definition of euthanasia, views about patients who are appropriate for euthanasia, views about patients who desire to die and feeling need for counselling on these concepts according to the mean total score of nurses' attitudes about euthanasia, death and dying patient (p euthanasia and work with dying patient. This is reflected in their attitude. In order to gain positive attitude towards death, dying patient and euthanasia, the implementation of training and consulting services to nurses at appropriate intervals during both education and professional life are required.

  12. Die nabyheid van die Koninkryk

    Directory of Open Access Journals (Sweden)

    W.J. Snyman


    Full Text Available Vanweë die belangrikheid daarvan volg hier ’n breër bespreking van die proefskrif van dr. Tjaart van der Walt oor die nabyheid van die Koninkryk as wat in ’n gewone resensie kan geskied. Die vraagstuk wat onder oë gesien word is so oud as die kerk en die teologie, soms minder en soms meer op die voorgrond. Tans kan gesê word, staan dit in die middelpunt. Daarby is dit nie maar ’n akademiese vraagstuk nie, maar ’n vraagstuk waarvoor elke nadenkende leser van die Skrif te staan kom.

  13. Study of protective coatings for aluminum die casting molds

    Energy Technology Data Exchange (ETDEWEB)

    Peter, Ildiko, E-mail:; Rosso, Mario; Gobber, Federico Simone


    Highlights: • Development and characterization of some protective coatings on steel substrate, realized by plasma spray techniques, were presented. • The substrate material used is a Cr–Mo–V based hot work tool steel. • The main attention is on the study of wear and on the characterization of the interface, because of their key role in determining the resistance of the coating layer. • Simulation of friction and wear processes is performed by pin-on-disk test and the tested samples are observed by scanning electron microscopy. - Abstract: In this paper, the development and characterization of some protective coatings on steel substrate are presented. The coatings are realized by plasma spray techniques. The substrate material used is a Cr–Mo–V based hot work tool steel, initially submitted to vacuum heat treatment to achieve homogeneous hardness. The main attention is focused on the study of wear and on the characterization of the interface between the substrate material and the coating layer, because of their key role in determining the resistance of the coating layer. Simulation of friction and wear processes is performed by pin-on-disk test and the tested samples are observed by scanning electron microscopy.

  14. Case study: an ethical dilemma involving a dying patient. (United States)

    Pacsi, Alsacia L


    Nursing often deals with ethical dilemmas in the clinical arena. A case study demonstrates an ethical dilemma faced by healthcare providers who care for and treat Jehovah's Witnesses who are placed in a critical situation due to medical life-threatening situations. A 20-year-old, pregnant, Black Hispanic female presented to the Emergency Department (ED) in critical condition following a single-vehicle car accident. She exhibited signs and symptoms of internal bleeding and was advised to have a blood transfusion and emergency surgery in an attempt to save her and the fetus. She refused to accept blood or blood products and rejected the surgery as well. Her refusal was based on a fear of blood transfusion due to her belief in Bible scripture. The ethical dilemma presented is whether to respect the patient's autonomy and compromise standards of care or ignore the patient's wishes in an attempt to save her life. This paper presents the clinical case, identifies the ethical dilemma, and discusses virtue ethical theory and principles that apply to this situation.

  15. Telemedicine’s potential to support good dying in Nigeria: a qualitative study

    NARCIS (Netherlands)

    van Gurp, J.; Soyannwo, O.; Odebunmi, K.; Dania, S.; van Selm, M.; van Leeuwen, E.; Vissers, K.; Hasselaar, J.


    Objectives This qualitative study explores Nigerian health care professionals’ concepts of good dying/a good death and how telemedicine technologies and services would fit the current Nigerian palliative care practice. Materials and Methods Supported by the Centre for Palliative Care Nigeria (CPCN)

  16. Dying in Hospital with Dementia and Pneumonia: A Nationwide Study Using Death Certificate Data

    NARCIS (Netherlands)

    Houttekier, D.; Reyniers, T.; Deliens, L.; Den Noortgate, N.; Cohen, J.


    Background: For people with dementia dying from pneumonia, hospitalization at the end of life may be of little benefit and result in unfavourable outcomes such as hospital death. Objective: The aim of this study is to estimate the incidence of and factors associated with hospital death in people

  17. Death and Dying Attitudes, Anxieties, and Fears of Certified Nursing Assistants: A Descriptive Study (United States)

    Hamilton, Josephine A.


    The critical role of Certified Nursing Assistants (CNAs) to help elderly nursing home residents' move through declining conditions or diseases to death is salient. It is important for CNAs and nursing home leaders to understand CNAs' attitudes, fears, and anxieties toward death and dying. The quantitative study investigated CNA's…

  18. Sedimentêre omgewings van die Inhaca-eilandstelsel met spesiale verwysing na die petrografiese en geochemiese eienskappe van die sedimente spesiale verwysing na die petrografiese en geochemiese eienskappe van die sedimente

    Directory of Open Access Journals (Sweden)

    Marieke Peché


    Full Text Available Die Inhaca-eilandstelsel is geleë langs die suidooskus van Mosambiek. Die oostekant van die stelsel grens aan die Indiese Oseaan en die westekant aan die Baai van Maputo. Hierdie eilandstelsel bestaan uit Inhaca- en Portugese eiland, asook ’n groep sandbanke wat van die noordlike punt van Inhaca na Portugese eiland strek. Die doel van hierdie studie is om die verskillende moderne en oer-sedimentêre omgewings op die eilandstelsel te identifiseer en te beskryf, die invloed van getye en golfaksie op die moderne sedimentêre omgewing vas te stel en die geochemiese en petrografiese samestelling van die geologiese eenhede te bepaal.

  19. Telemedicine's Potential to Support Good Dying in Nigeria: A Qualitative Study.

    Directory of Open Access Journals (Sweden)

    Jelle van Gurp

    Full Text Available This qualitative study explores Nigerian health care professionals' concepts of good dying/a good death and how telemedicine technologies and services would fit the current Nigerian palliative care practice.Supported by the Centre for Palliative Care Nigeria (CPCN and the University College Hospital (UCH in Ibadan, Nigeria, the authors organized three focus groups with Nigerian health care professionals interested in palliative care, unstructured interviews with key role players for palliative care and representatives of telecom companies, and field visits to primary, secondary and tertiary healthcare clinics that provided palliative care. Data analysis consisted of open coding, constant comparison, diagramming of categorizations and relations, and extensive member checks.The focus group participants classified good dying into 2 domains: a feeling of completion of the individual life and dying within the community. Reported barriers to palliative care provision were socio-economic consequences of being seriously ill, taboos on dying and being ill, restricted access to adequate medical-technical care, equation of religion with medicine, and the faulty implementation of palliative care policy by government. The addition of telemedicine to Nigeria's palliative care practice appears problematic, due to irregular bandwidth, poor network coverage, and unstable power supply obstructing interactivity and access to information. However, a tele-education 'lite' scenario seemed viable in Nigeria, wherein low-tech educational networks are central that build on non-synchronous online communication.Nigerian health care professionals' concepts on good dying/a good death and barriers and opportunities for palliative care provision were, for the greater part, similar to prior findings from other studies in Africa. Information for and education of patient, family, and community are essential to further improve palliative care in Africa. Telemedicine can only help

  20. Telemedicine's Potential to Support Good Dying in Nigeria: A Qualitative Study. (United States)

    van Gurp, Jelle; Soyannwo, Olaitan; Odebunmi, Kehinde; Dania, Simpa; van Selm, Martine; van Leeuwen, Evert; Vissers, Kris; Hasselaar, Jeroen


    This qualitative study explores Nigerian health care professionals' concepts of good dying/a good death and how telemedicine technologies and services would fit the current Nigerian palliative care practice. Supported by the Centre for Palliative Care Nigeria (CPCN) and the University College Hospital (UCH) in Ibadan, Nigeria, the authors organized three focus groups with Nigerian health care professionals interested in palliative care, unstructured interviews with key role players for palliative care and representatives of telecom companies, and field visits to primary, secondary and tertiary healthcare clinics that provided palliative care. Data analysis consisted of open coding, constant comparison, diagramming of categorizations and relations, and extensive member checks. The focus group participants classified good dying into 2 domains: a feeling of completion of the individual life and dying within the community. Reported barriers to palliative care provision were socio-economic consequences of being seriously ill, taboos on dying and being ill, restricted access to adequate medical-technical care, equation of religion with medicine, and the faulty implementation of palliative care policy by government. The addition of telemedicine to Nigeria's palliative care practice appears problematic, due to irregular bandwidth, poor network coverage, and unstable power supply obstructing interactivity and access to information. However, a tele-education 'lite' scenario seemed viable in Nigeria, wherein low-tech educational networks are central that build on non-synchronous online communication. Nigerian health care professionals' concepts on good dying/a good death and barriers and opportunities for palliative care provision were, for the greater part, similar to prior findings from other studies in Africa. Information for and education of patient, family, and community are essential to further improve palliative care in Africa. Telemedicine can only help if low

  1. Die ontwikkeling van die bestuursmotiveringsvraelys (BMV

    Directory of Open Access Journals (Sweden)

    A. S. Engelbrecht


    Full Text Available The development of the Managerial Motivation Questionnaire (MMQ: Several criticisms of the psychometric suitability of existing measures of managerial motivation are reported in the literature. This study aimed at developing a new psychometrically sound instrument, the Managerial Motivation Questionnaire (MMQ. This was done on the basis of a comprehensive study of the literature on managerial motivation and the role-motivation theory. The preliminary MMQ was systematically shortened and refined until the final MMQ of 98 items was composed. This was based on social desirability and semantic appraisal, item analysis and factor analysis of the questionnaire. The results indicate that it was possible to develop a final MMQ that was relatively free of social desirability. It further demonstrated satsifactory internal consistencies on two samples (a = 0/90, N = 360; a = 0/91, N = 535, where all subscale items were found to be relatively pure measures of the isolated factors. Although some evidence was found providing support for the reliability of the MMQ, a need for further research on the construct validity of managerial motivation still exists. Opsomming In die literatuur word verskeie punte van kritiek teen die psigometriese geskiktheid van bestaande meetinstrumente van bestuursmotivering gerapporteer. Die doelstelling van hierdie studie was dus om aan die hand van die konseptuele omiyning van bestuursmotivering, en die rolmotiveringsteorie as algemene verwysingsraamwerk, 'n nuwe psigometries aanvaarbare meetinstrument, die Bestuursmotiveringsvraelys (BMV, te ontwikkel. Op grond van sosiale wenslikheids- en semantiese beoordeling, itemontleding en faktorontleding van die voorlopige BMV is die vraelys stelselmatig verkort en verfyn totdat die finale BMV van 98 items saamgestel is. Die resultate dui daarop dat hierdie studie wel daarin geslaag het om 'n finale BMV te ontwikkel wat relatief vry van sosiale wenslikheid is, bevredigende interne

  2. Die sestienpersoonlikheidsfaktorvraelys as hulpmiddel by die takseersentrum

    Directory of Open Access Journals (Sweden)

    J. C. D. Augustyn


    Full Text Available The 16PF Personality Test as an aid to the assessment centre Assessment centres still remains costly and thime consuming. This study investigates the reduction of time and costs by the use of the 16 PF Personality Test as a method for measuring management dimensions. Promising results were obtained with a relatively small sample for the prediction of initiative and perseverance. Significant multiple correlations were also found for three criteria of management success. Further research may establish the use of the 16 PF as an aid to management assessment and thereby reduce the costs and time involved in assessment centres. Opsomming Takseersentrums se grootste probleem is gelee in die koste en tyd wat dit behels. Hierdie studie ondersoek die moontlikheid om beide te verminder deur die aanwending van die 16 PF Persoonlikheidsvraelys vir die meting van bestuursdimensies. Belowende resultate is met 'n relatiewe klein steekproef bevind ten opsigte van die voorspelling van inisiatiefen deursettingsvermoe. Beduidende meervoudige korrelasies is ook ten opsigte van drie kriteria van bestuursukses bevind. Verdere navorsing kan die gebruik van die 16 PF as hulpmiddel by bestuursevaluering vestig en sodoende die tydsduur en koste van takseersentrums verminder.

  3. Blanke vroue-arbeid in die Unie van Suid-Afrika : 'n sosiologiese studie, met spesiale verwysing na die grootstedelike gebiede van die land

    NARCIS (Netherlands)

    Prinsloo, Maria Johanna Magdalena


    The purpose of this study is to present a sociological analysis of the phenomenon of European female-labour in the Union of South Africa, with special reference to the industrial areas of the country. The inspiration for this undertaking can be summed up in two main points: (i) That female-labour is

  4. Die funksie van die belydenis in die struktuur van die kerk en die ...

    African Journals Online (AJOL)

    Ter wille van die argument wat in hierdie voordrag na vore gebring word, word vier sodanige konstituerende elemente van die kerklike struktuur onderskei, te wete die belydenis, die teologie, die verkondi- ging (meer bepaald die prediking) en die kerkorde (kerkwet volgens ons terminologie). Ons gaan nou elkeen hiervan ...

  5. Cultural beliefs about a patient's right time to die: an exploratory study. (United States)

    Perkins, Henry S; Cortez, Josie D; Hazuda, Helen P


    Generalist physicians must often counsel patients or their families about the right time to die, but feel ill-prepared to do so. Patient beliefs may help guide the discussions. Because little prior research addresses such beliefs, we investigated them in this exploratory, hypothesis-generating study. Anticipating culture as a key influence, we interviewed 26 Mexican Americans (MAs), 18 Euro-Americans (EAs), and 14 African Americans (AAs) and content-analyzed their responses. Nearly all subjects regardless of ethnic group or gender said God determines (at least partially) a patient's right time to die, and serious disease signals it. Yet subjects differed by ethnic group over other signals for that time. Patient suffering and dependence on "artificial" life support signaled it for the MAs; patient acceptance of death signaled it for the EAs; and patient suffering and family presence at or before the death signaled it for the AAs. Subjects also differed by gender over other beliefs. In all ethnic groups more men than women said the time of death is unpredictable; but more women than men said the time of death is preset, and family suffering signals it. Furthermore, most MA women--but few others--explicitly declared that family have an important say in determining a patient's right time to die. No confounding occurred by religion. Americans may share some beliefs about the right time to die but differ by ethnic group or gender over other beliefs about that time. Quality end-of-life care requires accommodating such differences whenever reasonable.

  6. Study on Manufacturing Process of Hollow Main Shaft by Open Die Forging

    International Nuclear Information System (INIS)

    Kwon, Yong Chul; Kang, Jong Hun; Kim, Sang Sik


    The main shaft is one of the key components connecting the rotor hub and gear box of a wind power generator. Typically, main shafts are manufactured by open die forging method. However, the main shaft for large MW class wind generators is designed to be hollow in order to reduce the weight. Additionally, the main shafts are manufactured by a casting process. This study aims to develop a manufacturing process for hollow main shafts by the open die forging method. The design of a forging process for a solid main shaft and hollow shaft was prepared by an open die forging process design scheme. Finite element analyses were performed to obtain the flow stress by a hot compression test at different temperature and strain rates. The control parameters of each forging process, such as temperature and effective strain, were obtained and compared to predict the suitability of the hollow main shaft forging process. Finally, high productivity reflecting material utilization ratio, internal quality, shape, and dimension was verified by the prototypes manufactured by the proposed forging process for hollow main shafts

  7. Study on Manufacturing Process of Hollow Main Shaft by Open Die Forging

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Yong Chul [Gyeongnam Technopark, Changwon (Korea, Republic of); Kang, Jong Hun [Jungwon Univ., Goisan (Korea, Republic of); Kim, Sang Sik [Gyeongsang Natiional Univ., Jinju (Korea, Republic of)


    The main shaft is one of the key components connecting the rotor hub and gear box of a wind power generator. Typically, main shafts are manufactured by open die forging method. However, the main shaft for large MW class wind generators is designed to be hollow in order to reduce the weight. Additionally, the main shafts are manufactured by a casting process. This study aims to develop a manufacturing process for hollow main shafts by the open die forging method. The design of a forging process for a solid main shaft and hollow shaft was prepared by an open die forging process design scheme. Finite element analyses were performed to obtain the flow stress by a hot compression test at different temperature and strain rates. The control parameters of each forging process, such as temperature and effective strain, were obtained and compared to predict the suitability of the hollow main shaft forging process. Finally, high productivity reflecting material utilization ratio, internal quality, shape, and dimension was verified by the prototypes manufactured by the proposed forging process for hollow main shafts.

  8. Is Email Business Dying?: A Study on Evolution of Email Spam Over Fifteen Years

    Directory of Open Access Journals (Sweden)

    De Wang


    Full Text Available With the increasing dedication and sophistication of spammers, email spam is a persistent problem even today. Popular social network sites such as Facebook, Twitter, and Google+ are not exempt from email spam as they all interface with email systems. While some report predicts that email spam business is dying due to the decreasing volume of email spam. Whether email spam business is really dying is an interesting question. In this paper, we analyze email spam trends on Spam Archive dataset, which contains 5.5 million spam emails over 15 years (1998 – 2013. We statistically analyze emails contents including header information (e.g. content type and embedded items (e.g. URL links. Also, we investigate topic drift using topic modeling technique. Moreover, we perform network analysis on sender-to-receiver IP routing networks. Our study shows the dynamic nature of email spam over one and a half decades and demonstrate that the email spam business is not dying but more capricious.

  9. Die verband tussen die sielkundige kontrak en organisasieverbondenheid

    Directory of Open Access Journals (Sweden)

    K. J. Stanz


    Full Text Available The relationship between the psychological contract and organisational commitment. The aim of this study is to design a measuring instrument with acceptable metric characteristics for the strength of the psychological contract within the South African context, and to determine empirically the relation between the strength of the psychological contract and organisational commitment. The Dhammanungune Model served as foundation for the design of the Strength of the Psychological Contract Questionnaire which consists of two scales namely, a needs expectation scale and a needs fulfilment expectation scale. The items of each scale have been formulated in the manner that ensures that the respondent reacts consecutively to two instructions namely, (a the level of the expectation and (b the importance of the expectation. This questionnaire was administered together with the Organisational Commitment Questionnaire to two population groups within the military environment. The Pearson Product Moment Correlation was calculated between the strength of the psychological contract and organisational commitment and the significance of the correlations was evaluated. Opsomming Die doel van die studie is om 'n meetinstrument met aanvaarbare metriese eienskappe vir die sterkte van die sielkundige kontrak vir Suid-Afrikaanse omstandighede te ontwerp en om empirics die verband tussen die sterkte van die sielkundige kontrak en organisasieverbondenheid te bepaal. Die sterkte van die sielkundige kontrak vraelys is op grond van die Dhammanungune-model ontwerp en het uit twee skale naamlik, die behoefteverwagting- en vervullingsverwagtingskale bestaan. Items vir eike skaal is sodanig geformuleer dat die respondent agteropeenvolgens op twee instruksies naamlik (a die vlak van die verwagting en (b die belangrikheid van die verwagting moet reageer. Die vraelys is saam met die organisasieverbondenheidsvraelys op twee populasies uit 'n militere omgewing toegepas. Die Pearson

  10. Die posisie van die Helper in die sending

    Directory of Open Access Journals (Sweden)

    I. J. van der Walt


    Full Text Available Gedurende die aanvangsjare van die sending het die helper ’n onmisbare funksie vervul. Hulle het die onherbergsame binnelande geken, waardevolle kontakpunte vir die sendelinge geopen en hulle mense geestelik help voorlig en voorberei.

  11. Digilanid C by die behandeling van hartlyers

    NARCIS (Netherlands)

    Snyman, Hendrik Willem


    In die voorafgaande word 'n literatuur studie oor die ontwikkeling en huidige stand van die chemie en farmakologie van die Digitalis purpurea en Digitalis lanata gegee, waarin spesiaal gelet word op die chemiese samestelling en farmakologiese aktiwiteit van die Digitalis lanata glikoside. Daarna

  12. Supportive and palliative care needs of families of children who die from cancer: an Australian study. (United States)

    Monterosso, Leanne; Kristjanson, Linda J


    To obtain feedback from parents of children who died from cancer about their understanding of palliative care, their experiences of palliative and supportive care received during their child's illness, and their palliative and supportive care needs. A qualitative study with semi-structured interviews. 24 parents from Perth (n = 10), Melbourne (n = 5), Brisbane (n = 5) and Sydney (n = 4). Five Australian tertiary paediatric oncology centres. Results Parents whose children died from cancer live within a context of chronic uncertainty and apprehension. Parents construed palliative care negatively as an independent process at the end of their children's lives rather than as a component of a wider and continuous process where children and their families are offered both curative and palliative care throughout the cancer trajectory. The concept of palliative care was perceived to be misunderstood by key health professionals involved in the care of the child and family. The importance and therapeutic value of authentic and honest relationships between health professionals and parents, and between health professionals and children were highlighted as a critical aspect of care. Also highlighted was the need to include children and adolescents in decision making, and for the delivery of compassionate end-of-life care that is sensitive to the developmental needs of the children, their parents and siblings. There is a need for health professionals to better understand the concept of palliative care, and factors that contribute to honest, open, authentic and therapeutic relationships of those concerned in the care of the dying child. This will facilitate a better understanding by both parents and their children with cancer, and acceptance of the integration of palliative and supportive care in routine cancer care.

  13. Characteristics of Mexican children and adolescents who died by suicide: A study of psychological autopsies. (United States)

    González-Castro, Thelma Beatriz; Tovilla-Zárate, Carlos Alfonso; Hernández-Díaz, Yazmín; Juárez-Rojop, Isela E; León-Garibay, Alejandra Giovanna; Guzmán-Priego, Crystell Guadalupe; López-Narváez, Lilia; Frésan, Ana


    In recent years, suicide in children and adolescents has increased considerably, becoming the second cause of death in this age group. Therefore, the aim of this study was to identify characteristics and factors that could precipitate deaths by suicide in children and adolescents. Using the psychological autopsy method, we studied 28 suicide cases of children and adolescents between 10 and 17 years old. Socio-demographic factors, characteristics of the suicide and family history were documented. The proportion of deaths by suicide was the same in females and males (50% each). Most of the suicides were performed at the child/adolescent's home (78.6%) and no history of previous suicide attempts were registered (85.7%). Also, the majority of suicidal individuals came from a dysfunctional family (60.7%). Our results identified characteristics of children and adolescents that had died by suicide, such as dying at their homes and coming from dysfunctional families. Knowing the characteristics of children and adolescents that had ended their lives by suicide should be considered in future studies to help developing preventive programs and strategies for treating suicidal behaviors in Mexican children and adolescents. Copyright © 2017 Elsevier Ltd and Faculty of Forensic and Legal Medicine. All rights reserved.

  14. STUDY OF THE flat die pellet mills kinematic diagram with active cylindrical press rolLS

    Directory of Open Access Journals (Sweden)

    Osokin Anton Vladislavovich


    Full Text Available Though being widely spread, the designs of such machines as flat die pellet mills have hardly been comprehensively theoretically studied. At the same time, the kinematic motion of the ring die pellet mill executive parts have been studied quite thoroughly. The machine executive parts kinematics determines the nature of their motion and velocity parameters, as well as the energy costs for the unit operation of the assembly. In addition, a detailed analysis of the facility kinematic diagram enables a rational approach to the design process for a new equipment. In view of this, this paper proposes a classification of flat matrix granulators over the kinematic diagrams of the executive parts interactions. We performed an analytical study of the kinematic diagram flat matrix granulator with active cylindrical press rolls. We considered the forces acting on the press roll during its operation. We determined the kinematic parameters and their interrelation with the design parameters of the press roll. We obtained the analytical equations for the of the neutral cross-section determination - the most characteristic section of the press-roll granulator

  15. Oorsigartikel – F. Gerrit Immink se prakties–teologiese studie van die geloofspraktyk: Liturgiese vernuwing in die Protestantse tradisie

    Directory of Open Access Journals (Sweden)

    Hendrik (Hennie J.C. Pieterse


    Full Text Available This contribution is a review article on the three most important books by F. Gerrit Immink in practical theology. His approach to this discipline is studying faith praxis of the Protestantse Kerk in Nederland (Protestant Church in the Netherlands which is a church in the Reformed tradition. In his first book he explained his approach to practical theology in a discussion with the action theory and hermeneutical-communucative approaches. His choice for the study of faith praxis opens the way for a more theological approach to him in which communication between God and people is an important aspect. His second book forms the central part of this article. He uses the concept performance in the liturgy which is adopted from the theater world. In the performance by means of the execution of the liturgy by the congregation (preacher, organ, music, singing, praying they all get involved in the message from the Bible of that Sunday, they are touched by it, it has an effect on them, and they get a new perspective on the problems of everyday life. This is possible through the work of the Holy Spirit. The epiclese prayers in the liturgy are prayers for the enlightening and work by the Spirit. He discusses singing, praying, preaching, baptism and Holy Communion in detail. The main idea is that the performance in the liturgy does something to you, it has an effect on you, something happens to you. To my mind there is no need to choose between the ritual approach and the approach he is putting on the table. The approaches can enrich each other.

  16. Case study of lean manufacturing application in a die casting manufacturing company (United States)

    Ching, Ng Tan; Hoe, Clarence Chan Kok; Hong, Tang Sai; Ghobakhloo, Morteza; Pin, Chen Kah


    The case study of lean manufacturing aims to study the application of lean manufacturing in a die casting manufacturing company located in Pulau Penang, Malaysia. This case study describes mainly about the important concepts and applications of lean manufacturing which could gradually help the company in increasing the profit by studying and analyzing their current manufacturing process and company culture. Many approaches of lean manufacturing are studied in this project which includes: 5S housekeeping, Kaizen, and Takt Time. Besides, the lean tools mentioned, quality tool such as the House of Quality is being used as an analysis tool to continuously improve the product quality. In short, the existing lean culture in the company is studied and analyzed, with recommendations written at the end of this paper.


    African Journals Online (AJOL)

    stel (kortdiensstelsel). Met die uitbreek van die oorlog in 1939 het die. Unieverdedigingsmag uit 40% Staandemag en. 60% aktiewe Burgermag bestaan. Op 22 Sept. 1939 is magtiging aan die Aktiewe Burgermag- eenhede verleen om vrywilligers vir die duur van die oorlog te aanvaar. Agv beswaar dat die Verdedigingswet.

  18. Die Formatestadt


    Günter Trojan


    Zu Zeiten von DV oder VHS (wer kennt das eigentlich noch?) war die Welt noch in Ordnung: Da hatte man eine Kassette in der Hand und wenn das passende Gerät gefunden wurde konnte man das Video auch abspielen. Günter Trojan diskutiert die Geschichte und Gegenwart unterschiedlicher Videoformate ...

  19. Die Formatestadt

    Directory of Open Access Journals (Sweden)

    Günter Trojan


    Full Text Available Zu Zeiten von DV oder VHS (wer kennt das eigentlich noch? war die Welt noch in Ordnung: Da hatte man eine Kassette in der Hand und wenn das passende Gerät gefunden wurde konnte man das Video auch abspielen. Günter Trojan diskutiert die Geschichte und Gegenwart unterschiedlicher Videoformate ...

  20. Frictional interactions in forming processes: New studies with transparent sapphire strip-drawing dies (United States)

    Rao, R. S.; Lu, C. Y.; Wright, P. K.; Devenpeck, M. L.; Richmond, O.; Appleby, E. J.


    This research is concerned with the frictional interactions at the toolwork interfaces in the machining and strip-drawing processes. A novel feature is that transparent sapphire (single crystal Al2O3) is being used as the tool and die material. This allows the tribological features of the interface to be directly observed and recorded on movie-film. These qualitative studies provide information on the role of lubricants. In addition, techniques are being developed to quantify the velocity gradient along the interface. For example, in the drawing work it has been found that tracer markings (e.g. dye-spots), applied to the undrawn strip, remain intact during drawing and can be tracked along the sapphire/strip interface. Such data will be used as input to a finite-element, elasto-plastic-workhardening model of the deformation process. The latter can compute strip deformation characteristics, drawing forces and local coefficients of friction at the interface. Introductory results will be presented in this paper, obtained from drawing tin-plated mild steel with sapphire and cemented carbide dies. Drawing loads and die-separating forces will be presented and movie-films of the action of tracer markings at the interface shown. In order to demonstrate how this data can be used in an analysis of a large strain deformation process with friction, initial results from running the FIPDEF elasto-plastic code will be discussed. From a commercial viewpoint research on strip-drawing is of special interest to the can-making industry. From a physical viewpoint stripdrawing is of particular interest because it is a symmetrical, plane strain deformation and, in comparison with other metal processing operations, it is more readily modeled. However, until now the elasto-plastic codes that have been developed to predictively model drawing have had limitations: the most notable being that of quantifying the friction conditions at the die-work interface. Hence the specification of the

  1. Medizinstudierende Eltern – die Dichotomie der Erfahrungswelten [Parents Studying Medicine – the dichotomy of studying with a family

    Directory of Open Access Journals (Sweden)

    Iden, Kirstin


    Full Text Available [english] Introduction: In this article the personal study and life situation of parents who are also medical students at the Medical School of the Goethe University Frankfurt am Main is discussed. There is a special focus on the topics “studying with children” and “family-friendly university”, which have been present in discussions about university development and in the daily life of academics, especially during the last decade. The workgroup “Individual Student Services” at the medical faculty at the Goethe University tries to meet the necessities of the individual study courses and to support the study success with a new counselling and student service concept.Methods: The experience of parents studying medicine was recorded in semi-structured interviews (Date: April 2010, which were held as part of the sponsored pilot project on part-time medical studies (“Pilot Project Part-time Medical Studies”. Additionally, study results from the Medical School of the Goethe University Frankfurt am Main were integrated as well as a literature analysis.Results: It was found that the teaching demands and support services, which have been suggested and needed for years now, have been partially implemented and are without sufficient support at the faculty level to date. Thus the current situation of medical students with children is still difficult and seems a big challenge for everyone involved.Solution: As part of the “Individual Student Services” a new pilot project on part-time medical studies was established in November 2009. Only the use of new, unconventional and innovative ideas allows universities to adequately support the changing and heterogeneous student population and support them to successfully completing their medical studies.[german] Einleitung: In dem vorliegenden Artikel wird die persönliche Studien- und Lebenssituation von Studierenden mit Kindern am Fachbereich Medizin der Goethe-Universität Frankfurt am Main

  2. Psychotherapie und Spiritualität : eine qualitative Studie über die Integration spiritueller Konzepte und Methoden in die psychotherapeutische Arbeitsweise


    Hundt, Ulrike


    Anhand biographischer Interviews werden die Motive von sechs Psychotherapeuten untersucht, sich einem spirituell orientierten Weg zuzuwenden und spirituelle Werte und Methoden in ihr westliches Therapiekonzept zu integrieren. Auffälligstes Ergebnis ist die Argumentation der Notwendigkeit von Spiritualität bzw. Religiosität für den therapeutischen Prozess, verbunden mit einer großen Offenheit für das Weltbild des Klienten. Die befragten Therapeuten lehnten es ab, eine spirituelle Perspektive v...

  3. Suffering and euthanasia: a qualitative study of dying cancer patients' perspectives. (United States)

    Karlsson, Marit; Milberg, Anna; Strang, Peter


    Although intolerable suffering is a core concept used to justify euthanasia, little is known about dying cancer patients' own interpretations and conclusions of suffering in relation to euthanasia. Sixty-six patients with cancer in a palliative phase were selected through maximum-variation sampling, and in-depth interviews were conducted on suffering and euthanasia. The interviews were analyzed using qualitative content analysis with no predetermined categories. The analysis demonstrated patients' different perspectives on suffering in connection to their attitude to euthanasia. Those advocating euthanasia, though not for themselves at the time of the study, did so due to (1) perceptions of suffering as meaningless, (2) anticipatory fears of losses and multi-dimensional suffering, or (3) doubts over the possibility of receiving help to alleviate suffering. Those opposing euthanasia did so due to (1) perceptions of life, despite suffering, as being meaningful, (2) trust in bodily or psychological adaptation to reduce suffering, a phenomenon personally experienced by informants, and (3) by placing trust in the provision of help and support by healthcare services to reduce future suffering. Dying cancer patients draw varying conclusions from suffering: suffering can, but does not necessarily, lead to advocations of euthanasia. Patients experiencing meaning and trust, and who find strategies to handle suffering, oppose euthanasia. In contrast, patients with anticipatory fears of multi-dimensional meaningless suffering and with lack of belief in the continuing availability of help, advocate euthanasia. This indicates a need for healthcare staff to address issues of trust, meaning, and anticipatory fears.

  4. [The meaning of dying with dignity from caregivers perspective: a phenomenological study]. (United States)

    Ibáñez-Masero, Olivia; Ortega-Galán, Ángela M; Carmona-Rega, M Inés; Ruiz-Fernández, M Dolores; Cabrera-Troya, José; García-Cisneros, Rogelio; Medina, Fernando Relinque

    To explore the meaning of dying with dignity from the perspective of the direct witnesses who have accompanied this process in dying people from Andalusia. Phenomenological study conducted in different centres, which including analysing the transcriptions of the dialogues from discussion groups with 40 participants in five provinces in Southern Spain. The data was analysed using the Van Manen proposal and Atlas Ti 7.0 program was applied as a software tool. Being in the company of loved ones is noted as a key element in the perception of a dignified death. The following elements, according to a priority order, were also pointed out: relief of suffering, a good professional care, decision making ability, and the opportunity to consider their spiritual dimension. Achievement of their Living Wills is hardly mentioned. The essential elements defined in the Death with Dignity Law, 2/2010 are confirmed as being true (without suffering, with company, respecting living wills, having possibilities of the farewell, and the transcendental meaning of the death process). Caregivers, at the end of life, give priority to psychological aspects, underlying the need of company, a farewell of the loved ones, and a good professional care on the physical aspects. The promotion of the dignified Death Law and Living Wills are still being developed. Copyright © 2016 Elsevier España, S.L.U. All rights reserved.

  5. Dimensional control of die castings (United States)

    Karve, Aniruddha Ajit

    The demand for net shape die castings, which require little or no machining, is steadily increasing. Stringent customer requirements are forcing die casters to deliver high quality castings in increasingly short lead times. Dimensional conformance to customer specifications is an inherent part of die casting quality. The dimensional attributes of a die casting are essentially dependent upon many factors--the quality of the die and the degree of control over the process variables being the two major sources of dimensional error in die castings. This study focused on investigating the nature and the causes of dimensional error in die castings. The two major components of dimensional error i.e., dimensional variability and die allowance were studied. The major effort of this study was to qualitatively and quantitatively study the effects of casting geometry and process variables on die casting dimensional variability and die allowance. This was accomplished by detailed dimensional data collection at production die casting sites. Robust feature characterization schemes were developed to describe complex casting geometry in quantitative terms. Empirical modeling was utilized to quantify the effects of the casting variables on dimensional variability and die allowance for die casting features. A number of casting geometry and process variables were found to affect dimensional variability in die castings. The dimensional variability was evaluated by comparisons with current published dimensional tolerance standards. The casting geometry was found to play a significant role in influencing the die allowance of the features measured. The predictive models developed for dimensional variability and die allowance were evaluated to test their effectiveness. Finally, the relative impact of all the components of dimensional error in die castings was put into perspective, and general guidelines for effective dimensional control in the die casting plant were laid out. The results of

  6. Die funksie van die skeppingstradisie in die boek Jeremia

    African Journals Online (AJOL)

    gedeeites voor wat sterk ooreenkomste toon met die beskrywings van die skep pingsgebeure in die boek Jeremia. • Volgpns Von Rad (1957:144-146) het daar wel 'n groep bestaan wat belange ge- had liet by die oorlewering van die skeppingstradisies. Dit was waarskynlik die. Sadokitiese priesters wat om twee redes aan ...

  7. A Study on Development of High Strength Al-Zn Based alloy for Die Casting Ⅲ

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Sang-Soo; Park, Ik-Min [Pusan National University, Busan (Korea, Republic of); Yeom, Gil-Young; Lim, Kyoung-Mook [Korea Institute of Industrial Technology, Incheon (Korea, Republic of); Son, Hyun-Jin [Oh-Sung Co. Ltd., Siheung (Korea, Republic of)


    In this study, the microstructural evolution and various characteristics of Al-20⁓45wt%Zn alloys were investigated. In terms of microstructure, as the amount of Zn addition to the alloys increased, the α-phase size decreased and the α+η non-equilibrium solidification phase fraction increased. Also, increasing Zn content improved the wear resistance of the alloys, but reduced the damping capacity and toughness of the alloys. Their physical properties of the Al-Zn alloy with high Zn content, specifically the wear resistance and toughness, were superior to those of commercial ALDC12 alloys for die-casting. Based on these results, we considered the possibility of application of the developed Al-Zn alloy as a structural material.

  8. A Study on Development of High Strength Al-Zn Based alloy for Die Casting Ⅲ

    International Nuclear Information System (INIS)

    Shin, Sang-Soo; Park, Ik-Min; Yeom, Gil-Young; Lim, Kyoung-Mook; Son, Hyun-Jin


    In this study, the microstructural evolution and various characteristics of Al-20⁓45wt%Zn alloys were investigated. In terms of microstructure, as the amount of Zn addition to the alloys increased, the α-phase size decreased and the α+η non-equilibrium solidification phase fraction increased. Also, increasing Zn content improved the wear resistance of the alloys, but reduced the damping capacity and toughness of the alloys. Their physical properties of the Al-Zn alloy with high Zn content, specifically the wear resistance and toughness, were superior to those of commercial ALDC12 alloys for die-casting. Based on these results, we considered the possibility of application of the developed Al-Zn alloy as a structural material.

  9. The studies on ash dying (Fraxinus excelsior L. in the Włoszczowa Forest Unit stands

    Directory of Open Access Journals (Sweden)

    Tadeusz Kowalski


    Full Text Available The studies were carried out in the Włoszczowa Forest Unit, in 9 ash stands differing in respect of age, origin (natural, artificial, site and in the nursery on 3 quarters differing due to a silvicultural method (transplanted and not transplanted and seedlings age. In each stand an analysis of disease symptoms was carried out on 100 trees (2 - 20 years old stands or 50 trees (21 - 80 years old stands growing side by side in central part of the stand, while in the nursery in each block 200 seedlings were analyzed (4 sectors with 50 seedlings each. From the infected seedlings and trees 120 fragments of dead branches, living branches with cankers, and dead roots were taken. Identification of fungi was made on the basis of fructification and over 300 isolations of fungi on malt agar medium. The most frequent disease symptoms in ash stands were: the dead top (34.7% trees, the dying of whole branches (83.5%, the dying of the top of branches (20.1%, the occurrence of healed (36.0% and unhealed cankers (18.9% and the slime flux (23.7% on the trunk, also the chlorosis of leaves (7.5% and their atrophy (11.2%. Most of the types of disease symptoms appeared irrespectively of the tree age, origin and site, sometimes showing only a difference in the frequency of occurrence. On the seedlings in the nursery the shoot discolouration, healed and unhealed cankers on shoots and necrosis of a part of leaves were recorded most frequently. Disease symptoms occurred more frequently on 4-year-old seedlings in comparison with 3-year-old. In respect of transplanted seedlings the leaves dying was more frequent. Within cankers and on dead tops of shoots the most frequent were: Alternaria alternata, Chalara sp., Cytospora ambiens, Diplodia mutila, Fusarium lateritium, Gloeosporidiella turgida, Phomopsis controversa and Phomopsis scobina. In sparsely found dead roots of living trees appeared mostly: Cryptosporiopsis radicicola, Cylindrocarpon destructans and Phialocephala

  10. Die regsposisie van die gemolesteerde kind 1

    Directory of Open Access Journals (Sweden)

    P.J. Schabort


    Full Text Available Hoe reik die reg uit na die seksueel gemolesteerde kind? As na die reg in wye verband gekyk word, sou dit alie wetgewing en alle gemeneregsbeginsels en alle regsprosedures insluit waardeur die Staat poog om molestering te voorkom en die gemolesteerde kind in beskerming te neem. Dit le baie wyd en sou byvoorbeeld die maatreels insluit van die Kindenvet 33 van 1960; die Wet op Egskeiding 70 van 1979; die Wet op Kindersorg 74 van 1983; die Wet op die Status van Kinders 82 van 1987 en die Wet op Bemiddeling in Sekere Egskeidingsaangeleenthede 24 van 1987. Eersdaags sal dit moontlik ook ’n Manifes vir die Regte van Kinders insluit wat vermoedelik geskoei sal wees op die W O se Konvensie vir die Regte van die Kind (1989 w a arv an die RSA tan s nog nie ’n ondertekenaar is nie.

  11. Suicide assisted by right-to-die associations: a population based cohort study. (United States)

    Steck, Nicole; Junker, Christoph; Maessen, Maud; Reisch, Thomas; Zwahlen, Marcel; Egger, Matthias


    In Switzerland, assisted suicide is legal but there is concern that vulnerable or disadvantaged groups are more likely to die in this way than other people. We examined socio-economic factors associated with assisted suicide. We linked the suicides assisted by right-to-die associations during 2003-08 to a census-based longitudinal study of the Swiss population. We used Cox and logistic regression models to examine associations with gender, age, marital status, education, religion, type of household, urbanization, neighbourhood socio-economic position and other variables. Separate analyses were done for younger (25 to 64 years) and older (65 to 94 years) people. Analyses were based on 5 004 403 Swiss residents and 1301 assisted suicides (439 in the younger and 862 in the older group). In 1093 (84.0%) assisted suicides, an underlying cause was recorded; cancer was the most common cause (508, 46.5%). In both age groups, assisted suicide was more likely in women than in men, those living alone compared with those living with others and in those with no religious affiliation compared with Protestants or Catholics. The rate was also higher in more educated people, in urban compared with rural areas and in neighbourhoods of higher socio-economic position. In older people, assisted suicide was more likely in the divorced compared with the married; in younger people, having children was associated with a lower rate. Assisted suicide in Switzerland was associated with female gender and situations that may indicate greater vulnerability such as living alone or being divorced, but also with higher education and higher socio-economic position.

  12. Study the effect of elevated dies temperature on aluminium and steel round deep drawing

    International Nuclear Information System (INIS)

    Lean, Yeong Wei; Azuddin, M.


    Round deep drawing operation can only be realized by expensive multi-step production processes. To reduce the cost of processes while expecting an acceptable result, round deep drawing can be done at elevated temperature. There are 3 common problems which are fracture, wrinkling and earing of deep drawing a round cup. The main objective is to investigate the effect of dies temperature on aluminium and steel round deep drawing; with a sub-objective of eliminate fracture and reducing wrinkling effect. Experimental method is conducted with 3 different techniques on heating the die. The techniques are heating both upper and lower dies, heating only the upper dies, and heating only the lower dies. 4 different temperatures has been chosen throughout the experiment. The experimental result then will be compared with finite element analysis software. There is a positive result from steel material on heating both upper and lower dies, where the simulation result shows comparable as experimental result. Heating both upper and lower dies will be the best among 3 types of heating techniques. (paper)

  13. Die Energiesicherheit Europas in Bezug auf Erdgas und die Auswirkungen einer Kartellbildung im Gassektor


    Krämer, Luis-Martín


    Die Dissertation untersucht die aktuelle Sicherheit der europaeischen Erdgasversorgung. Sie beruecksichtigt zudem die moeglichen Auswirkungen einer Kartellbildung auf die europaeische Gasversorgungssicherheit. Die Arbeit besteht aus einer detaillierten empirischen Studie und darauf aufbauender Szenarioanalyse. Hierzu wird auf den Interdependenzansatz von Robert O. Keohane und Joseph Nye zurueckgegriffen. Zur Darstellung des komplexen Themenbereichs wird auf die Darstellungspraxis der Dichten ...

  14. Study of die-away time for a slab type passive neutron detector system

    International Nuclear Information System (INIS)

    Muralidhar, S.; Gubbi, G.K.; Dange, S.P.; Ali, M.Y.; Tomar, B.S.; Basu, T.K.; Anand, R.P.


    Full text: A slab type passive neutron detector coincidence counting system has been fabricated to estimate the plutonium content in nuclear materials. The present work focuses on the measurement of the die-away time of the system. The results obtained by carrying out neutron counting experiments, using the slab detector and a PC-based data acquisition system, are compared to the die-away time estimated by using Monte Carlo N-particle Transport (MCNP) code for the detector configuration. These results are presented along with the parameters and method for measuring the die-away time both experimentally and theoretically. Results of this validity check are in good agreement

  15. Is Email Business Dying?: A Study on Evolution of Email Spam Over Fifteen Years


    De Wang; Danesh Irani; Calton Pu


    With the increasing dedication and sophistication of spammers, email spam is a persistent problem even today. Popular social network sites such as Facebook, Twitter, and Google+ are not exempt from email spam as they all interface with email systems. While some report predicts that email spam business is dying due to the decreasing volume of email spam. Whether email spam business is really dying is an interesting question. In this paper, we analyze email spam trends on Spam Archive dataset, ...

  16. Modeling the Mechanical Performance of Die Casting Dies

    Energy Technology Data Exchange (ETDEWEB)

    R. Allen Miller


    The following report covers work performed at Ohio State on modeling the mechanical performance of dies. The focus of the project was development and particularly verification of finite element techniques used to model and predict displacements and stresses in die casting dies. The work entails a major case study performed with and industrial partner on a production die and laboratory experiments performed at Ohio State.

  17. Klinische Studie zur Messung der Dimensionsstabilität von digitalen Ganzkieferabformungen und die Entwicklung einer neuen Messmethode


    Kuhr, Fabian


    Digitale Abformungen mit intraoralen Scannern haben klinisch bereits bewiesen, dass sie einzelne Zähne detail- und dimensionsgenau aufnehmen und in dieser Hinsicht eine Alternative zur konventionellen zahnärztlichen Abformung bieten können. Ob dies klinisch auch mit dem Scannen gesamter Zahnreihen möglich ist, wurde bislang nicht untersucht. Sowohl für konventionelle wie auch für digitale Abformungen gibt es keine In-vivo-Studie, die eine Methode zur Überprüfung der dimensionsgetreuen Übertra...

  18. [The right to die with dignity in an acute-care hospital: a qualitative study]. (United States)

    Sepúlveda-Sánchez, Juana María; Morales-Asencio, Jose Miguel; Morales-Gil, Isabel María; Canca-Sánchez, José Carlos; Crespillo-García, Eva; Timonet-Andreu, Eva María


    To examine the perceptions and beliefs of doctors and nurses, and the barriers and facilitators they must address as regards the right to die with dignity in an acute-care hospital, and to consider the applicability of the provisions of Law 2/2010 of 8 April in this respect. A qualitative descriptive study, based on the focus group technique, using discourse analysis of the views of doctors and nurses responsible for the health care of terminal cancer and non-cancer patients in an acute-care hospital. The results obtained show that there are diverse obstacles to assure the rights of terminal patients, and to ensure the proper performance of their duties by healthcare professionals and institutions. The nature and impact of these difficulties depend on the characteristics of the patients and their families, the health workers involved, the organisation of health care, and cultural factors. The study highlights the need to improve the process of communication with patients and their families, to facilitate shared decision making and to establish measures to clarify issues such as palliative sedation and treatment limitation. It is necessary to improve the applicability of the law on living wills and dignified death in non-cancer specialist areas. Further training is needed regarding ethical, spiritual and anthropological aspects of care in these situations. Copyright © 2013 Elsevier España, S.L. All rights reserved.

  19. Does ethnicity affect where people with cancer die? A population-based 10 year study.

    Directory of Open Access Journals (Sweden)

    Jonathan Koffman

    Full Text Available Ageing is a growing issue for people from UK black, Asian and minority ethnic (BAME groups. The health experiences of these groups are recognised as a 'tracer' to measure success in end of life patient-preferred outcomes that includes place of death (PoD.To examine patterns in PoD among BAME groups who died of cancer.Mortality data for 93,375 cancer deaths of those aged ≥65 years in London from 2001-2010 were obtained from the UK Office for National Statistics (ONS. Decedent's country of birth was used as a proxy for ethnicity. Linear regression examined trends in place of death across the eight ethnic groups and Poisson regression examined the association between country of birth and place of death.76% decedents were born in the UK, followed by Ireland (5.9%, Europe(5.4% and Caribbean(4.3%. Most deaths(52.5% occurred in hospital, followed by home(18.7%. During the study period, deaths in hospital declined with an increase in home deaths; trend for time analysis for those born in UK(0.50%/yr[0.36-0.64%]p<0.001, Europe (1.00%/yr[0.64-1.30%]p<0.001, Asia(1.09%/yr[0.94-1.20%]p<0.001 and Caribbean(1.03%/yr[0.72-1.30%]p<0.001. However, time consistent gaps across the geographical groups remained. Following adjustment hospital deaths were more likely for those born in Asia(Proportion ratio(PR1.12[95%CI1.08-1.15]p<0.001 and Africa(PR 1.11[95%CI1.07-1.16]p<0.001. Hospice deaths were less likely for those born in Asia(PR 0.73 [0.68-0.80] p<0.001, Africa (PR 0.83[95%CI0.74-0.93]p<0.001, and 'other' geographical regions (PR0.90[95% 0.82-0.98]p<0.001. Home deaths were less likely for those born in the Caribbean(PR0.91[95%CI 0.85-0.98]p<0.001.Location of death varies by country of birth. BAME groups are more likely to die in a hospital and less likely to die at home or in a hospice. Further investigation is needed to determine whether these differences result from patient-centred preferences, or other environment or service-related factors. This knowledge


    Falcochio, Diego Figueira; Crepaldi, Bruno Eiras; Trindade, Christiano Augusto; da Costa, Antonio Carlos; Chakkour, Ivan


    the aim of this study is try to show the best view for distal radius fractures so called die-punch fractures. There has been used a human cadaver radius bone from the Salvador Arena Tissue Bank. This bone was cleaned up after removing the soft tissues and osteotomies created displaced lunate fossa fractures of 0, 1, 2, 3 and 5 mm. We have fixed this fragment with adhesive tape. Then the joint deviation were significantly increased with step-offs of 1 mm. Radiographs were then taken into 5 different positions: postero-anterior view, lateral view, oblique views and tangencial view for each of the deviations. The resulting lunate fossa depression in each X-ray film was analyzed by the AutoCAD 2010® software. The tangencial view was the best one to see the 1mm and 3mm bone degrees and the second one view to see the 2mm and 5 mm degrees. The pronated oblique view was the best to see the 2mm degrees and the oblique supinated view wasn't able to see the degrees between 1 and 2mm. The tangencial view was the best one to see the 1mm and 3mm bone degrees and the second one view to see the 2mm and 5 mm degrees.

  1. The attitudes of brain cancer patients and their caregivers towards death and dying: a qualitative study

    Directory of Open Access Journals (Sweden)

    Kimmelman Jonathan


    Full Text Available Abstract Background Much money and energy has been spent on the study of the molecular biology of malignant brain tumours. However, little attention has been paid to the wishes of patients afflicted with these incurable tumours, and how this might influence treatment considerations. Methods We interviewed 29 individuals – 7 patients dying of a malignant brain tumor and 22 loved ones. One-on-one interviews were conducted according to a pre-designed interview guide. A combination of open-ended questions, as well as clinical scenarios was presented to participants in order to understand what is meaningful and valuable to them when determining treatment options and management approaches. The results were analyzed, coded, and interpreted using qualitative analytic techniques in order to arrive at several common overarching themes. Results Seven major themes were identified. In general, respondents were united in viewing brain cancer as unique amongst malignancies, due in large part to the premium placed on mental competence and cognitive functioning. Importantly, participants found their experiences, however difficult, led to the discovery of inner strength and resilience. Responses were usually framed within an interpersonal context, and participants were generally grateful for the opportunity to speak about their experiences. Attitudes towards religion, spirituality, and euthanasia were also probed. Conclusion Several important themes underlie the experiences of brain cancer patients and their caregivers. It is important to consider these when managing these patients and to respect not only their autonomy but also the complex interpersonal toll that a malignant diagnosis can have.

  2. Geslagsverskille in die ouditiewe ontlokte potensiaal van die brein

    Directory of Open Access Journals (Sweden)

    Anita D Stuart


    Full Text Available Gender differences in the auditory evoked potential of the brain. Based on literature indications of an association between temperament characteristics and the evoked potential of the brain, and indications of gender differences in certain temperament traits, the purpose of this study was to ascertain whether evoked responses also differentiated between the genders. A sample of 81 male and 210 female students was randomly selected. Two auditory evoked potential procedures were applied. The results indicated statistically significant differences in evoked potential responses between the genders. The results are interpreted against the background of sensory and neurological sources of the evoked potential responses and linked to the neurophysiological foundations of temperament. Opsomming: Gegrond op aanduidings in die literatuur van ’n assosiasie tussen temperamentskenmerke en die ontlokte potensiaal van die brein, sowel as aanduidings van geslagsverskille in sekere temperamentstrekke, was die doel van die huidige studie om te bepaal of ontloktepotensiaal-response ook tussen die geslagte onderskei. ’n Steekproef van 81 manlike en 210 vroulike studente is ewekansig geselekteer. Twee ouditiewe ontloktepotensiaal- prosedures is toegepas. Die resultate het op statisties beduidende verskille tussen die geslagte gedui. Die bevindinge word teen die agtergrond van die sensoriese en neurologiese oorsprong van ontloktepotensiaal–response geïnterpreteer en verbind aan die neurofisiologiese verankering van temperament.

  3. Comparative study on laser welding and TIG welding of semi-solid high pressure die cast A356 aluminium alloy

    CSIR Research Space (South Africa)

    Govender, G


    Full Text Available components. The low porosity levels in SSM high pressure die castings (HPDC) improves the weldability of these components. The aim of the current research was to perform a comparative study of laser and TIG welding of SSM HPDC aluminium alloy A356. SSM...

  4. James Henry Greathead en die Londense Moltrein

    Directory of Open Access Journals (Sweden)

    Laurence Wright


    Full Text Available Die artikel ondersoek die oorsprong en vroeë geskiedenis van die toestel genaamd die ‘Greathead Skild’, ‘n belangrike nuwigheid in Viktoriaanse ingenieurwetenskap, wat van deurslaggewende belang was in die konstruksie van die Londense Moltrein. Die doel is om die basis te ontleed waarop, baie jare later, ‘n Suid-Afrikaanse ingenieur wye openbare erkenning in die vorm van ‘n standbeeld vir die ‘ontwerp’ van die Skild geniet het. Uit die perspektief van kulturele studies beskou, hoe moet ons uitvinding verstaan, gegewe dat ander briljante ingenieurs ook betrokke was? Hierdie vraag word ontleed met die gebruik van die konsep ‘extelligence’ (Stewart and Cohen 1997, in samehang met ander kontemporêre en geskiedkundige weergawes, insluitend Greathead se eie rekord van sy prestasies in die verrigtinge van die Instituut van Siviele Ingenieurs en voorgelê in The City and South London Railway (1896, onder redaksie van James Forrest. Hierdie artikel is die eerste keer as referaat aangebied by die konferensie oor ‘Nuuthede en Innovasie in die Negentiende Eeu’ aan die Noordwes-Universiteit, Mei 2016.

  5. Euthanasia in patients dying at home in Belgium: interview study on adherence to legal safeguards (United States)

    Smets, Tinne; Bilsen, Johan; Van den Block, Lieve; Cohen, Joachim; Van Casteren, Viviane; Deliens, Luc


    Background Euthanasia became legal in Belgium in 2002. Physicians must adhere to legal due care requirements when performing euthanasia; for example, consulting a second physician and reporting each euthanasia case to the Federal Review Committee. Aim To study the adherence and non-adherence of GPs to legal due care requirements for euthanasia among patients dying at home in Belgium and to explore possible reasons for non-adherence. Design of study Large scale, retrospective study. Setting General practice in Belgium. Method A retrospective mortality study was performed in 2005–2006 using the nationwide Belgian Sentinel Network of General Practitioners. Each week GPs reported medical end-of-life decisions taken in all non-sudden deaths of patients in their practice. GP interviews were conducted for each euthanasia case occurring at home. Results Interviews were conducted for nine of the 11 identified euthanasia cases. Requirements concerning the patient's medical condition were met in all cases. Procedural requirements such as consultation of a second physician were sometimes ignored. Euthanasia cases were least often reported (n = 4) when the physician did not regard the decision as euthanasia, when only opioids were used to perform euthanasia, or when no second physician was consulted. Factors that may contribute to explaining non-adherence to the euthanasia law included: being unaware of which practices are considered to be euthanasia; insufficient knowledge of the euthanasia law; and the fact that certain procedures are deemed burdensome. Conclusion Substantive legal due care requirements for euthanasia concerning the patient's request for euthanasia and medical situation were almost always met by GPs in euthanasia cases. Procedural consultation and reporting requirements were not always met. PMID:20353662

  6. Die rol van die blanke werker in die motivering van die swart werker

    Directory of Open Access Journals (Sweden)

    G. J. Oosthuizen


    Opsomming Die motivering van die Swart werker kan nie in die huidige situasie in isolasie bestudeer word nie, omdat die Blanke werker steeds in die bestuursposisie is en daarom die motivering van die Swart werker kan beïnvloed. Hierdie ondersoek was daarop gerig om die rol van die Blanke werker in die motivering van die Swart werker nader te ondersoek. Die houding en die leierskapsbenadering van die Blanke werker teenoor die Swart werker is gemeet, asook die behoeftes wat volgens die Blanke werker by die Swart werker bestaan, bevredig is, of nie bestaan nie. Die behoeftes van Swart werkers, soos deur hulleself gesien, is ook ondersoek. Ten opsigte van sekere aspekte is beduidende verskille gevind.

  7. Die lewensvatbaarheid van 'n slaghuisfranchise / deur Johan Smit


    Smit, Johan


    Die Suid-Afrikaanse rooivleisindustrie is lomp en wyd. Een van die redes vir hierdie toedrag van sake is die verskeie rolspelers in die industrie. 'n Moontlike oplossing vir hierdie probleem is die vertikale integrasie-sisteem gerugsteun deur 'n lewensvatbare franchise in die kleinhandelsektor. Die studie fokus op die lewensvatbaarheid van 'n slaghuisfranchise. Daar moet egter ook bepaal word of 'n slaghuis wei gefranchise kan word, voordat die lewensvatbaarheid van 'n slaghuisfranchise be...

  8. Comparative Evaluation of Tensile Strength in Die Stone Incorporated with Sodium and Calcium Hypochlorite as Disinfectants: An in vitro Study. (United States)

    Pramodh, N R; Kumar, C N Vijay; Pradeep, M R; Naik, Ravi; Mahesh, C S; Kumari, Manju R


    The aim of this study was to evaluate the tensile strength of die stone incorporated with sodium and calcium hypochlorite as disinfectants. Two commercially available type IV die stone (Kalrock: Kalabhai Karson Pvt., Ltd and Pearlstone: Asian Chemicals) and two commercially available disinfectant solutions (sodium hypochlorite and calcium hypochlorite: Beachem Laboratory Chemical Private Limited, Chennai and Leo Chem Private Limited, Bengaluru) were used in this study, and the tensile strength was measured using Lloyd's Universal Testing Machine. The results show that incorporating the disinfecting solutions decreases the tensile strength of both products. The effect of decreasing tensile strength on type IV gypsum product is seen more in calcium hypochlorite when compared with sodium hypochlorite disinfecting solution, and the tensile strength of Kalrock specimens is higher than Pearlstone specimens after disinfecting with sodium hypochlorite and calcium hypochlorite solution. The statistical results also show significant results in all the groups when compared with the control group. The incorporation of sodium and calcium hypochlorite disinfecting solutions is not an encouraging method for both die materials as it reduces the tensile strength of type IV gypsum product. Tensile strength of Kalstone® die material is superior than Pearlstone® die material after mixing with sodium hypochlorite and calcium hypochlorite. According to the recommendations of Americans with Disability Act (ADA) and the Centers for Disease Control and Prevention, disinfecting the whole cast without or minimal changes in physical and mechanical properties was the motto of the study. The tensile strength in type IV gypsum product plays a most important role in retrieval of cast from impression, especially in narrow tooth preparation. This study reveals that incorporating method of disinfecting solutions is not recommended as it reduces the tensile strength.

  9. a study of attitudes of nurses toward death and dying in tertiary ...

    African Journals Online (AJOL)


    disease/illness. Transition to the terminal stage of care is tension packed and care burden enormous. The nurses should therefore muster the necessary resources to ensure effective control of pain and other symptoms (palliative care) Anarado (2010). The attitudes of nurses toward death and dying patients may influence to.

  10. Modeling the Smartphone Game to Improve Players Focus Case Study of Game Dumb Ways to Die

    Directory of Open Access Journals (Sweden)

    Elisa Purnamasari


    There are a need to find some characteristics of a game which has positive effects for the players. Those characteristics can be formulated as the example of a good game. This paper will analyze the opinion and produce the conclusion from a survey of playing "Dumb Ways to Die to generate a positive game model.

  11. Natural Body Posture of Preference in the Dying Process : An Explorative Observational Study in a hospicesetting

    NARCIS (Netherlands)

    Verboeket-Crul, Cathelijne; Thien, Nynke; Teunissen, SCCM


    Background: All people have different postures while sleeping. Most people will prefer a lateral position. In the last days and hours before dying, patients are usually to be found in a supine position. In literature so far it has never been questioned whether the supine position is the most

  12. Die hervertolking van die paradigma in verband met die ...

    African Journals Online (AJOL)

    Kerkorde van De Mist en die Algemene Reglement van 1816, wat onderskeidelik vir die Kaapse Kerk en die .... Een van die eerstes was Sam Freiherr von Pufendorf (1632-1694) wat in sy werk De habitu religionis ..... Koning was weer aan bewind (vgl Diepenhorst sj:74w; De Visser 1926/1927 lll:202w). 43.1 JD Janssen ...

  13. die heidelbergse kategismus en die kategesemateriaal van die ned

    African Journals Online (AJOL)

    subjek, objek, leerstof en die metodiek van die senior kategese. Bloemfontein: Algemene Jeugkommissie Sondagskoolboekhandel. de rAAd oer ned ger kerken in Zuid AfrikA. 1921. De zevende vergadering: handelinge. 1925. De negende vergadering: handelinge. de villierS, d. W. 1957. Die Kategese in die Ned. Geref.

  14. die sinodale verband van die nederduitse gereformeerde kerk in die

    African Journals Online (AJOL)


    Strauss. Die sinodale verband van die Nederduitse Gereformeerde Kerk. 122 die Vrystaatse Sinode anti-veranderingsgesind of eerder gesond-behoudend of gereformeerd-gematig? Veral as dit .... howe) in moeilike omstandighede gebring is (NG Kerk in die OVS 1865-1912:5). In 'n brief op 8 Augustus 1864 ontken Ds.

  15. Die kerkregtelike posisie van die ouderling en diaken in die ...

    African Journals Online (AJOL)

    ... drie dekades die Kerkreg gevestig as 'n selfstandige vak in die teologiese curriculum, maar ook 'n baie groot rol gespeel daarin dat die beginsels van die kerk like reg beter begryp word. Naas sy wetenskaplike bydrae word met eweveel genoegdoening gedink aan sy bcsondere persoonlikheid, sy werkvermoe, sy humor-.

  16. Incidence of Suicide Among Persons Who Had a Parent Who Died During Their Childhood: A Population-Based Cohort Study. (United States)

    Guldin, Mai-Britt; Li, Jiong; Pedersen, Henrik Søndergaard; Obel, Carsten; Agerbo, Esben; Gissler, Mika; Cnattingius, Sven; Olsen, Jørn; Vestergaard, Mogens


    Parental death from suicide is associated with increased risk of suicide in the bereaved child, but little is known about the long-term risks of suicide after parental death from other causes. A better understanding of this association may improve suicide prevention efforts. To examine the long-term risks of suicide after parental death and how the risk trajectories differed by cause of parental death while accounting for major potential confounding variables. A population-based matched cohort study was performed using information from nationwide registers (data from 1968 to 2008) in 3 Scandinavian countries (for a total of 7,302,033 persons). We identified 189,094 children (2.6%) who had a parent who died before the child reached 18 years of age (ie, the bereaved cohort). Each bereaved child was matched by sex and age to 10 children who did not have a parent who died before they reached 18 years of age (for a total of 1,890,940 children) (ie, the reference cohort). Both cohorts were followed for up to 40 years. Poisson regression was used to calculate the incidence rate ratio (IRR), while accounting for age at parental death, sex, time since bereavement, maternal/paternal death, birth order, family history of psychiatric illness, and socioeconomic status. Data analyses were finalized June 24, 2015. The main exposure was death of a parent within the first 18 years of life. Incidence of suicide among persons who had a parent who died during their childhood. During follow-up, 265 bereaved persons (0.14%) and 1342 nonbereaved persons (0.07%) died of suicide (IRR = 2.02 [95% CI, 1.75-2.34]); IRR = 3.44 (95% CI, 2.61-4.52) for children who had a parent who died of suicide, and IRR = 1.76 (95% CI, 1.49-2.09) for children who had a parent who died of other causes. The IRR tended to be higher for children who had a parent who died before they reached 6 years of age, and the IRR remained high for at least 25 years. During 25 years of follow-up, the absolute risk

  17. Rezension zu: Rebecca Pates, Daniel Schmidt: Die Verwaltung der Prostitution. Eine vergleichende Studie am Beispiel deutscher, polnischer und tschechischer Kommunen. Bielefeld: transcript Verlag 2009.

    Directory of Open Access Journals (Sweden)

    Jenny Künkel


    Full Text Available Die aus dem Forschungsprojekt ‚Verwaltung der Prostitution‘ an der Universität Leipzig heraus entstandene Publikation geht der Frage nach, welche Problemdefinitionen, Kategorisierungen und Wissensbestände lokale Verwaltungsakteure/-innen in Deutschland, Polen und Tschechien der Prostitutionsregulierung zugrunde legen. Die Studie zeigt, dass teilautonomes Verwaltungshandeln Recht nicht nur umsetzt, sondern auch produziert. Durch den Fokus auf die lokale Ebene der Prostitutionsregulierung und durch den staatsethnographischen Zugang ist die Monographie in zweierlei Hinsicht innovativ. Lediglich etwas mehr Informationen zum methodischen Vorgehen sowie ein expliziteres Aufgreifen der theoretischen Konzepte bei der Aufbereitung des empirischen Materials wären wünschenswert gewesen.

  18. Die verband tussen lokus van beheer en die werks prestasie van swart bemarkers in die lewensversekeringsbedryf

    Directory of Open Access Journals (Sweden)

    E. L. Coetzer


    Full Text Available The relationship between locus of control and the work performance of black marketers in the life assurance industry. The aim of the study was to establish the relationship between locus of control and the work performance of black marketers in the life assurance industry. These constructs were selected by virtue of the lack of empirical research regarding the assumed relationship between them. The Locus of Control Scale of Schepers (1995 was used for measuring locus of control. Work performance was measured by the commission earned per month by the marketer, the number of policies generated by the marketer, as well as the percentage of lapsed policies. The relevant measurements were obtained in respect of a sample of 149 black marketing personnel. The results indicated a modest but statistically significant relationship between external locus of control and the work performance of black marketers. Opsomming Die doel van die studie was om die verband tussen lokus van beheer en die werksprestasie van swart bemarkers in die lewensversekeringsbedryf te bepaal. Hierdie konstrukte is gekies op grond van die gebrek aan empiriese navorsing rakende die veronderstelde verband tussen genoemde konstrukte. Die Lokus van Beheer-vraelys van Schepers (1995 is in die meting van lokus van beheer gebruik. Werksprestasie is aan die hand van kommissie per maand verdien, aantal polisse gegenereer deur 'n bemarker en die persentasie vervalde polisse, gemeet. Die tersaaklike metinge is verkry ten opsigte van 'n steekproef van 149 swart bemarkers. Die resultate toon 'n klein, dog statisties beduidende verband tussen eksterne lokus van beheer en die werksprestasie van swart bemarkers in die lewensversekeringsbedryf.

  19. Home to die from the intensive care unit: A qualitative descriptive study of the family's experience. (United States)

    Hutchinson, Amy L; Van Wissen, Kim A


    Many people would choose to die at home, and this can be an option for intensive care patients. However, there is limited exploration of the impact on the family. To gain insight into family members' experiences when an adult intensive care unit patient is taken home to die. Methodology is qualitative description, utilising purposeful sampling, unstructured interviews and thematic analysis. Four participants, from two different families were interviewed. The setting was a tertiary level Intensive Care Unit in New Zealand. The experience was described as a kaleidoscope of events with two main themes: 'value' family member's found in the patient going home, and their experience of the 'process'. 'Value' subthemes: going home being the patient's own decision, home as an end-of-life environment, and the patient's positive response to being at home. 'Process' subthemes: care and support received, stress of a family member being in intensive care, feeling that everything happened quickly, and concerns and uncertainties. Going home to die from the intensive care unit can be a positive but challenging experience for the family. Full collaboration between the patient, family and staff is essential, to ensure the family are appropriately supported. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Riglyne vir die onderwys.

    Directory of Open Access Journals (Sweden)

    J. L. du Plooy


    Full Text Available In die afgelope vyftig jaar sedert die Unie tot stand gekom het, is veel op die gebied van onderwys tot stand gebring. Dit is heel natuurlik dat ’n mens sou vra: Wat van die toekoms?

  1. Bevordering van transformerende leer: Die skryf van ’n reflektiewe joernaal in die Natuurwetenskappe

    Directory of Open Access Journals (Sweden)

    Erna R. du Toit


    Full Text Available Die doel van die artikel is om aan te toon hoe die skryf van ’n reflektiewe joernaal in die Natuurwetenskappe die perspektiewe en denke van onderwysstudente kan transformeer en/of leer kan bevorder. Die studie maak voorspraak vir die gebruik van ’n reflektiewe joernaal as ’n instrument vir studente om betekenis te gee aan die leeromgewing vanuit verskillende perspektiewe deur te leer in praktyk. ’n Kwalitatiewe navorsingsmetode is gevolg om die inskrywings in ’n joernaal te analiseer aan die hand van bepaalde indikatore. Die bevindinge toon dat die meeste studente na die praktykervaring positief was en sommiges het tot ander perspektiewe vanweë hul ervaring gekom.

  2. Studies of the quality and cost-effectiveness of a novel conceptof open-die forged powerplant main shaft

    Directory of Open Access Journals (Sweden)

    P. Skubisz


    Full Text Available An innovatory concept of open-die forging of windmill main shaft is described. Comparative study of the new technology based on the concept of cogging hollow shaft on mandrel featuring material savings and higher quality of a finished part versus traditional production chain of this component is presented, indicating benefits and technological setbacks of industrial implementation. Results of industrial sampling aided with numerical simulation form guidelines for technological realization.

  3. Die partypolitiek en die toekoms van die Afrikaanse volkskultuur

    Directory of Open Access Journals (Sweden)

    A.P. Treurnicht


    Full Text Available Reeds in 1853 het die Zuid Afrikaan hom soos volg uitgelaat: „Dis ’n dwaling wat ons reeds meermale bestry het dat ons as Britse onderdane verplig sou wees, om die Britse nasionaliteit ons s’n te maak. Die Kolonis van Hollandse oorsprong kan geen Engelsman word nie, en moet ook geen Nederlander wil wees nie. Wanneer hy weet om sy standpunt te waardeer, dan sal hy as verligte kolonis die grondtrekke van die Engelse volkskarakter met dié van die Nederlandse harmonies leer verenig en daardeur word wat hy as Kapenaar moet word.”

  4. Die Defects and Die Corrections in Metal Extrusion

    Directory of Open Access Journals (Sweden)

    Sayyad Zahid Qamar


    Full Text Available Extrusion is a very popular and multi-faceted manufacturing process. A large number of products for the automotive, aerospace, and construction sectors are produced through aluminum extrusion. Many defects in the extruded products occur because of the conditions of the dies and tooling. The problems in dies can be due to material issues, design and manufacturing, or severe usage. They can be avoided by maintaining the billet quality, by controlling the extrusion process parameters, and through routine maintenance. Die problems that occur on a day-to-day basis are mostly repairable and are rectified through various types of die correction operations. These defects and repair operations have not been reported in detail in the published literature. The current paper presents an in-depth description of repairable die defects and related die correction operations in metal extrusion. All major die defects are defined and classified, and their causes, preventive measures, and die correction operations are described. A brief frequency-based statistical study of die defects is also carried out to identify the most frequent die corrections. This work can be of direct benefit to plant engineers and operators and to researchers and academics in the field of metal extrusion.

  5. Die Voortrekker-Monument

    Directory of Open Access Journals (Sweden)

    Gerard Moerdyk


    Full Text Available Die Eeufeesjaar is vir die Afrikaner ’n tydperk van besieling. Nog nooit sedert die ontstaan van ons volk het een enkele gebeurtenis soveel nasietrots gewek as die honderdjarige herdenking van die Groot Trek. Vir die eerste keer in ons geskiedenis voel ons ons nie meer Kapenaars, Vrystaters, Natalers, en Transvalers nie, maar Afrikaners, saamgesnoer deur die tradisies van ’n selfstandige kultuurvolk. Wanneer die klimaks van die Ossewatrek met die hocksteenlegging van die Voortrekker-Monument bereik word, sal die besieling nie uitsterf nie, die krag wat geskep is sal bly voortgroei tot ’n onweerstaanbare mag. Die Afrikaner sal homself vind, en as die Monument na sowat vyf jaar onthul word, sal die saad wat in hierdie jaar gesaai is, tot voile rypheid gekom het. Dan sal die Monument self tot die volk spreek; intussen egter, is dit wenslik, nee noodsaaklik selfs, om die Monument aan die Afrikaners te verklaar, om ‘n uiteensetting te gee van die noodsaaklikheid van so ’n Monument, sowel as om die motief te verduidelik wat as inspirasie gedien het vir die ontwerpdaar van.

  6. Calvyn en die kerklike orde: Enkele opmerkings

    African Journals Online (AJOL)

    Om dié saak verder te belig word ook van die latere uitsprake van Calvyn in hierdie verband in berekening gebring. Met hierdie beperkte studie word dus in die eerste plek die feit in herinnering geroep dat dit vanjaar 450 jaar gelede is dat Calvyn se. Institusie die eerste maal in Basel verskyn het. Terselfdertyd word hier-.

  7. Die Britse owerheid en die onderwys op Heidelberg gedurende die ...

    African Journals Online (AJOL)

    The establishment of Christian National Education (CNE) Schools stimulated the concept of mother tongue education. Oor die klaskamerpraktyk en die werklike gehalte van onderrig tydens die kampskooltydperk is daar min bekend. Heidelberg wat na 1902 in 'n belangrike onderwyssentrum in Transvaal ontwikkel het, het ...

  8. Die belangrikste kenmerk van die diereproduksie- bedrywe oor die ...

    African Journals Online (AJOL)

    digdhede teen 1980 uit 'n kudde van 30 rnilj.skape ge- produseer moet word. Tweedens sal die faktore ... die Republiek van Suid-Mrika teen 1980 in totaal 28 milj. sal wees. Indien die produsente dit as 'n ..... Appendix Table 4 in Digestive Physiology and nutrition of ruminants Vol. 3 Ed. and Publ. D.C. Church, Oregon State ...


    African Journals Online (AJOL)

    aanslag op die sogenaamde "Intentional Fallacy", heelwat verder. n. Mens sou hier eintlik ook op die invloed van Lacan se toepassing van. De Sacs sure op Freud moet wys, en op Macherey se Theory of Literary. Production. Barthes is naamlik besig om repressie teen te werk, en die teks as produksieproses in stede van ...

  10. An Experiment Study on Surface Roughness in High Speed Milling NAK80 Die Steel

    Directory of Open Access Journals (Sweden)

    Su Fa


    Full Text Available The paper introduces that the high speed milling experiments on NAK80 die steel was carried out on the DMU 60 mono BLOCK five axis linkage high speed CNC machining center tool by the TiAlN coated tools, in order to research the effect of milling parameters on surface roughness Ra. The results showed that the Ra value increased with the decrease of milling speed vc, increased with the axial depth of milling ap, and feed per tooth fz and radial depth of milling ae. On the basis of the single factor experiment results, the mathematics model for between surface roughness and milling parameters were established by linear regression analysis.

  11. Wêreldmededingendheid en die tegnologie

    Directory of Open Access Journals (Sweden)

    C. W. I. Pistorius


    Full Text Available Afgesien van die interne uitdagings wat die Heropbou- en Ontwikkelingsprogram (HOP aan Suid-Afrika bied, moet die land ook tred hou met die veranderende globale omgewing, spesifiek die toenemende belangrikheid van ekonomiese sekuriteit as komponent van nasionale sekuriteit. Die konsep van mededingendheid vergestalt die doelwit wat nagestreef moet word ten einde die ontluikende globale ekonomiese stryd aan te durf. As ’n belangrike drywer van ekonomiese welvaart is tegnologie een van die belangrikste sleutels tot internasionale mededingendheid. Tegnologiese innovasie is die proses wat as hefboom hiervoor gebruik moet word. Dit is egter nodig dat tegnologie, en spesifiek die proses van tegnologiese innovasie, formeel en gestruktureerd bestuur moet word, sowel op nasionale as firmavlak. Op nasionale vlak is die voorsiene Nasionale Innovasiestelsel beslis ’n stap in die regte rigting.

  12. die ontstaan en die ontwikkeling van die skoolkadette-stelsel in die rsa

    African Journals Online (AJOL)

    toe algemene diensplig ingestel is. Die diens- plig het intussen sy volle beslag gekry en in. Weermagkringe het die gedagte posgevat dat skoolkadette. 'n deeglike ondersoek vereis ten einde die skoolgaande seun vir sy komende nasionale diensplig te orienteer. Tydens kadetopleldlng leer die seuns al die fynere kunsles ...

  13. Van die Gasredakteur

    African Journals Online (AJOL)

    cherish and teach.'1. Die Fakulteit Geneeskunde van die Universiteit van die Oranje-Vrystaat het pragtig gegroei ge- durende die eerste 21 jaar van sy bestaan. Die entoesiasme, doelgerigtheid, harde werk en inisia- tiewe van 'n groot aantal persone was hiervoor verantwoordelik. 'If we see a bit more clearly than they, it is ...

  14. Halfkrone vir die Nagmaal

    African Journals Online (AJOL)


    die omgewing van Velddrif en Laaiplek, ook noordwaarts verby Lambertsbaai tot by. Doringbaai en Strandfontein. “Haar seeverhale is Sussie (Kotze) se belangrikste bydrae tot die Afrikaanse letterkunde”, sê Kotzé-Myburgh in die voorwoord van die versamelbundel. Die leser word herinner aan Kotze se debuutroman, ...

  15. Die uitbeelding van die vrou in Huisgenoot (1963 en 2013: ’n Multimodale diskoersanalise

    Directory of Open Access Journals (Sweden)

    Susann H. Marais


    Full Text Available Die standpunt dat die mens en die media in ’n verhouding van wedersydse beïnvloeding staan, sowel as die studie wat die kulturele konseptualisering van vroulikheid in twee Huisgenoot-uitgawes (1953 en 2003 ondersoek, geld as uitgangspunt vir dié studie. Hierdie studie het ten doel om te bepaal of daar ’n verskil is in die uitbeelding van die vrou in die Huisgenoot uitgawes van onderskeidelik 1963 en 2013. Volgens navorsing werk die visuele beeld en geskrewe teks saam om ’n boodskap oor te dra. Multimodale diskoersanalise (MDA word juis gebruik om beide visuele beeld en geskrewe teks te bestudeer. Sodoende word die metode van intersemiotiese komplementariteit binne MDA in hierdie studie gebruik. Die studie kom tot die gevolgtrekking dat die uitbeelding van die ideale vrou se verantwoordelikhede uitgebrei is, maar dat die vrou se rol tóg tot sekere ruimtes beperk word, soos die sigbaarheid van die moeder-stereotipe weerspieël.

  16. Die teologie in gesprek met die ekonomie

    African Journals Online (AJOL)

    (1723-1790) sy vertrekpunt neem, ontwikkel, as oorwinnaars uit die Franse Revolu .... Die onmiddellike sukses van Adam Smith se 'Wealth of Nations' was .... alle vorme van sosialisme niks anders as 'kommunisme' (Wassenaar 1977:12) nie.

  17. Brief Study and Spanish Translation of Die Kunst das Clavier zu Spielen by Friedrich Wilhelm Marpurg (Berlin, Henning, 1750

    Directory of Open Access Journals (Sweden)

    María de las Nieves Pascual León


    Full Text Available This paper includes the fi rst Spanish version of F. W. Marpurg’s treaty Die Kunst das Clavier zu spielen, which had been restricted for the common Spanish-speaking reader since its fi rst appearance in 1750. This philological translation of the treaty (with the facsimile of the fi rst edition and its Spanish translation on the opposite page is instroduced by a brief study of the text’s various editions published during the author’s life, and pretends to offer an initial approach to the treaty, to facilitate the public’s access to the work and to contribute to its full disclosure.

  18. Die faktore gemeenskaplik aan die selfondersoekvraelys van Holland en die nuwe Suid-Afrikaanse beroepsbelangstellingsvraelys

    Directory of Open Access Journals (Sweden)

    C. Swanevelder


    Full Text Available The factors common to the Self Directed Search of Holland (SDS and the new South African Vocational Interest Inventory (SAVII. The new South African Vocational Interest Inventory was locally developed with the purpose to create a single vocational interest inventory for all population groups in the RSA. In this study the common factors underlying the SDS and the SAVII were determined with the aid of interbattery factor analysis. The results indicate that there are six common factors underlying the two instruments for both the standard nine boys and girls, and that these factors agree with the six factors built into the SDS by Holland. Opsomming Die nuwe Suid-Afrikaanse Beroepsbelangstellingsvraelys (SABBV is plaaslik ontwikkel met die doel om 'n enkele beroepsbelangstellingsvraelys vir alle bevolkingsgroepe binne die RSA, daar te stel. In hierdie studie is daar ondersoek ingestel na die gemeenskaplike faktore onderliggend aan die SABBV en die Selfondersoekvraelys (SOV van Holland met behulp van 'n interbatteryfaktorontleding. Daar is bevind dat daar ses gemeenskaplike faktore onderliggend aan die twee instrumente is vir sowel standerd nege seuns as dogters, en dat hierdie faktore ooreenstem met die ses faktore wat deur Holland in die SOV ingebou is.

  19. Die dogmatiese binding van die prediking

    African Journals Online (AJOL)

    genoemde probleemstelling wat ons homileties na riglyne wil soek, sonder die pretensie dat finale oplossings gevind sal word. Om hierdie probleem te ontleed is dit nodig om eers kortliks 'n begripsbepaling van die begrippe dogma, binding en prediking te maak. Vanuit die begripsbepaling kan ons dan probeer vasstel wat ...


    African Journals Online (AJOL)

    aan dat 'n lewe onder die gesag van God tot volle vrede lei: “In coming under the rule of Yahweh, moreover, life was made whole and safe.” Dit is spesifiek in die tempel waar die volheid van God se vrede ondervind word (1997:662):. The temple is indeed the place where Israel entered into Yahweh's full zone of shalom.

  1. Level of consciousness in dying patients. The role of palliative sedation: a longitudinal prospective study. (United States)

    Claessens, Patricia; Menten, Johan; Schotsmans, Paul; Broeckaert, Bert


    Patients suffering from a terminal illness often are confronted with severe symptoms during the last phase of their lives. Palliative sedation, although one of the options of last resort, remains a much debated and controversial issue and is often referred to as a form of slow euthanasia or euthanasia in disguise. A prospective longitudinal and descriptive design was used. Each patient admitted in one of the 8 participating units was included if they met the inclusion criteria and gave written informed consent. 266 patients were included. The incidence of palliative sedation was 7;5%. For the group of sedated patients results show that 90% entered the palliative care unit being fully conscious. Two patients were comatose upon arrival. 90% of the patients remained fully conscious up to the day palliative sedation was started. When looking at the effect of palliative sedation on the level of consciousness the analysis strongly suggest that the palliative sedation - as expected- has an impact on the GCS score. Irrespective of the dichotomization of the score the probability of having a lower GCS increases substantially once sedation is initiated. Additionally, results show that once palliative sedation is administered, the level of consciousness gradually goes down up until the day of death. Palliative sedation is nor slow euthanasia nor an ambivalent practice. It is an intentional medical treatment which is administered in a proportional way when refractory suffering occurs. It occurs in extraordinary situations and at the very end of the dying process.

  2. Die attach dimension and material on thermal conductivity study for high power COB LED (United States)

    Sarukunaselan, K.; Ong, N. R.; Sauli, Z.; Mahmed, N.; Kirtsaeng, S.; Sakuntasathien, S.; Suppiah, S.; Alcain, J. B.; Retnasamy, V.


    High power LED began to gain popularity in the semiconductor market due to its efficiency and luminance. Nonetheless, along with the increased in efficiency, there was an increased in the junction temperature too. The alleviating junction temperature is undesirable since the performances and lifetime will be degraded over time. Therefore, it is crucial to solve this thermal problem by maximizing the heat dissipation to the ambience. Improvising the die attach (DA) layer would be the best option because this layer is sandwiched between the chip (heat source) and the substrate (channel to the ambient). In this paper, the impact of thickness and thermal conductivity onto the junction temperature and Von Mises stress is analyzed. Results obtained showed that the junction temperature is directly proportional to the thickness but the stress was inversely proportional to the thickness of the DA. The thermal conductivity of the materials did affect the junction temperature as there was not much changes once the thermal conductivity reached 20W/mK. However, no significant changes were observed on the Von Mises stress caused by the thermal conductivity. Material with the second highest thermal conductivity had the lowest stress, whereas the highest conductivity material had the highest stress value at 20 µm. Overall, silver sinter provided the best thermal dissipation compared to the other materials.

  3. Dying cancer patients' own opinions on euthanasia: an expression of autonomy? A qualitative study. (United States)

    Karlsson, Marit; Milberg, Anna; Strang, Peter


    Deliberations on euthanasia are mostly theoretical, and often lack first-hand perspectives of the affected persons. Sixty-six patients suffering from cancer in a palliative phase were interviewed about their perspectives of euthanasia in relation to autonomy. The interviews were transcribed verbatim and analysed using qualitative content analysis with no predetermined categories. The informants expressed different positions on euthanasia, ranging from support to opposition, but the majority were undecided due to the complexity of the problem. The informants' perspectives on euthanasia in relation to autonomy focused on decision making, being affected by (1) power and (2) trust. Legalization of euthanasia was perceived as either (a) increasing patient autonomy by patient empowerment, or (b) decreasing patient autonomy by increasing the medical power of the health care staff, which could be frightening. The informants experienced dependence on others, and expressed various levels of trust in others' intentions, ranging from full trust to complete mistrust. Dying cancer patients perceive that they cannot feel completely independent, which affects true autonomous decision making. Further, when considering legalization of euthanasia, the perspectives of patients fearing the effects of legalization should also be taken into account, not only those of patients opting for it.

  4. n Oorsig van die huidige stand van navorsing oor die

    African Journals Online (AJOL)


    7 Jun 2011 ... Die eerste maal wat dit as deel van die teks van 1 Johannes aangehaal word, is in die. 4de eeu in 'n Latynse teks, Liber Apologeticus (hf 4). Eers aan die einde van die 16de eeu is dit in 'n amptelike Katolieke uitgawe van die Vulgaat ingesluit. Die doel van die Johannesbriewe. Waarom is die Briewe ...

  5. Die Ware Buch und die Philologie

    Directory of Open Access Journals (Sweden)

    Bernhard Hurch


    Full Text Available Die im 19. Jahrhundert sich verändernden Produktionsbedingungen für Druckwerke (Buchdruck, Satz, Papier, Bindung wirkten katalysierend auf die Fachkonstitution und Institutionalisierung der Philologien. Hier steht der tatsächliche Buchmarkt im Vordergrund der Darstellung, das Käuferpublikum und die Voraussetzungen des Vertriebs. Dazu gehören auch die Rezension als entstehende Textsorte und die rasch arbeitenden Rezensionsorgane. F.-R. Hausmann wurde in den letzten Jahren unentbehrlicher Mitarbeiter dieses im Rahmen des Grazer Schuchardt-Projekts "Netzwerk des Wissens" angesiedelten Ansatzes.

  6. Die stand van wiskundeonderwys in Afrikaanse skole

    Directory of Open Access Journals (Sweden)

    Gerrit Stols


    Full Text Available Hoërordedenkvaardighede is noodsaaklike basiese vaardighede vir die een-en-twintigste eeu aangesien rekenaars berekeninge en algoritmes baie vinniger en akkurater kan doen as mense. Dit beteken dat skole leerders moet toerus om logies te dink, patrone te ontdek, bewyse te lewer, asook om nieroetineprobleme op te los. Hierdie fasette wat as hoërordedenke geklassifiseer word, is die kern van wiskundige denke en ontwikkeling. Suid-Afrika neem aan verskeie internasionaal vergelykende studies deel. Met behulp van hierdie vergelykende studies kan bepaal word hoe die Afrikaanse wiskundeleerders in Suid-Afrika se prestasie met dié van leerders in ander lande vergelyk en ook wat die tekortkominge in die wiskundeonderwys is. Volgens die 2003-TIMSS-uitslae is die probleem in Afrikaanse skole juis dié vrae wat hoërordedenke vereis. Dit beteken dat die Afrikaanse skole ’n doelbewuste poging sal moet aanwend om hoërordedenke te ontwikkel. Die 1999-TIMSS-videostudie toon dat die lande wat die beste presteer, soos Japan, tydens onderrig meer tyd wy aan die ontwikkeling van begripsvorming en aan die oplos van moeiliker probleme. Die fokus in die presterende lande is op die ontwikkeling van hoërordedenke deur probleemoplossing. Daar word dus minder tyd afgestaan aan herhaling van roetine- of soortgelyke oefeninge wat ’n rekenaar ook kan doen. Die omgekeerde hiervan is ’n tipiese verskynsel in Afrikaanse skole, waar ’n onderwyser byvoorbeeld een of meer voorbeelde op die bord doen waarna die leerders ’n hele aantal soortgelyke roetine-oefeninge doen.

  7. Die waarde van voorafopleiding deur die ouer vir pedo-oudiometrie by drie- en vierjarige kleuters

    Directory of Open Access Journals (Sweden)

    Merisa Lodewyckx


    Full Text Available Die verkryging van akkurate, betroubare inligting aangaande die gehoorvermoë van jong kinders is van besondere belang vir die oudioloog, maar word dikwels bemoeilik aangesien die kleuter nie goeie samewerking bied in die vreemde pedo-oudiometriese situasie nie. Die oplossing hiervoor is grootliks geleë in die opleiding van die kind voor formele  gehoortoetsing en meer spesifiek  opleiding tuis deur die ouer. Die doel van hierdie studie was om 'n voorbereidende program op te stel wat die ouer tuis met die kind kan uitvoer, voordat formele  toetsing plaasvind. Die waarde en effek van hierdie program in die pedo-oudiometriese situasie is geevalueer by 'n groep drie- en vierjarige kleuters. Resultate dui daarop dat laer en meer akkurate drempels, 'n korter toetstydperk, verminderde angs en beter samewerking verkry is by die kleuters wat vooraf  opleiding ontvang het. Die opleidingsprogram kan dus in die kliniese praktyk benut word as voorafopleiding  vir pedo-oudiometrie.

  8. A Case Study in Analysing Digitised Archive Data: Authors at the Comédie-Italienne, 1760-70

    Directory of Open Access Journals (Sweden)

    Jessica Goodman


    Full Text Available The use of ‘big data’ in the humanities is becoming increasingly prevalent, as researchers try to exploit the capacities of modern computing to provide new perspectives on and access to more traditional forms of documentation. In this vein, two major projects currently seek to digitise and analyse the financial records of the major Parisian theatres in the eighteenth century, creating searchable databases that promise to bring the information to worldwide audiences and allow entirely new types of analysis. This article uses a small-scale study of a subset of the Comédie-Italienne’s administrative records in the period 1760-70 to explore the potential benefits and challenges of such enterprises. It makes new data on audience, takings and authorial payments for this decade freely available to readers, and examines the process of capturing and rationalising data drawn from early modern records. To demonstrate the potential of the larger projects, this subset of data is then used both to reconsider the commercial status of the Comédie-Italienne with respect to its French counterpart, and to provide the first account of the finances of the authors who wrote for the Italian troupe. Finally, this article argues that despite the many and varied benefits of digitisation and computational manipulation of archive data, in order for such projects to make a serious contribution to scholarship, it is vital that the material, contingent, human element of original records is not lost.

  9. Thermal Neutron Die-Way-Time Studies for P and DGNAA of Radioactive Waste Drums at the MEDINA Facility

    Energy Technology Data Exchange (ETDEWEB)

    Mildenberger, Frank; Mauerhofer, Eric [Institute of Energy and Climate Research - Nuclear Waste Management and Reactor Safety, Forschungszentrum Juelich GmbH, 52425 Juelich (Germany)


    In Germany, radioactive waste with negligible heat production has to pass through a process of quality checking in order to check its conformance with national regulations prior to its transport, intermediate storage and final disposal. Additionally to its radioactive components, the waste may contain non-radioactive chemically toxic substances that can adversely affect human health and pollute the environment, especially the ground water. After an adequate decay time, the waste radioactivity will become harmless but the non-radioactive substances will persist over time. In principle, these hazardous substances may be quantified from traceability and quality controls performed during the production of the waste packages. As a consequence, a research and development program was initiated in 2007 with the aim to develop a nondestructive analytical technique for radioactive waste packages based on prompt and delayed gamma neutron activation analysis (P and DGNAA) employing a DT-neutron generator in pulsed mode. In a preliminary study it was experimentally demonstrated that P and DGNAA is suitable to determine the chemical composition of large samples. In 2010 a facility called MEDINA (Multi Element Detection based on Instrumental Neutron Activation) was developed for the qualitative and quantitative determination of nonradioactive, toxic elements and substances in 200-l steel drums. The determination of hazardous substances and elements is generally achieved measuring the prompt gamma-rays induced by thermal neutrons. Additional information about the composition of the waste matrix could be derived measuring the delayed gamma-rays from short life activation products. However a sensitive detection of these delayed gamma-rays requires that thermal neutrons have almost vanished. Therefore, the thermal neutron die-away-time has to be known in order to achieve an optimal discrimination between prompt and delayed gamma-ray spectra acquisition. Measurements Thermal neutron

  10. Die vrede van Münster / Westfale en die betekenis daarvan vir die ...

    African Journals Online (AJOL)

    In die Suid-Afrikaanse kerkgeskiedenis egter is die Vrede van Münster as epogmakende gebeure tot dusver nie net in die algemeen verwaarloos nie, maar boonop is die direkte verband tussen hierdie sentrale historiese baken aan die een kant en aan die ander kant die vestiging van die VOC se verversingspos aan die ...

  11. Artikel 2 van die Nederlandse Geloofsbelydenis as geloofsvooronderstelling in die gesprek tussen wetenskap en geloof

    Directory of Open Access Journals (Sweden)

    Jan A. Erasmus


    Full Text Available Artikel 2 van die Nederlandse Geloofsbelydenis bely dat God deur twee middele geken word, te wete deur middel van die skepping, onderhouding en regering van die wêreld (waaronder die wetenskap en deur die heilige en goddelike Woord (die Bybel. Hierdie belydenis is van groot belang vir die gesprek tussen Wetenskap en Teologie. In hierdie artikel word gepoog om die verskille, maar ook die ooreenkomste tussen hierdie twee middele van openbaring uit te lig, elkeen tot sy reg te laat kom, maar hulle ook in balans met mekaar te stel. Die wyse waarop te werk gegaan word, is die volgende: eers word gestel wat vooronderstellings is, asook die plek wat vooronderstellings in die beoefening van wetenskap sowel as geloof inneem. Daarna word nagevors watter perspektiewe artikel 2 van die Nederlandse Geloofsbelydenis as geloofsvooronderstelling vir die wetenskaps- en teologiebeoefening respektiewelik bied. Hieruit word ’n aantal gevolgtrekkings gemaak wat kan help om die problematiek in die wetenskap-geloofsgesprek op te los. Die kernbevinding van hierdie artikel is die volgende: Vanweë die verskil in die aard en die doel tussen Bybelfeite en wetenskaplike navorsingsresultate kan en sal klaarblyklike harmonieprobleme tussen die Skrif en die wetenskap ontstaan. Hierdie is egter slegs klaarblyklike probleme, omdat ’n verrekening van die verskil in die aard en die bedoeling van die wetenskapresultate en die Bybelfeite hierdie probleem sal oplos. Article 2 of the Belgic Confession as faith presupposition in the science-faith debate. Article 2 of the Belgic Confession confesses that God can be known by two means: firstly by studying the creation, preservation and government of the universe (i.e. science and secondly by studying the Word of God (the Bible. This confession is very important for the discussion between science and faith. In this article the similarities, but also the differences between these two means of revelation are researched. The aim is to

  12. Tegnologie en die mens

    African Journals Online (AJOL)

    omgewingsbesoedeling, volgend op industrialisasie en verstedeliking, gee uit- ing tot krete van wanhoop en frustrasie. Die maatskaplike ontwrigting agv outomatisasie het die begrippe van vervreemding en naam- loosheid op die voorgrond van sosiale be- wustheid geplaas. • Die Neutrale Siening. Tegnologie was nag. 34.


    African Journals Online (AJOL)

    15 Mei 2010 ... Biezeveld, de Boer, Brümmer, Muis. 2001; Brown 2006; Durand 2007). ... Wanneer sal hy weer in God se teenwoordigheid verskyn (vers 3)? Dié vraag is vol onsekerheid. (Schuman 2004:8). Sy onsekerheid ... God se volk en die enkeling in die geskiedenis het al die trou van God ervaar waarop die digter ...

  14. Varswateralge en die ekonomie

    Directory of Open Access Journals (Sweden)

    W. E. Scott


    Full Text Available Die artikel bespreek die ekonomiese belong wat varswateralge alreeds het en hul moontlike verdere ontginning in die toekoms. Sowel gewenste as ongewenste aspekte word oorweeg en hoofsaaklik met voorbeelde uit Suid-Afrika geïllustreer. Die oormatige ontwikkeling van ongewenste alge in varswater verlaag die watergehalte dear verskeie chemiese veranderinge, wat kan wissel van smake en geure tot die produksie van verbindings wat gesondheidsgevare vir mens of dier inhou. Verwydering van ongewenste alge dra aansienlik by tot die koste van waterbehandeling. Oormatige alggroei belemmer ontspanningsgebruike en kan eiendomswaardes langs rivier- en damoewers beïnvloed.

  15. Die spacer thickness reproduction for central incisor crown fabrication with combined computer-aided design and 3D printing technology: an in vitro study. (United States)

    Hoang, Lisa N; Thompson, Geoffrey A; Cho, Seok-Hwan; Berzins, David W; Ahn, Kwang Woo


    The inability to control die spacer thickness has been reported. However, little information is available on the congruency between the computer-aided design parameters for die spacer thickness and the actual printout. The purpose of this study was to evaluate the accuracy and precision of the die spacer thickness achieved by combining computer-aided design and 3-dimensional printing technology. An ivorine maxillary central incisor was prepared for a ceramic crown. The prepared tooth was duplicated by using polyvinyl siloxane duplicating silicone, and 80 die-stone models were produced from Type IV dental stone. The dies were randomly divided into 5 groups with assigned die spacer thicknesses of 25 μm, 45 μm, 65 μm, 85 μm, and 105 μm (n=16). The printed resin copings, obtained from a printer (ProJet DP 3000; 3D Systems), were cemented onto their respective die-stone models with self-adhesive resin cement and stored at room temperature until sectioning into halves in a buccolingual direction. The internal gap was measured at 5 defined locations per side of the sectioned die. Images of the printed resin coping/die-stone model internal gap dimensions were obtained with an inverted bright field metallurgical microscope at ×100 magnification. The acquired digital image was calibrated, and measurements were made using image analysis software. Mixed models (α=.05) were used to evaluate accuracy. A false discovery rate at 5% was used to adjust for multiple testing. Coefficient of variation was used to determine the precision for each group and was evaluated statistically with the Wald test (α=.05). The accuracy, expressed in terms of the mean differences between the prescribed die spacer thickness and the measured internal gap (standard deviation), was 50 μm (11) for the 25 μm group simulated die spacer thickness, 30 μm (10) for the 45 μm group, 15 μm (14) for the 65 μm group, 3 μm (23) for the 85 μm group, and -10 μm (32) for the 105 μm group. The

  16. Prediking aan die hand van die metafoor van fiksieskryf

    African Journals Online (AJOL)


    HTS 64(3) 2008 siening van die self en waarheid. In die pre-moderne paradigma kan die dominante metafoor verstaan word aan die hand van 'n spieël wat die lig uit 'n transendente oorsprong weerkaats, terwyl die moderne paradigma uitgedruk word met die metafoor van 'n lamp wat 'n eie, oorspronklike lig binne die self.


    African Journals Online (AJOL)


    ENGELBRECHT ver antwoordelik vir die Ou-Testamentiese vakke en Hebreeus. Die aan stelling van 'n derde professor het noodsaaklik geword, want dit sou. 85 .... De .Spreuken ran 5a/o?no omvat die nuwe vertaling en die ekse gese van die eerste 24 hoofstukke van die Spreukeboek. Die geskoold- heid in die Semitiese ...

  18. Die dialogiese prinsipe

    Directory of Open Access Journals (Sweden)

    J. J. de Klerk


    Full Text Available Met die dialogiese prinsipe word daardie beginsel bedoel, waarin die tweerigtingverkeer of kommunikasie onder, of met, of deur die mense op 'n heel besondere gesprekmatige wyse gere�l word. Tot die wese van die dialogiese prinsipe behoort "als Grundvoraussetzung das Ernstnehmen des Gesprachspartners und das darin enthaltene zuhoren-konnen. Dialog ist also etwas anderes als Disput oder Diskussion. Er setzt gegenseitiges Vertrauen und Hochachtung voraus."

  19. Die identifisering van maatstawwe vir die navorsingsprestasie van akademici

    Directory of Open Access Journals (Sweden)

    H. A. Labuschagne


    Full Text Available Identification of criteria for academic research performance. At South African universities, the achievement of objectives is usually measured in terms of so-called "process criteria" (e.g. pass rates, instead of performance criteria which reflect the quality of academic personnel. Stimulated by the need to identify valid indices of research performance, as a component of academic performance, this study investigated the dimensionality of several criteria, identified from empirical and literature studies. It was found that various valid criteria could be represented by six constructs, viz.: the stature of the researcher as scientist; scientific contributions; enhancement of own profession; community development; participation in research projects; and giving advice to persons or institutions outside the university. Opsomming By Suid-Afrikaanse universiteite word doelwitbereiking gewoonlik aan die hand van sogenaamde "prosesmaat-stawwe" (bv. slaagsyfers in plaas van prestasiemaatstawwe wat die gehalte van akademiese personeel weerspieel, gemeet. Na aanleiding van 'n behoefte aan die identifisering van geldige rigtingwysers vir navorsingsprestasie as 'n komponent van akademiese prestasie, is daar ondersoek ingestel na die dimensionaliteit van verskillende maatstawwe wat vooraf deur middel van empiriese- en literatuurstudies geidentifiseer is. Daar is gevind dat verskeie geldige maatstawwe deur ses konstrukte verteenwoordig word, te wete: die statuur van die navorser as wetenskaplike, wetenskaplike bydraes, uitbouing van eie professie, gemeenskapsontwikkeling, deelname aan navorsingsprojekte en advieslewering aan persone of instellings buite die Universiteit.

  20. Awareness of dementia by family carers of nursing home residents dying with dementia: a post-death study. (United States)

    Penders, Yolanda W H; Albers, Gwenda; Deliens, Luc; Vander Stichele, Robert; Van den Block, Lieve


    High-quality palliative care for people with dementia should be patient-centered, family-focused, and include well-informed and shared decision-making, as affirmed in a recent white paper on dementia from the European Association for Palliative Care. To describe how often family carers of nursing home residents who died with dementia are aware that their relative has dementia, and study resident, family carer, and care characteristics associated with awareness. Post-death study using random cluster sampling. Structured questionnaires were completed by family carers, nursing staff, and general practitioners of deceased nursing home residents with dementia in Flanders, Belgium (2010). Of 190 residents who died with dementia, 53.2% of family carers responded. In 28% of cases, family carers indicated they were unaware their relative had dementia. Awareness by family carers was related to more advanced stages of dementia 1 month before death (odds ratio = 5.4), with 48% of family carers being unaware when dementia was mild and 20% unaware when dementia was advanced. The longer the onset of dementia after admission to a nursing home, the less likely family carers were aware (odds ratio = 0.94). Family carers are often unaware that their relative has dementia, that is, in one-fourth of cases of dementia and one-fifth of advanced dementia, posing considerable challenges for optimal care provision and end-of-life decision-making. Considering that family carers of residents who develop dementia later after admission to a nursing home are less likely to be aware, there is room for improving communication strategies toward family carers of nursing home residents. © The Author(s) 2014.


    African Journals Online (AJOL)

    1 Aug 1978 ... dan ook aangebied, Agv die probleem wat ont- staan het met die gebrek aan goedgekeurde poste vir die Afdeling en as gevolg van die ver- wagte vertraging met die ondersoek van die. DOS-span, het die Afdeling Logistiek en Afde- ling Personeel oorleg gepleeg en laasgenoemde het ingestem dat die ...

  2. Film Presentation: Die Urknallmaschine

    CERN Multimedia

    Carolyn Lee


    Die Urknallmaschine, an Austrian film by Gerd Baldauf, narrated by Norbert Frischauf (Alpha Österreich - ORF, 2009).  In CERN’s gigantic complex particles are accelerated to almost the speed of light, brought to collision and made to divide into even smaller particles. Public opinion of CERN’s research is also divided. Sceptics fear that black holes may be created. Might the goal to study the origin of the world lead to its destruction? The Austrian researcher Norbert Frischauf worked at CERN for many years. With his guidance it is possible to explore the world’s largest research centre, get a glimpse of the fascinating work the scientists do there and take a crash course in particle physics. Die Urknallmaschine will be presented on Friday, 25 June from 13:00 to 14:00 in the Main Auditorium. Language: German

  3. Die effek van intelligensie op die verhouding tussen lokus van kontrole en taakkompleksiteit

    Directory of Open Access Journals (Sweden)

    F. G. de Kock


    Full Text Available The effect of intelligence on the relationship between locus of control and task complexity. The aim of the study was to establish the effects of intelligence on the relationship between locus of control and task complexity. These constructs were selected by virtue of their importance in the literature, as well as the lack of empirical research regarding the assumed relationship which exists between them. The Human Sciences Research Council's (HSRC General Scholastic Aptitude Test (ASAT was used for measuring intelligence, Duttweiler's Internal Control Index (ICI was used for determining locus of control and the Raven's Advanced Progressive Matrices (APM was used as a criterion for coping with task complexity. These instruments were administered to 292 subjects to determine whether the relationship between locus of control and task complexity was effected when the effect of intelligence was controlled. The results indicated a significant relationship between locus of control and task complexity, however the relationship was no longer significant after the effect of intelligence was controlled. Opsomming Die doel van die studie was om die effek van intelligensie op die verhouding tussen lokus van kontrole en taak-kompleksiteit te ondersoek. Hierdie konstrukte is gekies na aanleiding van hulle belangrikheid in die literatuur asook die leemte in empiric se navorsing rakende die veronderstelde verband wat tussen hulle bestaan. Die Algemene Skolastiese Aanlegtoets (ASAT van die Raad vir Geesteswetenskaplike Navorsing (RGN is gebruik vir die meting van intelligensie, die Internal Control Index (ICI van Duttweiler is gebruik vir die meting van lokus van kontrole en die Advanced Progressive Matrices (APM van Raven is gebruik as maatstaf vir die bantering van taakkompleksiteit. Die genoemde meetinstrumente is op 292 proefpersone toegepas om te bepaal of die verband tussen lokus van kontrole en taakkompleksiteit geaffekteer word wanneer daar vir die effek

  4. Annual report references to dog longevity studies in which all dogs have died

    Energy Technology Data Exchange (ETDEWEB)

    Boecker, B B


    All of the dogs in several of the-lifespan studies with beta-emitting radionuclides are dead. Routine annual summaries of these studies have been discontinued. To aid the reader interested in obtaining further information, this report provides summaries of the final status of each study and lists all previous ITRI Annual Report references for each study. (author)

  5. Annual report references to dog longevity studies in which all dogs have died

    International Nuclear Information System (INIS)

    Boecker, B.B.


    All of the dogs in several of the-lifespan studies with beta-emitting radionuclides are dead. Routine annual summaries of these studies have been discontinued. To aid the reader interested in obtaining further information, this report provides summaries of the final status of each study and lists all previous ITRI Annual Report references for each study. (author)

  6. Die relevansie van die boek Prediker

    African Journals Online (AJOL)

    ook in die dogmatiek te bespeur is nie. 'n Vinnige oorsig oor die teksverwysings van. 'n paar wydgelese dogmatiekhandboeke kan dit bevestig. In Karl Barth se omvang- ryke Kirchliche Dogmatik word Prediker slegs vyf en dertig maal aangehaal en slegs sewe maal word teksgedeeltes bespreek. Emil Brunner haal Prediker ...

  7. Influence of Training on First-Year Nursing Department Students' Attitudes on Death and Caring for Dying Patients: A Single-Group Pretest-Posttest Experimental Study. (United States)

    Cerit, Birgül


    The study examined the influence of training on first-year nursing department students' attitudes on death and caring for dying patients. Utilizing the experimental model, the study sample consisted of 81 first-year students attending the nursing department of a university. Death Attitude Profile-Revised and Frommelt Attitude toward Care of the Dying Scale were used for data collection. Data analysis included means, standard deviation, and t test for related samples. Student attitudes toward death were measured as 146.43 (16.741) and 152.75 (15.132) for pre- and posttraining, respectively. Student attitudes toward caring for dying patients were established to be 103.02 (7.655) during pretraining period and 111.02 (10.359) at posttraining period. The difference between pre- and posttests for mean attitudes toward death and caring for the dying patient was statistically significant. Study results determined that training was effective in forming positive student attitudes toward death and caring for dying patients.

  8. Moderator veranderlikes en differensiele geldigheid van die aansoekvorm

    Directory of Open Access Journals (Sweden)

    A. de Bod


    Empiriese studies toon dat die Geweegde Aansoekvorm (G.A.V. 'n doeltreffende voorspellingsinstrument in personeelseleksie is. Daar is egter studies wat voorspel dat die voorspellingsgeldigheid van die G.A.V. in die literatuur aansienlik oorbeklemtoon word. Teenstrydig met die beginsels van klassieke psigometriese teorie word voorgestel dat moderator veranderlikes vir hierdie paradoks verantwoordelik is. Hierdie studie toon hoe die biografiese korrelate van dienstyd as moderators fungeer en empiriese bewys van die modererende effek op die voorspellingsgeldigheid van die G.A.V. word gelewer. Daar word voorgestel dat ‘n nuwe benadering tot die ontwikkeling van die G.A.V. noodsaaklik is ten einde die effek van moderators te benut.

  9. Physicians' willingness to grant requests for assistance in dying for children: a study of hypothetical cases

    NARCIS (Netherlands)

    Vrakking, A.M.; Heide, van der A.; Looman, C.W.; Delden, van J.J.M.; Philipsen, B.D.; Maas, van der P.J.; Wal, van der G.


    OBJECTIVE: To study the willingness of Dutch physicians to use potentially life-shortening or lethal drugs for severely ill children. STUDY DESIGN: We asked 63 pediatricians about their approach to 10 hypothetical cases of children with cancer. The age of the child (15, 11, or 6 years), the child's

  10. Factors associated with dying at the place of wish: a cross-country comparison of cancer patients with the EURO SENTI-MELC Study 2009-2010.

    NARCIS (Netherlands)

    Ko, W.; Miccinesi, G.; Beccaro, M.; Vanthomme, K.; Donker, G.A.; Onwuteaka-Philipsen, B.; Alonso, T.V.A.V; Deliens, L.; Block, L. van den


    Aims: 1) To study demographic and clinical factors associated with dying at a preferred place for cancer patients 2) To study cross-country differences in the intensity of factors Methods: A mortality follow-back study was undertaken in 2009-2010 via representative nationwide networks of general

  11. The German uranium miners study. Knowledge for radiation protection; Die deutsche Uranbergarbeiterstudie. Erkenntnisse fuer den Strahlenschutz

    Energy Technology Data Exchange (ETDEWEB)

    Kreuzer, Michaela; Schnelzer, Maria [Bundesamt fuer Strahlenschutz, Salzgitter (Germany). Fachbereicih fuer Strahlenschutz und Gesundheit


    The Wismut cohort comprises about 60.000 former Wismut employees. Due the size and the large surveillance time from 1946 to 2013 the German uranium miners study is of high significance and worldwide unique.

  12. Die rol van persoonlikheidstrekke in die weerstand teen stres

    Directory of Open Access Journals (Sweden)

    Sonja V. R. van Oudtshoorn


    Full Text Available The role of personality characteristics in resistance to stress: A study was conducted to establish whether certain personality characteristics contribute to resistance to stress. Rescue brigadesmen, performing dangerous rescue operations in the goldmining industry, served as basis for the study. The sample consisted of 63 current, 56 ex- and 50 non-brigadesmen. Results indicate that brigadesmen, on the basis of their personality structure, are better equipped to cope with stress. Scores on the 16PF show that they have a lower level of interpersonal anxiety (Factor Q4 and that they are more practical (Factor I, emotionally stable (Factor C, and conscientious (Factor G. These findings support existing knowledge of the 16PF. Opsomming Ten einde vas te stel ofdaar sekere persoonlikheidstrekke bestaan wat bydra tot weerstand teen stres, is 'n studie uitgevoer met reddingspanlede, wat lewensgevaarlike reddingsdiens in die goudmynbedryf verrig, as ondersoekgroep. Die streekproefhet uit 63 huidige, 56 oud-reddingspanlede en 50 amptenare, wat nog nooit aan die span behoort het nie, bestaan. Dit blyk dat reddingspanlede, op grond van hulle persoonlikheidstruktuur, beter toegerus is om stres te hanteer. Tellings op die 16PF toon dat hulle oor 'n laervlakvan interpersoonlike angs beskik, (Faktor Q4, dat hulle meer prakties (Faktor I, emosioneel stabiel (Faktor C en konsensieus is (Faktor G. Hierdie bevindinge sluit aan by die reeds bestaande kennis oor die 16PF.


    African Journals Online (AJOL)


    DIE ONTVC'ERP VAN 'N SENDINGBELEID IN DIE. HUIDIGE SITUASIE. Sending is 'n deel van die vervulling van die apostoliese opdrag van die kerk. Dit geskied op grond van en in gehoorsaamheid aan Gods. \\C'oord. Teologiese besinning is daarom die eerste en grondliggende vereiste by die ontwerp van 'n ...

  14. Die vier Social-Media-Typen in der Wissenschaft. Ergebnisse einer bundesweiten Studie

    Directory of Open Access Journals (Sweden)

    Ostrzinski, Ulrike


    Full Text Available [english] ZB MED and its partners within the Leibniz Research Alliance Scienc participated in a nationwide study involving academics and researchers from universities and Leibniz Association research institutions. The purpose was to examine the use of social media tools. One of the key goals was to learn more about the usage patterns and behaviours of target groups, and the study has provided some important pointers to assist in this task. The preliminary part of the study identified four types of social media user who display significantly different patterns of behaviour in their use of and attitudes toward social web applications. The poster shows the figures for researchers working in the fields of medicine and life sciences – the main user group of ZB MED.

  15. Residents Learning from a Narrative Experience with Dying Patients: A Qualitative Study (United States)

    Tait, Glendon R.; Hodges, Brian D.


    For patients at the end of life, it is crucial to address the psychological, existential, and spiritual distress of patients. Medical education research suggests trainees feel unprepared to provide the whole person, humanistic care held as the ideal. This study used an empirically based narrative intervention, the dignity interview, as an…

  16. Sodomie, gender studies und die baltische Geschichte : Anmerkungen zu einer schwedischen Dissertation / Aivar Põldvee

    Index Scriptorium Estoniae

    Põldvee, Aivar, 1962-


    Arvustus: Sjödin Lindenskoug, Susanna. Manlighetens bortre gräns : tidelagsrättegångar i Livland åren 1685-1709. (Stockholms Studie in history, 94 ; Södertörn doctoral dissertations, 55). Stockholm, 2011

  17. (2008) SWJ:21-25 Comparative Studies On the Dying rate Migration

    African Journals Online (AJOL)

    Dr. Ahmed

    COMPARATIVE STUDIES ON DYEING RATE MIGRATION AND WASH FASTNESS PROPERTIES OF AZO DYES. DERIVED FROM ..... The dyeing of Cellulose Fibres Publication thrust,. London. Standard methods for determination of fastness properties of textiles and leather, 4th Edition. 1978. Soceity of dyers and ...


    African Journals Online (AJOL)


    Sy moet hierdie opdrag uitvoer deur mid del van die Prediking d.w.s. deur middel van die Woord-vorm, maar ook deur die bediening van die sakramente, dws. deur middel van die vorm van die Daad. Maar nou wil God nie hê dat die Kerk slegs één maal die Evangelie sal predik en die mense sal doop om hulle daarna.

  19. Packaged die heater (United States)

    Spielberger, Richard; Ohme, Bruce Walker; Jensen, Ronald J.


    A heater for heating packaged die for burn-in and heat testing is described. The heater may be a ceramic-type heater with a metal filament. The heater may be incorporated into the integrated circuit package as an additional ceramic layer of the package, or may be an external heater placed in contact with the package to heat the die. Many different types of integrated circuit packages may be accommodated. The method provides increased energy efficiency for heating the die while reducing temperature stresses on testing equipment. The method allows the use of multiple heaters to heat die to different temperatures. Faulty die may be heated to weaken die attach material to facilitate removal of the die. The heater filament or a separate temperature thermistor located in the package may be used to accurately measure die temperature.

  20. Die radio in Afrika

    Directory of Open Access Journals (Sweden)

    S. de Villiers


    Full Text Available Omvang van radio-uitsendings in en na Afrika. — Redes vir die versnelde tempo van uitbreiding. — Radio as die geskikste massa-kommunikasiemiddel vir Afrika. — Faktore wat die verspreiding bemoeilik. — Skouspelagtige toename in luistertalle.Toe Plinius, wat in die jaar 79 oorlede is, in sy „Historia Naturalis” verklaar het dat daar altyd iets nuuts uit Afrika afkomstig is, kon hy nouliks voorsien het dat die „iets" negentien eeue later in die lug sou setel wat hierdie reuse-vasteland oorspan — ’n Babelse spraakverwarring en ’n ongekende, verbete woorde-oorlog in die etergolwe, onder meer daarop bereken om die harte en hoofde van derduisendes te verower.

  1. Die kortikale Verarbeitung semantischer Domänen : eine ERP-Studie


    Wengenroth, Alexandra


    From a semantic point of view concrete nouns can be divided into different categories or domains such as living - non-living as well as into different lexical hierarchies (e.g. dog - beagle). Psycholinguistic and aphasiological case studies as well as neurophysiological investigations have shown that distinct semantic categories can be selectively damaged or show advantages in processing. However, these mental lexicon structures are still sketchy with regard to psycho- and neurolinguistics. I...

  2. Study of the upper die clamping conditions in the small punch test

    Czech Academy of Sciences Publication Activity Database

    Andrés, D.; Dymáček, Petr

    86A, DEC (2016), s. 117-123 ISSN 0167-8442 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : Small punch test * Finite element method * Parametric study * High temperature * Creep Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 2.659, year: 2016

  3. Families' experiences with patients who died after assisted suicide: a retrospective interview study in southern Switzerland. (United States)

    Gamondi, C; Pott, M; Payne, S


    In Switzerland, if certain conditions are met, assisted suicide is not prosecuted. International debate suggests that requests for hasten death are often altered by the provision of palliative care. Aims of the study were to explore patients' reasons for choice of assisted suicide and family perceptions of the interactions with health care professionals. This is a qualitative study upon 11 relatives of 8 patients cared for by a palliative care team, deceased of assisted suicide. Pain and symptom burden were not regarded by patients as key reasons to seek assisted suicide: existential distress and fear of loss of control were the determinants. Most patients had made pre-illness decisions to use assisted suicide. A general need for perceived control and fear of dependency were reported as a common characteristic of these patients. Patients held misunderstandings about the nature and purpose of palliative care, and the interviewed indicated that patients did not regard provision of palliative care services as influential in preventing their decision. Assisted suicide was preferred despite provision of palliative care. Better understanding of the importance placed on perceived control and anticipated dependency is needed. Further research is needed to develop appropriate support for patients contemplating assisted suicide.

  4. Die Erfindung des Manuskripts

    DEFF Research Database (Denmark)

    Benne, Christian

    Die Entstehung der literarischen Moderne ging seit dem 18. Jahrhundert damit einher, dass die Anzahl literarischer Manuskripte ebenso wuchs wie deren Bedeutung. Der Buchdruck hatte die Handschrift keineswegs überflüssig gemacht, sondern provozierte im Gegenteil einen neuen, am Autographen...

  5. "Please. Don't. Die.": A Grounded Theory Study of Bystander Cardiopulmonary Resuscitation. (United States)

    Mausz, Justin; Snobelen, Paul; Tavares, Walter


    Bystander cardiopulmonary resuscitation (CPR) is an important determinant of survival from out-of-hospital cardiac arrest (OHCA), yet rates of bystander CPR are highly variable. In an effort to promote bystander CPR, the procedure has been streamlined, and ultrashort teaching modalities have been introduced. CPR has been increasingly reconceptualized as simple, safe, and easy to perform; however, current methods of CPR instruction may not adequately prepare lay rescuers for the various logistical, conceptual, and emotional challenges of resuscitating a victim of cardiac arrest. We adopted a constructivist grounded theory methodology to qualitatively explore bystander CPR and invited lay rescuers who had recently (ie, within 1 week) intervened in an OHCA to participate in semistructured interviews and focus groups. We used constant comparative analysis until theoretical saturation to derive a midrange explanatory theory of bystander CPR. We constructed a 3-stage theoretical model describing a common experiential process for lay rescuer intervention in OHCA: Being called to act is disturbing, causing panic, shock, and disbelief that must ultimately be overcome. Taking action to save the victim is complicated by several misconceptions about cardiac arrest, where victims are mistakenly believed to be choking, and agonal respirations are misinterpreted to mean the victim is alive. Making sense of the experience is challenging, at least in the short term, where lay rescuers have to contend with self-doubt, unanswered questions, and uncomfortable emotional reactions to a traumatic event. Our study suggests that current CPR training programs may not adequately prepare lay rescuers for the reality of an OHCA and identifies several key knowledge gaps that should be addressed. The long-term psychological consequences of bystander intervention in OHCA remain poorly understood and warrant further study. © 2018 American Heart Association, Inc.

  6. Die begrafnisdíens

    African Journals Online (AJOL)

    Num 20: 1; Jos 24: 30; Hand 5: 5 - 11). Selfs van die ... Gebruike rondom die begrafnis het van geslag tot geslag gewissel. De Vaux ... der geskied deur die hoorders 'te onderrig, te vermaan, te vertroos en te bestraf, soos dit in elke geval ..... gehandhaaf hoef te word, veral in die lig van die feit dat die predikant die kerklike.

  7. Exploring Canadian Physicians' Experiences Providing Medical Assistance in Dying: A Qualitative Study. (United States)

    Khoshnood, Narges; Hopwood, Marie-Clare; Lokuge, Bhadra; Kurahashi, Allison; Tobin, Anastasia; Isenberg, Sarina; Husain, Amna


    MAiD allows a practitioner to administer or prescribe medication for the purpose of ending a patient's life. In 2016, Canada was the latest country, following several European countries and American states, to legalize physician-assisted death. Although some studies report on physician attitudes towards MAiD or describe patient characteristics, there are few that explore the professional challenges faced by physicians who provide MAiD. To explore the professional challenges faced by Canadian physicians who provide MAiD. Sixteen physicians from across Canada who provide MAiD completed in-depth, semi-structured telephone interviews. An inductive thematic analysis approach guided data collection and the iterative, interpretive analysis of interview transcripts. Three members of the research team systematically co-coded interview transcripts and the emerging themes were developed with the broader research team. NVivo was used to manage the coded data. Participants described three challenges associated with providing MAiD: 1) their relationships with other MAiD providers were enhanced and relationships with objecting colleagues were sometimes strained, 2) they received inadequate financial compensation for time, and, 3) they experienced increased workload, resulting in sacrifices to personal time. Although these providers did not intend to stop providing MAiD at the time of the interview, they indicated their concerns about whether they would be able to sustain this service over time. Physicians described relationship, financial, and workload challenges to providing MAiD. We provide several recommendations to address these challenges and help ensure the sustainability of MAiD in countries that provide this service. Copyright © 2018. Published by Elsevier Inc.

  8. Die invloed van die neo-marxistiese kultuuranalise op die Wêreldraad van Kerke en die Gereformeerde Kerke van Nederland

    Directory of Open Access Journals (Sweden)

    J. M. Vorster


    Full Text Available Toe die studente dwarsoor die VSA en Europa in die laat sestigerjare ’n plotselinge en radikale verset openbaar het teen die bestaande orde, het hulle die deur geopen vir ’n nuwe mededinger om die hart van die Westerse kultuur. Dit is die nou reeds bekende neo-Marxisme. Sedertdien het hierdie jongeling sy voetspore op vele vlakke van die Westerse kultuur gelaat.

  9. Morir con dignidad: Estudio sobre voluntades anticipadas Dying with dignity: A study of living wills

    Directory of Open Access Journals (Sweden)

    Cristina Nebot


    draw up a living will, to analyze physicians´ knowledge of living wills and attitudes toward them, and to compare the regulations pertaining to this right in the distinct autonomous regions of Spain. Method: A descriptive study that included an analysis of a systematic sample of 931 living wills registered in the autonomous region of Valencia (Spain, a self-administered structured questionnaire administered to a sample of 84 physicians working in emergency departments and intensive care units (45% response rate, and a comparison of the regional legislation covering living wills. Results: A total of 1.6% of inhabitants aged 16 or over had registered a living will (female/male ratio: 1.8/1. Most (73.8% used a standard document drawn up by a particular religious faith. The most common reasons for writing a living will were to limit therapeutic efforts (99% and obtain pain-relieving drugs (98%. Although 61 physicians (72.6% frequently attended the terminally ill, only 6% consulted the register of living wills in these situations and 28% did not know how to consult this register. There is wide variation among regions in the minimum age for registering a living will, in the procedure to be followed if the signer is pregnant, in designating a person as having the authority to make a living will, and in the number of registration points available to deposit livingwills. Conclusions: Most persons registering a living will are healthy individuals with a particular religious faith who reject certain treatments. Most health professionals do not check whether critically ill patients have made a living will. Exercising the rights contained in living wills is complicated by the diversity of criteria among different regions.

  10. die pers as bron oor die geskiedenis van die eerste vrydeidsoorlog

    African Journals Online (AJOL)

    dood agv wonde wat hy tydens die slag opgedoen het. Dit was vir die Britse volk onaanvaarbaar dat slegs twee Boere gedood is nadat daar tussen. 20 000 en 30 000 rondtes op die Boere afgevuur is. Die pers kon net nie die ware syfers publiseer nie, want dit sou na 'n onwaarheid Iyk. Het die. Britse volk egter die Boere ...

  11. die impak van metodologie op die verstaan van die nuwe testament

    African Journals Online (AJOL)

    voorbeeld eers een maal deur die bril van die vorm- en redaksiekritiek na die Evangelies gekyk het, dink jy vir altyd anders oor hulle tot- standkoming. Inderdaad, nuwe metodes lei tot nuwe perspektiewe! Dit is dan ook waar die fokus van hierdie artikel val: die impak van metodologie op die verstaan van die Nuwe ...

  12. Verskuiwing in die moraal?

    Directory of Open Access Journals (Sweden)

    S.P. van der Walt


    Full Text Available Modewoorde het ons deesdae oorgenoeg in die Christelike sedeleer en hulle kan nogal verwarring stig. U moet my vergun om met u te spreek oor een so ’n modewoord nl „verskuiwing’’ in die moraal. Dis nogal ’n mooi woord, wat so dikwels gebruik word op baie terreine en tog meer wil aandui as maar net ’n veranderde sienswyse, ’n wysiging in opvattinge of nuwe riglyne wat al gangbaar geword het in die praktyk. Die begrip wil eintlik die ewolusionêre gang beklemtoon, want dit is dan eintlik net die ou norme wat effens anders bekyk word of nie meer so nou geneem of dik onderstreep word nie. Die verskuiwing beteken dan dat alles nog dieselfde bly, net die posisie of plek het verander. Verskuiwing beteken tog plekverandering of plekwisseling en dan sekerlik nie in die sin dat die plekke ver uitmekaar lê nie. Verskuiwing beteken net maar vlak langs die vorige te staan kom. As dit dan ’n beter plek is, is dit ewolusie, ontwikkeling, verbetering.


    Falcochio, Diego Figueira; Crepaldi, Bruno Eiras; Trindade, Christiano Augusto; da Costa, Antonio Carlos; Chakkour, Ivan


    Objective: the aim of this study is try to show the best view for distal radius fractures so called die-punch fractures. Methods: There has been used a human cadaver radius bone from the Salvador Arena Tissue Bank. This bone was cleaned up after removing the soft tissues and osteotomies created displaced lunate fossa fractures of 0, 1, 2, 3 and 5 mm. We have fixed this fragment with adhesive tape. Then the joint deviation were significantly increased with step-offs of 1 mm. Radiographs were then taken into 5 different positions: postero-anterior view, lateral view, oblique views and tangencial view for each of the deviations. The resulting lunate fossa depression in each X-ray film was analyzed by the AutoCAD 2010® software. Results: The tangencial view was the best one to see the 1mm and 3mm bone degrees and the second one view to see the 2mm and 5 mm degrees. The pronated oblique view was the best to see the 2mm degrees and the oblique supinated view wasn't able to see the degrees between 1 and 2mm. Conclusion: The tangencial view was the best one to see the 1mm and 3mm bone degrees and the second one view to see the 2mm and 5 mm degrees. PMID:27027079

  14. End-of-Life Care and Circumstances of Death in Patients Dying As a Result of Cancer in Belgium and the Netherlands: A Retrospective Comparative Study

    NARCIS (Netherlands)

    Meeussen, K.; van den Block, L.; Echteld, M.A.; Boffin, N.; Bilsen, J.; van Casteren, V.; Abarshi-Fatiregun, E.A.B.; Donker, G.; Onwuteaka-Philipsen, B.D.; Deliens, L.


    Purpose: To examine and compare end-of-life care in patients with cancer dying in Belgium and the Netherlands. Patients and Methods: A mortality follow-back study was undertaken in 2008 via representative nationwide sentinel networks of general practitioners (GPs) in Belgium and the Netherlands. By

  15. End-of-life care and circumstances of death in patients dying as a result of cancer in Belgium and the Netherlands: a retrospective comparative study.

    NARCIS (Netherlands)

    Meeussen, K.; Block, L. van den; Echteld, M.A.; Boffin, N.; Bilsen, J.; Casteren, V. van; Abarshi, E.; Donker, G.; Onwuteaka-Philipsen, B.; Deliens, L.


    Purpose: To examine and compare end-of-life care in patients with cancer dying in Belgium and the Netherlands. Patients and methods: A mortality follow-back study was undertaken in 2008 via representative nationwide sentinel networks of general practitioners (GPs) in Belgium and the Netherlands. By

  16. Relatives' Perspective on the Terminally Ill Patients Who Died after Euthanasia or Physician-Assisted Suicide: A Retrospective Cross-Sectional Interview Study in the Netherlands (United States)

    Georges, Jean-Jacques; Onwuteaka-Philipsen, Bregje D.; Muller, Martien T.; van der Wal, Gerrit; van der Heide, Agnes; van der Maas, Paul J.


    This study used retrospective interviews with 87 relatives to describe the experiences of patients who died by euthanasia or physician-assisted suicide (EAS) in the Netherlands. Most of the patients suffered from cancer (85%). The relatives were most often a partner (63%) or a child (28%) of the patient. Before explicitly requesting EAS most…

  17. Spanische Identität unter der Voraussetzung des trikulturellen Mittelalters: zu Fabian Sevillas StudieDie ‚Drei Kulturen‘ und die spanische Identität“

    Directory of Open Access Journals (Sweden)

    Jan Henrik Witthaus


    Full Text Available Fabian Sevilla, Die „Drei Kulturen“ und die spanische Identität: ein Konflikt bei Américo Castro und in der spanischsprachigen Narrativik der Moderne, Siegener Forschungen zur romanischen Literatur- und Medienwissenschaft 26 (Tübingen: Stauffenburg, 2014, 372 S.

  18. oor die inhoud en boodskap van die heidelbergse kategismus

    African Journals Online (AJOL)

    Smit. Oor die Inhoud en Boodskap van die Heidelbergse Kategismus. 52. Uiteraard sal dié tema saamhang met die bedoelinge agter die opstel van die Kategismus. Ook die vraag na moontlike bedoelinge of motiewe is egter 'n ingewikkelder vraag as wat miskien gedink mag word. Uiteraard was daar agter elke kategismus ...

  19. Thomas Erastus oor die struktuur van die gemeenskap'^

    African Journals Online (AJOL)

    óók aansprake en regte het, is die opvatting dat sowel die burgerlike gemeenskap as die kerk 'n perfecta societas sibi sufficiens is, nié werklik aanvaar nie. Die Middeleeuse gemeenskap was die corpus christianum,. 'n gemeenskap wat nie deur fisiese of politieke grense beperk was nie. Sy grense het gelê waar die grense ...

  20. die doel en wese van opvoedende onderwys en die implikasies

    African Journals Online (AJOL)

    Oaar moet onderskei word tussen die doelstellings van opvoedende onderwys en die einddoel wat bereik word deur die nastrewing van hierdie doelstellings. Gunter praat van die naderliggende doelstellings (1981, b1.105). \\/at die enddoel van opvoedende onderwys bet ref, gaan die meeste opvoedkundi ges akkoord dat ...

  1. ’n Oorsig van die bepaling van die vroeë bakterisidiese aktiwiteit van verskeie antituberkulosemiddels

    Directory of Open Access Journals (Sweden)

    P. R. Donald


    Full Text Available Die vroeë bakterisidiese aktiwiteit (VBA van ’n antituberkulosemiddel is die daaglikse afname van M tuberculosis in log10 kolonievormende eenhede per ml sputum, tydens die eerste twee dae van behandeling met die middel. Dit weerspieël die vermoë van ’n middel om aktief metaboliserende organismes in tuberkulose-longholtes te dood. Dit is ’n relatief goedkoop metode om in ’n klein groep pasiënte die antituberkulose-aktiwiteit van ’n middel, binne maande, in vivo te evalueer. Hierdie artikel som ons ondervinding op tydens sewe gepubliseerde VBA-studies, en die bronne van variasie in die prosedure word identifiseer. Die pasiënte in hierdie studies was gemiddeld 33 jaar oud, met ’n gemiddelde gewig van 50 kg en 55% het ekstensiewe of massiewe longaantasting gehad. Die hoogste VBA-waardes (0,50-0,66 is gevind in pasiënte wat isoniasied ontvang het, en die laagste waardes (0,05 en 0,09 respektiewelik was gevind in pasiënte wat die aminoglikosiede amikasien en paromomisien, albei in doserings van 15 mg/kg liggaamsgewig, ontvang het. Die algehele variasie in die VBA van 248 pasiënte was 0,0312, en die variasie toegeskryf aan die proses van sputumproduksie en -versameling was 0,0223. Dit blyk dat die verskillende aspekte van sputumproduksie en -versameling, betrokke by die lewering van ’n verteenwoordigende sputummonster, ’n groter bydrae maak tot variasie tydens die prosedure as die laboratoriumaspekte van die tegniek. Die keuring van pasiënte vir insluiting in VBA-studies, en hulle vermoë om saam te werk om ’n verteenwoordigende sputummonster te produseer, is van deurslaggewende belang in die suksesvolle voltooiing van VBA-studies.

  2. Ein (neuer Blick auf die Konkurrenz unter Frauenforscherinnen A (New Look at Competition Among Women Scholars in Women’s Studies

    Directory of Open Access Journals (Sweden)

    Anina Mischau


    Full Text Available Die Solidarität unter Frauenforscherinnen wird bis heute als politisch-ideologisches Postulat der Frauenforschung aufrechterhalten, obwohl im Zuge einer zunehmenden Institutionalisierung und Professionalisierung bei einer gleichzeitig nahezu unveränderten Marginalisierung der Frauenforschung an deutschen Hochschulen eine stärker werdende Konkurrenz auch unter Frauenforscherinnen zu beobachten ist. Sünne Andresen geht der Frage nach den möglichen Ursachen von Konkurrenz unter Frauenforscherinnen in der Hochschule nach. Diese Fragestellung ist in der Frauen- und Geschlechterforschung nicht neu, wenngleich sie bislang eher allgemein auf die Konkurrenz unter Wissenschaftlerinnen bezogen worden ist. Innovativ ist jedoch, dass die Autorin hierfür den subjektwissenschaftlichen Ansatz der Kritischen Psychologie und die Habitus-Feld-Konzeption Bourdieus als theoretischen Bezugsrahmen auswählt und damit deutlich über die vorherrschenden subjektzentrierten oder strukturtheoretischen Erklärungsansätze hinausgeht. Die empirische Basis ihrer Studie sind sechs qualitative Interviews mit Habilitandinnen der geistes- und sozialwissenschaftlichen Fächer, die sich auf die Frauen- und Geschlechterforschung spezialisiert haben. Insgesamt arbeitet die Autorin interessante Aspekte möglicher Ursachen des Konkurrenzverhaltens unter und der Konkurrenzerfahrungen von Frauenforscherinnen heraus. Sie bleibt der Leserin aber mindestens genauso viele Antworten schuldig, wie sie durch die dargestellten „empirischen Ergebnisse" zu geben vermag.Until the present day, solidarity among feminist scholars is upheld as an ideological-political postulate in this particular scholarly community. These views continue to be upheld despite the increasing institutionalisation and professionalisation of research in women’s studies research. These institutional changes result in an increased sense of competition among feminist scholars, while women’s studies continue to

  3. Die tug oor ampsdraers tydens die doleansie van 1886

    Directory of Open Access Journals (Sweden)

    J. Visser


    Full Text Available In art 29 van die Nederlandse Geloofsbelydenis word bely: “Die merktekens om die ware Kerk te ken is die volgende: As die Kerk die suiwere prediking van die evangelie uitoefen, as dit die suiwer bediening van die sakramente gebruik soos Christus dit ingestel het, as die kerklike tug gebruik word om die sondes te straf.” Dit spreek vanself dat wanneer ampsdraers, aan wie Christus sy kudde toevertrou het (Hand 20 : 28, met leer en /of lewenswandel in sonde volhard en nie daarin met tug gestuit word nie, word die ware kerk nie gebou nie maar afgebreek. 0ns sal later in hierdie artikel aantoon hoedanig die suiwer tug oor ampsdraers, veral leertug, tydens die Doleansie tot skade van die kerk van Christus agterweë gebly het.

  4. Die verhouding tussen vertroue en diversiteitsklimaat by 'n Suid-Afrikaanse universiteit


    McCallaghan, Sean; Heyns, Marita


    Hierdie studie stel ondersoek in na die verwantskap tussen vertroue en die diversiteitsklimaat binne 'n Suid-Afrikaanse tersiêre inrigting. 'n Kwantitatiewe benadering met behulp van 'n nie-waarskynlikheidsgerieflikheidsteekproef (N=350) is gevolg. Die vraelys wat in die studie gebruik is, maak gebruik van 'n kombinasie van drie vooraf-gevalideerde instrumente. Die resultate dui aan dat die werknemers saamstem dat die instelling bereid is tot diversiteitsbestuur en die uitskakeling van diskri...

  5. die ontstaan van vrouelugverenigings in suid-afrika voor die tweede

    African Journals Online (AJOL)

    aangestel. Ander eenhede het later gevolg. Drle van die Vrouehulplugmag se lelersflgure staan voor die VHLM se kleure wat gewy Is In Durban op 18 Mei 1940. Die vroue Is vlnr mal (meil E. Percival-Hart, It-kol (mev) D. Dunning en mal (mel) M. Egerton-Bird. 24. Scientia Militaria, South African Journal of Military Studies, ...

  6. Where do the elderly die? The impact of nursing home utilisation on the place of death. Observations from a mortality cohort study in Flanders

    Directory of Open Access Journals (Sweden)

    Van Hecke Ettiene


    Full Text Available Abstract Background Most of the research concerning place of death focuses on terminally ill patients (cancer patients while the determinants of place of death of the elderly of the general population are not intensively studied. Studies showed the influence of gender, age, social-economical status and living arrangements on the place of death, but a facet not taken into account so far is the influence of the availability of nursing homes. Methods We conducted a survey of deaths, between January 1999 and December 2000 in a small densely populated area in Belgium, with a high availability of nursing homes (within 5 to 10 km of the place of residence of every elderly. We determined the incidence of total mortality (of subjects >60 years from local official death registers that we consulted via the priest or the mortician of the local parish, to ask where the decedent had died and whether the deceased had lived in a nursing home. We compared the distribution of the places of death between parishes with a nursing home and with parishes without nursing home. Results 240 women and 217 men died during the two years study period. Only 22% died at home, while the majority (78% died in an institutional setting, either a hospital (50% or a nursing home (28%. Place of death was influenced by individual factors (age and gender and the availability of a nursing home in the 'own' parish. The chance of in-hospital death was 65% higher for men (95% Confidence Interval [CI]: 14 to 138%; p = 0.008 and decreased by 4% (CI: -5.1% to -2.5%; p Conclusion Demographic, but especially social-contextual factors determine where elderly will end their life. The majority of elderly in Flanders die in an institution. Age, gender and living situation are predictors of the place of death but the embedment of a nursing home in the local community seems to be a key predictor.

  7. Symptoms, unbearability and the nature of suffering in terminal cancer patients dying at home: a prospective primary care study

    NARCIS (Netherlands)

    Ruijs, C.D.M.; Kerkhof, A.J.F.M.; van der Wal, G.; Onwuteaka-Philipsen, B.D.


    Background: Primary care physicians provide palliative home care. In cancer patients dying at home in the Netherlands (45% of all cancer patients) euthanasia in about one out of every seven patients indicates unbearable suffering. Symptom prevalence, relationship between intensity of symptoms and

  8. Die metafoor by Breyten Breytenbach

    African Journals Online (AJOL)


    23 Jun 2009 ... metafories, of spesifiek verwysend, te werk gegaan is. Tyd sou mens die hoofmotief van die bundel noem, tyd en geheue wat verbygaan: 1 en 2; en die einde van die storie wat gekom het: “fluit-fluit my storie is uit”. (Die tema van verbygaan word weer opgeneem in 8 en 9: die stories wat nooit meer gehoor ...


    African Journals Online (AJOL)

    In die verband kan genoem word dat die Russe nog grotendeels gebruik maak van 'n metode waarvolgens water in die oliestratum gepomp word om 'n opwaartse druk van ru-olie te verseker; een nadeel hiervan is dat die water mettertyd deur die oliehoudende laag ontsnap en agv die drukverlies isvoortgesette ontginning.

  10. Die singulation method (United States)

    Swiler, Thomas P.; Garcia, Ernest J.; Francis, Kathryn M.


    A method is disclosed for singulating die from a semiconductor substrate (e.g. a semiconductor-on-insulator substrate or a bulk silicon substrate) containing an oxide layer (e.g. silicon dioxide or a silicate glass) and one or more semiconductor layers (e.g. monocrystalline or polycrystalline silicon) located above the oxide layer. The method etches trenches through the substrate and through each semiconductor layer about the die being singulated, with the trenches being offset from each other around at least a part of the die so that the oxide layer between the trenches holds the substrate and die together. The trenches can be anisotropically etched using a Deep Reactive Ion Etching (DRIE) process. After the trenches are etched, the oxide layer between the trenches can be etched away with an HF etchant to singulate the die. A release fixture can be located near one side of the substrate to receive the singulated die.

  11. No Negative Impact of Palliative Sedation on Relatives' Experience of the Dying Phase and Their Wellbeing after the Patient's Death: An Observational Study.

    Directory of Open Access Journals (Sweden)

    S M Bruinsma

    Full Text Available Palliative sedation is the widely-used intervention of administering sedating agents to induce a state of unconsciousness to take away a dying patient's perception of otherwise irrelievable symptoms. However, it remains questionable whether this ethically complex intervention is beneficial for patients and whether the associated lack of communication in the last phase of life has a negative impact on relatives' wellbeing.An observational questionnaire study was conducted among relatives of a consecutive sample of patients who died a non-sudden death in the Erasmus MC Cancer Institute or in the hospice 'Laurens Cadenza' (both in Rotterdam between 2010 and 2013.Relatives filled in questionnaires regarding 151 patients who had been sedated and 90 patients who had not been sedated. The median time since all patients had passed away was 21 (IQR 14-32 months. No significant differences were found in relatives´ assessments of the quality of end-of-life care, patients´ quality of life in the last week before death and their quality of dying, between patients who did and did not receive sedation, or in relatives' satisfaction with their own life, their general health and their mental wellbeing after the patient's death.The use of sedation in these patients appears to have no negative effect on bereaved relatives' evaluation of the patient's dying phase, or on their own wellbeing after the patient's death.

  12. No Negative Impact of Palliative Sedation on Relatives’ Experience of the Dying Phase and Their Wellbeing after the Patient’s Death: An Observational Study (United States)

    van der Lee, M. L.; Vergouwe, Y.


    Background Palliative sedation is the widely-used intervention of administering sedating agents to induce a state of unconsciousness to take away a dying patient’s perception of otherwise irrelievable symptoms. However, it remains questionable whether this ethically complex intervention is beneficial for patients and whether the associated lack of communication in the last phase of life has a negative impact on relatives’ wellbeing. Methods An observational questionnaire study was conducted among relatives of a consecutive sample of patients who died a non-sudden death in the Erasmus MC Cancer Institute or in the hospice ‘Laurens Cadenza’ (both in Rotterdam) between 2010 and 2013. Results Relatives filled in questionnaires regarding 151 patients who had been sedated and 90 patients who had not been sedated. The median time since all patients had passed away was 21 (IQR 14–32) months. No significant differences were found in relatives´ assessments of the quality of end-of-life care, patients´ quality of life in the last week before death and their quality of dying, between patients who did and did not receive sedation, or in relatives’ satisfaction with their own life, their general health and their mental wellbeing after the patient’s death. Conclusions The use of sedation in these patients appears to have no negative effect on bereaved relatives’ evaluation of the patient’s dying phase, or on their own wellbeing after the patient’s death. PMID:26871717

  13. No Negative Impact of Palliative Sedation on Relatives' Experience of the Dying Phase and Their Wellbeing after the Patient's Death: An Observational Study. (United States)

    Bruinsma, S M; van der Heide, A; van der Lee, M L; Vergouwe, Y; Rietjens, J A C


    Palliative sedation is the widely-used intervention of administering sedating agents to induce a state of unconsciousness to take away a dying patient's perception of otherwise irrelievable symptoms. However, it remains questionable whether this ethically complex intervention is beneficial for patients and whether the associated lack of communication in the last phase of life has a negative impact on relatives' wellbeing. An observational questionnaire study was conducted among relatives of a consecutive sample of patients who died a non-sudden death in the Erasmus MC Cancer Institute or in the hospice 'Laurens Cadenza' (both in Rotterdam) between 2010 and 2013. Relatives filled in questionnaires regarding 151 patients who had been sedated and 90 patients who had not been sedated. The median time since all patients had passed away was 21 (IQR 14-32) months. No significant differences were found in relatives´ assessments of the quality of end-of-life care, patients´ quality of life in the last week before death and their quality of dying, between patients who did and did not receive sedation, or in relatives' satisfaction with their own life, their general health and their mental wellbeing after the patient's death. The use of sedation in these patients appears to have no negative effect on bereaved relatives' evaluation of the patient's dying phase, or on their own wellbeing after the patient's death.

  14. Evaluation of the Luting Cement Space for Provisional Restoration by using Various Coats of Die Spacer Materials-An Invitro Study. (United States)

    Chiramana, Sandeep; Siddineni, Krishna Chaitanya; Jyothula, Ravi Rakesh Dev; Gade, Phani Krishna; Bhupathi, Deepthi; Kondaka, Sudheer; Hussain, Zakir; Paluri, Geetha Bhavani


    The present study was to evaluate the space provided for the temporary luting cement, after the application of various coats of die spacers, during the fabrication of provisional crowns and bridges. A total of 50 specimens of dental stone with provisional crowns on all these samples were prepared and were divided into five groups based on the application of various coats of different die spacers. Later these specimens were sectioned buccolingually and were observed using a stereomicroscope under 100X magnification. The images thus obtained were evaluated and noted for the amount of space between the inner surface of the provisional crown and the specimens at five different locations using Image Pro 6.0 Express software and the values were subjected to one-way ANOVA test, and unpaired t-test. There was a significant increase of luting space thickness with various die spacer applications than the specimens of control group. Specimens of double coat applications of silver and gold die spacers showed higher luting cement space than the separating media application specimens.

  15. Ontsporing van die regstaatsbegrip en sy konsekwensies vir die afrikanervolk

    Directory of Open Access Journals (Sweden)

    N. G.S. Van der Walt


    Full Text Available Die opvatting van die suiwere regstaat bring sy vraagstukke mee wanneer dit in verband gebring word met die leer van die soewereiniteit in eie kring. Laasgenoemde leer wortel in die geloof dat God die mens roep tot diens aan Hom, en dat die mens vry moet wees om ten opsigte van alle lewensaspekte God na die hoogste mate te kan dien. Hierdie verskeidenheid van aspekte is deur dr. A. Kuyper en sy volgelinge gesistemati- seer tot menslike verbande en lewenskringe, elk met ’n be- paalde sfeer waarin ander kringe nie mag inmeng nie. Elkeen is dan soewerein binne sy eie kring. Met verwysing na die staat is dan gespreek van die staatstaak as synde die hand- hawing van die reg, en omdat die staat in toenemende mate hom veral in die latere tyd ook besig gehou het met bedrywig- hede wat nouliks as van juridiese aard beskou kan word, is daar die onderskeid gemaak tussen die primêre en sekundêre taak van die staat. Die sistematiek van die wetsidee, deur prof. Dooyeweerd ontwikkel, waar die staat sy bestemmingsfunksie in die regsaspek vind, het vanselfsprekend geen plek vir so 'n dualistiese staatstaak nie, en die oplossing is deur sommige daarin gesoek om sulke staatsoptrede te vertolk as hebbende wel betrekking op die regsgemeenskap of die regsverkeer. Staatsondernemings soos paaie, spoorweë, spellingreëling, ens. word dan beskou as noodsaaklik vir die instandhouding van die regsgemeenskap en regsverkeer. Tereg wys A. M. Donner1 daarop dat so ’n vertolking eintlik neerkom op ’n oorspanning van die regsbegrip. Hy self sien dan die staatstaak in vrede- of orde-handhawing, wat in die eerste plaas wel regshandha- wing veronderstel. Onder orde word dan alles verstaan wat noodsaaklik is vir die gladde verkeer in die ontwikkelingsgang van die regsgemeenskap. Die wese van die staat het dan vol- gens hom te doen met reg, maar sy taak is meer as suiwere regshandhawing. Wat onrus verwek en die orde versteur, moet uit die openbare lewe verwyder word, en die

  16. Die sterwende kindjie

    Directory of Open Access Journals (Sweden)

    J.T. De Jongh van Arkel


    Full Text Available The thought of a child dying appears as an antithesis and thus the feelings evoked by the dying child are stronger than when older persons are dying. Around the child’s death bed there is no place for detached spectators and all become involved in caring for and supporting him. Caregivers also have a supporting responsibility towards the members of the child’s family.

  17. Mu opioid receptor availability in people with psychiatric disorders who died by suicide: a case control study

    Directory of Open Access Journals (Sweden)

    Scarr Elizabeth


    Full Text Available Abstract Background Mu opioid receptors have previously been shown to be altered in people with affective disorders who died as a result of suicide. We wished to determine whether these changes were more widespread and independent of psychiatric diagnoses. Methods Mu receptor levels were determined using [3 H]DAMGO binding in BA24 from 51 control subjects; 38 people with schizophrenia (12 suicides; 20 people with major depressive disorder (15 suicides; 13 people with bipolar disorder (5 suicides and 9 people who had no history of psychiatric disorders but who died as a result of suicide. Mu receptor levels were further determined in BA9 and caudate-putamen from 38 people with schizophrenia and 20 control subjects using [3 H]DAMGO binding and, in all three regions, using Western blots. Data was analysed using one-way ANOVAs with Bonferroni’s Multiple Comparison Test or, where data either didn’t approximate to a binomial distribution or the sample size was too small to determine distribution, a Kruskal-Wallis test with Dunn’s Multiple Comparison Test. Results [3 H]DAMGO binding density was lower in people who had died as a result of suicide (p3 H]DAMGO binding densities, but not mu protein levels, were significantly decreased in BA9 from people with schizophrenia who died as a result of suicide (p Conclusions Overall these data suggest that mu opioid receptor availability is decreased in the brains of people with schizophrenia who died as a result of suicide, which would be consistent with increased levels of endogenous ligands occupying these receptors.

  18. A comparative evaluation of the marginal adaptation of a thermoplastic resin, a light cured wax and an inlay casting wax on stone dies: An in vitro study. (United States)

    Gopalan, Reji P; Nair, Vivek V; Harshakumar, K; Ravichandran, R; Lylajam, S; Viswambaran, Prasanth


    Different pattern materials do not produce copings with satisfactory, marginal accuracy when used on stone dies at varying time intervals. The purpose of this study was to evaluate and compare the vertical marginal accuracy of patterns formed from three materials, namely, thermoplastic resin, light cured wax and inlay casting wax at three-time intervals of 1, 12, and 24 h. A master die (zirconia abutment mimicking a prepared permanent maxillary central incisor) and metal sleeve (direct metal laser sintering crown #11) were fabricated. A total of 30 stone dies were obtained from the master die. Ten patterns were made each from the three materials and stored off the die at room temperature. The vertical marginal gaps were measured using digital microscope at 1, 12, and 24 h after reseating with gentle finger pressure. The results revealed a significant statistical difference in the marginal adaptation of three materials at all the three-time intervals. Light cured wax was found to be most accurate at all time intervals, followed by thermoplastic resin and inlay casting wax. Furthermore, there was a significant difference between all pairs of materials. The change in vertical marginal gap from 1 to 24 h between thermoplastic resin and light cured wax was not statistically significant. The marginal adaptation of all the three materials used, was well within the acceptable range of 25-70 μm. The resin pattern materials studied revealed significantly less dimensional change than inlay casting wax on storage at 1, 12, and 24 h time intervals. They may be employed in situations where high precision and delayed investing is expected.

  19. Place of death in the population dying from diseases indicative of palliative care need: a cross-national population-level study in 14 countries. (United States)

    Pivodic, Lara; Pardon, Koen; Morin, Lucas; Addington-Hall, Julia; Miccinesi, Guido; Cardenas-Turanzas, Marylou; Onwuteaka-Philipsen, Bregje; Naylor, Wayne; Ruiz Ramos, Miguel; Van den Block, Lieve; Wilson, Donna M; Loucka, Martin; Csikos, Agnes; Rhee, Yong Joo; Teno, Joan; Deliens, Luc; Houttekier, Dirk; Cohen, Joachim


    Studying where people die across countries can serve as an evidence base for health policy on end-of-life care. This study describes the place of death of people who died from diseases indicative of palliative care need in 14 countries, the association of place of death with cause of death, sociodemographic and healthcare availability characteristics in each country and the extent to which these characteristics explain country differences in the place of death. Death certificate data for all deaths in 2008 (age ≥1 year) in Belgium, Canada, the Czech Republic, England, France, Hungary, Italy, Mexico, the Netherlands, New Zealand, South Korea, Spain (Andalusia), the USA and Wales caused by cancer, heart/renal/liver failure, chronic obstructive pulmonary disease, diseases of the nervous system or HIV/AIDS were linked with national or regional healthcare statistics (N=2,220,997). 13% (Canada) to 53% (Mexico) of people died at home and 25% (the Netherlands) to 85% (South Korea) died in hospital. The strength and direction of associations between home death and cause of death, sociodemographic and healthcare availability factors differed between countries. Differences between countries in home versus hospital death were only partly explained by differences in these factors. The large differences between countries in and beyond Europe in the place of death of people in potential need of palliative care are not entirely attributable to sociodemographic characteristics, cause of death or availability of healthcare resources, which suggests that countries' palliative and end-of-life care policies may influence where people die. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to

  20. Nina Degele: Gender/Queer Studies. München: UTB Fink 2008. — Franziska Schößler: Einführung in die Gender Studies. Berlin: Akademie Verlag 2008

    Directory of Open Access Journals (Sweden)

    Heike Kahlert


    Full Text Available Nina Degele und Franziska Schößler treiben mit ihren Einführungsbüchern in die Gender Studies beziehungsweise in die Gender/Queer Studies die Disziplinierung dieser neuen Wissensfelder voran. Ausgehend von ihren jeweiligen Herkunftsdisziplinen (Soziologie und Literaturwissenschaft legen sie übersichtliche Überblicke vor, die explizit für die Hochschullehre konzipiert sind. Beide Bücher leisten einen wichtigen Beitrag zur Kanonisierung der Gender Studies als akademisches Fach, bleiben aber in ihrer Konzeption stark den Herkunftsdisziplinen ihrer Verfasserinnen verhaftet. Hier stößt die viel beschworene Interdisziplinarität der Gender Studies an ihre Grenzen.Nina Degele and Franziska Schößler promote the disciplinary establishment of new fields of knowledge with their introductory books in Gender Studies and Gender/Queer Studies. Using their individual home disciplines (sociology and literary studies as a starting point, they present clear overviews of these new fields of knowledge explicitly conceived for use in higher education. Both books contribute to the canonization of Gender Studies as an academic discipline, however they remain in their conception strongly attached to the home disciplines of their authors. It is here that the often-touted interdisciplinarity of Gender Studies reaches its limits.

  1. Analise van die Tswanaraaisel

    Directory of Open Access Journals (Sweden)

    S. A. Swanepoel


    Full Text Available ’n Strukturele, stilistiese en funksionele bcskrywing van die Twanaraaisel bring mee dat daar aan die volgende aspekte aandag gegee moet word: •\tWat is ’n raaisel en lioe word dit in Tswana genoem. •\tTot watter studiegebied en literere genre hoort die raaisel en watter subvorme kan vir Tswana onderskei word. •\tHoe sien die struktuur van Tswanaraaisels daar uit. •\tDeur wie, waar, wanneer en hoe word Tswanaraaisels voorgedra. •\tWatter stilistiese kenmcrke kan in Tswanaraaisels onderskei word. •\tWatter funksies vervul raaisels in ’n Tswanagcmeenskap.

  2. The Angry Dying Patient. (United States)

    Houston, Robert E.


    Over 25 years ago, Kubler-Ross identified anger as a predictable part of the dying process. When the dying patient becomes angry in the clinical setting, all types of communication become strained. Physicians can help the angry dying patient through this difficult time by using 10 rules of engagement. When physicians engage and empathize with these patients, they improve the patient's response to pain and they reduce patient suffering. When physicians educate patients on their normal responses to dying and enlist them in the process of family reconciliation, they can impact the end-of-life experience in a positive way.

  3. Die brein soos beskou deur die Grieke en Romeine

    Directory of Open Access Journals (Sweden)

    Francois P. Retief


    Full Text Available In Ou Egipte is mummifikasie met uitgebreide reseksie of uitsnyding van organe geassosieer, maar geen kennis is geneem van die morfologie van die brein nie. Griekse skrywers van die sesde en vyfde eeue v.C. het die brein aanvanklik gesien as die setel van intelligensie, die orgaan van sensoriese waarneming en gedeeltelik die oorsprong van sperma. Pneuma het ’n belangrike rol in breinfunksie gespeel. Hippokrates was die eerste om die brein te beskryf as ’n dubbele orgaan, wat met harsingvlies (meninges bedek, funksioneel van pneuma afhanklik en vertolker van begrip is. Tydgenote soos Plato, Aristoteles en Diokles het tot die beskrywing bygedra, maar laasgenoemde twee het beweer dat die hart die middelpunt van intelligensie is en nie die brein nie. Gedurende die laaste helfte van die vierde eeu v.C. is disseksie van die menslike liggaam tydelik aan die mediese skool van Alexandrië toegelaat en het dit tot merkwaardige vooruitgang in die begrip van die menslike anatomie en fisiologie gelei. Herofilus en Erasistratus het uitstekende beskrywings van die struktuur en funksie van die brein gegee wat eers in die tweede eeu n.C. deur Galenus geëwenaar is.


    African Journals Online (AJOL)

    dien. Die planke en velie moes keer dat die assegaaie die mense tref. Voor die geveg het die vrouens en groter dogters koeels gegiet. Tydens die geveg het die seuns gehelp skiet terwyl die vrouens en dogters die gewere vir die mans gelaai het. Van die dogters soos Nellie. Botha (11 jaar oud) en haar sussie Fya (15 jaar.

  5. Dogmatiek en Christelike Etiek binne die Fakulteit Teologie (Afd A ...

    African Journals Online (AJOL)

    their influence on the study of Dogmatics and Ethics in the Department. The article concludes with a vision for ... heid door systematische ordening' (Berkhof 1982:14) aan die een kant en om diens aan die kerklike verkondiging aan die ander kant gaan, sal bogenoemde twee sake beslis nie uit die cog verloor kan word nie.

  6. Die uitbouing van die Bybelse kanon in antieke Judaïsme en die ...

    African Journals Online (AJOL)

    31 Jul 2015 ... die oer-Christelike boodskap tot by sy Ou Testamentiese wortels, die geskrifte van Israel wat cum grano salis die 'Bybel' van die oer-Christendom geword het en die blywende verwysingspunt van die Christelike boodskap is. Erkenning. Hierdie artikel is vertaal na Afrikaans deur Prof. Jan G. van der Watt.

  7. Die opleiding van bedryfsielkundiges aan die universiteit van Fort Hare

    Directory of Open Access Journals (Sweden)

    W. Botha


    Full Text Available Die Departement Bedryfsielkunde aan die Universiteit van Fort Hare is 'n relatiewe jong departement en het eers in 1965 tot stand gekom. Voor hierdie datum is Bedryfsielkunde as 'n kort kursus deur die departement van suiwer Sielkunde aangebied en een van die destydse dosente, Dr. W. Backer, het die inisiatief geneem om 'n selfstandige departement van Bedryfsielkunde in die Fakulteit van Ekonomiese Wetenskappe op die been te bring.

  8. [Dying with cancer: Hollywood lessons]. (United States)

    Niemeyer, Fernanda; Kruse, Maria Henriqueta Luce


    The study attempts to understand how dying from cancer is portrayed by five movies produced in Hollywood between 1993 and 2006. Based on the cultural studies and their post-structuralism version and supported by the notions of discourse and subjectivity, as proposed by philosopher Michel Foucault, we suggest one of the possible readings of the movie picture corpus. We assess how the movie picture discourse acts as a cultural pedagogy that produces ways of seeing dying with cancer: immortalizing the healthy body image, silencing death, taking care of the dead body and, finally, accepting death. Our proposal is intended to stimulate reflections that may contribute to care and education in nursing.

  9. Oor die Bybel in die Afrikaanse digkuns

    African Journals Online (AJOL)

    another. As a matter of fact, the development of Afri kaans, the instrument of the poet, has been significantly influenced the Afrikaans translation of the Bible. Belie ... ook gesê het: Saam met ons literatuur, so oud as hy is. Die eerste Afrikaanse digter by wie ons omvattende Bybelse invloed kry, is. Totius, een van ons vroegste ...

  10. calvyn oor die leiding van die heilige gees in die verklaring van die

    African Journals Online (AJOL)

    Mittel alters, bis er zur Ruhe kommt bei den kanonischen Schriften der. Urzeit der christlichen Ära (Barth ... (ego tamen dimoveri non possum ab amore compendii, CO 10, 403). Deur die boodskap van die .... Idem ergo spiritus qui per os prophetarum loquutus est, in corda nostra penetret necesse est, ut persuadeat fideliter ...


    African Journals Online (AJOL)

    Acta Theologica is an accredited South. African journal publishing ... SciELO South Africa. REDAKSIE/ ... 'n persoon belydenis van geloof af wat instemming met die betrokke kerk se ...... Ek was na my ongeluk buite aksie en op Clarens. 'n Mede-lid ...... Die “formation of new confessions, change to current confessions, and.

  12. Dying with dignity


    S P Kalantri


    The concept of dignity has beeen one of the ambiguous concepts in biomedical ethics. Thus the ambiguous nature of this concept has been extended to what it means to die with dignity. This research work is an investigation into the complexity in the understanding of "dying with dignity" in Applied Ethics.

  13. The day Madiba died

    African Journals Online (AJOL)

    8 Apr 2016 ... shibien en ma is nie happy nie. Susan Gaigher se allegoriese fanta- sie- oftewel wetenskapsfiksieverhale. “Martine se teepot” (46–55) en “Maslow”. (56–67) is verfrissend. Gaigher is een van die min skrywers in die bundel wat 'n kenmerkende en oorspronklike stem laat klink. 'n Mens sal 'n Gaigher-verhaal.

  14. Die entwicklung, die metamorphose, die entstehung: Die konzepte des organismus von Aristoteles bis Darwin

    Directory of Open Access Journals (Sweden)

    Kamerer Eva


    Full Text Available (nemački In diesem Aufsatz versuche ich, die Elemente verschiedener Konzepte des Organismus in der Philosophie und in der Wissenschaft zu analysieren. Die Deutungen des Organismus und der Einheit der Natur bei Aristoteles, Kant und Goethe werden als ein Beispiel der Bewegung von einem finalistischen zum antifinalistischen Bild der Natur verstanden.

  15. Mu opioid receptor availability in people with psychiatric disorders who died by suicide: a case control study. (United States)

    Scarr, Elizabeth; Money, Tammie Terese; Pavey, Geoffrey; Neo, Jaclyn; Dean, Brian


    Mu opioid receptors have previously been shown to be altered in people with affective disorders who died as a result of suicide. We wished to determine whether these changes were more widespread and independent of psychiatric diagnoses. Mu receptor levels were determined using [3 H]DAMGO binding in BA24 from 51 control subjects; 38 people with schizophrenia (12 suicides); 20 people with major depressive disorder (15 suicides); 13 people with bipolar disorder (5 suicides) and 9 people who had no history of psychiatric disorders but who died as a result of suicide. Mu receptor levels were further determined in BA9 and caudate-putamen from 38 people with schizophrenia and 20 control subjects using [3 H]DAMGO binding and, in all three regions, using Western blots. Data was analysed using one-way ANOVAs with Bonferroni's Multiple Comparison Test or, where data either didn't approximate to a binomial distribution or the sample size was too small to determine distribution, a Kruskal-Wallis test with Dunn's Multiple Comparison Test. [3 H]DAMGO binding density was lower in people who had died as a result of suicide (pendogenous ligands occupying these receptors.

  16. Paradigmas en progressie in die teologie: *n Perspektief op die ...

    African Journals Online (AJOL)

    Die metodologie as besinningsterrein word egter al belangriker. Gedurende die tweede week van April 1988 het teoloë van dwarsoor Suid-. Afrika by die nuwe gebou van die Raad vir Geesteswetenskaplike Navorsing in. Pretoria byeen gekom vir 'n kongres van amper drie dae met die tema Paradigma.'> 476. ISSN 0259 ...

  17. die korrelasie tussen die gemiddelde daaglikse toename van ...

    African Journals Online (AJOL)

    'n Regressielyn is uit die gegewens bereken deur 'n beswaarde regressieanaliese en die 80 persent-voorspellings- bande is bepaal. Die punte wat ver buite die normale ver- spreidingsband geval hetkon almal met goeie rede as abnor- maal beskou word (sien tabel 1) en is nie ingesluit by die statistiese berekenings nie.

  18. amp' van die ouderling in die Nuwe Testament

    African Journals Online (AJOL)

    Jesus self het geen kerk gestig nie en daarom, veral omdat die Jesus-beweging inter mums ten opsigte van die Joodse godsdiens van sy tyd tot stand gekom het, het ...... Die klem val dus nie op die npoTCTT0fievo<; se rang of outoriteit nie, maar op sy pastorale funksie in die huishouding of huisgemeente (kyk Reicke.

  19. Leerteoretiese basis van die andragogie

    Directory of Open Access Journals (Sweden)

    C. J. A. Simpson


    Full Text Available Learning theory basis of andragogy. A cursory glance at andragogy creates the impression that humanistic learning theory plays an all encompassing role in the learner centered approach andragogy espouses. A closer look, however, reveals that Knowles (1973, after having made an intensive study of learning theory, created an extensive framework within which human resource development can take place. The fact that Knowles attracted critique from different areas, led to a need to ascertain the role different learning theories, if any, played in the emergence of andragogy. Having looked at the assumptions displayed by the andragogical approach, as well as a comparison of different learning theories and their connection with andragogy, it became clear that andragogy contains elements of various learning theories in an adapted way. These adaptations resulted in an approach to adult education in which learners are given the opportunity to be part of the learning process in such a way that they themselves contribute to the development which takes place. Opsomming Met 'n eerste oogopslag wil dit voorkom asof humanistiese leerteorie 'n oorheersende rol in die leerdergesentreerde benadering van andragogie speel. By nadere ondersoek blyk dit egter dat Knowles (1973, na 'n deeglike studie van verskillende leerteoretiese beginsels, 'n omvangryke raamwerk geskep het waarbinne, aan die hand van verskeie aangepaste leerteoretiese beginsels, menslike hulpbronontwikkeling kan plaasvind. As gevolg van die feit dat Knowles vanuit verskillende oorde kritiek op die lyf geloop het, is besluit om die rol wat verskillende leerteorieë in andragogie speel, te bestudeer. Dit blyk dat andragogie nie net elemente van verskillende leerteorieë bevat nie, maar dat toepaslike aspekte van die teoriee wat ondersoek is, benut en aangepas is om 'n geintegreerde benadering te bewerkstellig waarin veral volwassene-leerders by leergeleenthede en hulle selfontwikkeling betrek word.

  20. Zukunftssicherung für die Zeit nach der Krise


    Ackermann, Karl-Friedrich; Wehner, Martina


    Die Studie berichtet zusammenfassend über die Ergebnisse der 9. HR-Expertenbefragung mit der Zeitschrift „Personalwirtschaft“ zum Thema „Employer Branding“. Berichtet wird über die Verbreitung des Employer Branding, die dabei verfolgten Ziele und die Instrumente, mit denen ein erfolgreiches Employer Branding realisiert werden kann. Eng damit verbunden sind ergänzende Fragen nach den Einflussfaktoren und den Gestaltungsmöglichkeiten der Arbeitgebermarke sowie nach den eingesetzten Methoden zur...

  1. Feasibility study for new ecolabels for the product group: Wood pellet firings. Final report; Machbarkeitsstudie fuer neue Umweltzeichen fuer die Produktgruppe: Holzpelletfeuerungen. Endbericht

    Energy Technology Data Exchange (ETDEWEB)

    Hoffmann, E.; Weiss, J.; Hirschl, B.


    This assessment is a feasibility study according to ISO 14024. It deals with the question whether an ecolabel is suitable for wood pellet heating systems and how concrete criteria for an ecolabel for wood pellet heating plants could be specified. The study begins with a comprehensive market analysis in order to identify possible plants for which an ecolabel would make sense. In the main part of the study, the environmental relevance of the chosen plants is analysed. For this analysis, plant manufacturers were interviewed and a comparison between wood pellet heating systems and heating systems which use gas, oil or wood was carried out. On the basis of this analysis, it was possible to derive a number of criteria which were discussed with company representatives and other experts in this field. As a result of this dialogue and the investigation process as a whole, the introduction of an ecolabel for wood pellet heating plants can be recommended. Wood pellet heating systems are characterized by their high level of automatation and the use of standardized fuels with constant high quality. Thus, they reach high combustion quality with low emission rates, and risks of misuse are minimized. They may contribute to the increased use of renewable energies and thereby to the achievement of climate protection goals. The proposed certification principles comprise requirements regarding (a) the efficient energy use (efficiency factor under partial load and nominal load, plant's supplementary energy consumption), (b) emission values for CO, NO{sub x}, dust and organic substances, (c) the offer of additional services, as well as (d) requirements with regard to the operating instructions. The transcription of the label is proposed as 'Ecolabel.. because low emission and energy-efficient'. (orig.) [German] Beim vorliegenden Gutachten handelt es sich um eine Machbarkeitsstudie nach ISO 14024. Es behandelt die Frage, ob ein Umweltzeichen fuer Holzpelletfeuerungen

  2. Hemofilie onder die nasate van koningin Victoria

    Directory of Open Access Journals (Sweden)

    Francois P. Retief


    Full Text Available Hierdie studie bespreek die uitwerking van die sogenaamde Victoriaanse hemofilie op Europese koningshuise gedurende die negentiende en twintigste eeu. Hemofilie as molekulêre defek word verduidelik en die kliniese beeld van die siekte word aangedui. ’n Bespreking van toepaslike terapeutiese ingrepe volg. Dan word ’n historiese oorsig verskaf van die verspreiding van Victoriaanse hemofilie vanaf koningin Victoria (Britse monarg, 1837–1901 via sommige van haar dogters na ander lede van die Britse koningshuis en ook na die Duitse, Russiese en Spaanse koningshuise. Elf bevestigde gevalle van hemofilie onder lede van koningin Victoria se nageslag word vermeld, asook drie ander moontlike gevalle van die siekte. Die effek van hemofilie op die verloop van die geskiedenis word ook ondersoek.Haemophilia amongst the descendants of Queen Victoria. This study discusses the impact of ‘Victorian haemophilia’ on the royal houses of Europe during the 19th and 20th centuries. Haemophilia as a molecular defect is explained and the clinical picture of the condition is indicated. Applicable therapeutic interventions also receive attention. Next, an historical review is provided of how ‘Victorian haemophilia’ spread from Queen Victoria (British monarch, 1837–1901 via some of her daughters to other members of the British royal family and also to the royal houses of Germany, Russia and Spain. Eleven confirmed cases of haemophilia amongst the descendants of Queen Victoria are mentioned, as well as three other possible cases. The effect of haemophilia on the course of history is also investigated.

  3. Declarations on euthanasia and assisted dying. (United States)

    Inbadas, Hamilton; Zaman, Shahaduz; Whitelaw, Sandy; Clark, David


    Declarations on end-of-life issues are advocacy interventions that seek to influence policy, raise awareness and call others to action. Despite increasing prominence, they have attracted little attention from researchers. This study tracks the emergence, content, and purpose of declarations concerned with assisted dying and euthanasia, in the global context. The authors identified 62 assisted dying/euthanasia declarations covering 1974-2016 and analyzed them for originating organization, geographic scope, format, and stated viewpoint on assisted dying/euthanasia. The declarations emerged from diverse organizational settings and became more frequent over time. Most opposed assisted dying/euthanasia.

  4. Declarations on euthanasia and assisted dying (United States)

    Inbadas, Hamilton; Zaman, Shahaduz; Whitelaw, Sandy; Clark, David


    ABSTRACT Declarations on end-of-life issues are advocacy interventions that seek to influence policy, raise awareness and call others to action. Despite increasing prominence, they have attracted little attention from researchers. This study tracks the emergence, content, and purpose of declarations concerned with assisted dying and euthanasia, in the global context. The authors identified 62 assisted dying/euthanasia declarations covering 1974–2016 and analyzed them for originating organization, geographic scope, format, and stated viewpoint on assisted dying/euthanasia. The declarations emerged from diverse organizational settings and became more frequent over time. Most opposed assisted dying/euthanasia. PMID:28398131

  5. Die toekoms en ons roeping

    Directory of Open Access Journals (Sweden)

    S. du Toit


    Full Text Available Om te weet wat ons roeping in die toekoms sal wees, moet ons eers besef wat in ons eie tyd aan die gang is en langs watter lyne die dinge beweeg. Dit is ons plig om te let op die tekens van die tye in die lig van die profetiese Woord. En dan wil ons dadelik beklemtoon dat ons in Suid-Afrika nie in die waan moet lewe dat ons hier onbekommerd en onaangetas deur die wêreldgebeure ons roeping en bestemming kan uitwerk nie.

  6. Die owerheidsinmenging met betrekking tot kerklike tughandelinge.

    Directory of Open Access Journals (Sweden)

    L. Roeleveld


    Full Text Available Volgens art 29 NGB is die merktekens van die ware kerk die suiwere prediking van die Evangelie, die suiwere bediening van die Sakramente en die gebruik van die kerklike tug. Art. 32 NGB spreek uit dat die Kerkorde nie mag afwyk van wat Christus ingestel het nie. Menslike vindinge en wette om die gewetens te bind en te dwing, moet daarom verwerp word. Die ekskommunikasie of die ban moet toegepas word volgens die Woord van God.

  7. Pentateugtradisies in die boek Hosea

    African Journals Online (AJOL)

    om te bepaal of die verwysing na 'n gebeure te doen het met die verre verlede of met die .... Hosea 2:1-2 JHWH se trou aan sy beloftes. ... dat huile na Egipte sal terugkeer. Die presiese bedoeiing van die woorde 'huile sal terugkeer na Egipte' is omstre- de. Kommentatore soos Rudolph meen dat dit verstaan moet word as ...

  8. Die begrafnisdíens

    African Journals Online (AJOL)

    (De Vaux 1961:108). Was die begrafnis 'n familie of 'n kerklike aangeleentheid? Hierdie vraag word nie in die Bybel beantwoord nie. Abraham het sy vrou begrawe (Gen 23: 19-. 20). Isak en Ismael ..... ver gekom om die begrafnis 'n kerklike aangeleentheid te maak nie. Hierdie stap .... trou aan die sorg van God. * Die kerk ...

  9. Metodes in die Christelike etiek

    African Journals Online (AJOL)

    The basic question in Christian ethics is not primarily. 'What should I do?' The basic question is rather ' ... should therefore be accepted as being part of the method used in Christian ethics. 1. INLEIDEND ..... aan die kant van die onderdrukte' verkondig word, word die Christen opgeroep om horn te skaar aan die kant van die ...

  10. Antiretroviral therapy status among people who died of AIDS-related causes from 2009 to 2013 in Brazil: a population-based study. (United States)

    de Freitas, Marcelo Araújo; Miranda, Angélica Espinosa; Pascom, Ana Roberta Pati; de Oliveira, Silvano Barbosa; Mesquita, Fabio; Ford, Nathan


    To describe the antiretroviral therapy status of people living with HIV (PLHIV) who died of AIDS-related causes between 2009 and 2013. We conducted a cross-sectional, population-based study. Data were obtained by linking the mortality information system and the national ART dispensing database. Trends were modelled using linear regression analysis. A total of 61 425 AIDS-related deaths were registered in Brazil between 2009 and 2013. Median age at death was 41 years (IQR: 33-49), and 65.7% (40 337) of deaths were among men; 47.2% (29 004) of PLHIV who died during the study period had never started treatment, 7.0% (4274) had discontinued it, 15.9% (9775) were on ART for 6 months or less and 29.9% (18 372) were on ART for more than 6 months. Only 1.3% of PLHIV were on third-line ARV regimens when they died. AIDS-related mortality remains a challenge even in a context of sustained universal access to antiretroviral treatment due to failure of service provision, not to therapy failure. Robust health policies closing gaps in the HIV continuum of care are crucial to further reduce mortality. © 2016 John Wiley & Sons Ltd.

  11. Die teologiese skool in die P.U.K vir C.H.O.: met die betekenis van die teologiese skool vir die Christelike wetenskap

    Directory of Open Access Journals (Sweden)

    F. Postma


    Full Text Available Die Teologiese Skool van die Gereformeerde Kerk gedink op 29 November 1944 sy vyf-en-sewentigjarige bestaan.Die Raad en Senaat van die P.U.K. vir C.H.O. wil ook langs hierdie weg die Teologiese Skool van harte gelukwens en die versekering gee dat daar by die outoriteite van die P.U.K. ’n diepgevoelde dankbaarheid heers dat hierdie inrigting sovele jare deur onse God en Vader gedra en gespaar is.

  12. Die omvang en aard van afwesigheid in die werkplek: ‘n Suid-Afrikaanse gevalstudie

    Directory of Open Access Journals (Sweden)

    Anel Du Plessis


    Full Text Available The scope and nature of absenteeism in the workplace: A South African case study. The objective of the study was to develop quantitative measures for monitoring trends of absenteeism in a company within the meat industry and to assess qualitatively the possible existence of a collective culture of absenteeism within the organisation. The scope and frequency of absenteeism, costs incurred due to absenteeism, and individual absenteeism patterns of 145 employees, were studied over a period of one year. It was found that 2900 planned and 912 unplanned leave workdays that were lost, resulted in direct costs of R895,054.55. Five employees who were absent most often accounted for 18.60% of the unplanned leave taken. The extraordinary levels of absenteeism found in this case study were ascribed to specific employees. Opsomming Die doel van die studie was om kwantitatiewe metings vir die monitering van afwesigheidstendense vir ‘n maatskappy in die vleisbedryf te ontwikkel en om die moontlike bestaan van ‘n kollektiewe afwesigheidskultuur kwalitatief te ondersoek. Die omvang, frekwensie en koste van afwesigheid, asook individuele afwesigheidspatrone, is bestudeer vir 145 werknemers oor ‘n tydperk van een jaar. Daar is bevind dat 2900 beplande en 912 onbeplande verlofwerkdae wat verloor is, die maatskappy R895,054.55 gekos het. Vyf werknemers wat die meeste afwesig was, was verantwoordelik vir 18,60% van die onbeplande verlof geneem. Die uitsonderlike vlakke van afwesigheid in hierdie gevalstudie is toegeskryf aan spesifieke werknemers.

  13. Living and dying: responsibility for end-of-life care in care homes without on-site nursing provision - a prospective study. (United States)

    Handley, Melanie; Goodman, Claire; Froggatt, Katherine; Mathie, Elspeth; Gage, Heather; Manthorpe, Jill; Barclay, Stephen; Crang, Clare; Iliffe, Steve


    The aim of the study was to describe the expectations and experiences of end-of-life care of older people resident in care homes, and how care home staff and the healthcare practitioners who visited the care home interpreted their role. A mixed-method design was used. The everyday experience of 121 residents from six care homes in the East of England were tracked; 63 residents, 30 care home staff with assorted roles and 19 National Health Service staff from different disciplines were interviewed. The review of care home notes demonstrated that residents had a wide range of healthcare problems. Length of time in the care homes, functional ability or episodes of ill-health were not necessarily meaningful indicators to staff that a resident was about to die. General Practitioner and district nursing services provided a frequent but episodic service to individual residents. There were two recurring themes that affected how staff engaged with the process of advance care planning with residents; 'talking about dying' and 'integrating living and dying'. All participants stated that they were committed to providing end-of-life care and supporting residents to die in the care home, if wanted. However, the process was complicated by an ongoing lack of clarity about roles and responsibilities in providing end-of-life care, doubts from care home and primary healthcare staff about their capacity to work together when residents' trajectories to death were unclear. The findings suggest that to support this population, there is a need for a pattern of working between health and care staff that can encourage review and discussion between multiple participants over sustained periods of time. © 2013 John Wiley & Sons Ltd.

  14. Die Frage nach Gerechtigkeit.

    Directory of Open Access Journals (Sweden)

    Martin Jäggle


    Full Text Available ENGLISH: In the first part six stages in the author’s path of life are described, which have influenced his engagement with justice. The second part gives an insight into his religious educational work, in which the issue of justice was especially significant on the example of ‘religion in the context of migration’ and of the ecumenic initiative ‘’ (school worth living. The vision of the Kingdom of God and the necessity of participation become apparent. DEUTSCH: Im ersten Teil werden sechs Stationen am Lebensweg des Autors beschrieben, die seine Auseinandersetzung mit Gerechtigkeit geprägt haben. Der zweite Teil gibt Einblick in seine religionspädagogische Arbeit, in der die Frage nach Gerechtigkeit besonders bedeutsam war am Beispiel ‚Religion im Kontext Migration‘ und der ökumenischen Initiative ‚‘. Die Vision vom Reich Gottes und die Notwendigkeit von Partizipation werden dabei deutlich.

  15. Die EG-Kabotageverordnung


    Basedow, Jürgen


    Die EG-Kabotageverordnung : e. Schritt zur Verwirklichung d. Dienstleistungsfreiheit im Straßengüterverkehr / Jürgen Basedow ; Ansgar Held. - In: Europäische Zeitschrift für Wirtschaftsrecht. 1. 1990. S. 305-308

  16. Die Bibliothek des Bezirksmuseums Josefstadt

    Directory of Open Access Journals (Sweden)

    Maria Ettl


    Josefstadt in Wien werden die Herkunft der Bibliotheksbestände und die beengte Raumsituation beschrieben. Abschließend wird auf die Erfassung der Medien mittels der Bibliothekssoftware „Biblioweb“ eingegangen.

  17. Die Freunde im und die Freude am Fernsehen

    Directory of Open Access Journals (Sweden)

    Amina Ovcina Cajacob


    Full Text Available Das Ziel der vorliegenden Arbeit besteht darin, die Wirkungen von Popstars und Popbands auf Jugendliche (13- bis 17-Jährige zu erforschen. Im Mittelpunkt der Interessen steht die Frage, welche Wirkungen aus der Rezeption von Musiksendungen (bzw. Videoclips von Musiksendern entstehen und welche Charakteristika innerhalb der aufgebauten Beziehungen zu den Stars bemerkbar sind. Andererseits wurden die Unterschiede und Parallelen zwischen parasozialen Beziehungen zu den Stars und orthosozialen Beziehungen aufgezeigt. Im Zusammenhang mit der empirischen Untersuchung bezieht sich die Autorin auf den Uses-and-Gratifications-Approach, wobei die bedürfnissbefriedigenden Wirkungen von Musikkanälen und den dazu gehörigen Popstars im Mittelpunkt stehen. Mit Hilfe des Uses-and-Gratifications-Approach wird angenommen, dass das Konsumieren der Musiksendungen und der Musikstars von den Jugendlichen gezielt zur Befriedigung bestimmter Bedürfnisse eingesetzt wird.The objective of this study is to explore the effects of pop stars on adolescents (aged between 13 and 17. The focus of interest is the question what effect music channels (i.e. video clips from music channels produce and what characteristics are noticeable from the formed relationship between adolescents and pop stars. On the other side, parallels and differences have been drawn between the para-social relationships to pop stars and ortho-social relationships. In connection with empirical study, the author also refers to Uses-and Gratification-Approach where the need satisfying effects of music channels and pop stars are in focus. With the help of Uses-and Gratification-Approach it will be assumed, that aim of watching music channels and therefore pop stars will be pointed toward the gratification of specific needs.

  18. Experimental studies on improving the performance of electrochemical machining of high carbon, high chromium die steel using jet patterns

    Directory of Open Access Journals (Sweden)

    V. Sathiyamoorthy


    Full Text Available Electrochemical machining (ECM is a non-traditional process used mainly to cut hard or difficult-to-cut metals, where the application of a more traditional process is not convenient. Stiff market competition and ever-growing demand for better, durable and reliable products has brought about a material revolution, which has greatly expanded the families of difficult-to-machine materials namely highcarbon,high-chromium die steel; stainless steel and superalloys. This investigation attempts to analyze the effect of electrolyte distribution on material removal rate (MRR and surface roughness (SR on electrochemical machining of high-carbon, high-chromium die steel using NaCl aqueous solution. Three electrolyte jet patterns namely straight jet in circular, inclined jet in circular and straight jet in spiral were used for this experimentation. The results reveal that electrolyte distribution significantly improves the performance of ECM and the straight jet in spiral pattern performs satisfactorily in obtaining better MRR and surface roughness.

  19. Die postpolitische Stadt

    Directory of Open Access Journals (Sweden)

    Erik Swyngedouw


    Full Text Available Die Polis ist tot, es lebe die kreative Stadt! Während die Stadt, zumindest in Teilen des städtischen Raums, blüht und gedeiht, scheint die Polis im idealisierten griechischen Sinn dem Untergang geweiht; in diesem Verständnis ist sie der Ort der öffentlichen politischen Auseinandersetzung und demokratischen Unterhandlung und somit eine Stätte (oft radikaler Abweichung und Unstimmigkeit, an der die politische Subjektivierung buchstäblich ihren Platz hat. Diese Figur einer entpolitisierten (oder postpolitischen und postdemokratischen Stadt im Spätkapitalismus bildet das Leitmotiv des vorliegenden Beitrags. Ich lehne mich dabei an Jacques Rancière, Slavoj Žižek, Chantal Mouffe, Mustafa Dikeç, Alain Badiou und andere Kritiker jenes zynischen Radikalismus an, der dafür gesorgt hat, dass eine kritische Theorie und eine radikale politische Praxis ohnmächtig und unfruchtbar vor jenen entpolitisierenden Gesten stehen, die in der polizeilichen Ordnung des zeitgenössischen neoliberalen Spätkapitalismus als Stadtentwicklungspolitik [urban policy] und städtische Politik [urban politics] gelten. Ziel meiner Intervention ist es, das Politische wieder in den Mittelpunkt der zeitgenössischen Debatten über das Urbane zu stellen. [...

  20. Feasibility study for new ecolabels according to ISO 14024 (type 1) within the product group: wood pellet heating systems; Machbarkeitsstudie fuer neue Umweltzeichen fuer die Produktgruppe: Holzpelletfeuerungen

    Energy Technology Data Exchange (ETDEWEB)

    Hoffmann, E.; Weiss, J.; Hirschl, B. [Institut fuer Oekologische Wirtschaftsforschung (IOEW) gGmbH, Berlin (Germany)


    This assessment is a feasibility study according to ISO 14024. It deals with the question whether an ecolabel is suitable for wood pellet heating systems and how concrete criteria for an ecolabel for wood pellet heating plants could be specified. The study begins with a comprehensive market analysis in order to identify possible plants for which an ecolabel would make sense. In the main part of the study, the environmental relevance of the chosen plants is analysed. For this analysis, plant manufacturers were interviewed and a comparison between wood pellet heating systems and heating systems which use gas, oil or wood was carried out. On the basis of this analysis, it was possible to derive a number of criteria which were discussed with company representatives and other experts in this field. As a result of this dialogue and the investigation process as a whole, the introduction of an ecolabel for wood pellet heating plants can be recommended. Wood pellet heating systems are characterized by their high level of automatation and the use of standardized fuels with constant high quality. Thus, they reach high combustion quality with low emission rates, and risks of misuse are minimized. They may contribute to the increased use of renewable energies and thereby to the achievement of climate protection goals. The proposed certification principles comprise requirements regarding (a) the efficient energy use (efficiency factor under partial load and nominal load, plant's supplementary energy consumption), (b) emission values for CO, NO{sub x}, dust and organic substances, (c) the offer of additional services, as well as (d) requirements with regard to the operating instructions. The transcription of the label is proposed as 'Ecolabel.. because low emission and energy-efficient'. (orig.) [German] Beim vorliegenden Gutachten handelt es sich um eine Machbarkeitsstudie nach ISO 14024. Es behandelt die Frage, ob ein Umweltzeichen fuer Holzpelletfeuerungen

  1. Die invloed van gesondheidsopvoeding op die prevalensie van skistosoombesmettings by leerders in ’n skistosoom - endemiese gebied in die Limpopoprovinsie

    Directory of Open Access Journals (Sweden)

    Corrie Wolmarans


    Full Text Available In hierdie studie is geselekteerde direkte en indirekte onderrigmetodes geëvalueer ten opsigte vanhulle potensiaal om die prevalensie van skistosoombesmettings by skoolgaande kinders, woonagtigin ’n landelike omgewing in ’n skistosoom-endemiese gebied, te verlaag. Twee direkte (poppekas enblaaibord en drie indirekte (plakkaat, kennisgewingbord en onderrig via ouers of voogdeonderrigmetodes is geëvalueer.Skistosoombesmette leerders is met behulp van parasitologiese metodes geïdentifiseer en aan ’nvraelys in hul moerdertaal onderwerp om onder andere op hoogte van hulle kennis ten opsigte vanskistosomose te kom en te bepaal hoe die infrastruktuur tot hulle beskikking wat water en sanitasiebetref, daar uitsien. Leerders is met behulp van plaaslike gesondheidspersoneel vir die siekte behandelen daarna op verskeie geleenthede in samewerking met plaaslike onderwysers aan die verskillendeonderrigmetodes blootgestel.’n Aansienlike toename in die leerders se kennis aangaande skistosomose is reeds na die tweedeonderrigsessie waargeneem. Ten spyte van die feit dat die leerders in ’n skistosoom-endemiesegebied woonagtig was, het slegs 2% die siekte met ’n natuurlike waterhabitat soos ’n rivier geassosieer.Daar is verder gevind dat relevante amptelike strukture soos klinieke, geneeshere en skole byna geenrol speel in die verskaffing van inligting van wat die siekte behels en hoe dit oorgedra word nie.Betekenisvolle afnames in die kumulatiewe prevalensie van besmetting het by al die groepe, wat aandie onderskeie onderrigmetodes blootgestel was gedurende die ondersoek, voorgekom, wanneer ditmet die kontrolewaarde waar die leerders geen onderrig ontvang het nie, vergelyk is. Statistiesevergelykings tussen die verskillende onderrigmetodes het getoon dat die poppekas, blaaibord enplakkaat die effektiefste was om die prevalensie te verlaag, terwyl die gebruik van ouers of voogdedie minste effektief was. Alhoewel die kumulatiewe prevalensie van

  2. Die histologie en ultrastruktuur van die hepatopankreas van die bloukurper Oreochromis mossambicus

    Directory of Open Access Journals (Sweden)

    M. M. Nel


    Full Text Available Die histologie en ultrastruktuur van die hepatopankreas van die bloukurper Oreochromis mossambicus word beskryf. ’n Dun bindweefselkapsel omring die lewer. Die hepatosietrangskikking vertoon as lobules, met die koorde van hepatosiete wat vanaf ’n sentrale vene uitradieer en met mekaar anastomaseer. Indiwiduele lewerlohules vertoon nie duidelike grense nie, maar enkele duidelike triades word wel in die lewer van O. mossambicus aangetref. Die hepatosiete bevat ’n enkele ronde kern met ’n duidelike nukleolus en die growwe endoplasmiese retikula kom in twee of meer rye om die kerne en teen die selgrense van die hepatosiete voor. Die ander sitoplasmiese organelle kom verspreid in die hepatosietsitoplasma voor. Die eksokriene pankreasselle is om die portale venes gesetel. Die kerne van hierdie selle is rond en is hasaal in die kubies- tot silindervormige selle gelee. ’n Goedontwikkelde growwe endoplasmiese retikulum — vesikulêr, tubulêr en sirkulêr in vorm — en sektretoriese granules wat apikaal in die sel gelee is, kom voor.

  3. Die teologiese arbeid van Antonius HJ Gunneweg

    African Journals Online (AJOL)

    En dis 'n klein treetjie van klagte na aanklag en na protes teen die gode, die heersers wat die mens vernietig deur hom oor sy ware lewe te bedrieg. Die ideologie eis dan ook dienooreenkomstig die bevryding en emansipasie van die mens van die gode en van God (1983: 118—119). Volgens die Jahwis is dit die slang wat, ...

  4. Pyramids and Prejudice: A Study of Cultural Discrimination in Lauretta Ngcobo’s And they didn’t die

    Directory of Open Access Journals (Sweden)

    Sophia I. Akh uemokhan


    Full Text Available A South African classic, Lauretta Ngcobo’s novel, And they didn’t die, explores the nexus of hegemony, culture, and transformation under apartheid rule. Edward Said’s thesis on the hierarchy of culture provides the conceptual framework for an analysis of politico-cultural agency in Ngcobo’s novel. Three characters in the narrative—Siyalo, Jezile, and Lungu—are used to comment on the cultural dynamics inherent in three different but interlocking sites: the nine-to-five working environment, rural Bantu culture, and the ambiguous location of “African Whiteness.” The paper establishes that the life of each character betrays culture’s negative discriminating power and the amplification of negativity by State policy

  5. Wie is die goeie Samaritane? Eienskappe van vrywilligers in Suid-Afrika


    Krugell, Waldo


    Mense wat vrywillig en sonder betaling hul arbeid aanbied vir die produksie van goedere en dienste waaruit ander voordeel trek, speel 'n belangrike rol in die ekonomie en gemeenskap. As vrywilligers beter verstaan word, kan hul kragte dalk beter gemobiliseer word. Die vraag is dus: Wie is die goeie Samaritane? Hierdie studie ondersoek die eienskappe van vrywilligers in Suid-Afrika met behulp van data uit die Arbeidsmagopname van September 2007. Die resultate toon dat vrywilligers in Suid-Afri...

  6. Die benutting van vraelyste met die oog op meer effektiewe ...

    African Journals Online (AJOL)


    effektiewe stresbeheer as een van die temas te hanteer. Op grond van die navorsing deur onder andere Lawson (1985) en Taylor (1999) sou ek graag die proses van differensiasie2 ook by genoemde lys voeg as tema vir bespreking tydens huweliksvoorbereiding. 2 Differensiasie kan beskryf word as die losmaakproses ...

  7. die aard van wetgewende diskresies by die suid-afrikaanse ...

    African Journals Online (AJOL)


    In enige moderne demokrasie is daar een of ander vorm van skeiding van magte tussen die wetgewende, uitvoerende en regsprekende gesag. Hierdie skeiding van magte, die sogenaamde trias politica, kan sover teruggevoer word as 1215, met die ondertekening van die Magna Carta deur Koning John van Engeland.

  8. die doeltreffendheid van die afrikaanse woordelys en spelreels

    African Journals Online (AJOL)

    sluiting by die reel vir die verdubbeling van medeklinkers na 'n kort, be- klemtoonde klinker, woorde soos ballet, ballon, terras, terrein, dissipel en dissipline slegs met een konsonant na die eerste vokaal gespel moes word, omdat daardie voorafgaande vokaal onbeklemtoon is. Ook hierdie uit- sondering op die reel word ...

  9. Die aanspraak op Goddelike steun in 'n konfliksituasie volgens die ...

    African Journals Online (AJOL)

    laws, and ethical or political principles. A synchronic investigation of relevant Old ... die toneel gebring met die vraag: 'aan wie se kant is God' (vgl bv The road to. Damascus 1979:6)? Volgens .... betrekking tot die Ou Testament: Hoe moet ons vasstel wie se kant God nou regtig kies, of wie veg aan die kant van God en wie ...

  10. Die evaluering van 'n bestuursopleidingskursus met behulp van die posmandjie-tegniek

    Directory of Open Access Journals (Sweden)

    W. de Jager


    Full Text Available The evaluation of a management training course by using the in-basket technique. A management training course was evaluated for effectiveness by using two specially compiled in-basket exercises equivalent in complexity. Outcome evaluation was performed so as to determine whether learning transfer took place, ie., whether management skills in the application of planning, organising and control manifest in the work context afterwards. Significant differences were found between the experimental and the control group and were investigated by means of the "Univariate procedure". This management training course could effectively be measured with the behaviour assessment approach using two groups, where only the one group was exposed to a management training course to assess whether management behaviour changed as a result of learning transfer. This study utilises the in-basket technique as an instrument for training course evaluation. Opsomming Die effektiwiteit van 'n bestuursopleidingskursus is geevalueer aan die hand van gedragverandering soos gemeet deur twee posmandjies van dieselfde moeilikheidsgraad. Uitkomsevaluering is gedoen om te bepaal of leeroordrag plaasgevind het, met ander woorde/ of the nuut aangeleerde bestuursvaardighede in die toepassing van die bestuursdimensies beplanning, organisering en beheer wel na die tyd in die konteks van werkgedrag manifesteer. Beduidende verskille tussen die eksperimentele en die kontrole groep is gevind. Dit is ondersoek met behulp van enkelveranderiike-variansie-ontleding. Die bestuursopleidingskursus kon effektief vanuit die gedragbeoordelingsbcnadering gemeet word by twee groepe, waar slegs die een groep aan 'n bestuursopleidingskursus blootgestel word om te kon bepaal of bestuursgedrag verander het. Die studie benut die posmandjie-tegniek as kursusevalueringsinstmment.

  11. Die verband tussen waargenome leierskap en die vlak van outonomie binne spanverband

    Directory of Open Access Journals (Sweden)

    A. Van der Heyde


    Full Text Available The relationship between perceived leadership and the level of outonomy in a team context remains a contemporary theme in the work environment and seemingly has a substantial influence on organisational success. This study attempted to ascertain the relationship between leadership and the level of outonomy in a team context. Two hundred and thirty (N=230 individuals, grouped into 56 teams from four South African companies participated in the study. The superordinate’s leadership style as well as the level of outonomy in the specific group was measured. Apart from the useful information obtained in comparison with international research, especially in terms of leadership data, the study did conclusively point out a significant correlation between leadership style and autonomy in team context. Opsomming Leierskap en selfgerigte spanfunksionering bly kontemporêre temas in die bedryfsmilieu, wat oënskynlik organisasiesukses wesenlik kan beïnvloed. Die doel van hierdie studie was om die waargenome verband tussen leierskap en die vlak van outonomie binne spanverband te bepaal. Tweehondered-en-dertig (N=230 individue, gegroepeer in 56 spanne vanuit vier Suid-Afrikaanse maatksappye het aan die studie deelgeneem. ‘n Meting van sowel die bogeskikte se leierskapstyl en die vlak van outonomie binne spanverband is verkry. Afgesien van bruikbare inligting rondom veral die leierskapdata in vergelyking met internasionale navorsing, het die studie ‘n beduidende verband tussen leierskapstyl en outonomie binne spanverband uitgewys.

  12. Die design and process optimization of die cast V6 engine blocks

    Directory of Open Access Journals (Sweden)

    Henry Hu


    Full Text Available The use of aluminum, particularly for engine blocks, has grown considerably in the past ten years, and continues to rise in the automotive industry. In order to enhance the quality and engineering functionality of die cast engine blocks, die design and processes have to be optimized. In this study, a computer simulation software, MAGMAsoft, as an advanced tool for optimizing die design and casting process, was emplooyed to virtually visualize cavity filling and patterns of a V6 engine block. The original die design and process was simulated first to establish a baseline. A reality check was used to verify the predicted results. Then, the die modification with a different unner system was made by using a CAD software, Unigraphics (UG. The simulation on combinations of the modified die design and revised process was performed to examine the effect of die modification and process change on flow filling of V6 engine blocks. The simulated prediction indicateds that the enhancement of cavity filling due to the die and process modification minimizeds the occurrence of defects during casting, and consequently improves the quality of blocks. The results of mechanical testing show a significant increase in fatigue strengths, and a moderately improvement on tensile properties for the blocks die cast with the new die design and prpocess in comparison with those produced by the original ones.

  13. Comparison Re-invented: Adaptation of Universal Methods to African Studies (Conference Report Die Wiederentdeckung des Vergleichs: Zur Anwendung universeller Methoden in der Afrikaforschung (Konferenzbericht

    Directory of Open Access Journals (Sweden)

    Franzisca Zanker


    Full Text Available Drawing from a combination of specific, empirical research projects with different theoretical backgrounds, a workshop discussed one methodological aspect often somewhat overlooked in African Studies: comparison. Participants addressed several questions, along with presenting overviews of how different disciplines within African Studies approach comparison in their research and naming specific challenges within individual research projects. The questions examined included: Why is explicit comparative research so rare in African Studies? Is comparative research more difficult in the African context than in other regions? Does it benefit our research? Should scholars strive to generalise beyond individual cases? Do studies in our field require an explicit comparative design, or will implicit comparison suffice? Cross-discipline communication should help us to move forward in this methodological debate, though in the end the subject matter and specific research question will lead to the appropriate comparative approach, not the other way round.Mit Blick auf einige empirische Forschungsprojekte mit jeweils unterschiedlichem theoretischem Hintergrund wurde im Rahmen eines Workshops ein methodologischer Aspekt debattiert, der in der Afrikaforschung wenig Beachtung erfährt: der Vergleich. Die Teilnehmer(innen entwickelten Fragestellungen, stellten jeweils dar, inwieweit in den verschiedene Disziplinen der Afrikaforschung der Vergleich als Methode eingesetzt wird, und benannten spezifische Herausforderungen in diesem Zusammenhang für einzelne Forschungsprojekte. Unter anderem wurden folgende Fragen erörtert: Warum ist die explizit vergleichende Methode in der Afrikaforschung so selten? Ist vergleichende Forschung im Kontext Afrikas schwieriger anwendbar als in der Forschung zu anderen Regionen? Verbessert sie unsere Forschungsresultate? Sollten sich Forscher um Generalisierungen jenseits der Einzelfallstudien bemühen? Ist in der Afrikaforschung eine

  14. Awareness of Dying Preface

    Directory of Open Access Journals (Sweden)

    Barney G. Glaser, PhD, Hon. PhD


    Full Text Available Recently The New York Times reported: “VERY ILL CHILDREN TOLD OF DISEASE; Leukemia Patients at N.I.H. Not Shielded From Truth. . . . A child should always be told the truth, even when he has an incurable disease such as leukemia, according to two researchers who interviewed 51 children hospitalized at the National Cancer Institute, Bethesda, Maryland, for treat¬ment of leukemia.” This kind of news item reflects the growing concern among researchers and public about matters which touch on morality as much as on the technical aspects of medi¬cine. The rapidly increasing proportion of elderly people in the American population presents a range of personal and social questions; not the least is how they view their newly won longevity (often including anticipated years of chronic disease as well as their attitudes toward death. In consequence, many geriatric specialists are beginning to study American attitudes toward death, while others, spurred on by what seems a sense-less prolonging of life within hospital walls by medical tech¬nology run wild, are raising questions about death and dying in American life.

  15. Die huwelik as identiteitsmerker in die Ou Testament

    African Journals Online (AJOL)


    Gen 2:18). Uit die woorde van Genesis 2:24 dat man en vrou een sal wees, lei die derde formulier af dat dit “getuig dat die huwelik 'n allesinsluitende gemeenskap is ..... die formule gebruik word: “Hier volg die vertelling oor X se nageslag.” (Gen ..... verwys daarna as “intertwining the principal value concepts of tradition”.

  16. Die doeltreffendheid van talentbestuursprogramme in uitgesoekte Suid-Afrikaanse organisasies

    Directory of Open Access Journals (Sweden)

    Jo-Ann P. Gainsford


    Full Text Available Oriëntasie: Die identifisering, behoud en ontwikkeling van talent moet doeltreffend bestuur word. Navorsingsdoelwit: Die studie het ten doel om die doeltreffendheid van bestaande talentbestuursprogramme in uitgesoekte Suid-Afrikaanse organisasies in die finansiële, vervoer- en mynbousektore te evalueer.Motivering vir die studie: Streng wetgewing (soos regstellende aksie en die swak ekonomiese situasie in Suid-Afrika veroorsaak dat goeie presteerders as baie waardevol beskou word en behou moet word. Indien organisasies nie oor ’n doeltreffende talentbestuursprogram beskik nie, sal hulle waarskynlik talentvolle werknemers verloor.Navorsingsontwerp, -benadering en -metode: Hierdie studie maak van ’n kwantitatiewe navorsingsontwerp gebruik. Deur middel van toevallige steekproefneming is 117 werknemers in die onderskeie sektore ingesluit. Die ANOVA-toets en Tukey se paarsgewyse vergelykingstegniek is aangewend om die verskille tussen die drie sektore te bepaal.Resultate: Die resultate van die studie dui daarop dat die organisasies wat aan die studie deelgeneem het grootliks al die noodsaaklike komponente in die talentbestuursprogramme insluit. Die uitsondering is egter talentbestuursagteware, wat oor die algemeen nie in die talentbestuursprogramme ingesluit is nie. Verdere resultate dui daarop dat die oorgrote meerderheid van die respondente nie baie tevrede is met die komponente van die talentbestuursprogramme in hul organisasies nie. Die respondente van die mynbousektor het die laagste tevredenheidsvlakke ten opsigte van die talentbestuursprogram getoon. Die resultate dui verder daarop dat die finansiële sektor se talentbestuursprogram meer doeltreffend as dié van die mynbousektor is.Praktiese/bestuursimplikasies: ’n Omvattende lys van komponente van ’n talentbestuursprogram is ontwikkel om organisasies te ondersteun in die ontwerp en implementering van ’n doeltreffende talentbestuursprogram.Bydrae/waardetoevoeging: Die resultate van

  17. Narratiwiteit en die Ou Testament

    African Journals Online (AJOL)

    INLEIDING. Die literêre benadering tot die Ou-Testamentiese narratiewe word algemeen as 'n alternatiewe paradigma in die Bybelwetenskappe aanvaar. Oor die filosofiese uit- gangspunte wat hierdie nuwe paradigma ten grondslag lê, bestaan daar egter nog weinig eenstemmigheid. Heelwat probleme van filosofiese en ...

  18. Eksistensialisme in die Franse letterkunde

    Directory of Open Access Journals (Sweden)

    A. A. Teurlinckx


    Full Text Available Nooit sou die Franse jeug — en die van Europa en verder — in dié mate deur die eksistensialisme be'invloed gewees het nie, indien hierdie filosofie in wysgerige traktate sou begrawe gelê het. Die eksistensialiste het die koning van die filosofiese verhaal, Voltaire, met sukses op sy Candide- en Zadig-pad gevolg en hulle teorieë in letterkundige werke, ver- hale, romans en ook toneelstukke kwytgeraak, wat baie gelees is en waaruit ook ander literatore kragte en inspirasie geput het. Omrede daarvan is daar inderdaad baie eksistensialisme in die Franse letterkunde, maar ’n eintlike eksistensialistiese letterkunde was daar nie, en ’n Eksistensialistiese Letterkun­ dige skool het nooit bestaan nie. Ook sit hierdie eksistensialiste nie langs dieselfde vuur nie. Die Christelike eksistensialis Gabriel Marcel het op 21 April van hierdie jaar uitgevaar teen die „Sartriane” na aanleiding van die opvoering van Les Paravents, Die W indskerms van Jean Genêt in ’n Paryse staatsondersteunde teater. „Mens mag seker wees”, skryf Marcel in Les Nouvelles Littéraires, „dat die hele sartriaanse parogie sal skreeu: groot meesterwerk”. Voortgaande op sy distansiëring kan die literêre eksistensialiste in drie groepe ingedeel word: 1. Die Sartriane; 2. Die Christelike Eksistensialiste; 3. Die Onafhanklikes.

  19. Verslaggewing oor volhoubaarheid in die mynbousektor: die identifisering van kritieke aan geleenthede


    Viviers, S; Boudler, J-M


    Hierdie studie ondersoek tendense in die volhoubaarheidsverslaggewing deur vyf prominente mynmaatskappye wat op die JSE genoteer is. Die 2005-, 2006-, 2007- en 2008- jaar- en volhoubaarheidsverslae van hierdie maatskappye is ontleed deur middel van inhoudsanalise. Sleutelwoorde wat verband hou met ekonomiese bemagtiging, MIV/VIGS, ander gesondheid- en veiligheidsaangeleenthede en omgewingsimpak sowel as opleiding en onderwys, is getel. Hierdie aangeleenthede is ook gekategoriseer in terme van...

  20. Gaining consensus on family carer needs when caring for someone dying at home to develop the Carers' Alert Thermometer (CAT): a modified Delphi study. (United States)

    Knighting, Katherine; O'Brien, Mary R; Roe, Brenda; Gandy, Rob; Lloyd-Williams, Mari; Nolan, Mike; Jack, Barbara A


    To report a multi-phase modified Delphi study conducted with carers and professionals to identify the priority areas for inclusion in an alert screening tool for carers providing support to someone dying at home. Internationally, there is a growing emphasis on increasing choice for patients who wish to die at home which relies heavily on care provided by the unpaid family carers. Family carers can have high levels of unmet needs comprising their psychological and physical health and their ability to provide effective care and support. Development of an alert tool to identify carers' needs in everyday practice required identification and consensus of the priority areas of need for inclusion. Multi-phase modified Delphi study and instrument development. Qualitative and quantitative data collection took place between 2011-2013 with 111 carers and 93 professionals to identify carers' needs and gain consensus on the priority areas for inclusion in the alert tool. An expert panel stage and final evidence review post-Delphi were used. The Delphi panels had high levels of agreement and consensus. Ten areas of carer need across two themes of 'the current caring situation' and 'the carer's own health and well-being' were prioritized for inclusion in the alert tool. An optional end-of-life planning question was included following the final stages. The results provide evidence of carers' needs to be assessed, areas for consideration in the education of those who support carers and someone dying at home and targeting of services, while demonstrating the usefulness and adaptability of the Delphi method. © 2015 The Authors. Journal of Advanced Nursing Published by John Wiley & Sons Ltd.

  1. Assisted Dying in Canada. (United States)

    Schuklenk, Udo

    This paper makes an affirmative ethical case in favour of the decriminalization of assisted dying in Canada. It then proceeds to defending the affirmative case against various slippery-slope arguments that are typically deployed by opponents of assisted dying. Finally, a recent case of questionable professional conduct by anti-euthanasia campaigners cum academics is flagged as a warning to all of us not to permit the quality of the professional debate to deteriorate unacceptably, despite the personal emotional investments involved on all sides of the debate.

  2. Study on the Surface Microstructure of a Modified STD61 Steel Mold Used for the Die Casting Process

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Ha-Young; Lee, Seung-Joon; Kang, Minwoo; Lee, Suk-Jin; Lee, Young-Kook [Yonsei University, Seoul (Korea, Republic of); Yang, Won Jon [Korea Institute of Materials Science, Changwon (Korea, Republic of); Jeong, Jae Suk; Kim, Byung-Hoon [Doosan Heavy Industries and Construction, Changwon (Korea, Republic of)


    The surface microstructure and crack formation of an aluminum die-casting mold were investigated. The mold was made of a modified STD61 steel, and was used for more than 165,000 cycles. The mold surface consisted of four layers; an oxidized layer, a decarburized layer, a network carbide layer and a tempered martensite matrix. The depth down to the hardest network carbide layer was ⁓200 μm. Inside the matrix, M{sub 3}C transition carbides were dissolved so that solute C joined pre-existing M{sub 2}3C{sub 6} and MC carbides to make them coarse. About 60% of thermal fatigue cracks had a depth less than 200 μm due to the hard network carbide layer, which obstructed the propagation of cracks. Cracks of over 200 μm were filled with oxide wedges of Al and Si which was which flown from the molten alloy as well as the Fe oxide.

  3. Formation of blade and slot die coated small molecule multilayers for OLED applications studied theoretically and by XPS depth profiling (United States)

    Peters, Katharina; Raupp, Sebastian; Hummel, Helga; Bruns, Michael; Scharfer, Philip; Schabel, Wilhelm


    Slot die coaters especially designed for low material consumption and doctor blades were used to process small molecule solutions for organic light-emitting diodes (OLEDs). Optimum process parameters were developed for the large-scale coating techniques to generate stable single and multiple layers only a few nanometers thick. Achieving a multilayer architecture for solution-processed OLEDs is the most challenging step. X-ray photoelectron spectroscopy sputter depth profiling was performed to determine defined interfaces between coated organic layers. Commercially available small molecules NPB (N,N'-Di(1-naphthyl)-N,N'-diphenyl-(1,1'-biphenyl)-4,4'-diamine) and BAlq (Bis(8-hdroxy-2methylquinoline)-(4-phenylphenoxy)aluminum), originally developed for vacuum deposition, were used as hole, respectively electron transport material. Defined double-layers were processed with both scalable coating methods using the orthogonal solvent approach. The use of non-orthogonal solvents resulted in complete intermixing of the material. The results are explained by calculations of solubilities and simulating drying and diffusion kinetics of the small molecule solutions.

  4. Formation of blade and slot die coated small molecule multilayers for OLED applications studied theoretically and by XPS depth profiling

    Directory of Open Access Journals (Sweden)

    Katharina Peters


    Full Text Available Slot die coaters especially designed for low material consumption and doctor blades were used to process small molecule solutions for organic light-emitting diodes (OLEDs. Optimum process parameters were developed for the large-scale coating techniques to generate stable single and multiple layers only a few nanometers thick. Achieving a multilayer architecture for solution-processed OLEDs is the most challenging step. X-ray photoelectron spectroscopy sputter depth profiling was performed to determine defined interfaces between coated organic layers. Commercially available small molecules NPB (N,N’-Di(1-naphthyl-N,N’-diphenyl-(1,1’-biphenyl-4,4’-diamine and BAlq (Bis(8-hdroxy-2methylquinoline-(4-phenylphenoxyaluminum, originally developed for vacuum deposition, were used as hole, respectively electron transport material. Defined double-layers were processed with both scalable coating methods using the orthogonal solvent approach. The use of non-orthogonal solvents resulted in complete intermixing of the material. The results are explained by calculations of solubilities and simulating drying and diffusion kinetics of the small molecule solutions.

  5. Living and dying with dignity: a qualitative study of the views of older people in nursing homes. (United States)

    Hall, Sue; Longhurst, Susan; Higginson, Irene


    most older people living in nursing homes die there. An empirically based model of dignity has been developed, which forms the basis of a brief psychotherapy to help promote dignity and reduce distress at the end of life. to explore the generalisability of the dignity model to older people in nursing homes. qualitative interviews were used to explore views on maintaining dignity of 18 residents of nursing homes. A qualitative descriptive approach was used. The analysis was both deductive (arising from the dignity model) and inductive (arising from participants' views). the main categories of the dignity model were broadly supported: illness-related concerns, social aspects of the illness experience and dignity conserving repertoire. However, subthemes relating to death were not supported and two new themes emerged. Some residents saw their symptoms and loss of function as due to old age rather than illness. Although residents did not appear to experience distress due to thoughts of impending death, they were distressed by the multiple losses they had experienced. these findings add to our understanding of the concerns of older people in care homes on maintaining dignity and suggest that dignity therapy may bolster their sense of dignity.

  6. Formation of blade and slot die coated small molecule multilayers for OLED applications studied theoretically and by XPS depth profiling

    Energy Technology Data Exchange (ETDEWEB)

    Peters, Katharina; Raupp, Sebastian, E-mail:; Scharfer, Philip; Schabel, Wilhelm [Institute of Thermal Process Engineering, Thin Film Technology, Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Hummel, Helga [Philips Technologie GmbH Innovative Technologies, Aachen (Germany); Bruns, Michael [Institute for Applied Materials and Karlsruhe Nano Micro Facility (KNMF), Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany)


    Slot die coaters especially designed for low material consumption and doctor blades were used to process small molecule solutions for organic light-emitting diodes (OLEDs). Optimum process parameters were developed for the large-scale coating techniques to generate stable single and multiple layers only a few nanometers thick. Achieving a multilayer architecture for solution-processed OLEDs is the most challenging step. X-ray photoelectron spectroscopy sputter depth profiling was performed to determine defined interfaces between coated organic layers. Commercially available small molecules NPB (N,N’-Di(1-naphthyl)-N,N’-diphenyl-(1,1’-biphenyl)-4,4’-diamine) and BAlq (Bis(8-hdroxy-2methylquinoline)-(4-phenylphenoxy)aluminum), originally developed for vacuum deposition, were used as hole, respectively electron transport material. Defined double-layers were processed with both scalable coating methods using the orthogonal solvent approach. The use of non-orthogonal solvents resulted in complete intermixing of the material. The results are explained by calculations of solubilities and simulating drying and diffusion kinetics of the small molecule solutions.

  7. Die afrikaner en sy pers*

    Directory of Open Access Journals (Sweden)

    G. D. Scholtz


    Full Text Available Die versoek w at van u inrigting tot my gekom het om buitengewone professor in die Persw etenskap te word, was vir my deels vererend, m aar deels het dit my in 'n moeilike posisie gestel. Dit was vir my vererend, om dat dit gekom het van 'n universiteit m et wie se Christelik- Nasionale koers ek my ten voile kan vereenselwig. Dit was dan ook vir my vererend, om dat ek daardeur in staat gestel kan w ord om die volk w aartoe ek behoort, op 'n vir my nuwe terrein te dien. As sodanig is dit vir my im m ers m oontlik om ook ’n beskeie bydrae te lewer tot die geestelike vorm ing van die jeug van ons volk. Dit het my m oeilik geval om, w aar ek reeds die m iddeljarige leeftyd bereik het, nou vir die eerste maal as dosent op te tree, aangesien ek daarvan in die verlede nie die m inste kennis en ervaring opgedoen het nie. As joernalis rig ek my im m ers tot die breë publiek deur middel van die pen. As dosent m oet ek my deur middel van die mond tot die studente rig. Dit lê voor die hand dat die eise w at so aan my gestel word, totaal anders is as dié waar- aan ek oor 'n tydperk van m eer as 'n kw arteeu as joer­ nalis gewoond geraak het.

  8. Die vestiging van die Kerk in Natal, die Vrystaat en Transvaal na ...

    African Journals Online (AJOL)

    as eerste predikant van die Voortrekkers laat orden en bevestig. Daama het verskeie kerksake van tyd tot tyd aandag geniet. Met betrekking tot die bevestiging van huwelike stel Retief 'n meer ordelike reëling daar, naamlik dat die gebooie van voomemende egpa- re van nou af drie maal in die kerk afgekondig moes wrord ...

  9. 'n Ondersoek na die potensiaal-bepaling van werknemers in die landbousektor.

    Directory of Open Access Journals (Sweden)

    J. C. D. Augustyn


    Full Text Available An investigation into determining the potential of workers in the agricultural sector. Industrial Psychological principles and concepts are not being applied extensively in the agricultural sector. Against this background an attempt was made to scientifically identify potential and predict job performance amongst farm labourers. Using the PAQ method of job analysis, critical attributes were identified and a satisfactorily valid battery of tests was developed. The results of this study underlines the importance of the identification of the potential of farm labourers as a first step in the personnel management process. It also serves as a source of information that could be used by farmers for counselling purposes. Opsomming Wat die toepassing van Bedryfsielkundige beginsels en konsepte betref bestaan daar in die landboubedryf nog groot leemtes. Teen hierdie agtergrond is 'n poging aangewend om op 'n wetenskaplike wyse die potensiaal van plaasarbeiders te bepaal. Deur middel van die WOV-metode van posontleding is kritieke attribute by workers geidentifiseer en kon 'n toetsbattery met aanvaarbare geldigheid saamgestel word. Die resultate van die studie bevestig dat die identifisering van die potensiaal van plaaswerkers 'n noodsaaklike eerste stap in die personeelbestuursproses is. Dit kan ook met groot vrug as voorligtingshulpmiddel deur boere gebruik word.

  10. Kennisbasisse, gebruikspatrone en gebruikshindernisse ten opsigte van die riglyne vir die ontwikkeling en validering van personeelkeuringsprosedures

    Directory of Open Access Journals (Sweden)

    M. Boolsen


    Full Text Available The guidelines for the validation and use of personnel selection procedures: knowledge, usage and obstacles. Selection is a key human resources function in any organization. Expected changes in South African Labour Law combined with the importance of advancing organizational efficiency lead in 1992 to the publication of the Guidelines on the Development and Validation of Personnel Selection Procedures. The study in question is aimed at a description of the current knowledge base, usage patterns and usage obstacles vis-a-vis the Guidelines of a specific group of human resource specialists in South Africa. Recommendation based on the research findings are made. Opsomming Keuring is 'n sleutel menslike hulpbronbestuursfunksie in enige onderneming. Verwagte veranderinge in Suid-Afrikaanse Arbeidswetgewing en die noodsaaklikheid van die bevordering van organisatoriese doeltreffendheid lei in 1992 tot die publikasie van die Riglyne vir die Ontwikkeling en Validering van Personeelkeuringsprosedures. Die onderhawige studie is gerig op 'n beskrywing van die heersende kennisbasisse, gebruikspatrone en gebruiks- hindernisse vis-a-vis die Riglyne by 'n spesifieke groep menslike hulpbronkundiges in Suid-Afrika. Aanbevelings word op grond van die bevindinge gemaak.

  11. Die skool en die onderwyser as faktore in die geestesgesondheid van die kind*

    Directory of Open Access Journals (Sweden)

    B. C. Schutte


    Full Text Available Ons hou geestesgesondheidsweke, stig beroepsentrums, samel geld in om mense wat geestelik siek is te genees, klae oor die tekort aan psigiaters, kliniese sielkundiges, bedryfsielkundiges, voorligters, skoolpsigoloë,ens. ’n Karige kwarteeu gelede het ons aan al hierdie dinge slegs akademiese aandag gewy. In hierdie kursus wordverskeie tipes kinders bespreek en geleer hoe om hulle probleme te benader.

  12. When Somebody Dies (United States)

    ... bottle became useless. The container is gone, but what's inside — the water — remains. The part of a person that's left after the body dies is often called the "soul" or "spirit." Some people believe the soul is the part ...

  13. Die Kunst des Scheiterns

    DEFF Research Database (Denmark)

    Juul, Jesper


    Menschen haben von Kindesbeinen an das Verlangen, Erfolge zu erzielen und Kompetenz zu erreichen. Computerspieler entscheiden sich jedoch fortlaufend für eine Aktivität, die oft und wiederholt zum Verlieren führen muss und ein taubes Gefühl der Unfähigkeit erzeugt. Im Kino, im Theatersaal und bei...

  14. Modelle in die onderrig van fisika

    Directory of Open Access Journals (Sweden)

    J. J. A. Smit


    Full Text Available Die rol van modelle in die onderrig van fisika is sedert die vroeë tagtigerjare erken. In die onderrig word die absent op die kwantitaiewe aspekte van die vak geplaas, terwyl die kwatitatiewe aspekte min aandag kry.


    African Journals Online (AJOL)

    31 Okt 1977 ... stelling van 'n higiene afdeling het in 'n belang- rike behoefte voorsien. Die pligte van die SAGO het dus op hierdie stadium die ondersoek van soldate, die sanita- sie van kampe, die verpleging van pasiente in militere hospitale en die opleiding van lede be- hels. 'n Hoogtepunt was die opening van die.

  16. The impact of the social and physical environments on parent-healthcare provider relationships when a child dies in PICU: Findings from a grounded theory study. (United States)

    Butler, Ashleigh E; Copnell, Beverley; Hall, Helen


    This study explores the influences of the paediatric intensive care environment on relationships between parents and healthcare providers when children are dying. It forms part of a larger study, investigating parental experiences of the death of their child in intensive care. Constructivist grounded theory. Four Australian paediatric intensive care units. Audio-recorded, semi-structured interviews were conducted with twenty-six bereaved parents. Data were analysed using the constant comparison and memoing techniques common to grounded theory. The physical and social environment of the intensive care unit influenced the quality of the parent-healthcare provider relationship. When a welcoming, open environment existed, parents tended to feel respected as equal and included members of their child's care team. In contrast, environments that restricted parental presence or lacked resources for parental self-care could leave parents feeling like 'watchers', excluded from their child's care. The paediatric intensive care unit environment either welcomes and includes parents of dying children into the care team, or demotes them to the status of 'watcher'. Such environments significantly influence the relationships parents form with healthcare staff, their ability to engage in elements of their parental role, and their experiences as a whole. Copyright © 2017 Elsevier Ltd. All rights reserved.

  17. Die transvaalse ontwerp-ordonnansie oor die onderwys

    Directory of Open Access Journals (Sweden)

    J. C. Coetzee


    Full Text Available In ’n Buitengewone Provinsiale Koerant van die Provinsie Transvaal is onder datum 25 Junie 1952 gepubliseer ’n „Ontwerp-Ordonnansie tot samevatting en wysiging van die Wette betreffende die Sentrale Beheer van die Onderwys, die Plaaslike Beheer van Skole, Godsdiensonderrig in Openbare Skole, Taal en die Onderwys, Onderwyspersoneel, Verpligte Onderwys, Toelating van Leerlinge tot Skole, Klasse of Inrigtings, Openbare Onderwys, Private Skole, Onderwys vir Kleurlinge en Asiate en Onderwys vir Naturelle, en om vir sake in verband daarmee voorsiening te maak” .


    African Journals Online (AJOL)

    v a k t a a l k w a l i £ i k a s i e s ) neem d i e I n s t i t u t t a l l e take waar ter u i t b r e i d i n g van kennis van die Duitse taal in die buiteland. Sedert 1964 publiseer die. Institut die tydskrif Deutsch als Fremdsprache met die bylae Sprachpraxis, asook 'n handboek met die titel Deutsch - eln Lehrbuch Eur Auslander (Duits.

  19. Navigating "Assisted Dying". (United States)

    Schipper, Harvey


    Carter is a bellwether decision, an adjudication on a narrow point of law whose implications are vast across society, and whose impact may not be realized for years. Coupled with Quebec's Act Respecting End-of-life Care it has sharply changed the legal landscape with respect to actively ending a person's life. "Medically assisted dying" will be permitted under circumstances, and through processes, which have yet to be operationally defined. This decision carries with it moral assumptions, which mean that it will be difficult to reach a unifying consensus. For some, the decision and Act reflect a modern acknowledgement of individual autonomy. For others, allowing such acts is morally unspeakable. Having opened the Pandora's Box, the question becomes one of navigating a tolerable societal path. I believe it is possible to achieve a workable solution based on the core principle that "medically assisted dying" should be a very rarely employed last option, subject to transparent ongoing review, specifically as to why it was deemed necessary. My analysis is based on 1. The societal conditions in which have fostered demand for "assisted dying", 2. Actions in other jurisdictions, 3. Carter and Quebec Bill 52, 4. Political considerations, 5. Current medical practice. Leading to a series of recommendations regarding. 1. Legislation and regulation, 2. The role of professional regulatory agencies, 3. Medical professions education and practice, 4. Public education, 5. Health care delivery and palliative care. Given the burden of public opinion, and the legal steps already taken, a process for assisted-dying is required. However, those legal and regulatory steps should only be considered a necessary and defensive first step in a two stage process. The larger goal, the second step, is to drive the improvement of care, and thus minimize assisted-dying.

  20. Die verband tussen werkbetrokkenheid en werkprestasie

    Directory of Open Access Journals (Sweden)

    M. M. E. Bleeker


    Full Text Available The relationship between work involvement and work performance. The primary goal of the study was to determine whether a relationship exists between the work involvement scores and work performance ratings of employees. A secondary goal was to determine whether work involvement could predict future work performance. The ‘‘Alienation-Involvement Scale’’ together with the ‘‘Comprehensive Structured Interviewing for Potential’’, were applied to a sample of convenience of 200 employees in job levels of workers, teamleaders and managers in a large manufacturing organisation. Opsomming Die primere doel van die studie was om vas te stel of daar ’n verband bestaan tussen die werkbetrokkenheidtellings en die werkprestasie-beoordelings van werkers.’n Sekondere oogmerk was om te bepaal of werkbetrokkenheid toekomstige werkprestasie kan voorspel. Die ‘‘Alienation-Involvement Scale’’ saam met die ‘‘Comprehensive Structured Interviewing for Potential’’ is op ’n gerieflikheidsteekproef van 200 werknemers op die posvlakke vanwerkers, spanleiers en bestuurders in ’n goot vervaardigingsonderneming toegepas.

  1. Noodlottige kindermishandeling: 'n literatuuroorsig en die profiel in ...

    African Journals Online (AJOL)

    Literatuuroorsig en bespreking. Literatuuroorsig. 'n Studie wat in The Children's Hospital in Camperdown, Australië, onderneem is,3 toon dat die meerderheid slagoffers van noodlottige kindermishandeling (9 van 17 gevalle) jonger as een jaar oud was, terwyl die res van die slagoffers almal jonger as drie jaar oud was.

  2. Die Entnahmemorbidität und Resensibilisierung des Acromiopectorallappens im Vergleich zum Pectoralis-Major-Lappen in der rekonstruktiven Mund-, Kiefer-, Gesichtschirurgie: Retrospektive Studie 2000-2010


    Acar, Selva


    Die vorliegende Arbeit beschäftigt sich mit der Rolle der gestielten Lappen, am Beispiel des Acromiopectoral- und Pectoralis-Major-Lappens, in der modernen Mund-, Kiefer-, Gesichtschirurgie in einer Ära, in der mikrochirurgisch revaskularisierten, freien Transplantaten meist der Vorzug gegeben wird. Insbesondere wird auf die Einheilung und Resensibilisierung des Acromiopectoral- und Pectoralis-Major-Lappens in der Empfängerregion des Kopf-/Halsbereiches eingegangen. Es wurde die Leben...

  3. Die faktorstruktuur van Bass se veelfaktor- leierskapsvraelys in die Suid-Afrikaanse konteks

    Directory of Open Access Journals (Sweden)

    C .P. Ackermann


    Full Text Available The factor structure of Bass's Multifactor Leadership Questionnaire in the South African context. The aim of the study was to determine whether the factor structure of Bass's Multifactor Leadership Questionnaire (MLQ, as a measure of transformational leadership, could be replicated within the South African context. The MLQ was chosen not only because it promised to be a valid and reliable measuring instrument of the construct in question, but also due to the fact that there was an urgent need for such an instrument in the management of human resources within organisations undergoing transformation. The MLQ was administered to 406 subjects within the military context and was subjected to factor analysis and item analysis. The factor analysis yielded three factors, namely transformational leadership, transactional leadership and avoidance of leadership ("laissez faire" leadership. The reliabilities of the scales were determined by means of Cronbach's coefficient alpha, and yielded coefficients of 0,944, 0,736 and 0,803 respectively. The factor structure as conceptualised by Bass (1985 was largely confirmed in the present study. Opsomming Die doel van die studie was om vas te stel of die faktorstruktuur van die Veelfaktorleierskapsvraelys (MLQ van Bass, as maatstafvan transformasionele leierskap, in die Suid-Afrikaanse konteks gerepliseer kon word. Die MLQ is gekies omdat dit belofte inhou as n geldige en betroubare meetinstrument van die onderhawige konstruk, en ook weens die feit dat daar 'n dringende behoefte bestaan aan so n instrument vir gebruik in die bestuur van menslike hulpbronne in organisasies tydens verandering. Die MLQ is op 406 proefpersone binne militêre konteks toegepas, en aan n faktorontleding en n itemontleding onderwerp. Die faktorontleding het drie faktore opgelewer, te wete transformasionele leierskap, transaksionele leierskap en vermyding van leierskap ("laissez faire"-leierskap. Die betroubaarheid van die skale is bepaal

  4. Die historiese betroubaarheid van die aartsvadervertellinge. 'n Beknopte bespreking van die huidige debat na aanleiding van die jongste publikasie

    Directory of Open Access Journals (Sweden)

    W. Vosloo


    Full Text Available Die afgelope twintig jaar was daar �n toenemende belangstelling in die aartsvadervertellinge in Genesis. Benewens die talle tydskrifartikels het skrywers soos die volgende ook boeke oor die onderwerp die lig laat sien: A. Parrot (1962, W. M. Clark (1964, R. Kilian (1966, R. E. Clements (1967, N. Lohfink (1967, H. Weidemann (1968, R. Martin-Achard (1969, T. L. Thompson (1974, J. van Seters (1975, J. P. Fokkelman (1975, C. Westermann (1976, R. Rendtorff (1977, J. Bright (1977, W. McKane (1979 en A. R. Millard en D. J. Wiseman (1980.

  5. 'n Kwalitatiewe ondersoek na die invloed van aspekte van die ...

    African Journals Online (AJOL)

    S Blignaut

    ISSN 0378-5254 Journal of Family Ecology and Consumer Sciences, Vol 26: No1, 1998. 15 ...... van byvoorbeeld die televisie en gedrukte media 'n invloed op die .... fashion promotion and advertising. New York. ... Consumer behaviour to-.

  6. The expedition ARCTIC `96 of RV `Polarstern` (ARK XII) with the Arctic Climate System Study (ACSYS). Cruise report; Die Expedition ARCTIC `96 des FS `Polarstern` (ARK XII) mit der Arctic Climate System Study (ACSYS). Fahrtbericht

    Energy Technology Data Exchange (ETDEWEB)

    Augstein, E.


    The multinational expedition ARCTIC `96 was carried out jointly by two ships, the German RV POLARSTERN and the Swedish RV ODEN. The research programme was developed by scientists from British, Canadian, Finish, German, Irish, Norwegian, Russian, Swedish and US American research institutions and universities. The physical programme on POLARSTERN was primarily designed to foster the Arctic Climte System Study (ACSYS) in the framework of the World Climate Research Programme (WCRP). Investigations during the recent years have provided substantial evidence that the Arctic Ocean and the adjacent shelf seas play a significant role in the thermohaline oceanic circulation and may therefore have a distinct influence on global climate. Consequently the main ACSYS goals are concerned with studies of the governing oceanic, atmospheric and hydrological processes in the entire Arctic region. (orig.) [Deutsch] Die Expedition ARCTIC `96 wurde von zwei Forschungsschiffen, der deutschen POLARSTERN und der schwedischen ODEN unter Beteiligung von Wissenschaftlern und Technikern aus Deutschland, Finnland, Grossbritannien, Irland, Kanada, Norwegen, Russland, Schweden und den Vereinigten Staaten von Amerika durchgefuehrt. Die physikalischen Projekte auf der POLARSTERN dienten ueberwiegend der Unterstuetzung der Arctic Climate System Study (ACSYS) des Weltklimaforschungsprogramms, die auf die Erforschung der vorherrschenden ozeanischen, atmosphaerischen, kryosphaerischen und hydrologischen Prozesse der Arktisregion ausgerichtet ist. (orig.)

  7. End-of-life care: nurses' experiences in caring for dying patients with profound learning disabilities--a descriptive case study. (United States)

    Li, S; Ng, J


    This qualitative study identifies areas of expertise and deficits in the specific knowledge and practical skills of nurses in the care of dying patients with profound learning disabilities in one NHS Primary Care Trust in the UK. In response to these findings, we have developed a simple observational checklist applicable to profound learning disability nursing to identify disease-related personality and physiological changes. The method consists of a descriptive case study of five nurses qualified in learning disabilities nursing, using semi-structured interviews. The disease trajectory was used as a framework of reference to guide the data analysis. Themes showed were 'certainty of knowing' about disease-related changes in patients' habits and behaviour and 'uncertainty and ambiguity' in the patho-physiology of advanced diseases and disease progression. This study interprets a lack of patho-physiological knowledge in both malignant and non-malignant diseases leading to delayed diagnosis and timely intervention. Timeliness of observation and intervention are emphasised.

  8. Die stryd teen die voorpposte: 1-2 Februarié 1941 | Du Plessis ...

    African Journals Online (AJOL)

    Scientia Militaria: South African Journal of Military Studies. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 4, No 4 (1974) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register. Die stryd teen die voorpposte: 1-2 ...


    African Journals Online (AJOL)


    vergewe. Dit sou in orde gewees het as daar gestaan het, ReMomë- j^onta^is hepta?ds. wat die grieks is vir sewentig maal sewe. Die uitdrukking. heMom&ontabis heptd sien hoogswaarskynlik op Gen. 4 : 24 (LXX) waar. Lameg meedeel dat hy sewe-en-sewentig-maal gewreek sal word. Daar sit die Afr. Vert, die uitdrukking ...

  10. Dying for security

    Directory of Open Access Journals (Sweden)

    Buchan, Bruce


    Full Text Available If political statements and media coverage are any guide, it seems Australians today are dying for security. At no other moment in our history has the spectre of war and terrorism so haunted popular, political and scholarly perceptions of Australia’s colonial past and of its geopolitical future. And yet, debates over colonial war or genocide and contemporary terrorism have been conducted in more or less complete isolation. In this article I argue that our contemporary obsession with ‘security’ is premised on the perennial threat of ‘insecurity’. This is the problem of in/security, and it has played a central role in the development of Western political thought. More importantly, its formulation in Western political thought provided a powerful justification for the violence of the early decades of Australia’s colonisation during which Indigenous Australians could also be said to have been dying for security.

  11. Dying for Security

    Directory of Open Access Journals (Sweden)

    Bruce Buchan


    Full Text Available If political statements and media coverage are any guide, it seems Australians today are dying for security. At no other moment in our history has the spectre of war and terrorism so haunted popular, political and scholarly perceptions of Australia’s colonial past and of its geopolitical future. And yet, debates over colonial war or genocide and contemporary terrorism have been conducted in more or less complete isolation. In this article I argue that our contemporary obsession with ‘security’ is premised on the perennial threat of ‘insecurity’. This is the problem of in/security, and it has played a central role in the development of Western political thought. More importantly, its formulation in Western political thought provided a powerful justification for the violence of the early decades of Australia’s colonisation during which Indigenous Australians could also be said to have been dying for security.

  12. Verbal autopsy as a tool for identifying children dying of sickle cell disease: a validation study conducted in Kilifi district, Kenya (United States)


    Background Sickle cell disease (SCD) is common in many parts of sub-Saharan Africa (SSA), where it is associated with high early mortality. In the absence of newborn screening, most deaths among children with SCD go unrecognized and unrecorded. As a result, SCD does not receive the attention it deserves as a leading cause of death among children in SSA. In the current study, we explored the potential utility of verbal autopsy (VA) as a tool for attributing underlying cause of death (COD) in children to SCD. Methods We used the 2007 WHO Sample Vital Registration with Verbal Autopsy (SAVVY) VA tool to determine COD among child residents of the Kilifi Health and Demographic Surveillance System (KHDSS), Kenya, who died between January 2008 and April 2011. VAs were coded both by physician review (physician coded verbal autopsy, PCVA) using COD categories based on the WHO International Classification of Diseases 10th Edition (ICD-10) and by using the InterVA-4 probabilistic model after extracting data according to the 2012 WHO VA standard. Both of these methods were validated against one of two gold standards: hospital ICD-10 physician-assigned COD for children who died in Kilifi District Hospital (KDH) and, where available, laboratory confirmed SCD status for those who died in the community. Results Overall, 6% and 5% of deaths were attributed to SCD on the basis of PCVA and the InterVA-4 model, respectively. Of the total deaths, 22% occurred in hospital, where the agreement coefficient (AC1) for SCD between PCVA and hospital physician diagnosis was 95.5%, and agreement between InterVA-4 and hospital physician diagnosis was 96.9%. Confirmatory laboratory evidence of SCD status was available for 15% of deaths, in which the AC1 against PCVA was 87.5%. Conclusions Other recent studies and provisional data from this study, outlining the importance of SCD as a cause of death in children in many parts of the developing world, contributed to the inclusion of specific SCD


    African Journals Online (AJOL)


    aangetoon het, 'n huis in Kapernaum gehad en hierdie geskiedenis speel in Kapernaum of daar digby af. Jesus en sy dissipele het namelik, volgens 6:35 geland by Gennesaret, net suid van Kapernaum Die gevolgtrekking word ondersteun deur Joh. 6:17 waarvolgens die dissi pele na die spysiging op Kapernaum gevaar ...

  14. 'n Verkenning van die soorte vennootskappe in die Amerikaanse reg ...

    African Journals Online (AJOL)

    In die Amerikaanse literatuur word talle verwysings gevind na die vennootskap in mynbou ("mining partnership"), familievennootskap ("family partnership", vennootskap in vaste eiendom ("partnership in real estate") en vennootskap vir boerdery ("farming partnership"). Hierdie onderskeiding is primer gebaseer op die tipe ...

  15. Die 'postmoderne' stempel in die Nuwe-Testamentiese hermeneutiek

    African Journals Online (AJOL)

    georiënteerde teorie en kritiek wat volgens Moore opbou tot 'n herhaling binne. Bybelnavorsing. Dit het reeds by Immanuel Kant begin. Sedert Kant is dit proble- maties cm die objek van kennis te beskou as iets wat kennis objektief in sigself bevat. Objektiwisme is prys gegee. Dialektiek het in die plek daarvan gekom. Die.

  16. duele verse sowel as die somtotaal die leser

    African Journals Online (AJOL)

    27 Jan 2006 ... selfs 'n landkaart afgedruk) terwyl dit ter- selfdertyd ver bo die lokale uitstyg. Die digter is sterk bewus van sy omgewing, geskiedenis en tradisies, maar veral van die algemene menslike kondisie wat binne hierdie referensiekader vergestalt word. Hy gebruik 'n bekende historiese slagveld as bundeltitel (en ...

  17. Die Leben Einsteins eine Reise durch die Geschichte der Physik

    CERN Document Server



    Jeder kennt die Namen Einstein, Newton oder Galilei. aber was weiss man über sie? Hier ein Porträt Einsteins anhand von sechs Meilensteinen aus der Geschichte der Physik. Einstein tritt auf als Protagonist in verschiedenen Epochen und bei verschiedenen Entdeckungen, die die Welt verändert haben.


    African Journals Online (AJOL)


    Die offerfees te Gibeon was 'n plegtigheid, waaraan geheel Israel deelgeneem het. Die duisend. "brandoffers" wat sowel Kon. as Kron. vermeld, sal wel opgevat moet word as „brandoffers en dankoffers", sodat daar vir die aanwesiges. *n groot feesmaaltyd aangerig is, vgl. I Kon. 3:15. n Sodanige maal- tyd verbind vors en ...

  19. Ruimtelike beplanning: die rol van die stads - en streeksbeplanner ...

    African Journals Online (AJOL)

    Ruimtelike beplanning: die rol van die stads - en streeksbeplanner in die saw. R Erasmus. Abstract. Since 1978 regional and town planners are employed in the SADF on a permanent basis as well as in the capacity of national service men. These men are all academically qualified and as such satisfy a need that developed ...

  20. n opinie oor die behaviouristiese siening versus die fenomenologie ...

    African Journals Online (AJOL)

    verband die eksperimente van Pavlov, Thorndike,. Skinner, Tolmann en Hull.) Fenomenologie. Die fenomenologie is 'n essensie-openbarende denkrigting. Dit impliseer'n denkende soektog na dit wat 'n besondere verskynsel of werklikheid maak juis dit wat dit is en nie iets anders nie. In die fenomenologiese antropologie ...

  1. Die Vier Typen von Projektmanagern

    DEFF Research Database (Denmark)

    Lund Pedersen, Carsten; Ritter, Thomas


    Bevor Sie einem Mitarbeiter die Leitung eines Projekts anvertrauen, sollten Sie sich über dessen Managementstil klar werden. Passt dieser nicht zur Art des Vorhabens, wird er scheitern. So treffen Sie die richtige Wahl....

  2. Die historiese Jesus as wondenverker

    African Journals Online (AJOL)

    Biblical Association, te wete 'The social sciences and second Testament exegesis'. John Pilch is die leier van die Society of Biblical Literature se 'Social sciences and ..... Hollenbach, P 1982. ... Stauffer, E 1982. Jesus ... London: Collins.

  3. A Study of the First Year of the End-of-Life Clinic for Physician-Assisted Dying in the Netherlands. (United States)

    Snijdewind, Marianne C; Willems, Dick L; Deliens, Luc; Onwuteaka-Philipsen, Bregje D; Chambaere, Kenneth


    Right to Die NL, an organization in the Netherlands that advocates for the option of euthanasia, founded the End-of-Life Clinic in 2012 to provide euthanasia or physician-assisted suicide for patients who meet all legal requirements but whose regular physicians rejected their request. Many patients whose requests are rejected have less common situations, such as a psychiatric or psychological condition, dementia, or being tired of living. To study outcomes of requests for euthanasia or physician-assisted suicide received by the clinic and factors associated with granting or rejecting requests. Analysis of application forms and registration files from March 1, 2012, to March 1, 2013, the clinic's first year of operation, for 645 patients who applied to the clinic with a request for euthanasia or physician-assisted suicide and whose cases were concluded during the study period. A request could be granted, rejected, or withdrawn or the patient could have died before a final decision was reached. We analyzed bivariate and multivariate associations with medical conditions, type of suffering, and sociodemographic variables. Of the 645 requests made by patients, 162 requests (25.1%) were granted, 300 requests (46.5%) were refused, 124 patients (19.2%) died before the request could be assessed, and 59 patients (9.1%) withdrew their requests. Patients with a somatic condition (113 of 344 [32.8%]) or with cognitive decline (21 of 56 [37.5%]) had the highest percentage of granted requests. Patients with a psychological condition had the smallest percentage of granted requests. Six (5.0%) of 121 requests from patients with a psychological condition were granted, as were 11 (27.5%) of 40 requests from patients who were tired of living. Physicians in the Netherlands have more reservations about less common reasons that patients request euthanasia and physician-assisted suicide, such as psychological conditions and being tired of living, than the medical staff working for the End

  4. Die Rolle von RANK-Ligand und Osteoprotegerin bei Osteoporose

    Directory of Open Access Journals (Sweden)

    Hofbauer LC


    Full Text Available Receptor activator of nuclear factor (NF- κB ligand (RANKL, sein zellulärer Rezeptor RANK und der Decoy-Rezeptor Osteoprotegerin (OPG stellen ein essentielles Zytokinsystem für die Zellbiologie von Osteoklasten dar. Verschiedene Untersuchungen belegen die Bedeutung von Störungen des OPG/RANKL/RANK-Systems bei der Pathogenese metabolischer Knochenerkrankungen. In dieser Arbeit werden die wichtigsten Störungen des OPG/RANKL/RANK-Systems bei verschiedenen Osteoporoseformen dargestellt. Östrogenrezeptor- (ER- Agonisten wie 17 β-Östradiol, Raloxifen und Genistein stimulieren die osteoblastäre Produktion von OPG durch Aktivierung von ER- α in vitro, während Lymphozyten von Patientinnen mit Östrogenmangel RANKL überexprimieren. Die parenterale Gabe von OPG vermag den mit Östrogenmangel assoziierten Knochenverlust im Tiermodell und in einer kleineren klinischen Studie zu verhindern. Glukokortikoide und Immunsuppressiva steigern gleichzeitig die RANKL-Expression und hemmen die OPG-Produktion in osteoblastären Zellen in vitro. Glukokortikoide sind auch in vivo imstande, die OPG-Serumspiegel deutlich zu reduzieren. Dagegen hemmen biomechanische Reize in vitro die RANKL-Produktion und steigern die OPG-Produktion. Ein Fehlen dieser biomechanischen Reize bei längerer Immobilisierung kann daher den RANKL/OPG-Quotienten steigern, während die tierexperimentelle Immobilisierungs-Osteoporose durch die parenterale Gabe von OPG gemildert werden kann.

  5. Precision die design by the die expansion method

    CERN Document Server

    Ibhadode, A O Akii


    This book presents a new method for the design of the precision dies used in cold-forging, extrusion and drawing processes. The method is based upon die expansion, and attempts to provide a clear-cut theoretical basis for the selection of critical die dimensions for this group of precision dies when the tolerance on product diameter (or thickness) is specified. It also presents a procedure for selecting the minimum-production-cost die from among a set of design alternatives. The mathematical content of the book is relatively simple and will present no difficulty to those who have taken basic c

  6. Die Dokter-Pasient Rolverwantskap

    African Journals Online (AJOL)

    17 Aug 1974 ... en as sodanig 'n ral sped in die persoon se siektegedrag en uiteindelike patroon van hulpsoeke. SIEKEROL EN SOSIALISERING IN DIE. PASIENTROL ..... more cumulative, resulting in a more gradual social and professional maturation.' Vit die voorafgaande word dit duidelik dat Dewy se pragmatiese ...

  7. prosesseringsmetodes op die voedingswaarde van

    African Journals Online (AJOL)

    gebring is, kon geen betekenisvolle verskille tussen die drie monsters gevind word nie. Volgens Opstvedt (1976) kan ME waardes ook dien as 'n kriteria van proteien- kwaliteit, hoofsaaklik a.g.v. die verhoogde stikstofuit- skeiding in die urine wat sal plaasvind a.g.v. beskadiging van aminosure. De Groote (1968) het gevind ...


    African Journals Online (AJOL)

    wei die verdediging van die landsgrense teen 'n vyand wat die orde, gesag, vrede, stabiliteit en welvaart in Suidwes-Afrika en die Republiek van. Suid-Afrika wil vernietig. Hierdie oorlog moet nie ge'lsoleerd gesien word nie, maar in perspektief geplaas word teen die agtergrond van 'n nag groter konflik, naamlik die van die ...

  9. Die Subjektiewe en Objektiewe doelwitte van Arbeid

    Directory of Open Access Journals (Sweden)

    T. H. Veldsman


    Die artikel gee aandag aan die subjektiewe en objektiewe doelwitte van arbeid. Hul plek en funksie binne 'n voorgestelde geïntegreerde motiveringsmodel word eerstens aangedui. Vervolgens word die verwantskap tussen die twee doelwitte uitgelig, gevolg deur 'n bespreking van die aard van die objektiewe doel. Laastens word die invloed van moderne arbeid op hierdie doelwitte uitgestippel.


    African Journals Online (AJOL)


    Kierkegaard en Nietzsche, Max Weber en Dilthey, om maar enkeles te noem, en 5.) Jaspers se persoonlike beskouing oor die roe ping en die taak van die Filosofie, sy aanvoeling van die filosofiese problematiek en sy grondhouding teenoor die eksistensiële verbonden- hede. Die woord van Fichte, naamlik dat die Filosofie ...

  11. ’n Vergelyking van die Mollusca-diversiteit in die Mooirivier (Noordwes-Provinsie soos gevind met opnames wat gemaak is in 1963 en weer 50 jaar later

    Directory of Open Access Journals (Sweden)

    Cornelius T. Wolmarans


    Full Text Available Die hoogste getal gedokumenteerde uitsterwings van enige belangrike taksonomiese groepword aan die Mollusca toegedig. Faktore wat hoofsaaklik hiervoor verantwoordelik is, sluitonder meer omgewingsveranderinge en antropogeniese impakte in wat tot die tot niet gaanvan die habitat aanleiding gee. Daarbenewens is die bewaringstatus van minder as 2% van dieongeveer 7000 molluskspesies wêreldwyd bekend tot dusver nog nie behoorlik geassesseernie. Die doel van die huidige ondersoek wat in 2014 uitgevoer is, was om die molluskdiversiteitvan die Mooirivier met die resultate van 1963 te vergelyk. Dit is gedoen deur ’n opnameuit te voer van die molluskdiversiteit by dieselfde lokaliteite as in 1963. Twee opnames isgemaak tydens ’n vroeë- en laatlaagvloeiperiode in 2014 by agt lokaliteite wat met dié vandie 1963-opnames ooreenstem. Die pH, elektriese geleiding (EG en temperatuur is ook byelk van die lokaliteite gemeet. Die identiteit van die 14 slakspesies wat in 1963 gevind is, hetooreengestem met 14 van die 15 in 2014. Die uitheemse indringerspesie Physa acuta is tydensdie 2014-opname vir die eerste keer in hierdie rivier gevind, waarskynlik weens ’n toename inorganiese verryking. In die 1963-opname is Burnupia mooiensis en Pisidium langlyanum by diemeeste lokaliteite gevind, en in 2014 Gyraulus connollyi en Ferrissia cawstoni. Die meeste van diemolluske uit hierdie gebied wat voorheen op rekord gestel is, is in 2014 gevind. Die pH watin 2014 ’n geringe tot aansienlike verlaging getoon het, word aan mynversuring toegeskryfen het nie ’n merkbare invloed op die molluskdiversiteit gehad nie. Die hoër elektriesegeleiding wat tydens die 2014-opname gemeet is, het vanweë die verdraagsaamheid vanvarswatermolluske in hierdie verband, ook geen verandering in die molluskdiversiteit teweeggebring nie. Die temperatuur was in die laatlaagvloei deurgaans hoër. Ondanks die feit dathierdie studies vyf dekades uitmekaar gedoen is en antropogeniese impakte

  12. Spondarthritis hyperostotica pustulo-psoriatica - Review and a clinical-radiological study with special emphasis on SAPHO syndrome; Die Spondarthritis hyperostotica pustulo-psoriatica: Nosologische Studie mit klinischer und radiologischer Darstellung innerhalb des SAPHO-Syndroms

    Energy Technology Data Exchange (ETDEWEB)

    Schilling, F. [Radiologische Universitaetsklinik Mainz (Germany)]|[Zentrum fuer Rheuma-Pathologie, Mainz (Germany); Kessler, S. [Radiologische Universitaetsklinik Mainz (Germany)


    Spondarthritis hyperostotica pustulo-psoriatica (Spond.hyp.pp-Schilling), corresponding nosologically to pustulotic arthroosteitis, is a dermato-skeletal `double system` disease of adults. It consists of the triad (a) palmo-plantar pustulosis (Ppp) or, alternatively, Koenigsbeck-Barber-type psoriasis, (b) sternocostoclavicular hyperostosis (SCCH), and (c) truncal-skeletal changes with syndesmophite-like, hyperostotic and/or parasyndesmophite-like ossifications of layers of the anterior vertebral ligament taken together in the sense of a desmophytal hyperostosis. There is also a potential for sclerosing inflammatory arthritis of the sacro-iliac joints and `dry` inflammatory arthritis of the sacro-iliac joints and `dry` inflammatory arthritis of peripheral joints. Thus, the pustulo-psoriatic terrain seems to have a decisive influence on osseous pathology. A total of 38 cases from a study during the years 1982 to 1992 is analysed with regard to morphological characteristics. Rare cases with diaphyseal and pelvic hyperostotic lesions subsequent to bland sclerosing osteomyelitis constitute an overlapping region to chronic recurrent multifocal osteomyelitis (CRMO) and illustrate the relationship between hyperostotic spondarthritis and CRMO. The syndromes of `acquired hyperostosis` and `SAPHO`, the former more radiologically oriented and the latter more clinically oriented, together with mainly CRMO and hyperostotic spondarthritis and its forms, constitute the `Spond.hyp.pp.`. Although hyperostosis is a guidepost for the radiologist and SAPHO symptoms are one for the clinician, the syndrome does not represent a diagnosis by itself and requires further differentiation. In this report the entity `Spond.hyp.pp.` is considered and requires contributions from rheumatologically and osteologically oriented radiologist. (orig.) [Deutsch] Die vorliegende Uebersicht beschreibt unter vorwiegend radiologischen Gesichtspunkten das Krankheitsbild der Spondarthritis hyperostatica

  13. Die oorsake van en bydraende faktore tot eensaamheid: 'n literatuuroorsig


    Doman, LCH; le Roux, A


    'n Groot deel van die bevolking ervaar gereeld eensaamheid en dit word as 'n algemene verskynsel in die menslike bestaan beskou. Verskeie studies dui daarop dat jong mense veral vatbaar is vir eensaamheid. Eensaamheid word ook beskou as 'n risiko-faktor vir 'n wye verskeidenheid probleme wat 'n potensiële gevaar vir die mens se gesondheid inhou. Verskeie faktore wat 'n invloed op die mate van eensaamheid het, is ook kenmerkend van die Suid-Afrikaanse konteks. Rokach se model van eensaamheidsv...

  14. Die Rolle des Gerichtsdolmetschers - Experte oder notwendiges Übel?

    DEFF Research Database (Denmark)

    Christensen, Tina Paulsen


    Die Zahl der gedolmetschten Gerichtsverhandlungen steigt weiterhin in vielen Rechtssystemen, weshalb es immer wichtiger wird, dass Rechtssysteme über qualifizierte Dolmetscher verfügen. In Dänemark begegnen Richter, die Rezipienten von Gerichtsdolmetschleistungen sind, sowohl professionellen als...... auch nicht- oder semi-professionellen Gerichtsdolmetschern. Dies lässt vermuten, dass die Richter in der Praxis Dolmetschleistungen von sehr unterschiedlicher Qualität erleben und vermutlich kein einheitliches Bild von der Rolle des Gerichtsdolmetschers haben. Ziel der Studie, die ich in diesem Beitrag...

  15. Dying with dignity. (United States)

    Madan, T N


    Death is a theme of central importance in all cultures, but the manner in which it is interpreted varies from society to society. Even so, traditional cultures, including Christian, Hindu and Jain religious traditions, exhibited a positive attitude to death and did not look upon it in a dualistic framework of good vs bad, or desirable vs undesirable. Nor was pessimism the dominant mood in their thinking about death itself. A fundamental paradigm shift occurred in the West in the eighteenth century when death was desacralized and transformed into a secular event amenable to human manipulation. From those early beginnings, dying and death have been thoroughly medicalized and brought under the purview of high technology in the twentieth century. Once death is seen as a problem for professional management, the hospital displaces the home, and specialists with different kinds and degrees of expertise take over from the family. Everyday speech and the religious idiom yield place to medical jargon. The subject (an ageing, sick or dying person) becomes the object of this make-believe yet real world. As the object of others' professional control, he or she loses the freedom of self-assessment, expression and choice. Or, he or she may be expected to choose when no longer able to do so. Thus, not only freedom but dignity also is lost, and lawyers join doctors in crisis manipulation and perpetuation. Although the modern medical culture has originated in the West, it has gradually spread to all parts of the world, subjugating other kinds of medical knowledge and other attitudes to dying and death.(ABSTRACT TRUNCATED AT 250 WORDS)

  16. Sal die ‘ewolusie’ vanaf biologie na lewenswetenskappe ‘uitsterwing’ van die vakgebied voorkom?

    Directory of Open Access Journals (Sweden)

    Johanna G. Ferreira


    Full Text Available In hierdie artikel word die wysiging van die skoolvak van ‘biologie’ na ‘lewenswetenskappe’ bespreek, asook die gepaardgaande en verwagte implikasies van die verandering. Die vraag word gestel of die beoogde wysiging wel noemenswaardig is en of dit enigsins ‘n verskil aan die dalende belangstelling in die lewenswetenskappe op tersiêre vlak sal maak. Die wysigings in die nuwe kurrikula verhoog die relevansie van die vakinhoud vir leerders en vir die gemeenskap, maar sekere kwessies kry nie aandag nie. Voorstelle word gemaak om die kurrikulum te wysig en onderrigmetodes aan te pas om die nodige vaardighede by leerders te vestig.

  17. enkele fasette van die problematiek van die akademikus by die skryf

    African Journals Online (AJOL)

    Om verskeie redes het dit van die allergrootste belong geword dot 'n his- tories korrekte, wetenskaplike weerga- we van bogenoemde gebeure opge- teken moet word. Die sluier, in sommige gevalle am logiese redes toegepas, moes eenvoudig gelig word am gebeure wat die gewone man op stroot in Suid-Afrika dikwels ...

  18. Die debat rondom die vertolking van die amptelike ...

    African Journals Online (AJOL)

    Southern African Linguistics and Applied Language Studies ... Debate around the interpretation of the official language policy principles of the ... Any discussion of language planning must first take into account the underlying orientation.

  19. Thermal Fatigue of Die-Casting Dies: An Overview

    Directory of Open Access Journals (Sweden)

    Abdulhadi Hassan A.


    Full Text Available Coupled studies by experimental and numerical simulations are necessary for an increased understanding of the material behaviour as related to the interaction between the thermal and mechanical conditions. This paper focus on the mechanisms of thermal fatigue in the failure of dies and cores used in the die casting of aluminum alloys. The thermal fatigue resistance is expressed by two crack parameters which are the average maximum crack and the average cracked area. Samples of various types of H13 steel were compared with a standard H13 steel by testing under identical thermal fatigue cycles. To determine the thermal constraint developed in the sample during the test, a finite difference technique was used to obtain the temperature distribution, based on temperature measurements at the boundaries. The resulting stresses and strains were computed, and the strain calculated at the edge or weakest point of the sample was used to correlate the number of cycles to crack initiation. As the strain at the edge increased, the number of cycles to failure decreased. The influence of various factors on thermal fatigue behavior was studied including austenitizing temperature, surface condition, stress relieving, casting, vacuum melting, and resulfurization. The thermal fatigue resistance improved as the austenitizing temperature increased from 1750 to 2050ºF.

  20. Die hermeneutiek van gereformeerde kerkreg

    Directory of Open Access Journals (Sweden)

    Andries le Roux du Plooy


    Full Text Available Die artikel het op die belangrikheid en noodsaaklikheid van ‘n hermeneutiek vir die gereformeerde kerkreg gefokus. Die kerkregtelike dokument wat besonderlik ter sake was, is die kerkorde van die Gereformeerde kerke in Suid-Afrika, met sy besondere band met die Dordtse kerkorde van 1618 en 1619. Agtereenvolgens is aandag gegee aan die volgende aspekte soos (1 die eiesoortige aard van ‘n kerkorde as ‘n teologiese dokument en teks, in onderskeiding van regsdokumente; (2 die aard van die hermeneutiek van kerkreg; (3 enkele teorieë oor die interpretasie of uitleg van tekste, veral regstekste en (4 normatiewe vooronderstellings en reëls vir die interpretasie en verstaan van die teks en artikels van die kerkorde asook besluite van kerklike vergaderinge. Die gevolgtrekking was dat weinig indringende navorsing gedoen is oor die saak van hermeneutiek vir kerkreg, hoewel dit noodsaaklik is. Duidelike hermeneutiese reëls is gesuggereer en verduidelik, wat sou kon meehelp dat kerke en kerklike vergaderinge die artikels van die kerkorde asook besluite en reglemente wat daarop berus het, kan interpreteer en toepas. The hermeneutics of reformed church polity. The article focused on the importance and urgency of a design for reformed hermeneutics on church polity. The Church Order referred to in the article is the Church Order of the Reformed Churches in South Africa, which are closely related to the Church Order of Dordt of 1618 and 1619. The following aspects received attention namely (1  the unique character of a Church Order, in comparison to and distinguished from legal documents and statutes; (2 the character and nature of hermeneutics of church polity; (3 theories of interpretation in the common law tradition and their relevance to church polity and (4 normative presuppositions and marks for the interpretation and understanding of the text and articles of the Church Order, as well as the resolutions of church assemblies. It was found that

  1. Is die ortodoksie se verstaan van die sondeval belemmerend vir die gesprek tussen teologie en natuurwetenskap?

    Directory of Open Access Journals (Sweden)

    Johan Buitendag


    Full Text Available In hierdie artikel is betoog dat die Gereformeerde Ortodoksie se begrip van die sondeval ’n  belemmering  was  vir  die  gesprek  tussen  teologie  en  natuurwetenskap.  Die  rede hiervoor was dat dit ten eerste ’n bepaalde verstaan van liniêre tyd nahou en ten tweede dat dit ’n bonatuurlike ingryp veronderstel het. Albei hierdie aspekte het die debat onnodig problematiseer. Die argument is ontwikkel deur eerstens die probleem te definieer, gevolg deur ’n uiteensetting van die standpunte van Augustinus en Calvyn onderskeidelik oor die sondeval. As ’n heuristiese sleutel is die konsepte van infralapsarisme en supralapsarisme aangewend om die tema te ontleed. Die artikel is afgesluit met die oortuiging dat die imago Dei ’n beliggaamde menslike persoon is wat biologies in die geskiedenis in terme van selfbewussyn en morele verantwoordelikheid ontluik het. Is the Orthodoxy’s notion of the Fall inhibitory for the dialogue between theology and science? In this article it was argued that the Reformed Orthodoxy’s interpretation of the Fall had become an impediment in the dialogue between theology and science. The reason was that it assumed firstly a specific understanding of linear time and secondly a metaphysical intervention. Both events were unnecessarily problematising the debate. The argument was deployed by stating the problem, followed by an exposition of the views of Augustine and Calvin on the Fall. As a heuristic key, the concepts of infralapsarism and supralapsarism were applied respectively to analyse the topic. The article concluded with the conviction that the imago Dei is an embodied human person that had biologically emerged in history as a center of self-awareness, and moral responsibility.

  2. Berufserfolg im Transformationsprozeß : eine theoretisch empirische Studie über die Gewinner und Verlierer der Wende in Ostdeutschland

    NARCIS (Netherlands)

    Kropp, Per Bruno


    This study focuses on the explanation of changes in occupational success in East Germany since the political turnover in 1989. The theoretical considerations, which are used in this study, are mainly based on results of labor market research in western economies (i.e., theories on labor market

  3. Die veranderende rol van die man in die dubbelinkomstegesin



    D.Litt. et Phil. In recent research studies that have been done within the cadre of family sociology, researchers have emphasised the fact that the role of the man in the family is an important topic. This interest in the role of the husband/father has been facilitated by significant trends and changes of our time, manifesting world-wide, as well as in South Africa. These trends, such as the continuous rise in the rate of married women entering the labour market and the accompanying issues...

  4. In-service monitoring of piping and vessels in nuclear power plants. Report on BMU-study SR 2218; Betriebsueberwachung von Rohrleitungen und Behaeltern in Kernkraftwerken. Bericht ueber die BMU-Studie SR 2218

    Energy Technology Data Exchange (ETDEWEB)

    Hofstoetter, P. [Technischer Ueberwachungs-Verein Rheinland e.V., Koeln (Germany); Dittmar, S. [Technischer Ueberwachungs-Verein Nord e.V., Hamburg (Germany); Maile, K. [Stuttgart Univ. (Germany). Staatliche Materialpruefungsanstalt; Metzner, K.J. [Preussen Elektra AG, Hannover (Germany). Hauptverwaltung


    On behalf of the BMU, the authors carried out a study intended to give an overview of and evaluate current practice and methods applied in fatigue monitoring of pipes and vessels of nuclear power plants. The authors on the one hand present fundamentals relating to typical load cases, monitoring and measuring techniques and fatigue computation methods, as well as the relevant legal provisions, and on the other hand describe the monitoring practice, tools and techniques referring to available literature, own experience, and interviews with operators/owners and manufacturers of existing power plants. The locations selected for examinations, measuring techniques, data acquisition and evaluation as well as measuring protocols are explained. The monitoring and inspection methods applied are assessed in a critical review which is the basis of proposals for improvement, relating to the measured data acquisition and especially to data analysis and evaluation. The paper focuses on the essential results of the study, excluding those parts of the study dealing with the calculation of fatigue in components, which will be the subject of another paper to be published. (orig./CB) [Deutsch] Im Auftrag ders BMU erarbeiteten die Verfasser eine Studie zur Darstellung und Bewertung der heute in Kernkraftwerken ueblichen Ermuedungsueberwachung von Rohrleitungen und Behaeltern. Dazu wurden einerseits die Grundlagen zur Beanspruchung, Messtechnik und Ermuedungsberechnung zusammengestellt sowie geltende Vorschriften aufgefuehrt. Andererseits wurde auf der Basis der verfuegbaren Literatur, eigener Erfahrungen sowie einer Befragung von Betreibern und Herstellern der heute ueblichen Anlagen die Messstellen, Messverfahren, Messwerterfassungsanlagen und Auswertungsmethoden sowie bisherige Ergebnisse der Messungen dargestellt. Das derzeitige Vorgehen wurde kritisch bewertet. Daraus resultierten Verbesserungsvorschlaege zur Messwerteerfassung, vor allem aber zur Auswertung und Bewertung der

  5. Talking about living and dying with the oldest old: public involvement in a study on end of life care in care homes

    Directory of Open Access Journals (Sweden)

    Goodman Claire


    Full Text Available Abstract Background Public involvement in research on sensitive subjects, such as death and dying, can help to ensure that questions are framed to reflect the interests of their peers, develop a shared understanding of issues raised, and moderate the often unequal power relationship between researcher and participant. This paper describes the contribution and impact of older members of a Public Involvement in Research group (PIRg to a study on living and dying in care homes. Methods A longitudinal study, with a mixed method approach, its aims were to capture key experiences, events and change over one year, of older people resident in participating care homes in the East of England. Residents were interviewed up to three times and their case notes were reviewed four times over the year. Interviews were semi structured, and recorded. Four members of a Public Involvement in Research group (PIRg contributed to preliminary discussions about the research and three were involved with many of the subsequent stages of the research process including the facilitation of discussion groups with residents. Results There were three areas where the involvement of the Public Involvement in Research group (PIRg positively influenced the study process. These were recruitment, governance and safeguarding, and in collaboration with the residents in the care homes, the discussion and interpretation of emergent findings. PIRg members were of similar age to the residents and their involvement provided different and often more reflective insights of the significance of the findings for the participants. There were examples where decision making about the range of PIRg participation was not always negotiable, and this raised issues about power relationships within the team. Nevertheless, PIRg members expressed personal benefit and satisfaction through participating in the research and a commitment to continue to support research with this older age group. Conclusions

  6. Die vangnet van die woord: forensies-linguistiese getuienis in 'n ...

    African Journals Online (AJOL)

    Een van die redes daarvoor is waarskynlik die gepaardgaande sleurwerk verbonde aan die verwerking van die betrokke taaldata — iets wat egter deur die onlangse meteoriese vooruitgang in tegnologiese tegnieke op die agtergrond geskuif is en nuwe moontlikhede na vore laat kom het. In die lig van die kompleksiteit van ...

  7. het om die Woord van God aan die gemeente te bedien. A. D. P ont ...

    African Journals Online (AJOL)


    Sizoo vertel met die vlotheid van die ervare skrywer en die ver antwoordelikheid van die wetenskaplike ... Maar in stiptelike trou aan die feitelikheid, verlaat die skrywer hom uitsluitlik op die outentieke bronne om ... de leser; in sy rykdom van gegewens en wetenskaplike betroubaarheid kan dit met vrug gelees word deur die ...

  8. Beliefs concerning death, dying, and hastening death among older, functionally impaired Dutch adults : A one-year longitudinal study

    NARCIS (Netherlands)

    Sullivan, M.; Ormel, J.; Kempen, G.I J M; Tymstra, T.


    OBJECTIVES: Population surveys have documented increasing public support for euthanasia and assisted suicide but have not focused on the population of chronically ill older persons, obtained detailed sociocultural or health status information, or performed repeat assessments. This study seeks to

  9. ["Good dying"--definition and current state of research]. (United States)

    Hutter, Nico; Stößel, Ulrich; Meffert, Cornelia; Körner, Mirjam; Bozzaro, Claudia; Becker, Gerhild; Baumeister, Harald


    The advances of modern medicine did not only result in prolongation of life expectancy, but also led to a shift from dying at home to dying in public institutions. In western countries most people die at advanced age in medical facilities. Hence, the question regarding the conditions, which should be provided by society and especially medicine, to allow terminally ill people to experience "good dying" is substantial. For this purpose, an examination of patients', family members' and health care providers' understanding of the term " good dying" is required. The present paper aims at shedding light on the term "good dying" and to summarize the current state of research. Therefore, the attributes of "good dying" will be described from the perspectives of patients, family members and health care providers, which are discussed and examined in current medical-sociological research. These attributes can be illustrated on three dimensions: Quality of life at the end of life (e. g. pain relief, mental well-being), quality of dying (e. g. avoiding prolonged dying, autonomy, presence of relatives) and quality of health care at the end of life (e. g. patient-oriented health care, positive communication between health care providers and patients, availability of guidelines). Although the attributes of "good dying" are described in detail in the existing literature, further studies have to clarify the relevance and impact of these attributes as predictors of "good dying". © Georg Thieme Verlag KG Stuttgart · New York.

  10. Prediking en spiritualiteit : 'n homiletiese studie oor die verband tussen prediking en geestelike groei / Jan Andries Erasmus


    Erasmus, Jan Andries


    The aim of this study was to determine how preaching can stimulate spiritual growth and intensify the spirituality of Listeners. The working method for the study has been based on the mode[ formulated by Zerfass (1974) for Practical Theology and follows a Reformatory angle. • In the first place, basis-theoretical principles regarding preaching, spirituality and spiritual growth have been researched, as well as the relationship between preaching and spiritual growth. To do this, exege...

  11. Die invloed van herbivorie en vuur op die oorlewing van sekere meerjarige kruide langs die Sabierivier, Kruger Nasionale Park

    Directory of Open Access Journals (Sweden)

    H. Myburgh


    Full Text Available Die groot vloede wat in die jaar 2000 in die Kruger Nasionale Park plaasgevind het, het dierivieroewerplantegroei versteur. Dit het die geleentheid gebied om heinings op te rig langsdie Sabierivier om herbivore uit sekere gebiede uit te sluit en sodoende die herstel van die rivieroewerekosisteme te monitor.

  12. Die heelal en sy onstaan (II

    Directory of Open Access Journals (Sweden)

    D. J. Van Rooy


    Full Text Available Ons kennis en wetenskap van die hemelliggame word volkome bepaal deur die lig wat ons van hulle ontvang, d.w.s. as ons die feite wat die Bybel daaromtrent meedeel, buite rekening laat.

  13. Versoening tussen leerders: Is parallelmediumskole die antwoord op die rassismeprobleem?


    Du Plessis, Elize; Marais, Petro


    Die Suid-Afrikaanse Grondwet stel dit duidelik dat enige vorm van diskriminasie nie toegelaat mag word nie. In ons skole beteken dit dat elke leerder ʼn reg het op goeie opvoeding en ʼn veilige skoolomgewing. Die fokus van hierdie navorsing is gerig op bestaande parallelmediumskole. Die uiteindelike vraagstuk is dus hoe multikulturele onderwys bevorder word en hoe rassisme aangespreek kan word? As teoretiese raamwerk is Kohlsberg se kognitiewe ontwikkelingsbenadering en Whitehouse se univerele ...

  14. Die ontmaskering van die bose: Eksegetiese perspektiewe op ...

    African Journals Online (AJOL)


    2 Yarbro Collins (1983) bied tans nog die beste agtergrond vir 'n besinning oor geweld in ..... John's grammatical howlers are intentionally designed to alert listerners ..... 26 In die Nuwe Testament word Paul se snydende opmerking teenoor die Korintiërs as ..... rnt g0r`m nh8 ldfhrs`}m du sg}u fg}u + n2sh d/m sg>}} e`ql`jdh.

  15. "Perhaps I will die young." Fears and worries regarding disease and death among Danish adolescents and young adults with cancer. A mixed method study

    DEFF Research Database (Denmark)

    Hølge-Hazelton, Bibi; Timm, Helle U; Graugaard, Christian


    worries about death; hereof, more than half of them expressed quite a bit or very much. The analysis showed significant gender differences, whereas age and duration of disease did not have any significant impact on such thoughts. Q2: One third had not talked to anybody about his or her worries. Q3...... about dying; (Q2) with whom, if anyone, they had shared those worries; and finally, (Q3) how fears and worries influenced their daily life. The emphasis will be on Q3. METHODS: A 151-item questionnaire (including two closed- and one open-ended questions about fears of death and dying) was distributed...... dying, but one third of them had not talked to anybody about those thoughts. It is an important clinical point that young age does not preclude fears and worries about dying in AYAs with cancer....

  16. Die beroepsoriëntasie van professioneel-rekeningkundiges tydens die vroeë beroepsjare

    Directory of Open Access Journals (Sweden)

    L. J. Van Vuuren


    Full Text Available The career orientation of professional accountants during the early career stage. The purpose with this study was to conduct research into the career orientations of aspiring and qualified persons in the accounting profession. Schein's Career Orientation Inventory was administered to 221 respondents in the early career stage and in different phases of Involvement in the profession. Managerial skill featured as the most prominent career orientation. It was also evident that respondents who had had occupational experience measured highest on the same orientation, i.e. managerial skill, irrespective of their phase within the early career stage. Furthermore, there were indications that career orientation differentiation increased in accordance with occupational experience. Opsomming Die doel met hierdie studie was om die beroepsoriëntasies van aspirant en gekwalifiseerde persone in die rekenmeesterprofessie na te vors. Schein se Beroepsorientasievraelys is afgeneem op 221 proefpersone in hul vroee beroepsjare en in verskillende fases van betrokkenheid in die professie. Bestuursbedrewenheid is as die mees kenmerkende beroepsorientasie geidentifiseer. Dit het ook aan die lig gekom dat proefpersone wat oor beroepsondervinding beskik, ongeag hul fase van betrokkenheid in die vroee beroepsjare, dieselfde orientasie naamlik bestuursbedrewenheid, realiseer. Aanduidings is verder verkry dat beroepsorientasie-differensiasie na gelang van beroepsblootstelling toeneem.

  17. Accurate defect die placement and nuisance defect reduction for reticle die-to-die inspections (United States)

    Wen, Vincent; Huang, L. R.; Lin, C. J.; Tseng, Y. N.; Huang, W. H.; Tuo, Laurent C.; Wylie, Mark; Chen, Ellison; Wang, Elvik; Glasser, Joshua; Kelkar, Amrish; Wu, David


    Die-to-die reticle inspections are among the simplest and most sensitive reticle inspections because of the use of an identical-design neighboring-die for the reference image. However, this inspection mode can have two key disadvantages: (1) The location of the defect is indeterminate because it is unclear to the inspector whether the test or reference image is defective; and (2) nuisance and false defects from mask manufacturing noise and tool optical variation can limit the usable sensitivity. The use of a new sequencing approach for a die-to-die inspection can resolve these issues without any additional scan time, without sacrifice in sensitivity requirement, and with a manageable increase in computation load. In this paper we explore another approach for die-to-die inspections using a new method of defect processing and sequencing. Utilizing die-to-die double arbitration during defect detection has been proven through extensive testing to generate accurate placement of the defect in the correct die to ensure efficient defect disposition at the AIMS step. The use of this method maintained the required inspection sensitivity for mask quality as verified with programmed-defectmask qualification and then further validated with production masks comparing the current inspection approach to the new method. Furthermore, this approach can significantly reduce the total number of defects that need to be reviewed by essentially eliminating the nuisance and false defects that can result from a die-to-die inspection. This "double-win" will significantly reduce the effort in classifying a die-to-die inspection result and will lead to improved cycle times.

  18. Die pastorale sielkundige as diakonale pastor

    Directory of Open Access Journals (Sweden)

    A. J. Smuts


    Full Text Available In die bedieningspatroon van die Ned. Geref. Kerk het die pastorale sielkundige die afgelope aantal jare steeds meer op die voorgrond begin tree. Hy is egter 'n problematiese figuur, wie se identiteit van meer as een kant onder bespreking is. In ander lande, selfs in die VSA waar die kerk veel gebruik maak van die sielkunde, is dit moeilik om 'n presiese parallel vir hom te vind. Sowel binne as buite die kerk word hy deur sommige bevraagteken. Daarom is dit noodsaaklik om vanuit die teologie te kyk na die werk wat hy doen.

  19. Berufserfolg im Transformationsprozess : eine theoretisch-empirische Studie über die Gewinner und Verlierer der Wende in Ostdeutschland

    NARCIS (Netherlands)

    Kropp, P.B.


    This study focuses on the explanation of changes in occupational success in East Germany since the political turnover in 1989. In a broader context it aims to explain how the winners and losers of transformation processes as in East Germany emerge. The explanation of occupational success is

  20. Die dialektiek in die waardes van die 1996 Grondwet

    Directory of Open Access Journals (Sweden)

    J Swanepoel


    Full Text Available In his paper The Dialectics in the Values of the 1996 Constitution Jan Swanepoel discusses various value statements in the 1996 Constitution of the Republic of South Africa and focuses the attention on indications of a lack of coherence as far as these value statements are concerned.He does this against the background of some introductory perspectives on the 1996 Constitution. In this regard he points out that the 1996 Constitution, as successor to the 1993 Constitution with its set of thirty four constitutional principles, can be regarded as a document of political and ideological compromise. He points out that constitutions (and in particular the value statements in Bills of Rights generally tend to be formulated rather broadly in order to promote flexibility and adaptability. He also focuses the attention on the fact that such a dialectic of values point to the variety of interests that has to be harmonized in a modern state, something which is unmistakably the case in South Africa with its heterogeneous society.The 1996 Constitution contains a variety of "value terms". A closer study of these terms does, however, indicate that these terms (value, principle, foundation, and the like are not used in a very systematic or technical fashion.The problems regarding the value statements are, however, not only of a terminological nature. There are also some substantive problems, as becomes clear from a discussion of value terms in the Preamble and in Sections 1 and 7 of the 1996 Constitution. Swanepoel indicates that a tension exists between what can be called the "process" formulation in section 1(a and the "state of affairs" formulation of the values in section 7(1. . While section 1(a speaks of "the achievement of equality" and "the advancement of human rights and freedoms", section 7(1 simply makes mention of "equality" and "freedom". The dialectic between these two formulations is discussed with reference to other relevant sections of the 1996

  1. Die skrifbeskouing van feministiese teoloë, in die besonder dié van Fiorenza, Brenner en Van Dijk-Hemmes – beoordeel in die lig van die gereformeerde teologie

    Directory of Open Access Journals (Sweden)

    Alta E. Swart


    Full Text Available Dit wil voorkom asof die feministiese Skrifbeskouing op die beginsel van selektiewe Skrifgesag berus. Dit beteken dat slegs dié dele in die Bybel wat met die feministiese ideologie ooreenstem, as gesaghebbend aanvaar word. Dit is veral die sogenaamde androsentriese taalgebruik wat dit vir aanhangers van hierdie benadering moeilik maak om die hele Skrif as gesaghebbend te erken. Hermeneuties vertoon hierdie benadering groot ooreenkomste met die Postmodernisme, waarin geen vaste reëls bestaan om die betekenis van tekste te bepaal nie. Gesien in die lig van die gereformeerde teologie, soos veranker in die Woord en belydenisskrifte, vertoon die feministiese teologie ernstige leemtes. Die bydraes (Skrifbeskouing van drie prominente feministiese teoloë – Fiorenza, Brenner en Van Dijk-Hemmes – word onder die loep geneem en teologies-krities geëvalueer ten einde hierdie leemtes uit te wys. It appears that the feminist view of Scripture is based on the principle of selective authority of the Scriptures, which means that only the parts of the Bible corresponding with the feminist ideology are accepted as authoritative. The use of androcentric language, in particular, makes it difficult for followers of feminism to accept the whole Bible as authoritative. Hermeneutically, their approach resembles Postmodernism, interpreting without any rules. Viewed from the paradigm of the reformed theology, which is anchored in Scripture and the articles of faith, feminist theology shows serious shortfalls. The contributions of three prominent feminist theologians – Fiorenza, Brenner and Van Dijk-Hemmes – are studied closely and evaluated critically in the light of the reformed theology, to underline these shortfalls.


    African Journals Online (AJOL)

    In 1933 belas Rykskanselier. Hitler vir. Goering, Minister van Lugvaart, in die geheim met die skepping van die Luftwaffe. Die basis in Rusland is gesluit en toekomstige vlieeniers is nou in die geheim na Italie waar hulle elke aspek van moderne oorlog- voering oefen en die Blitzkrieg-gedagte, deur op ondersteuning van 'n.


    African Journals Online (AJOL)

    rang. In Assiries beteken die woord “hoof-eunug”. Soos reeds vermeld (by 2), vorm die eunug 'n belangrike deel van die Assiriese burokrasie. Dokumente dui aan ... rang in die Babiloniese weermag, en so 'n amptenaar het saam met die rabsag ..... baie laat, in die inter-testamentêre periode, gebruik is vir 'n gekastreerde.

  4. Treating palliative care patients with pain with the body tambura: A prospective case study at St. Joseph′s hospice for dying destitute in Dindigul South India

    Directory of Open Access Journals (Sweden)

    Cordula Dietrich


    Full Text Available Background: The Body Tambura is a recently invented stringed instrument that is used for receptive music therapy designed to be placed and attached on the human body. The aim of this study was to record perceived effects of a treatment with the Body Tambura on palliative care patients with special reference to pain. Materials and Methods: A prospective case study was carried out with patients of St. Joseph′s Hospice for Dying Destitute in Dindigul/South India. Patients were treated with a treatment after baseline assessment and also on the next day. Outcomes were measured quantitatively by using a numeric rating scale (0-10, 10 maximum intensity of pain felt at baseline, directly after treatment, and the day after the treatment to determine the intensity of the pain. Results: Ten patients (five women and five men participated in the study. The majority described the therapy as a pleasant experience. The pain intensity at baseline was reduced from 8.3 ± standard deviation (SD 1.16 to 4.6 ± 1.52 at day 1 and from 4.6 ± 2.07 to 2.4 ± 1.58 at day 2. Conclusion: A clinically relevant pain reduction was described as short time outcome; the therapy was received and perceived well. Forthcoming research should include a control group, randomization, a larger number of participants, and a longer period of treatment.

  5. Voedingpraktyke en behoeftes van hulpbron-arm gemeenskappe deur die oë van laerskoolonderwysers

    Directory of Open Access Journals (Sweden)

    Ronel Ferreira


    Full Text Available In hierdie artikel bespreek ons die persepsies van onderwysers (n = 45 wat betref die voedingpraktyke van ’n steekproef laerskoolleerders en hul gesinne in ’n hulpbron-arm gemeenskap. Ons fokus spesifiek op die behoeftes, praktyke en verwagtings ten opsigte van die gebruik van voedsel, wat die produksie, keuse en voorbereiding van voedsel impliseer. Ons studie vorm die eerste deel van ’n groter institusionele navorsingprojek. Vir die doel van ons studie het ons deelnemende refleksie en aksie-gebaseerde werkwinkels gehou om data te genereer en tydens die interpretasie van bevindinge op interpretivisme staatgemaak. Hierdie studie beklemtoon die behoeftes van hulpbron-arm en werklose gemeenskapslede wat dikwels genoodsaak is om teen verlaagde pryse voedsel te koop waarvan die kwaliteit nie optimaal is nie. ’n Verskraalde ontbyt, middagete of aandete waarvan die keuse algemeen beperk is tot swart tee, pap en een of twee snye ou brood, bevestig die manifestasies van armoede in hulpbron-arm gemeenskappe. Maaltye is dikwels beperk tot groot hoeveelhede koolhidrate, min groente, ingelegde vis, pap met inkomazi en marog. Hoenderpote en afval vul soms die spyskaart aan. Onderwysers beklemtoon die feit dat gemeenskapslede tipies op skenkings van werkgewers, kerke en kruidenierswinkels staatmaak om hul voedselbegroting aan te vul. Onderwysers fokus verder op die behoeftes aan opleiding vir gemeenskapslede. Na hulle mening moet gemeenskappe ingelig word oor voedselproduksie, groentetuine, die wyses waarop die kwaliteit van grond bepaal kan word, besproeiing en die toepassing van volhoubare wisselbou. Die artikel word afgesluit met uitvoerbare en leersame wenke vir die opleiding van landelike gemeenskappe. Op grond van dié navorsingsbevindinge word ’n intervensieprogram tans ontwikkel, met die doel om dit in die onderskeie deelnemende skole te implementeer ter bevordering van gesonde voedselverwante gedrag en welsyn.

  6. Die Transition zur pflegenden Tochter

    Directory of Open Access Journals (Sweden)

    Dagmar Dräger


    Full Text Available Das Buch aus der Reihe „Studien zur Gesundheits- und Pflegewissenschaft“ beschreibt den theoretischen Hintergrund, das methodische Vorgehen und die Ergebnisse einer biografischen Untersuchung, die sich dem Übergang von der Tochter zur pflegenden Tochter widmete. Grundlage der Publikation ist die Dissertation (2002 der Autorin. Mit der Berücksichtigung biographischer und familiärer Hintergründe wird eine neue Perspektive in der Forschung zu pflegenden Angehörigen eingenommen.

  7. Maintaining Low Voiding Solder Die Attach for Power Die While Minimizing Die Tilt

    Energy Technology Data Exchange (ETDEWEB)

    Hamm, Randy; Peterson, Kenneth A.


    This paper addresses work to minimize voiding and die tilt in solder attachment of a large power die, measuring 9.0 mm X 6.5 mm X 0.1 mm (0.354” x 0.256” x 0.004”), to a heat spreader. As demands for larger high power die continue, minimizing voiding and die tilt is of interest for improved die functionality, yield, manufacturability, and reliability. High-power die generate considerable heat, which is important to dissipate effectively through control of voiding under high thermal load areas of the die while maintaining a consistent bondline (minimizing die tilt). Voiding was measured using acoustic imaging and die tilt was measured using two different optical measurement systems. 80Au-20Sn solder reflow was achieved using a batch vacuum solder system with optimized fixturing. Minimizing die tilt proved to be the more difficult of the two product requirements to meet. Process development variables included tooling, weight and solder preform thickness.

  8. A case study exploring the ethical and policy dimensions of allocating acute care resources to a dying patient. (United States)

    Cooke, Mary; Hurley, Ciarán


    We aimed to identify policy, process and ethical issues related to allocation of National Health Service resources when patients with end-of-life illness are referred to acute care services. Sharing healthcare decisions denotes a different partnership between professionals and patients when patients are empowered to define their needs. Implementation of a transition from professional to patient decision-making appears to be dependent upon its interpretation by personnel delivering care using the local trust policy. The outcome of this is a reformation of responsibility for budget allocation, choice of acute care provider and selecting services, currently in the realm of primary care; be it the general practitioner, community practitioners, or the patient. We used a 'lens' approach to case study analysis in which the lens is constructed of a model of policy analysis and four principles of biomedical ethics. A patient's decision to decline care proposed by an Accident and Emergency department nurse and the nurse's response to that decision expose a policy that restricts the use of ambulance transport and with that, flexibility in responses to patients' decisions. End-of-life care partnership decisions require sensitivity and flexibility from all healthcare practitioners. We found that policy-based systems currently used to deliver care across the primary care - hospital care border are far from seamless and can lead to foreseeable problems. Health professionals responsible for the care of a patient at the end of life should consider the holistic outcomes of resource allocation decisions for patients. Government and health professional agenda suggest that patients should be given a greater element of control over their healthcare than has historically been the case. When patients take responsibility for their decisions, healthcare personnel should recognize that this signals a shift in the nature of the professional-patient relationship to one of partnership.

  9. Neurokognitiewe integrasie en die leerproses

    Directory of Open Access Journals (Sweden)

    Du Preez, Johan J.


    Full Text Available The purpose of this article, "Neuro-cognitive integration and the learning process'; is to find principles and strategies for the development of brain potential and the optimal integration of subject matter. Eight neuro-cognitive systems are identified and their importance to the integration of subject matter is emphasized. These systems are cortical energy, coding, planning and controlling, as well as the verbal sequential, non-verbal holistic, physical-motor, social effective and the subconscious. The relevant principles and strategies can serve as basis for mainstream and special education, guidance as well as psychotherapy. Die doe! met hierdie artikel is om beginsels en strategiee te vind om breinpotensiaal te ontsluit en leerstof optimaal te integreer. Aan die hand van 'n neurokognitiewe model word 'n aantal beginsels en strategiee bespreek en die verband met die leerproses word aangetoon. Agt neurokognitiewe sisteme is gei'dentifiseer en die belangrike rot wat dit speel ten opsigte van die integrasie van leerstof word beklemtoon. Genoemde sisteme sluit die volgende in: kortikale energie, kodering, beplanning en kontrolering, asook die verbaal-sekwensiele, nieverbaal-holistiese, fisiek-motoriese, sosio-affektiewe en die subbewuste. Genoemde beginsels en strategiee kan oak dien as grondslag vir hoofstroomonderwys, spesialiseringsonderwys, voorligting sowel as psigoterapie.

  10. Energy-resolved photoemission studies of Be-containing surfaces for fusion; Energievariierte Photoemissionsstudien an berylliumhaltigen Oberflaechen fuer die Fusion

    Energy Technology Data Exchange (ETDEWEB)

    Koeppen, Martin


    . Oxygen diffusion is observed and attributed to diffusion of BeO. Further, the influence of a BeO-interlayer on the carbidisation in the system C-W is investigated. Already at RT small amounts of carbidised W are visible. At 1280 K further carbidisation of W is observed. No reaction between BeO and W is visible. Carbidisation of W shows, that BeO does not serve as a diffusion barrier for C, even at RT. Using energy-resolved XPS and the newly developed quantitative model allows detailed studies of multi-component surface reactions considering the evolution of the depth distribution.

  11. Study on the planning of a demonstration plant for hydrogen fuel production by electrolysis using caching in salt caverns under pressure; Studie ueber die Planung einer Demonstrationsanlage zur Wasserstoff-Kraftstoffgewinnung durch Elektrolyse mit Zwischenspeicherung in Salzkavernen unter Druck

    Energy Technology Data Exchange (ETDEWEB)



    In a two year research project the long-term storage of hydrogen as energy carrier has been assessed in detail for large renewable electricity quantities in underground storage caverns in Germany. Next to a regions analysis for potential storage sites, the benchmarking against other large scale storage concepts, a comparative and perspective analysis of alkaline and PEM-electrolysers also potential business cases for Power-to-Hydrogen in the mobility sector as well as for the chemical, electricity and natural gas industry have been analysed. [German] Durch den geplanten Ausbau der Stromerzeugung aus fluktuierenden, erneuerbaren Energien in Deutschland ruecken Speichertechnologien fuer elektrische Energie immer staerker in den Fokus des industriellen und politischen Interesses. Eine vielversprechende Moeglichkeit fuer eine Langzeitspeicherung bei hohen Anteilen von Wind- und Photovoltaikanlagen sind Speichertechnologien wie die Wasserstoffspeicherung mit Hilfe von Wasserelektrolyseuren. Diese koennen erneuerbaren Strom in grossen Mengen und bei entsprechender Steuerung selektiv in Zeiten mit hohem Dargebot z.B. an Windstrom chemisch speichern. Der gespeicherte Wasserstoff kann dann entweder zu einem spaeteren Zeitpunkt wieder rueckverstromt oder direkt stofflich verwertet werden, z.B. als Kraftstoff fuer den Verkehrssektor, als chemischer Rohstoff oder fuer den Hausenergiebereich durch Einspeisung in das Erdgastransportnetz. Thema der vorliegenden Studie sind Analysen und Planungen fuer die Erprobung des Gesamtsystems ''Wasserstoff-Elektrolyse-Speicherung'' in energiewirtschaftlich relevanten Dimensionen. Dazu werden mit einem neuen Ansatz techno-oekonomische Entwicklungspfade fuer Wasserstoff-Systeme unterschiedlicher Groesse und Technologien charakterisiert und technologische Risiken bei der Realisierung dieser Systeme identifiziert und bewertet. Diese Arbeiten werden ergaenzt durch Arbeiten auf dem Gebiet der Salzkavernenspeicherung in Form

  12. Numerical optimization of die geometry in open die forging

    DEFF Research Database (Denmark)

    Christiansen, Peter; Hattel, Jesper Henri; Bay, Niels


    This paper deals with numerical optimization of open die forging of large metallic ingots made by casting implying risk of defects, e.g. central pores. Different material hardening properties and die geometries are combined in order to investigate, which geometry gives rise to maximum closure...

  13. die geskiedenis van die saw gedenkteken te fort klapperkop militere ...

    African Journals Online (AJOL)

    As gevolg van enige optrede, op enige plek, te enige tyd, deur enige vyand van die RSA of deur enige terroris(te), insurgent(e) of ander persoon of persone wat die RSA en sy volkere kwaadgesind is. h. Binne twee jaar (vyfhondred-en-dertig dae) nadat hy/sy met 'n ongeskiktheids- pensioen uit diens getree het agv siekte,.

  14. Die adversatiewe stelsel van bewyslewering en die beste belang ...

    African Journals Online (AJOL)

    MJM Venter

    weeg. Hierdie vraag word teen die agtergrond daarvan beoordeel dat veral dispute ..... restructuring family into the highly polarized positions of court-based dispute resolution.16. Talle alternatiewe om tekortkominge in die adversatiewe proses te ..... De Jong M "Mediation and Other Appropriate Forms of Alternative Dispute.

  15. Die teologiese debat: Die waarde of betekenis daarvan

    African Journals Online (AJOL)

    Ego vero hoc libro non contuli sed asservi et assero, ac penes nullum vo- lo esse iudicium, sed omnibus suadeo, ut praestent obsequium. (M Luther, De servo arbitrio, 1525). 1. INLEIDING. In ons dae is dit hoe mode om oor alles debat te voer. Een van die towerwoorde van ons tyd, veral op die politiek-staatkundige terrein, ...

  16. Die konteks vir die keuse van geriefsvoedsel van bepaalde ...

    African Journals Online (AJOL)


    70. Die konteks vir die keuse van geriefsvoedsel van bepaalde beroepsvroue *. Martha Kok en Priscilla Botha. ABSTRACT. The purpose of this research is to understand and describe the context in which career women choose, purchase and use convenience food (CF). A person is rarely isolated from or unaffected by.

  17. Die vlugtige taal van vergeet: Die metafoor by Breyten Breytenbach ...

    African Journals Online (AJOL)

    From his first book of poetry, die ysterkoei moet sweet (“the iron cow must sweat”, 1964), till his most recent one, die windvanger (“the windcatcher”, 2007), metaphor has been a central means towards the creation of meaning for Breytenbach. This article will investigate the use of metaphor particularly in this recent book.

  18. Bestuur van die Nasionale Skoolvoedingsprogram in hulpbronarm skole in Limpopo – praktyk, suksesse en uitdagings

    Directory of Open Access Journals (Sweden)

    Eric Eberlein


    Full Text Available Hierdie studie stel ondersoek in na die wyse waarop die implementering van die Nasionale Skoolvoedingsprogram (NSVP bestuur word deur skoolhoofde in hulpbronarm laerskole in die Waterberg-distrik van die Limpopo-provinsie. Dit vorm deel van ’n groter gesamentlike studie van die Universiteit van Pretoria en Northeast Normal University (UP en NENU wat fokus op die stand van prinsipaalskap in beide stedelike en landelike omgewings in SuidAfrika en in China. Data vir hierdie kwalitatiewe studie is met behulp van onderhoude en waarneming verkry binne die raamwerk van die vier bestuursfunksies soos omskryf deur Van Deventer en Kruger: beplanning; organisasie; leiding en rigtinggewing; asook kontrole en evaluering. Die primêre bevinding van die studie is dat hoewel skoolhoofde bewus is van riglyne en praktyke vir die implementering van die NSVP wat deur die Departement van Basiese Onderwys voorgeskryf word, hulle byna volledig op ander rolspelers op skoolvlak staatmaak om die program te bestuur, sonder enige daaglikse betrokkenheid by die proses of enige erkenning van hul eie rol en verantwoordelikhede in hierdie verband.

  19. Pylstertmotte (Lepidoptera: Sphingidae van die Nasionale Krugerwildtuin

    Directory of Open Access Journals (Sweden)

    M. A. van den Berg


    Full Text Available 'n Totaal van 42 spesies van pylstertmotte is in die Nasionale Krugerwildtuin versamel. Die bekendste hiervan is die patatrusper (Herse convolvuli (L en die dood-skedelmot (Acherontia atropos (L. Die volgende spesies wat versamel is, se voorkoms is nog nie voorheen vir die Republiek van Suid-Afrika aangemeld nie nl. Pemba flavillacea (Walk., Praedora plagiata (R. &J., Leptoclanis basalis (Walk., Polyptychus calcareus (R. &J., Polyptychus compar (R. &J., Nephele aequivalens (Walk., Nephele peneus (Cram., Hippotion roseipennis (Butler en Xenosphingia jansei (Jord.. Die verspreiding van Oligographa juniperi (Bsd. wat langs die kusgebiede van Natal en die Oos-Kaap aangetrefword, is op verskeie plekke in die Krugerwildtuin versamel.

  20. Statues Also Die

    Directory of Open Access Journals (Sweden)

    Pierre-Philippe Fraiture


    Full Text Available “African thinking,” “African thought,” and “African philosophy.” These phrases are often used indiscriminately to refer to intellectual activities in and/or about Africa. This large field, which sits at the crossroads between analytic philosophy, continental thought, political philosophy and even linguistics is apparently limitless in its ability to submit the object “Africa” to a multiplicity of disciplinary approaches. This absence of limits has far-reaching historical origins. Indeed it needs to be understood as a legacy of the period leading to African independence and to the context in which African philosophy emerged not so much as a discipline as a point of departure to think colonial strictures and the constraints of colonial modes of thinking. That the first (self-appointed exponents of African philosophy were Westerners speaks volumes. Placide Tempels but also some of his predecessors such as Paul Radin (Primitive Man as Philosopher, 1927 and Vernon Brelsford (Primitive Philosophy, 1935 were the first scholars to envisage this extension of philosophy into the realm of the African “primitive.” The material explored in this article – Statues Also Die (Marker, Resnais, and Cloquet, Bantu Philosophy (Tempels, The Cultural Unity of Negro Africa (Cheikh Anta Diop, and It For Others (Duncan Campbell - resonates with this initial gesture but also with the ambition on part of African philosophers such as VY Mudimbe to challenge the limits of a discipline shaped by late colonialism and then subsequently recaptured by ethnophilosophers. Statues Also Die is thus used here as a text to appraise the limitations of African philosophy at an early stage.  The term “stage,” however, is purely arbitrary and the work of African philosophers has since the 1950s often been absorbed by an effort to retrieve African philosophizing practices before, or away from, the colonial matrix. This activity has gained momentum and has been

  1. Die invloed van grootgroeponderrig op die selfgereguleerde leer van tersiêre wiskundeleerders

    Directory of Open Access Journals (Sweden)



    Full Text Available elfregulering is belangrik in die ontwikkeling van lewenslange leerders, veral by voordiensonderwysers wat op hul beurt modelleerders van selfregulering in hul eie klaskamers gaan wees. Onderrig op tersiêre vlak word grootliks gekenmerk deur tradisionele onderrigmetodes vanweë die groot groepe leerders betrokke. In hierdie studie is vasgestel of ’n bepaalde grootgroeponderrigstrategie ’n invloed het op lede van groot klasgroepe se selfregulering, al dan nie. ’n Kwantitatiewe voortoets-natoets-ontwerp is gebruik waarin die studiegewoontesveld van die Studie-Oriëntasievraelys in Wiskunde aan die begin en einde van die semester ingesluit is. In ’n tweede vraelys het leerders hul belewenis van die grootgroeponderrigstrategie volgens ’n vyfpunt-Likertskaal beoordeel en ’n oopeindevraag voltooi wat ingesluit is om moontlike addisionele verklarings te bied vir die resultate wat verkry is uit die geslote vrae van die vraelys oor grootgroeponderrig. Beskrywende statistiek is gebruik om die data te interpreteer. Uit die resultate blyk dit dat daar nie ’n verbetering in leerders se selfregulering was nie. By ontleding van die oopeindevraag het dit aan die lig gekom dat verskeie aspekte van selfregulering by leerders ontbreek, soos tydsbestuur en goeie studiegewoontes, asook die bereidwilligheid om meer as net die voorgeskrewe probleme te doen.The influence of a large group teaching strategy on the self-regulated learning of tertiary mathematics learners. Self-regulation is important in developing lifelong learners, especially in the case of pre-service teachers who will soon be models of self-regulation in their own classrooms. In many instances, teaching at tertiary level is characterised by traditional teaching methods in large classes. In this study a particular large group instructional strategy was examined to determine whether it had an influence on learners’ self-regulation. A quantitative pre-test post-test design was used which

  2. Die verband tussen voeding en die leesprestasie van graad 4-leerders in Suid-Afrika: Bevindinge van prePIRLS 2011

    Directory of Open Access Journals (Sweden)

    Surette van Staden


    Full Text Available Die effek van voeding op leerderprestasie was al die onderwerp van menige studie. Bewyse wat die oorsaaklike verhouding tussen voeding en prestasie staaf, bestaan egter nie. Op nasionale vlak belê die Departement van Basiese Onderwys tyd, moeite en geldelike hulpbronne in ’n Nasionale Skoolvoedingsprogram in ’n poging om die gesondheid van SuidAfrika se armste leerders te beskerm en om ’n bydrae tot hul opvoeding te maak. Teen hierdie agtergrond ondersoek die huidige studie patrone in die leesgeletterd van graad 4-leerlinge, wat geassosieer word met die response van onderwysers oor leerdervoeding, deur gebruik te maak van die Suid-Afrikaanse data van die Pre-Progress in International Reading Literacy Study (prePIRLS 2011. Volledige verslae van onderwysers oor die mate waartoe onderrig beϊnvloed word deur leerders se gebrek aan basiese voeding word aangebied, terwyl verslae van onderwysers volgens taalgroep ook oorweeg word in ’n poging om beter insig te verkry in patrone van prestasie op ’n gedisaggregeerde vlak. Resultate vir die huidige studie bevestig bestaande literatuur, naamlik dat ’n oorsaaklike verband tussen voeding en leesprestasie nie sonder twyfel vasgestel kan word nie. Nieteenstaande die gebrek aan oorsaaklike bewyse, behoort nasionale skoolvoedingsprogramme egter nie gediskrediteer of gestaak te word nie. Sulke programme kan moontlik juis van waarde wees wanneer realistiese doelwitte gestel word met die oog op verbeterde ondersteuning vir leerders.

  3. Die Parlamentswahlen 2008 in Malaysia

    DEFF Research Database (Denmark)

    Reher, Stefanie; Knirsch, Thomas


    aus diversen Parteien bestehende Oppositionsbündnis erfuhr überraschend eine klare Stärkung. Während die aus der UMNO und 13 weiteren Koalitionären bestehende BN unter dem Motto „Sicherheit, Frieden, Wohlstand” für Premier Badawi warb, führten die Oppositionsparteien DAP, PAS und PRK – letztere unter...

  4. In diens van die Kompanjie

    African Journals Online (AJOL)

    was ook siektes WQl Jit onvoldoende of ondoel- treffende voeding, eentonige kos en ontoerei- kende geneesmiddels voortgespruit het, terwyl behoorlike versorging dikwels ontbreek he!. Doodsoorsake tydens die seereis het voartge- vloei uit ongelukke aan boord, beperkte ruimte vir die bemanning en geringe vars lug, ...

  5. Die Mythen von der Globalisierung

    DEFF Research Database (Denmark)

    Nell, Phillip; Schmitt, Jan; Decreton, Benoit


    Der Wissensstand über den Grad und die Art der Globalisierung ist viel niedriger als angenommen. Daraus entstehen Fehleinschätzungen.......Der Wissensstand über den Grad und die Art der Globalisierung ist viel niedriger als angenommen. Daraus entstehen Fehleinschätzungen....

  6. n hoofstuk in die (outo)biografie van die predikant (pastor?) 1 ...

    African Journals Online (AJOL)

    biografie van die dominee (pastor?), spreek om verskeie redes boekdele. Die gebruik van die onbepaalde lidwoord is eerstens 'n bevestiging dat die artikel slegs 'n verdere bydrae (hoofstuk) tot die bestaande en steeds voortgaande gesprek (boek) oor die biografie van die dominee is (Heitink 2001). Tweedens plaas ek ...

  7. die krag van simbole en rites in die liturgie 1. probleemstelling

    African Journals Online (AJOL)

    uitroepe vervang met die drie keer Kyrie eleison, die drie maal Christe eleison en die drie keer Kyrie eleison-uitroepe (Albrecht 1989:43). Op die lang duur het die uitroep dus heeltemal losgeraak van die gebede en het dit 'n selfstandige liturgiese element geword (Van Rongen. 1990:35). Die Reformasie met sy nadruk op ...

  8. Vanaf die Fermat-punte na die De Villiers-punte van ’n driehoek

    Directory of Open Access Journals (Sweden)

    Michael de Villiers


    Full Text Available Hierdie artikel beskryf die ontdekking van die sogenaamde De Villiers-punte van ’n driehoek die bewyse wat betrokke is, en trek die historiese oorsprong terug na die Fermat-punte van ’n driehoek, die swaartepunt van ’n driehoek, en ’n nuttige veralgemening van die Fermat-punte van ’n driehoek.

  9. Die benutting van bestuurstalent met verwysing na die invloed van leierskapstyl en tydspan

    Directory of Open Access Journals (Sweden)

    J. C. D. Augustyn


    Full Text Available A field and Laboratory study were conducted to determine the relationship between Leadership style, time-span of discretion and group performance. The results of this research support the prediction that situational variables such as time-span of discretion tend to moderate the relationship between Leadership style and group performance. Implications for future theory development, research and applications are discussed. Opsomming In 'n gekontroleerde laboratorium- en kontrolestudie is die verband tussen leierskapstyl en bestuursdoeltreffendheid onder verskillende tydspantoestande bepaal. Resultate toon aan dat beide leierskapstyl en tydspan 'n invloed uitoefen op bestuursdoeltreffendheid. Doeltreffendheid kan beskou word as 'n funksie van die aanpassing van basiese leierskapstyl by die betrokke situasie. Die gevolge wat hierdie bevindings vir verdere navorsing en bestuursontwikkeling mag inhou, word bespreek.

  10. Montessori-skole: die ander kant

    Directory of Open Access Journals (Sweden)

    Monica Viljoen


    Full Text Available Na aanleiding van die artikel “Die invloed van die New Age-beweging op die onderwysagenda van die toekoms” deur Lien van Niekerk en Corinne Meier van die Departement Historiese Opvoedkunde van Unisa (vgl. Koers, 59 (1 1994:69-84 wil ek graag ’n ander sy van Montessori-skole onder die aandag van Koers lesers bring.

  11. Mediamonitering in die bestuur van korporatiewe beeld



    M.Comm. Die waarde van hierdie ondersoek hou verband met die bemarking van 'n onderneming en die handhawing van 'n mededingende voordeel deur die projektering van 'n positiewe beeld (Anon., 1995a:92; Bateman & Zeithaml, 1993:75; Caminiti, 1992:50; Kotler & Armstrong, 1991:240). Hierdie aspek neem toe in belangrikheid soos wat die besigheidsmilieu in Suid-Afrika verander, veral wat betref die toetrede van buitelandse maatskappye tot die Suid-Afrikaanse mark.

  12. Filosofiese tendense in die wordinggeskiedenis van ons verstaan van die fisiese natuur

    Directory of Open Access Journals (Sweden)

    D. F. M. Strauss


    Full Text Available Die ontstaan van ’n lang tradisie van natuurwetenskaplike denke is in antieke Griekeland te vind – die bakermat van die Westerse beskawing en die bron van geartikuleerde rasionele besinning. Die vroegste fases van die Griekse kultuur het reeds geboorte geskenk aan ’n teoretiese nadenke oor die heelal. Die Pythagoreërs is veral bekend vir hul klem op die verklaringskrag van getalsverhoudinge. In hul tese dat “alles getal is” het hulle egter slegs rasionale getalle (breuke erken en gevolglik uiteindelik vasgeloop in die ontdekking van irrasionale getalle wat tot die geometrisering van die Griekse wiskunde gelei het en tegelyk die bedding gevorm het van waaruit ’n magtige tradisie van ruimte-metafisika gegroei het wat die hele middeleeuse tydperk omspan het. Die vermeende statiese syn is in die mees ekstreme geval – die skool van Parmenides en die argumente van Zeno teen veelheid en beweging – tot in die uiteindelike antinomiese konsekwensies daarvan deurdink. Dit was egter eers die vroeg-moderne tyd – die voorgangers en nakomelinge van Galilei – wat naas getal en ruimte ’n waardering ontwikkel het vir die verklaringskrag van beweging (vergelyk die klassieke meganistiese wêreldbeeld van die heelal as ’n meganisme van stofdeeltjies in beweging. Maar ook hierdie meganistiese reduksie (waardeur alle fisiese verskynsels herlei is tot die beweging van al of niegelade massapunte sou uiteindelik misluk omdat dit nie van die onomkeerbaarheid van fisiese prosesse rekenskap kon gee nie. Gevolglik beliggaam eers die fisika van die 20ste eeu ’n erkenning van die deurslaggewend-stempelende rol van energie-werking (dus van die fisiese aspek in die aard van stoflike dinge en prosesse. Die artikel word afgesluit met ’n vlugtige verduideliking van die implikasies van die voorafgaande argumentasie vir ’n benadering van die misterie van die bestaan van materie.

  13. Die invloed van doelwitstelling op prestasie

    Directory of Open Access Journals (Sweden)

    J. G. A. Louw


    Ofskoon die meeste navorsing Locke se doelwitstellingsteorie ondersteun, is bepaalde afwykings teengekom wat nie op 'n bevredigende wyse verklaar kan word nie. Die resultate van hierdie studie dui daarop dat 'n toename in doelwitmoeilikheidsgraad nie altyd tot ‘n ooreenstemmende toename in prestasie lei nie. Hierdie resultaat kon ook nie op grond van 'n gebrek aan doelwitaanvaarding verklaar word nie. Daar is voorts gevind dat die wyse waarop 'n nie-spesifieke doelwit gestel word, 'n beduidende invloed op prestasie kan hê. Finansiële aansporings blyk ook 'n onafhanklike invloed op prestasie te hê. Bepaalde aspekte van Locke se teorie word dus deur bogenoemde resultate bevraagteken. Aanbevelings vir verdere navorsing word ten slotte gedoen.

  14. Die toepassing van die K3-model op die televisieteks Colour TV

    African Journals Online (AJOL)

    “OIL's approach to investigating the coloured market took place in the form of ethnographic research which ... communication strategies” (Botha 2010: 14). ... Op grond van die waarnemings, onderhoude en vraelyste het OIL tot die volgende ..... hold onto your nearest and dearest because this is going to be a kwaai mix bag.

  15. Brittle Fracture Behaviors of Large Die Holders Used in Hot Die Forging

    Directory of Open Access Journals (Sweden)

    Weifang Zhang


    Full Text Available Brittle fracture of large forging equipment usually leads to catastrophic consequences. To avoid this kind of accident, the brittle fracture behaviors of a large die holder were studied by simulating the practical application. The die holder is used on the large die forging press, and it is made of 55NiCrMoV7 hot-work tool steel. Detailed investigations including mechanical properties analysis, metallographic observation, fractography, transmission electron microscope (TEM analysis and selected area electron diffraction (SAED were conducted. The results reveal that the material generated a large quantity of large size polyhedral M23C6 (M: Fe and Cr mainly and elongated M3C (M: Fe mainly carbides along the martensitic lath boundaries when the die holder was recurrently tempered and water-cooled at 250 °C during the service. The large size carbides lead to the material embrittlement and impact toughness degradation, and further resulted in the brittle fracture of the die holder. Therefore, the operation specification must be emphasized to avoid the die holder being cooled by using water, which is aimed at accelerating the cooling.

  16. Case Study to Illustrate the Potential of Conformal Cooling Channels for Hot Stamping Dies Manufactured Using Hybrid Process of Laser Metal Deposition (LMD and Milling

    Directory of Open Access Journals (Sweden)

    Magdalena Cortina


    Full Text Available Hot stamping dies include cooling channels to treat the formed sheet. The optimum cooling channels of dies and molds should adapt to the shape and surface of the dies, so that a homogeneous temperature distribution and cooling are guaranteed. Nevertheless, cooling ducts are conventionally manufactured by deep drilling, attaining straight channels unable to follow the geometry of the tool. Laser Metal Deposition (LMD is an additive manufacturing technique capable of fabricating nearly free-form integrated cooling channels and therefore shape the so-called conformal cooling. The present work investigates the design and manufacturing of conformal cooling ducts, which are additively built up on hot work steel and then milled in order to attain the final part. Their mechanical performance and heat transfer capability has been evaluated, both experimentally and by means of thermal simulation. Finally, conformal cooling conduits are evaluated and compared to traditional straight channels. The results show that LMD is a proper technology for the generation of cooling ducts, opening the possibility to produce new geometries on dies and molds and, therefore, new products.

  17. Hospice assist at home : does the integration of hospice care in primary healthcare support patients to die in their preferred location - A retrospective cross-sectional evaluation study

    NARCIS (Netherlands)

    de Graaf, Everlien; Zweers, Daniëlle; Valkenburg, Anna Ch; Uyttewaal, Allegonda; Teunissen, Saskia Ccm

    BACKGROUND: A majority of patients prefer to die at home. Specialist palliative care aims to improve quality of life. Hospice assist at home is a Dutch model of general/specialised palliative care within primary care, collaboratively built by general practitioners and a hospice. AIM: The aims of

  18. No negative impact of Palliative sedation on relatives' experience of the dying phase and their wellbeing after the patient's death: An observational study

    NARCIS (Netherlands)

    S.M. Bruinsma (Sophie); A. van der Heide (Agnes); M. Van Der Lee; Y. Vergouwe (Yvonne); J.A.C. Rietjens (Judith)


    textabstractBackground: Palliative sedation is the widely-used intervention of administering sedating agents to induce a state of unconsciousness to take away a dying patient's perception of otherwise irrelievable symptoms. However, it remains questionable whether this ethically complex intervention

  19. Effect of palliative care nurse champions on the quality of dying in the hospital according to bereaved relatives: A controlled before-and-after study

    NARCIS (Netherlands)

    F.E. Witkamp (Frederika); L. van Zuylen (Lia); C.C.D. van der Rijt (Carin); A. van der Heide (Agnes)


    textabstractBackground: To improve the quality of end-of-life care, hospitals increasingly appoint palliative care nurse champions. Aim: We investigated the effect of nurse champions on the quality of life during the last 3 days of life and the quality of dying as experienced by bereaved relatives.

  20. Die kliniese kindersielkundige as diagnostikus1

    Directory of Open Access Journals (Sweden)

    D. J. W. Strümpfer


    Full Text Available Die benaming „Kliniese Kindersielkunde” is nog onbekend en gevolglik betreklik onbemind. Dit is in 1951 die eerste keer gebruik. Die werk van die Kliniese Kindersielkunde is egter so oud as die werk van die algemene Kliniese Sielkunde, waarvan die geskiedenis gewoonlik teruggevoer word tot die begin van sielkundige toetsing vroeg in die tagtigerjare. Tot ’n aansienlike mate is hierdie vroeë werk op kinders uitgevoer, bv. dié van Galton en later die van Binet en Simon. Witmer het in 1896 die eerste sielkundige kliniek geopen en het ook die term „Kliniese Sielkunde” ingevoer; die meerderheid van sy pasiënte was egter ook kinders. Tot voor die Tweede Wêreldoorlog was klinies-sielkundige werk hoofsaaklik op kinders toegespits. Sedertdien het die kliniese sielkundige tot ’n belangrike mate toegetree tot die gebied van die diagnose en terapie van psigiese afwykings by volwassenes, tot so ’n mate dat in die gedagtes en geskrifte van baie werkers die terrein van die Kliniese Sielkunde byna tot werk met volwassenes beperk word.


    African Journals Online (AJOL)

    P.J. Strauss. DIE NAAM “NEDERDUITSE. GEREFORMEERDE KERK”. ABSTRACT. An investigation into the name of the Dutch Reformed Church (DRC) reveals that it is a reformed church in the ... P.J. Strauss, Fakulteit Teologie, Universiteit van die Vrystaat, Suid‑Afrika. ..... Dit is so omdat die staat en sy howe die reg in die ...

  2. Abstraksie en veralgemening in die Wiskunde

    Directory of Open Access Journals (Sweden)

    B.C. Strydom


    Full Text Available Wanneer ek tot u spreek oor abstraksie en veralgemening in die Wiskunde, wil ek u aandag vestig op die belangrikheid daarvaan vir die Wiskunde, maar u terselfdertyd daarop wys dat die wiskundige hom nie langs hierdie weg heeltemal van die werklikheid kan losmaak nie.

  3. Die Dankesrede bei der Preisverleihung

    Directory of Open Access Journals (Sweden)

    Elenmari Pletikos Olof


    Full Text Available Festliche Preisverleihungen sind Gelegenheiten, bei denen von den Preisträgerneine kurze Rede erwartet wird. Obwohl die Dankesrede eine kleinere Randgattung innerhalb des epideiktischen Genres ist, steht sie im Mittelpunkt des Ereignisses. Rhetorikhandbücher geben zahlreiche Ratschläge, wie eine gute Festrede vorbereitet werden soll, um zu unterhalten, zu bewegen und zu belehren. Ziel dieser Untersuchung ist es festzustellen, welche Eigenschaften der Dankesrede die Zuhörer als erwünscht oder unerwünscht wahrnehmen und welche Charakteristika am meisten zur Qualität festlicher Dankesreden beitragen. Das Korpus der gesprochenen Texte bilden 30 Dankesreden anlässlich kroatischer Preisverleihungen in den Bereichen Schauspiel, Sport, Musik, Fernsehen, Literatur und Wirtschaft. Die Audio-Aufnahmen der Dankesreden wurden einer Gruppe von Hörern zur Bewertung in folgenden Kategorien vorgelegt: interessant, geistreich, hoher Sprachstil, feierlich, emotiv, persönlich, originell, bescheiden, vorbereitet und spontan. Zusätzlich wurde zu jeder Rede die offene Frage gestellt, was dem Zuhörer an der Rede gefallen oder nicht gefallen habe. Die Resultate der Perzeptionsanalye lassen erkennen, dass die Interessantheit einer Rede mit der Eigenschaft des Geistreichen, des Originellen, des Emotionalen und des Persönlichen in Verbindung gebracht wird und die Eigenschaft des Festlichen im Wesentlichen nur mit dem hohen Sprachstil und der Vorbereitetheit des Textes korreliert. Einige Eigenschaften können sowohl erwünscht als auch unerwünscht sein, z. B. Dialekt, Persönliches und Kürze. Die besten Dankesreden haben Eigenschaften, die im Grunde schwer miteinander zu verbinden sind: Einerseits soll der Text vorbereitet sein (hoher Stil, Wortwahl, Figuren, Originalität der Geschichte, Humor, andererseits wird bei der Ausführung Spontaneität (Aufrichtigkeit, Emotionalität, Persönlichkeit erwartet.

  4. Where is God in My Dying?

    DEFF Research Database (Denmark)

    Moestrup, Lene; Hvidt, Niels Christian


    Despite increased focus on the role of spiritual care in palliative care, there is limited knowledge about spirituality / religiosity among dying patients in secularized cultures such as Denmark. This study aims through semi-structured interviews with Danish hospice patients and participant obser......, important faith although it was not something they knew much about, let alone discussed or practiced much....

  5. The Japan HOspice and Palliative Care Evaluation Study (J-HOPE Study): views about legalization of death with dignity and euthanasia among the bereaved whose family member died at palliative care units. (United States)

    Okishiro, Nao; Miyashita, Mitsunori; Tsuneto, Satoru; Sato, Kazuki; Shima, Yasuo


    There has been a debate in appropriateness of legalization of death with dignity and euthanasia in Japan. To clarify views about these issues, we conducted a large nationwide study of the bereaved whose family member died at palliative care units. The percentages of 429 bereaved family members (response rate 65%) who affirmed legal authorization were 52 for death with dignity and 45 for euthanasia and who affirmed assignment at the discretion of the physician involved were 37 for death with dignity and 38 for euthanasia. In conclusion, views about legalization of death with dignity and euthanasia among the bereaved are inconsistent. No consensus is reached as to legislation of these issues.


    African Journals Online (AJOL)


    So ver terug as die vroeë twintigste eeu het die Appèlhof in Cassiem v Standard. Bank of SA Ltd,1 .... 838; Capital Building Society v De Jager 1963 3 SA 381 (T); Smit v Walles 1985 2 SA 189 (T). 196-198. 18 ...... moeilik kon regverdig.97. Ons howe het tot op hede gehuiwer om 'n algemene plig van goeie trou ten aansien.

  7. Quantenfische die Stringtheorie und die Suche nach Weltformel

    CERN Document Server

    Lüst, Dieter


    Lässt sich das Verhalten aller Dinge, von den kleinsten Teilchen bis zum Universum, einheitlich beschreiben? Der heißeste Kandidat für die Entwicklung einer Weltformel, die alle physikalischen Phänomene erklären kann, ist die Stringtheorie. Sollte sie sich als richtig erweisen, so würde das unser Verständnis über den Ursprung der Naturgesetze dramatisch verändern. Denn das von uns beobachtete Universum wäre dann vermutlich eine winzige Blase in einem viel größeren Gebilde, dem Multiversum. Um die Stringtheorie und die Idee des Multiversums plausibel zu machen, greift der international bekannte theoretische Physiker Dieter Lüst auf ein Modell zurück: das Leben von Fischen in einem Teich. Eines Tages gelingt es den Fischen, die kleinsten Teilchen zu identifizieren, aus denen alles im Fischteich besteht - eingeschlossen sie selbst. Sie nennen diese Urbausteine Quantenfische, da ihr Verhalten nahelegt, dass sie auch eine Art von Lebewesen sind. Doch der ersten folgt eine weitere Entdeckung der Fisch...

  8. Feasibility study for new ecolabels according to ISO 14024 (type I) within the product group: small cogeneration plants; Machbarkeitsstudie fuer neue Umweltzeichen in Anlehnung an ISO 14024 (Type I) fuer die Produktgruppe: Kleine Blockheizkraftwerk-Module

    Energy Technology Data Exchange (ETDEWEB)

    Hoffmann, E.; Hirschl, B.; Kaliske, J. [Institut fuer Oekologische Wirtschaftsforschung (IOEW) gGmbH, Berlin (Germany); Reese, I.; Grimpe, T. [Hamburg Gas Consult (HGC) GmbH (Germany)


    available data, it is not possible at the moment to derive concrete criteria for an ecolabel in this field. After the introduction of initial products onto the market, corresponding requirements for plants based on this new technology should be specified. (orig.) [German] Beim vorliegenden Gutachten handelt es sich um eine Machbarkeitsstudie nach ISO 14024. Es behandelt die Frage, ob ein Umweltzeichen fuer kleine BHKW-Module gerechtfertigt ist, und welche Anforderungen diese im Vergabefall erfuellen sollten. Im Rahmen der Untersuchung wurde zunaechst eine umfassende Marktanalyse durchgefuehrt, um daraus die Anlagen zu identifizieren, die fuer ein Umweltzeichen in Frage kommen. Im Hauptteil der Studie ging es um die vertiefende Analyse der Umweltrelevanz der ausgewaehlten Anlagen. Hierzu wurde eine Herstellerbefragung durchgefuehrt und ausgeaehlte BHKW anhand eines Systemvergleiches mit Gas- und Oelheizkesseln verglichen. Auf der Basis dieser Analyse wurden Anforderungskataloge fuer Gas- und Diesel-BHKW-Module abgeleitet, die in einem Fachgespraech in einer breiten Runde von Experten und Herstellern vorgestellt und diskutiert wurden. Aus der Studie und dem Fachgespraech konnte ein deutliches Votum fuer ein Umweltzeichen fuer die untersuchten BHWK-Module abgeleitet werden. Die vorgeschlagenen Vergabegrundlagen umfassen Anforderungen an Richtlinienkonformitaet, rationelle Energienutzung (Elektrischer und Gesamtwirkungsgrad bei Nennlast und Teillast, Angabe des Hilfsstrombedarfes), Emissionswerte von CO, NO{sub x}, Staub und organischen Stoffen, Schallemissionen, Angebot von Wartungsvertraegen, Ruecknahmeverpflichtung sowie Anforderungen an die Bedienungsanleitung. Als moegliche Umschrift eines Zeichens fuer kleine BHKW-Module wird empfohlen: 'Umweltzeichen... weil energieefizient'. Neben motorischen BHKW wurden auch kleine Brennstoffzellen-BHKW untersucht. Diese befinden sich zur Zeit noch in einer Feldtest- und Erprobungsphase. Sie weisen deutliche oekologische

  9. Racism, Ethnicity and the Media in Africa: Reflections Inspired by Studies of Xenophobia in Cameroon and South Africa Rassismus, Ethnizität und die Medien in Afrika: Reflektionen angeregt durch Studien zu Fremdenfeindlichkeit in Kamerun und Südafrika

    Directory of Open Access Journals (Sweden)

    Francis B. Nyamnjoh


    Full Text Available This paper demonstrates the extent to which the media and belonging in Africa are torn between competing and often conflicting claims of bounded and flexible ideas of culture and identity. It draws on studies of xenophobia in Cameroon and South Africa, inspired by the resilience of the politicization of culture and identity, to discuss the hierarchies and inequalities that underpin political, economic and social citizenship in Africa and the world over, and the role of the media in the production, enforcement and contestation of these hierarchies and inequalities. In any country with liberal democratic aspirations or pretensions, the media are expected to promote national citizenship and its emphasis on large-scale, assimilationist and territorially bounded belonging, while turning a blind eye to those who fall through the cracks as a result of racism and/or ethnicity. Little wonder that such an exclusionary articulation of citizenship is facing formidable challenges from its inherent contradictions and closures, and from an upsurge in the politics of recognition and representation by small-scale communities claiming autochthony at a historical juncture where the rhetoric espouses flexible mobility, postmodern flux and discontinuity. Der vorliegende Beitrag zeigt auf, inwieweit die Medien und gesellschaftliche Bindungen in Afrika zwischen konfligierenden Ansprüchen abgegrenzter und sich wandelnder kultureller Identitäten zerrissen sind. Angeregt durch die Erfahrung der kontinuierlichen Politisierung kultureller und sozialer Identitäten zieht der Autor Studien zu Fremdenfeindlichkeit in Kamerun und Südafrika heran, um die Hierarchien und Ungleichheiten zu diskutieren, auf denen politische, wirtschaftliche und soziale Staatsbürgerschaft in Afrika und darüber hinaus basiert, sowie die Rolle der Medien bei der Entstehung, Verstärkung und im Wettstreit dieser Hierarchien und Ungleichheiten. In jedem liberal-demokratisch ausgerichteten Staat

  10. A laser-based study of kerosine evaporation and -mixing for lean prevaporized combustion at elevated pressure; Lasermesstechnische Untersuchung der Kerosinverdampfung und -mischung fuer die magere Vormischverbrennung unter erhoehtem Druck

    Energy Technology Data Exchange (ETDEWEB)

    Brandt, M.


    The evaporation and mixing of a kerosine spray in the turbulent airstream of a prevaporizer is investigated at conditions prevailing in the combustion chamber of gas turbines. An experiment is described that allows to study an evaporating fuel spray downstream a prefilming airblast atomizer with Phase-Doppler anemometry, laser-induced fluorescence and an infrared light absorption technique. At an air pressure of 9 bars, an air temperature of 750 K, a mean air velocity of 120 m/s and a fuel flow rate of 1 g/s the kerosine spray evaporates completely without autoignition. At this operating condition the parameters air pressure, air temperature and air turbulence are varied. The influence of these parametric variations on the dropsize distribution, the evaporation rate and the concentration profiles of liquid and evaporated fuel is presented and discussed. (orig.) [German] Die Verdampfung und Vermischung eines Kerosinsprays in der turbulenten Luftstroemung eines Vorverdampfers wird unter Bedingungen untersucht, die in Brennkammern fuer Gasturbinen vorherrschen. Ein Experiment wird vorgestellt, welches es erlaubt, ein verdampfendes Kraftstoffspray stromab eines ebenen Luftstromzerstaeubers mit Filmleger mittels der Phasen-Doppler-Anemometrie, Laser-induzierter Fluoreszenz und einer Infrarotabsorptionsmesstechnik zu untersuchen. Bei einem Luftdruck von 9 bar, einer Vorwaermetemperatur der Luft von 750 K, einer mittleren Luftgeschwindigkeit von 120 m/s und einem Kraftstoffmassenstrom von 1 g/s verdampft das Kerosinspray vollstaendig, ohne die Selbstzuendungszeit zu erreichen. Bei dieser Betriebsbedingung werden die Parameter Luftdruck, Lufttemperatur und Turbulenzgrad variiert. Der Einfluss dieser Parameter auf das Tropfengroessenspektrum, den Verdampfungsgrad und die Konzentrationsprofile des fluessigen sowie des verdampften Kraftstoffs wird dargestellt und diskutiert. (orig.)

  11. "Sometimes I've gone home feeling that my voice hasn't been heard": a focus group study exploring the views and experiences of health care assistants when caring for dying residents. (United States)

    Fryer, Susan; Bellamy, Gary; Morgan, Tessa; Gott, Merryn


    In most developed countries, Health Care Assistants comprise a significant, and growing, proportion of the residential aged care workforce. Despite the fact that they provide the majority of direct care for residents, little is known about a key care aspect of their work, namely their experience of caring for dying residents. Twenty-six Health Care Assistants working in aged residential care facilities in Auckland, New Zealand participated in six focus group discussions. Focus groups were designed to explore the experiences of Health Care Assistants caring for imminently dying residents in aged care facilities and to identify barriers and facilitators to their work in this area. The focus groups were digitally recorded, transcribed verbatim and analysed using a general inductive approach. Participants confirmed that Health Care Assistants provide the majority of hands on care to dying residents and believed they had a valuable role to play at this time due to their unique 'familial' relationship with residents and families. However, it was apparent that a number of barriers existed to them maximising their contribution to supporting dying residents, most notably the lack of value placed on their knowledge and experience by other members of the multidisciplinary team. Whilst a need for additional palliative and end of life care education was identified, a preference was identified for hands on education delivered by peers, rather than the didactic education they currently receive. Given ageing populations internationally coupled with a constrained health budget, the role of Health Care Assistants in most developed countries is likely to become even more significant in the short to medium term. This study makes a unique contribution to the international literature by identifying the barriers to caring for dying residents experienced by this valuable sector of the aged care workforce. These data have the potential to inform new, innovative, interventions to address

  12. Nuwe patogene in die voedselbedryf

    Directory of Open Access Journals (Sweden)

    M. M. Ehlers


    Full Text Available ’n “Nuwe generasie” voedselpatogene het die afgelope jare hul verskyning gemaak en kan 'n ernstige gevaar vir die voedselbedryf inhou. Hierdie organismes is uiters aanpasbaar en bestaande voedselprosesseringstegnieke, veral die verkoeling van voedsel, is nie altyd volkome effektief om hul groei te voorkom nie. Clostridium botulinum tipe E, enterotoksigeniese Eschsrichia coli. Listeria monocytogenes en Aeromonas hydrophila is in staat om in voedsel by 5 °C te groei. Campylobacter jejuni en Brucella kan weer by 5 °C oorleef en 'n derde groep organismes, naamlik Salmonella, Staphylococcus aureus, Vibrio parahaemolyticus en Vibrio vulnificus kan by temperature tussen 5 °C en 12 °C groei en hul teenwoordigheid is ’n aanduiding dat die koueketting verbreek is.

  13. Die Last mit der Lust

    Directory of Open Access Journals (Sweden)

    Lutz Sauerteig


    Full Text Available Robert Jütte legt mit Lust ohne Last eine umfassende, allgemeinverständliche und spannend zu lesende Geschichte der Empfängnisverhütung von der Antike bis in die unmittelbare Gegenwart vor.

  14. pastorale begeleiding aan die persoon met dissosiatiewe ...

    African Journals Online (AJOL)

    psychological or pastoral by nature. Effective assistance to the person ... INLEIDING. Volgens die kriteria in die DSM-IV2 (Diagnostic and statistical manual of mental disorders, 4th edition) van die APA (American Psychiatric. Association 1995) ...

  15. Die verband tussen werknemertevredenheid en organisasieverbondenheid

    Directory of Open Access Journals (Sweden)

    A. A. S. Pretorius


    Full Text Available The relationship between employee satisfaction and organisational commitment. The primary goal of the study is to determine whether a relationship exists between employee satisfaction and organisational commitment. A secondary goal is to determine whether any biographical variables mediate this relationship. Standardised instruments were used for operationalising these two contructs. A sample of convenience yielded 167 respondents out of a sampling frame of 300 employees from a financial organisation. Only 145 respondents returned fully completed questionnaires that were used for final analysis. Responses from both questionnaires were subjected to a factor and item analysis. A statistically significant relation between employee satisfaction and organisational commitment was found. The implications of the findings are discussed further. Opsomming Die primêre doel van die studie is om vas te stel of daar ’n verband bestaan tussen werknemertevredenheid en organisasieverbondenheid. ’n Sekondêre oogmerk is om te bepaal of enige biografiese veranderlikes hierdie verband medieer. Gestandaardiseerde instrumente is gebruik om hierdie twee konstrukte te operasionaliseer. ’n Gerieflikheidsteekproef het 167 respondente uit ’n steekproefraamwerk van 300 werknemers van ’n finansiële instelling opgelewer. Slegs 145 respondente het volledig voltooide vraelyste terugbesorg, wat vir finale ontleding gebruik is. Response op albei vraelyste is aan ’n faktor- en itemontleding onderwerp. ’n Statisties-beduidende verband tussen werknemertevredenheid en organisasieverbondenheid is gevind. Die implikasies van die bevindinge word verder bespreek.

  16. The efficient ones; Die Leistungsfaehigen

    Energy Technology Data Exchange (ETDEWEB)



    The increase of output of a solar system where vacuum tube collectors replace flatbed collectors is difficult to calculate exactly. The formula for the calculation of efficiency is the basis of such calculations. Due to evacuation and better insulation the heat loss of vacuum tube collectors is smaller than that of flatbed collectors. This is also evident in the fact that the efficiency curve decreases less steeply as the temperature difference increases. Efficiency remains relatively high. Up to now vacuum tube collectors have been a niche product but more and more companies now sell these efficient collectors.(orig.). [German] Wie stark sich die Leistung der Solaranlage verbessert, wenn man Vakuumroehrenkollektoren (VRK) statt Flachkollektoren einsetzt, laesst sich nur schwer berechnen. Grundlage ist stets die Wirkungsgradformel. Aufgrund der Evakuierung und dadurch besseren Isolierung weisen die VRK deutlich geringere Waermeverluste auf als Flachkollektoren. Dies drueckt sich auch dadurch aus, dass die Wirkungsgradkurve mit wachsender Temperaturdifferenz {delta}{theta} deutlich flacher abfaellt. Der Wirkungsgrad bleibt relativ hoch. Als Hightech-Produkt hatte der Vakuumroehrenkollektor bisher eine typische Marktnische besetzt. Doch immer mehr Anbieter entscheiden sich fuer die Vermarktung dieser leistungsfaehigen Kollektoren. (orig.)

  17. Reparation of damaged forging dies

    Directory of Open Access Journals (Sweden)

    Vukić Lazić


    Full Text Available The forging dies are in exploitation exposed to elevated temperatures and variable impact loads, both compressive and shear. Steels for manufacturing of these tools must endure those loads while maintaining mechanical properties and being resistant to wear and thermal fatigue. For those reasons, the alloyed steels are used for making the forging dies, though they have less weldability, because alloying increases proneness to hardening. Any reparatory hard facing (HF of the damaged dies would require the specially adjusted technology to the particular piece. In this paper reparatory hard facing of dies used for forging pieces in the automobile industry is considered. Prior to reparatory hard facing of the real tools, numerous experimental hard facings on models were performed. All the model hard facings were done on the same steels which were used for production of the real forging dies. To define the optimal hard facing technology one needs to derive the optimal combination of the adequate heat treatment(s, to select the proper filler metals and the welding procedure. The established optimal HF technology was applied to real forging dies whose service life was further monitored in conditions of exploitation

  18. Project study for the final disposal of high-level radioactive wastes in deep-lying geological formations and for intermediate storage. Projektstudie fuer die Endlagerung von hochaktiven Abfaellen in tiefliegenden geologischen Formationen sowie fuer die Zwischenlagerung

    Energy Technology Data Exchange (ETDEWEB)


    The present report has been written to show the feasibility of construction and the operational suitability of different intermediate and final storage concepts for high-level radioactive wastes. It summarizes the information from a project study given under contract by Nagra. The report should orient a broader public about the possible construction of such intermediate and final repositories. The work presented here refers to radioactive wastes which need an extremely long isolation time. Important information from a separate study concerning different aspects of the drilling of deep boreholes, has been integrated into the present report.

  19. Uitdagings in die onderrig van evolusie in die lewenswetenskappeklaskamer

    Directory of Open Access Journals (Sweden)

    Josef J. de Beer


    Full Text Available In hierdie artikel skryf die outeurs oor navorsing wat hulle gedoen het oor onderwysers se siening van die onderrig van evolusie, wat in 2008 as ’n tema in lewenswetenskappe in Suid-Afrikaanse skole ingesluit is. Hierdie vernuwing in die kurrikulum is met gemengde reaksies begroet. Terwyl sommige onderwysers dit met entoesiasme onderrig, is baie gekant teen die onderrig van evolusie. Die artikel is gebaseer op ’n navorsingsprojek waarby 255 onderwysers betrek is. Vraelyste is gebruik om kwalitatiewe data, wat vir diskoers ontleed is, in te samel. Die diskoers van die onderwysers het getoon dat ’n groot getal van hulle nie hul onderrigopdrag kan versoen met hul geloof nie en konsepte oor evolusie as ‘feite’ verduidelik, maar seker maak dat evolusie as ’n teorie gediskrediteer word. Dit het verreikende implikasies vir sowel onderwyseropleiding as kurrikulumontwikkeling. Konseptuele veranderingsteorie word as ’n lens gebruik om na hierdie problematiek te kyk. Challenges in the teaching of evolution in the life sciences classroom. In this article the authors report on research that was conducted about teachers’ views on evolution, which was introduced as a theme in the school life sciences curriculum in 2008. This innovation in the curriculum has been met with mixed reactions. Whereas some teachers embrace this new theme, many teachers are opposed to the teaching of evolution. The article reports on an inquiry that was conducted amongst 255 teachers and in which survey questionnaires were used to collect qualitative data, which was analysed for its discourse. The discourse of the teachers shows that many of them cannot reconcile their religious faith with their teaching and that they may teach the ‘facts’ of evolution, but make sure that they discredit evolution as a theory. This raises serious concerns about teacher education and curriculum development. The authors examine these issues through the lens of conceptual change


    African Journals Online (AJOL)

    brith to 136 kg with two planes of nutrition from 53 to 136 kilograms. J. Anim. Sci. 37,683. SIEBRITS, F.K., 1979. Die kwantifisering van effekte van oat teenoor droe voeding op die spekvark. M.Sc. (Agric) verhandeling. Universiteit van Pretoria. THORBEK, GRETE, 1975. Studies on energy metabolism in growing pigs.

  1. Death and Dying Anxiety among Bereaved and Nonbereaved Elderly Parents (United States)

    Azaiza, Faisal; Ron, Pnina; Shoham, Meyrav; Tinsky-Roimi, Tal


    This study examines differences in death and dying anxiety between bereaved and nonbereaved elderly Israeli parents, as well as correlates of these factors among bereaved parents. A total of 97 parents (49 bereaved, 48 nonbereaved) completed measures of death and dying anxiety and religiosity. Bereaved parents reported significantly higher dying…

  2. die kasteel••de goede hoop" (1921.1923): die verhaal van in ...

    African Journals Online (AJOL)

    3. TWEE. KOMITEE-VERGADERINGS. BESLUITE a. Doel en samestelling van die komitee. Op 12 Desember 1921 stuur die Sekretans yap Verdediging uitnodigings aan sekere amptelike instansies en ander behingstd1endes waarin hy die redes vir die wenslikheid van 'n komitee en die werksaamhede uitecnsit en die ge-.

  3. Chrístologie: Die historiese Jesus en die kerugmatiese Christus by ...

    African Journals Online (AJOL)

    dige Here van sy kerk. Die Christelike teologie en die kerk het dus nie 'n ander oprsprong as wat die Christologiese belydenis van die oer-Christendom het nie, naamlik die paasgebeure. Schmithals (1972b:77) wil kerk en teologie aanmoedig om hierdie oorsprong in gedagte te hou en om goed te besef dat die Christus-.

  4. PROF DR FELIX V. lATEGAN: Die Boer se Roer. Die Groot ...

    African Journals Online (AJOL)

    PROF DR FELIX V. lATEGAN: Die Boer se. Roer. Die Groot Geweerboek van Suid-. Afrika. Tafelberg. Uitgewers. Kaapstad, pp. 209, bibliografie, register. Sonder die Boer en sy roer is die geskiede:lis van ons land feitlik ondenkbc:wr en dit is clan ook vo/kome juis gesien dat die skrywer van hierdie baanbrekerswerk die ...

  5. Paulus as vredemaker. Oor die resepsie van die Brief aan Filemon ...

    African Journals Online (AJOL)

    7 Jul 2015 ... Inleiding. Die woord 'vrede' kom net een maal in die Filemonbrief voor, en wel in die aanhef van die brief. Kommentatore merk egter gereeld op dat 'n mens nie daaruit moet aflei dat dié begrip onbelangrik vir die verstaan van die brief is nie. Om een voorbeeld te noem: Barth en Blanke. (2002) skryf as volg:.

  6. Die berekening van vloeiing in ’n roterende annulus deur die metode van kunsmatige saamdrukbaarheid

    Directory of Open Access Journals (Sweden)

    H. Grobler


    Full Text Available Die vloeiing van ’n onsaamdrukbare, viskeuse vloeier word ondersoek aan die hand van die numeriese oplossing van die gediskretiseerde Navier-Stokes- en kontinuiteitsbeheervergelykings. In die besonder word vloeiing in ’n annulus bestaande uit twee koaksiale silinders wat elk ten opsigte van die ander kan roteer, en met ’n voorgeskrewe drukval oor die lengte van die silinder, beskou. Die oplossings word bereken deur die toepassing van Chorin se metode van kunsmatige saamdrukbaarheid, waarin die tydonafhanklike beheervergelykings getransformeer word na tydafhanklike hulpvergelykings deur die invoering van ’n kunsmatige toestandsvergelyking. Die oplossing van die hulpvergelykings konvergeer na ’n stasionêre oplossing, wat ooreenstem met die oplossing van die oorspronklike tydonafhanklike beheervergelykings. Die gedrag van die vloeier, wanneer ten voile ontwikkelde laminêre vloeiing bereik word, is met sukses bereken. ’n Eenvoudige model vir die bepaling van ontwikkeling van vloeiing langs die annulus vir enige gegewe invloeisnelheidsprofiel word voorgestel. Die berekende resultate stem ooreen met die resultate wat uit die fisika van die probleem verwag word.

  7. Die kritiek van tradisie en die tradisie van kritiek in die Geesteswetenskappe. 'n Rekonstruksie van die debat tussen Habermas en Gadamer


    Duvenage, Pieter


    In hierdie bydrae word die bekende debat (1967-1971) tussen Jürgen Habermas en Hans-Georg Gadamer gerekonstrueer. Die debat word hier in noue samehang met die kwessie van die geesteswetenskappe gelees. Die bydrae val in vier dele uiteen. In die eerste afdeling word Habermas se opening tot die debat in vyf onderafdelings uiteengesit. Dit gaan hier oor Gadamer se verdediging van tradisie en Habermas se kritiek op die begrip (1.1). In antwoord op Gadamer se begrip van tradisie ontwerp Habermas s...

  8. Enkele opmerkings oor die intrinsieke waarde van die Latynse teks van Kodeks Bezae as herstelbron vir die Griekse teks van die Nuwe Testament

    Directory of Open Access Journals (Sweden)

    G. J.C. Jordaan


    Full Text Available Een van die belangrikste oud-Latynse vertalings word gevind in Kodeks Bezae, ’n vyfde-eeuse manuskrip van die vier Evangelies. Kodeks Bezae bevat ’n Griekse teks (D en ’n Latynse teks (d van die Evangelies langs mekaar, die Latynse teks in ’n lettertipe wat baie aan die Griekse majuskelskrif herinner. Wat hierdie dokument so merkwaardig maak, is die feit dat dit die enigste manuskrip is wat ’n Griekse Evangelie-teks uit die Westerse teksfamilie bevat.

  9. Die gebruik van ’n reologiese tegniek in die bepaling van die verhardingsreaksiekinetika van ’n reaktiewe poliësterpoeierdeklaag

    Directory of Open Access Journals (Sweden)

    O. C. Vorster


    Full Text Available

    Die studie van die verhardingsreaksiekinetika van deklae word bemoeilik deur die aanwesigheid van vlugtige stowwe, pigmente en bypigmente. In hierdie studie word die verhardingsreaksiekinetika van ’n karboksielgetermineerde poliëstertriglisediel-isosianuraat deur middel van parallelplaatspanningsreometrie bepaal. Jeltye is verkry en skaleringseksponente bepaal. ’n Nuwe metode vir die voorspelling van die verloop van die reaksie word voorgestel en vergelyk met resultate verkry deur middel van differensiël skanderingskalorimetrie.


    The use of a rheological technique in the determination of the curing kinetics of a reactive polyester powder coating

    In this article a study of the curing process of carboxyl terminated polyester-triglycidyl isocyanurate systems is reported. A comparison is made between the generally used Differential Scanning Calorimetric methods and rheokinetic methods, using a parallel plate oscillating stress rheometer. Gel times were determined and scaling exponents calculated. A new method for the estimation of the extent of reaction is presented and compared with results obtained by means of differential scanning calorimetry

  10. Die gebruik van die mite in Die werfbobbejaan van Alexander Strachan

    Directory of Open Access Journals (Sweden)

    E. M.M. Klopper


    Full Text Available The use of myths in Die werfbobbejaan by Alexander Strachan This article focuses on the rote of Zulu myths in Alexander Strachan’s novel Die werfbobbejaan. It lakes as point of departure sources on mythology like Cuddon (1991, Baldick (1990, Grimal (1969, Levi-Strauss (1979 and Jung (1969. Die werfbobbejaan essentially recounts the story of a man (the adventurer, the academic, the writer, the hunter who also is the central character in Strachan's two preceding novels. Die werfbobbejaan focuses on the completion of an individuation process in the life of the central character, a process already begun in the preceding two novels and which in this novel finally culminates in the confrontation between hunter and baboon. The completion of this process is facilitated by the African milieu of Zululand where people give meaning to their existence by means of myths, and where no distinction is made between the mythic and rational modes of experiencing reality.

  11. Die rol van die onderwys in die handhawing en uitbouing van ons volkskultuur

    Directory of Open Access Journals (Sweden)

    G.J. Jordaan


    Full Text Available Op die oog af lyk dit ’n baie maklike onderwerp, maar hoe meer 'n mens daaroor nadink hoe ingewikkelder en omvangryker word die implikasies wat verband hou. Dit is veral so omdat dit hier voor alles gaan om eerste fundamentele uitgangspunte, dit wil sê, om lewens- en wêreldbeskouing. Dit geld van albei komponente — van onderwys sowel as van kultuur.

  12. Optimum stamping die structure based on analytical method of die deformation during draw process; Seikei katei no kanagata henkei kaiseki ni motozuku, press kanagata kozo no saitekika

    Energy Technology Data Exchange (ETDEWEB)

    Nakahara, T; Tamai, H [Mazda Motor Corp., Hiroshima (Japan)


    We measured an actual deformation and pressure distribution in draw process of bending cam, and analyzed deformation process of die structure, in order to eliminate adjusting work considering die deformation by stamping force. We studied die structure improvement with simulation based on analytical method. This report describes a sample of die structure improvement based on a simulation and actual measurement. 1 ref., 11 figs., 1 tab.

  13. Finding common ground to achieve a "good death": family physicians working with substitute decision-makers of dying patients. A qualitative grounded theory study. (United States)

    Tan, Amy; Manca, Donna


    Substitute decision-makers are integral to the care of dying patients and make many healthcare decisions for patients. Unfortunately, conflict between physicians and surrogate decision-makers is not uncommon in end-of-life care and this could contribute to a "bad death" experience for the patient and family. We aim to describe Canadian family physicians' experiences of conflict with substitute decision-makers of dying patients to identify factors that may facilitate or hinder the end-of-life decision-making process. This insight will help determine how to best manage these complex situations, ultimately improving the overall care of dying patients. Grounded Theory methodology was used with semi-structured interviews of family physicians in Edmonton, Canada, who experienced conflict with substitute decision-makers of dying patients. Purposeful sampling included maximum variation and theoretical sampling strategies. Interviews were audio-taped, and transcribed verbatim. Transcripts, field notes and memos were coded using the constant-comparative method to identify key concepts until saturation was achieved and a theoretical framework emerged. Eleven family physicians with a range of 3 to 40 years in clinical practice participated.The family physicians expressed a desire to achieve a "good death" and described their role in positively influencing the experience of death.Finding Common Ground to Achieve a "Good Death" for the Patient emerged as an important process which includes 1) Building Mutual Trust and Rapport through identifying key players and delivering manageable amounts of information, 2) Understanding One Another through active listening and ultimately, and 3) Making Informed, Shared Decisions. Facilitators and barriers to achieving Common Ground were identified. Barriers were linked to conflict. The inability to resolve an overt conflict may lead to an impasse at any point. A process for Resolving an Impasse is described. A novel framework for developing

  14. Die vraag na ’n nuwe belydenisskrif

    Directory of Open Access Journals (Sweden)

    J. H. van Wyk


    Full Text Available Die mees bekende reformatoriese belydenisskrifte dateer uit die sestiende en sewentiende eeue (E 16—17 en is dus almal 300 tot 400 jaar oud: Die Galliese Konfessie 1559, die Nederlandse Geloofsbelydenis 1561, die Heidelbergse Kategismus 1563, die 39 Articles 1563, die Tweede Helvietiese Konfessie 1566, die Dordtse Leerreëls 1619, die Westminsterse Konfessie 1646.

  15. as by die huisbesoek. HP WOLMARANS. PROF. DR. SP ...

    African Journals Online (AJOL)


    van 'n evangeüedienaar wat alles fei! gehad het vir die werk en werk kring waartoe God hom geroep het. Hy is dan ook werklik die eerste grondlegger van die gemeente in Zoutpansberg en die man wat dit opgewerk het. Die geskiedenis van Hofmeyer is die geskiedenis van die kerk- vereniging en die redes waarom die ...

  16. Die krisis van ongeloof in Numeri 13-14

    African Journals Online (AJOL)

    Die ver- haal gebruik die aanloklikheid van die land as 'n submotief om 'n groter drama uit te beeld: die konflik tussen Israel en sy God. ISSN 0259 9422 ... In aansluiting by Eksodus 34 laat die liefde en trou van die Here aan Horn die ...... langs die weg van die tema van veertig jaar dat 'de hoofdstukken 13-14 een sleutel-.

  17. Alle Wege führen nach Rom: Trifft dies auch für die Veränderungsmessung zu?

    DEFF Research Database (Denmark)

    Boecker, Maren; Volz-Sidiropoulou, Eftychia; Nielsen, Tine

    Die Erfassung von Veränderungen mithilfe von Fragebögen spielt eine wichtige Rolle in der klinischen Praxis und Forschung. Ziel dieser Studie war es zu untersuchen, ob im Rahmen der Veränderungsmessung die verwendete Datenanalysemethode einen Einfluss auf die Studienergebnisse hat. Insbesondere w...

  18. ’n Ondersoek na die bronne van werkstevredenheid en werkstres onder middelvlakbestuurders in die Wes-Kaap

    Directory of Open Access Journals (Sweden)

    S. C. Strydom


    Full Text Available The general aim of the study is to investigate the different attitudes and perceptions of middle level managers with regard to sources of job satisfaction, sources which contribute to job dissatisfaction, and to job stress. In this regard it was decided to make use of triangulation by which qualitative and quantitative research methods are used. Thematic analysis is used on the qualitative level to identify the possible sources of job satisfaction, dissatisfaction and job stress. This method is quantitatively supported by a determination of the frequencies and percentages of subject responses by means of semi structured interviews. On the qualitative level it was found that the experience of success is rated as the most important source of job satisfaction and that interpersonal relationships are the most significant source of job dissatisfaction. Finally it seems that work expectations/ demands appear to be the major source of job stress. Opsomming Die algemene doelstelling van die studie is om ondersoek in te stel na die verskillende houdings en persepsies van middelvlak-bestuurders rakende werkstevredenheid, sowel as die bronne wat bydra tot werkstres en werksontevredenheid. In dié verband is besluit om van triangulasie gebruik te maak. Op die kwalitatiewe vlak word tematiese analise gebruik om potensiële bronne van werkstevredenheid, ontevredenheid en werkstres te identifiseer. Hierdie metode word verder kwantitatief ondersteun deur ‘n bepaling van frekwensies en persentasies van subjekte se reponse wat uit semi-gestruktureerde onderhoude verkry is. Op die kwalitatiewe vlak blyk dit dat die ervaring van sukses die grootste bron van werkstevredenheid is en dat interpersoonlike verhoudings die bron is wat die meeste bydra tot ontevredenheid. Verder blyk dit dat werksverwagtinge/-eise die grootste bron van werkstres is.

  19. Lewenswetenskappe-onderwys in die een-en-twintigste eeu: ’n Paradigmaskuif

    Directory of Open Access Journals (Sweden)

    Marie Louise Botha


    Full Text Available Die ontwikkeling van ’n gehalte onderwyskorps is ’n ‘primêre voorwaarde vir opvoedkundige transformasie’ (Nasionale Onderwysbeleidondersoek [NEPI] 1993:235. Die gehalte van leer word beduidend beïnvloed deur die gehalte van onderwysers en hulle onderrig (McGrath 2008. Die gehalte van leer kan dus gekoppel word aan uitnemendheid in onderrig wat deur nuwe, kreatiewe denke bereik kan word. Dit kan moontlik realiseer met die implementering van vernuwende vaardighede en tegnieke wat voldoen aan die kreatiewe en vernuwende beplanning van die kurrikulum (Departement van Basiese Onderwys [DBO] 2011:8. Daar word van opvoeders (lektore of onderwysers verwag om ’n stimulerende en ondersteunende leer- en onderrigomgewing te skep. In die ontwikkelende wêreld van opvoeding het die fokus duidelik van ’n onderwysergesentreerde klaskamerpraktyk geskuif na ’n meer leerdergesentreerde benadering soos in die kurrikulum vir Lewenswetenskappe (Departement van Onderwys 2003 weerspieël word. Die uitdaging is gevolglik dat opvoeders gekonfronteer word om Lewenswetenskappe sodanig te onderrig dat dit op sowel ’n kognitiewe as ’n affektiewe vlak by alle leerders in die een-en-twintigste eeu aanklank vind. Nuwe kurrikuluminisiatiewe verg dus aanpassings en veranderings in die praktyk van die opvoeder. Hierdie teoretiese studie het ten doel om verslag te lewer oor die herbesinning van Lewenswetenskappe-onderwys in die een-en-twintigste eeu in Suid-Afrika. Dit is noodsaaklik dat kennis geneem word van die behoeftes en uitdagings in kreatiewe Lewenswetenskappeonderwys en -opvoeding vir die een-en-twintigste eeu. Hoë gehalte navorsing in Biologieonderrig word as noodsaaklik beskou ten einde die beroep van ’n Lewenswetenskappeonderwyser te vorm en te verbeter.

  20. Die Kunst des Intavolierens: Gebundenheit und Freiheit

    Directory of Open Access Journals (Sweden)

    Ring, Johannes


    Full Text Available A big part of 16th century keyboard repertory was intabulated vocal music; arrangements of motets, sets of masses and chansons. Marcant and sometimes little known examples show the different functions of intabulations: repertoire for the organists (liturgical function, music of delight and pedagogical functions. As a part of Ars Organistum intabulations were the basis of professional musical studies, learning to improvise organ music and to compose music. Masters like H. Scheidemann, the both Gabrielis, J. de Lublin, P. Philips, the both Cabezóns, some English and French anonym composers demonstrate that intabulations are much more than keyboard reductions - artful arrangements with their own life and character on the way to artful paraphrases. The intentions of the composers / arrangers in connection with the possibilities of the keyboard instruments definite the character and the step of transforming a vocal set in a (new piece of keyboard music.

    [de] Ein großer Teil des Musikrepertoires für Tasteninstrumente im 16. Jahrhundert bestand aus intavolierter Vokalmusik - Bearbeitungen von Motetten, Messsätzen und Chansons. Markante und teilweise wenig bekannte Beispiele zeigen verschiedene Funktionen der Intavolierungen. Zu nennen sind das Organistenrepertoire (liturgisches Umfeld, die Musik zur Erbauung und Unterhaltung und die pädagogische Funktion. Als Bestandteil der Ars Organistum waren Intavolierungen wichtig um professionell das Improvisieren von Musik und das Komponieren zu erlernen. Exemplarisch dokumentieren besonders H. Scheidemann, die beiden Gabrielis, J. de Lublin, P. Philips, die beiden Cabezóns und einige anonyme Komponisten aus England und Frankreich, dass ihre Kunst des Intavolierens weit über den Übertragungsmodus hinausgeht, bis hin zum virtuosen Arrangement und zur kunstvollen Paraphrase. Die Intentionen der Komponisten in Verbindung mit den Möglichkeiten der Tasteninstrumente pr

  1. Die kerk, maatskappy en vrye verenigings: 'n studie van die ...

    African Journals Online (AJOL)

    Two main principles guide these stipulations of the DRC-CO. The first one is that such a society or organization should be based on Christian principles and be able to show it convincingly in practice. The second one is that the well-known principle used in Neo-Calvinistic thought namely that of “souvereignty in its own ...

  2. Der Nahostkonflikt und die Medien

    Directory of Open Access Journals (Sweden)

    Carola Richter


    Full Text Available Diese Einführung in eine Themenausgabe zu den vielfältigen Rollen der Medien im Nahostkonflikt skizziert die Probleme, die sich für Medien und Journalisten als Akteure im Konflikt, Adressaten der Konfliktparteien und Anlass für Konflikt durch ihre Berichterstattung ergeben. Das Konfliktgebiet Israel und Palästina ist sowohl für Forschung über Auslandsbericht-erstattung, über transnationale Agenda Building- und Public Diplomacy-Prozesse als auch über mediensystemische Entwicklungen in Besatzer- und Besatzungsgebieten interessant. Der Artikel gibt einen Überblick über das Feld und führt dabei in die in der Themenausgabe präsentierten empirischen Studien zum Nahostkonflikt und den Medien ein.


    African Journals Online (AJOL)

    teen gekant was, is dit op 15 Oktober 1880 by die Kaapkolonie ingelyf.9. Gedurende sy kortstondige bestaan van minder as 'n dekade lank het die kroonkolonie Griekwa- land-Wes met talle finansiele, ekonomiese, so- siale en ander probleme te doen gehad. Een van die ernstige probleme was die bedreiging wat.

  4. Die Gereformeerde Ekumeniese Sinode en Sending 1984

    African Journals Online (AJOL)

    opvatting. Indien 'n mens al die kerke wat aan die Gereformeerde. Ekumeniese Sinode (GES) behoort een vir een sendingmatig sal be- studeer, sal daar waarskynlik 'n sterk differensiasie tussen sommige kerke aan die lig kom. Die GES kan dus nie verantwoordelik gehou word vir individuele kerke se sendingopvatting nie.

  5. voorgeskiedenis tot die stigting van 'n unieverdedigingsmag

    African Journals Online (AJOL)

    gesien nie en toe die wetsontwerp op 23 Februa- rie 1912 deur Smuts in sy hoedanigheid as Mi- nister van Verdediging ingedien is, het Beyers heelwat kritiek daarop gehad. Beyers het be- weer dat dit op vergaderings geblyk het dat die volk wou he Engeland moet steeds die verdedi- ging waarneem aangesien die Unie ...

  6. Moderne diskoerse in die teologie vandag

    Directory of Open Access Journals (Sweden)

    J.H. van Wyk


    Full Text Available In hierdie artikel word aandag gevra vir enkele moderne diskoerse in die teologie vandag. Volgens die outeur staan die vrae oor God, Jesus, die mens en die aarde in die sentrum van belangstelling en oorheers dit in ’n groot mate die teologiese debat. Die opkoms van die moderne aggressiewe ateïsme, die wetenskaplike navorsing oor die historiese Jesus, die groeiende vrae oor die mens en die menslike samelewing, asook die dreigende ekologiese krisis op aarde, sorg vir nuwe debatte van ongekende omvang. Die outeur bespreek hierdie debatte oorsigtelik, met kritiek waar nodig, en sluit af met enkele rigtingwysers van wat hy as ‘goeie teologie’ verstaan. In this article attention is paid to some modern discourses in theology today. According to the author the questions about God, Jesus, man and the earth are in the centre of interest and to a large extent dominate the theological debate. The rise of modern aggressive atheism, the scientific research on the historic Jesus, the growing questions about man and human society as well as the threatening ecological crisis on earth, provide new discourses of unparalleled magnitude. The author provides a broad summary of these discourses, with criticism where necessary, and concludes with some indicators of his view what can be called ‘good theology’.


    African Journals Online (AJOL)

    Die geboorte van meer as 2 lammers per ooi is egter ongewens in die Karakoelbedryf aangesien dit aanleiding gee tot kleiner pelse veral wanneer voedingstoestande nie opti- maal is nie. In stoetteling is selfs tweelinge nie gewens nie, aangesien die ware fenotipiese waarde van die lammers nie in tweelinge te voorskyn ...

  8. Die waarde van tolking vir tersiêre onderrig en leer. 'n Ondersoek na ...

    African Journals Online (AJOL)

    tesis in Tolkstudie. Die studie het spesifiek 'n bydrae gemaak tot die bestaande navorsing in Opvoedkundige tolking. Simultane (gesproke) opvoedkundige tolking het relatief onlangs as aparte subdomein van gemeenskapstolking in Suid-Afrika ...

  9. Method of treating tool steel die materials

    International Nuclear Information System (INIS)

    Cook, C.S.; Damon, S.


    In a method of hardening pilger dies to provide a hard case containing residual compressive stresses and tough body, the tool steel die is heated to the austenitizing temperature range, followed by selectively removing heat from the die at a predetermined faster rate in the direction of the desired case than the rate of heat removal from the balance of the die, and thereafter tempering the die. The invention provides a fully hardened and tempered case on the working surface of the die and a tough body in the balance of the die, usually of lower hardness. (author)

  10. Die «ASEAN-Wirtschaftsgemeinschaft»

    DEFF Research Database (Denmark)

    Juego, Bonn


    Seit dem Ende der 1990er-Jahre verfolgt die ASEAN die Vision einer politischen, wirtschaftlichen und sozialen Gemeinschaft. Doch wie realistisch ist die Umsetzung eines solch ambitionierten Vorhabens vor dem Hintergrund der enormen Heterogenität der Region? ASEAN vereint Staaten auf...... Entwicklungsstufen, wie sie unterschiedlicher kaum sein können. Der Autor, Bonn Juego, nimmt die ASEAN Vision 2020 sowie die Debatten, die diesbezüglich in den einzelnen Ländern geführt werden, unter die Lupe. Er geht dem Potenzial des ASEANAnsatzes zu sozialer Teilhabe und wirtschaftlicher Verteilungsgerechtigkeit...

  11. Die pastorale begeleiding van predikante van die Nederduitse ...

    African Journals Online (AJOL)

    21 Jan 2013 ... Stone, M.F., 1999, Coaching, counselling & mentoring: How to choose & use the right technique to boost employee performance, AMACOM, New York. Strydom, W.A., 2011, 'Pastoraat aan getraumatiseerde kinders in die intensiewesorgeenheid: 'n Gestalt benadering', DD tesis, Universiteit van Suid-. Afrika ...

  12. 'n Begronde bedieningsmodel vir die diakonia van die gemeente

    African Journals Online (AJOL)

    15 Feb 2012 ... At first, various angles of approach to the research on ministry in ... Lingenfelter 2005; Armour & Browning 2000) en daarmee saam die ...... Grobler, A.B. & Van der Walt, A.L., 2008, 'An assessment of the management skills.

  13. Die ontwikkeling van menslike potensiaal in die Republiek van Suid ...

    African Journals Online (AJOL)

    Erna Kinsey

    Dit het dus ook te doen met lewenstandaard, aangesien lewenstandaard `n bepalende faktor is met betrekking tot die optimale ontwikkeling van menslike potensiaal. Ander minder materiële aspekte van menslike potensiaal het te doen met menslike vryheid, waaronder vryheid van spraak, beweging en keuse ter sake is.


    African Journals Online (AJOL)

    20 van 1898 van die Kaapkolonie, getiteld The Navy Contribution. Act, i898 is a.m. ... as a contribution towards the annual expenditure by the ...... The above are inclusive of all allowances for lodging and provisions. Petty Officer Ins ...... that system we can retain full constitutional control not only in theory but also complete ...

  15. Die Korallenfauna des Perm von Timor und die permische Vereisung

    NARCIS (Netherlands)

    Gerth, H.


    Bei den zahlreichen Rekonstruktionen der klimatologischen Verhältnisse, die man für das Ende des Palaeozoikums gemacht hat, ist man fast immer von der Kohlenbildung, der Florenverbreitung und den Vereisungserscheinungen ausgegangen. Der marinen Tierwelt hat man bei der Behandlung dieser Fragen meist

  16. Existential Needs among the Dying

    DEFF Research Database (Denmark)

    Moestrup, Lene

    meaning making. Methods: The key research question is: 1. What kind of existential needs are central to dying cancer patients and their relatives during the terminal phase in Danish hospices? Exploring this highly sensitive and complex research area entails substantial ethical responsibility during data...... based and practice relevant knowledge about the complexity of existential considerations and needs among dying cancer patients and their relatives in a secularized society as Denmark. Existential needs are seen as a multidimensional concept that encompasses religious, spiritual and secular existential...

  17. ’n Etiek van liefde: Die etiese perspektiewe van die Heidelbergse Kategismus

    Directory of Open Access Journals (Sweden)

    Koos Vorster


    Full Text Available Hierdie artikel behandel die etiese perspektiewe van die Heidelbergse Kategismus – een van die prominente belydenisskrifte in die gereformeerde tradisie. Die etiese relevansie is ingebed in die konfessie se verklaring van die tien gebooie. Die artikel verduidelik dat die etiek van die Heidelbergse Kategismus ten diepste ’n karakteretiek is en dat dit gelowiges oproep tot ’n etiek van liefde. Hierdie liefde sluit in liefde vir die verbondsgemeenskap, die bediening van die Woord, die heiligheid van God en die waardigheid van mense, die gemeenskap van die gelowiges, gesag, die lewe, die huwelik, privaatbesit en arbeid asook waarheid en geregtigheid. As gevolg van die sinekdogeekarakter van die wet is hierdie etiek van liefde vandag baie relevant. This article deals with the ethical relevance of one of the prominent confessions in the reformed tradition, namely the Heidelberg Cathechism. The ethical relevance lies in the confession’s elucidation of the ten commandments and its application to moral conduct. The article explains that the ethics of the Heidelberg Catechism is essentially a virtue ethics calling for an ethics of love. This love should include love for the covenantal communion, ministry of the Word, the holiness of God and the dignity of people, the communion of the saints, authority, life, marriage, private property and labour, and truth and justice. Due to the synecdochical character of the ten commandments this ethics of love is highy relevant in the present times.

  18. Adapt or Die

    DEFF Research Database (Denmark)

    Brody, Joshua Eric; Larsen, Kasper Green


    In this paper, we study the role non-adaptivity plays in maintaining dynamic data structures. Roughly speaking, a data structure is non-adaptive if the memory locations it reads and/or writes when processing a query or update depend only on the query or update and not on the contents of previously...... read cells. We study such non-adaptive data structures in the cell probe model. This model is one of the least restrictive lower bound models and in particular, cell probe lower bounds apply to data structures developed in the popular word-RAM model. Unfortunately, this generality comes at a high cost......: the highest lower bound proved for any data structure problem is only polylogarithmic. Our main result is to demonstrate that one can in fact obtain polynomial cell probe lower bounds for non-adaptive data structures. To shed more light on the seemingly inherent polylogarithmic lower bound barrier, we study...

  19. Die WTO in Hongkong: Zwischenergebnisse einer "Entwicklungsrunde"


    Küblböck, Karin; Six, Clemens


    Die sechste Ministerkonferenz der Welthandelsorganisation (WTO), die von 13. bis 18. Dezember 2005 in Hongkong stattfand, war mit dem Anspruch angetreten, die Agenda der Doha-Entwicklungsrunde, also die B erücksichtigung der Interessen und ökonomischen Bedürfnisse der Entwicklungsländer und insbesondere der am wenigsten entwickelten Staaten, um wesentliche Schritte im Hinblick auf einen erfolgreichen Abschluss voranzubringen. Die Ergebnisse sind vor dem Hintergrund des Anspruches dieser Verha...

  20. Chirurgie in die Grieks-Romeinse era

    Directory of Open Access Journals (Sweden)

    François P. Retief


    Full Text Available In die Grieks-Romeinse era het mediese behandeling kenmerkend uit drie elemente bestaan, naamlik regimen (dieet en gesonde leefwyse, geneesmiddels en chirurgie – laasgenoemde alleen toegepas indien regimen en geneesmiddels onsuksesvol was. Bewyse van primitiewe chirurgie dateer terug na die Bronstydperk, en in Homerus se eposse is heelwat vermelding van die chirurgiese hantering van oorlogswonde, met tussenkoms van die gode. Met die koms van empiriese geneeskunde in die 5de eeu v.C. het chirurgie in die Hippokratiese Corpus prominent gefigureer met beduidende bydraes in veral die ortopediese veld en hoofbeserings. Uitbouing van anatomiese en fisiologiese kennis, gebaseer op disseksie van menslike kadawers in Alexandrië vanaf die laat 4de eeu v.C., het chirurgie ’n hupstoot gegee. Teen die Romeinse era vanaf die 2de eeu v.C. het snykundetegnieke (en -instrumente beduidend verbeter, maar is steeds oorwegend deur Griekse geneeshere beoefen. Van geneeshere is steeds verwag om al drie bovermelde terapeutiese modaliteite te bemeester, maar chirurgie het meer aansien verwerf en daar is al meer in onderafdelings van chirurgie soos oogheelkunde, vrouesiektes en verloskunde, blaaskwale en mond- en keelsnykunde gespesialiseer. Militêre geneeskunde was in die Romeinse Ryk ’n belangrike aktiwiteit, en het veral traumachirurgie uitgebou. Betreding van die buik- en toraksholtes was nie meer noodwendig fataal nie, en veeartsenykunde het tot stand gekom. Die eerste beduidende chirurgiehandboek ná die Hippokratiese Corpus is in die 1ste eeu n.C. deur Celsus opgestel. Vanaf die 3de eeu het die chirurgieberoep min vordering gemaak, die beroepstaal het mettertyd van Grieks na Latyn verander en kundigheid is later veral deur Islam-geneeshere na die Middeleeue en later oorgedra.

  1. Frauen. Kultur. Mittel- und Osteuropa oder: Über den langsamen Einzug der gender studies in die slawistischen Kulturwissenschaften Women. Culture. Middle and Eastern Europe or: On the Slow Introduction of gender studies into the Slavonic Cultural Sciences

    Directory of Open Access Journals (Sweden)

    Barbara Wurm


    Full Text Available Der vorliegende Sammelband, entstanden anläßlich einer Konferenz, die im September 1997 vom Institut für Slawistik der Universität Innsbruck in Zusammenarbeit mit der österreichischen UNESCO-Kommission veranstaltet wurde, untersucht aus soziologischer, kulturhistorischer, literatur- und filmwissenschaftlicher Perspektive verschiedenste Aspekte der Institutionalisierung und Repräsentation von „Frauen in der Kultur“ Mittel- und Osteuropas.This anthology, the result of a conference organized in September 1997 by the Institute for Slavonic studies at the University of Innsbruck in co-operation with the Austrian UNESCO commission, examines various aspects of the institutionalization and representation of women in Middle and Eastern European culture from a sociological and cultural historical perspective and from that of literary and film sciences.

  2. Die invloed van drie kruisbestuiwers op die saadinhoud van Minneola tangelo (Citrus parodist x C reticulata

    Directory of Open Access Journals (Sweden)

    H. J. Esterhuizen


    Full Text Available Die invloed van verskillende kruisbestuiwers (Clementine, Empress en Valencia op die gemiddelde saadinhoud van Minneo­la tangelo is ondersoek. Clementine en Empress as kruisbestuiwers het die grootste invloed op die gemiddelde saadinhoud van die vrugte gehad, terwyl dié van Valencia nie noemenswaardig was nie. Die gemiddelde saadinhoud van die vrugte het afgeneem met toename in afstand vanaf die kruisbestuiwer. Indien ’n beperking op die afstand tussen kultivar en kruisbestuiwer geplaas word, sal ’n groter persentasie vrugte aan uitvoerstandaarde ten opsigte van saadinhoud voldoen.

  3. Euthanasia, assisted dying and the right to die in Ghana: a socio-legal analysis. (United States)

    Owusu-Dapaa, Ernest


    There is unanimity among states to protect the continuation of life of the individual as a safeguard against their collective extinction. The right to life is accordingly guaranteed but its antithesis, the right to die is the subject of an unending debate. The controversy over the right to die is deepened by rapid advances in medicine, creating the capability for prolongation of life beyond the span which one's natural strength can endure. Ghana's supreme law explicitly guarantees the right to life but remains ambiguous on right to die, particularly euthanasia and assisted dying. Thus, some of the other rights, such as the right to dignity and not to be tortured, can creatively be exploited to justify some instances of euthanasia. Ghana's criminal code largely proscribes euthanasia. Notwithstanding, proscription of euthanasia and assisted dying by the law, in Ghana's empirical work undertaken in some of the communities in Ghana, suggests that euthanasia is quietly practisedin health facilities and private homes, especially in the rural areas. Contrary to the popular reasons assigned in the literature of the Western world, with respect to the practice or quest for legalization of euthanasia as being a necessity for providing relief from pain or hopeless quality of life, empirical data from social and anthropological studies conducted in Ghana reveal that poverty is the motivation for informal euthanasia practice in Ghana rather than genuine desire on part of patients to die or their relatives to see to their accelerated death. Apart from poverty, traditional cultural values of African societies consider non-natural death as a taboo and ignominy to the victim and his family. Thus, any move by the government to legalize euthanasia will need to be informed by widely held consultations and a possible referendum; otherwise the law may be just a mere transplant of Western models of legislation on euthanasia without reflecting the ethos of the African people.


    African Journals Online (AJOL)

    sedert die vroeg 1900's deur die Weermag be- heer. In 1967 was dit die eerste militere terrein wat tot privaatnatuurreservaat verklaar is. Vhembe bestaan uit 4 hoofplantgemeenskappe nl. rivieraewerbos, vloedvlaktes, ranteveld en die sandveldplato. Wildsoorte op die terrein sl!Jit rooibokke, bosbokke, waterbokke, koedoes,.

  5. Die era van Suid-Afrika se militere hoogbloei met die ...

    African Journals Online (AJOL)

    4 Jun 1976 ... Die Toyota 1200 bakkie is geadverteer met die woorde 'Hier kom die pantserbakkie', teen die agtergrond van 'n olifant tenk.32. Daar is ook 'n betrekking deur Thorold en van Wyk geadverteer waar militere opleiding 'n voorvereiste was.33. Daar was ook films wat weermag en polisie gebasseer is wat in die ...

  6. Riglyne vir ‘n omvattende verrykingsprogram vir die bevordering van die geestesgesondheid

    Directory of Open Access Journals (Sweden)

    Antoinette Gmeiner


    Full Text Available In Suid-Afrika, met die snelle veranderinge in die politiek, ekonomie, lewenstyl en tegnologiese vooruitgang, gepaard met die geweld tans in die land, is die lewenskwaliteit van mense so bemvloed dat produktiwiteit en gedrag benadeel is. *Please note: This is a reduced version of the abstract. Please refer to PDF for full text.

  7. Etíese perspektiewe vir die bantering van konflik in die mediese ...

    African Journals Online (AJOL)

    mits versagtende omstandighede nie aangevoer kan word nie. Die howe oefen dan ook alleen sy regterlike funksie uit oor 'n konkrete geskil wat van daadwerklike belang vir die werklike partye is (Strauss 1982:14). Die hof laat hom lei deur die maatstaf van goeie sedes, die boni mores. Regter Mostert se verduideliking in ...

  8. ontwikkeling van die gemenereg in die lig van artikels 39(2)

    African Journals Online (AJOL)


    'n Mens kan met reg vra of die ius connubiorum van Brouwer en die Law of. Husband and Wife van ... AD 560 (Geheime Raad) 563. 5 Sien vir besonderhede Hahlo en Kahn SA Legal System and its Background 304. ..... Die Franse chemikus, Antoine Lavoisier, is in 1794 tydens die Franse revolusie tereggestel. Terwyl die ...

  9. Die wonders in Johannes 6 verklaar aan die hand van 'n ...

    African Journals Online (AJOL)

    Maar die Evangelie van Johannes gee self 'n aanduiding van wat die intensie van die geskrif is, te wete Johannes 20: 30-31: Jesus het nog baie ander wondertekens, wat nie in hierdie boek beskrywe is nie, voor sy dissipels gedoen. Maar hierdie wonder tekens is beskrywe sodat julle kan glo dat Jesus die Christus is, die.

  10. How Tycho Brahe really died

    DEFF Research Database (Denmark)

    Jacobsen, Aase Roland; Petersen, Lars


    In 2001 we commemorate the 4th centenary of the death of Tycho Brahe, perhaps the first great scientists in a modern sense.This famous Danish astronomer died in Prague on the 24th of October 1601, eleven days after he had attended a banquet at the Bohemian count of Rosenberg. Tycho was too courte...

  11. Die Suche nach den Gottesteilchen

    CERN Multimedia


    2008 wird der größte jemals gebaute Teilchenbeschleuniger in Betrieb genommen Anlässlich des Mathematik-Jahres 2008 hat der Experimentalphysiker der Universität Hamburg und der designierte Generaldirektor des europäischen Zentrums für Teilchenphysik CERN in Genf, Rolf-Dieter Heuer, die Bedeutung des Dialogs zwischen Naturwissenschaftlern und Philosophen hervorgehoben.

  12. When a major star dies

    International Nuclear Information System (INIS)

    Joubert, G.


    Astrologers are slowly learning what happens when a star dies. On the night of 23-24 February 1987, the light of an exploding star - a supernova with the name SN 1987A - reached the earth. In this article this astrological event of the century are discussed, and its importance for astrologers

  13. polisemie in die woordeboek - 'n

    African Journals Online (AJOL)

    mous items, the problem of monosemic prototype categories vs. polysemous prototype categories, ...... bv. te make met kulturele norme vir die drink van warm vloeistowwe. ..... (en nie bv. teen ander soorte water of ander soorte chemiese middele nie) gede- ...... INLIGTING VERSKAF TE WORD (EN VERW AG DIT AS SODA-.

  14. Die verhouding tussen kerk en staat: Enkele modelle met verwysing ...

    African Journals Online (AJOL)

    ook ingaan op die vraag na die reg tot opstand teen die gesag van die staat soos dit in hierdie modelle beantwoord word. Ons wil eindig by die vraag na 'n teologiese model wat geskik is vir ons dag. 1. DIE TEOLOGIESE MODEL VAN DIE ROOMS-KATOLIEKE. KERK. Die Rooms-Katolieke Kerk se opvatting word bepaal ...

  15. die rol van kleurlinge in suid afrika se militere verlede

    African Journals Online (AJOL)

    die geval, want hierdie volks- groep het 'n lang en kleurryke historiese verbin- tenis met die miltere verlede van Suid-Afrika. Die feit dat die Kleurlinge nou op die drumpel staan van 'n nuwe tydvak in die staatkundige ontwikke- ling van die Republiek van Suid-Afrika, beteken ook nie dat hulle vir die eerste maal ten nouste.

  16. Die atmosfeer in die erediens deur die loop van die geskiedenis

    Directory of Open Access Journals (Sweden)

    BJ de Klerk


    Full Text Available The worship service occupies a central position in the life of the believer and therefore the atmosphere in the worship service is vital. The variations through history are studied in this article.� The viewpoints of the first four centuries, the Middle Ages, Reformation, post-Reformation and twentieth century came under discussion. Lessons from history are stated. The atmosphere in the worship service should be such that the worshipper meets God with the necessary awe and respect.� The service must also create an atmosphere of love, warmth, friendliness, and joy. All present must be invited and made welcome by the service. The atmosphere must further encourage and create room for everybody to participate and use their specific gifts. It can therefore change from service to service and within a single service. Important instruments in the atmosphere are the liturgical space, symbols, rituals, physical movement, gestures, music, song and the senses.

  17. Ironie in die Johaimesevangelie

    Directory of Open Access Journals (Sweden)

    P. P. A. Kotzé


    Full Text Available Irony in the Gospel of John An exponent of literary theory and criticism described the shift of focus from the text to the reader as a revolution. One of the main features of irony is the intensive involvement of the reader. As far as John is concerned, some scholars are convinced that 'In the Fourth Gospel theology is irony'. This may be an exaggeration, but emphasises the need to ascertain to v/hat extent irony is used in John and what contribution the study of irony in John can make to the better understanding of the message of the Gospel. In order to answer these questions, one must first determine what irony is, how it functions and how it can be detected in a text. This article is an attempt in this direction.

  18. Dying of corruption. (United States)

    Holmberg, Sören; Rothstein, Bo


    In many poor countries, over 80% of the population have experienced corrupt practices in the health sector. In rich countries, corruption takes other forms such as overbilling. The causal link between low levels of the quality of government (QoG) and population health can be either direct or indirect. Using cross-sectional data from more than 120 countries, our findings are that more of a QoG variable is positively associated with higher levels of life expectancy, lower levels of mortality rates for children and mothers, higher levels of healthy life expectancies and higher levels of subjective health feelings. In contrast to the strong relationships between the QoG variables and the health indicators, the relationship between the health-spending measures and population health are rather weak most of the time and occasionally non-existent. Moreover, for private health spending as well as for private share of total health spending, the relation to good health is close to zero or slightly negative. The policy recommendation coming out of our study to improve health levels around the world, in rich countries as well as in poor countries, is to improve the QoG and to finance health care with public, not private, money.

  19. Aanpassing en evaluering van die litwin en stringer- klimaatmetingsvraelys

    Directory of Open Access Journals (Sweden)

    H. Dippenaar


    Full Text Available Adapting and evaluating the Litwin and Stringer organisational climate questionnaire. In an attempt to satisfy the need which exists for scientifically justified climate questionnaires, the climate questionnaire of Litwin and Stringer (1968 was adapted and evaluated in this study. The questionnaire was administered to 122 managers in a financial institution. First and second order factor analyses were performed on the items of the questionnaire. Two factors of organisation climate were identified, viz. motivational - relationship considerations and uncertainty - job ownership considerations. The implications of the findings are discussed. Opsomming In 'n poging om aan die behoefte wat daar aan wetenskaplik verantwoordbare klimaatmetingsvraelyste bestaan, te voldoen, is die klimaatmetingsvraelys van Litwin en Stringer (1968 in hierdie studie aangepas en geevalueer. Die vraelys is op 'n steekproef van 122 bestuurders in 'n finansiele instelling toegepas. Eerste- en tweedeordefaktorontledings is op die items van die vraelys uitgevoer. Twee faktore van organisasieklimaat is geidentifiseer, te wete motivering - verhoudingoorwegings en onsekerheidtaakeienaarskapoorwegings. Die implikasies van die bevindinge word bespreek.

  20. Die naslaanpotensiaal van lemmakandidate vir ʼn ...

    African Journals Online (AJOL)

    Kate H

    Afrikaans-woordeboek in die gedrukte medium plaas welbekende tradisionele beperkinge op die leksikograaf, waarvan die vernaamste dié op ruimte is. Gegee die konteks, teikengebruiker, gebruikersituasie en funksie van die woordeboek moet ...

  1. Professional caregivers' work with the dying in nursing homes

    DEFF Research Database (Denmark)

    Nielsen, Karen Tind; Glasdam, Stinne


    International studies on the death of elderly nursing home residents show the complexity in the understanding of the professionals who care for the dying. The aim of this study is to explore the discourses about professional caregivers caring for those dying in Denmark in the last decade. A disco......International studies on the death of elderly nursing home residents show the complexity in the understanding of the professionals who care for the dying. The aim of this study is to explore the discourses about professional caregivers caring for those dying in Denmark in the last decade....... A discourse analysis inspired by Foucault was constructed. The material consists of different source documents: research articles, newspaper articles, theses, books, websites – 35 sources in total. There are constructed six positions of speech, five discourses and three themes: (1) ‘the work...

  2. Effects of MRI on the electrophysiology of the motor cortex: a TMS study; Auswirkungen der Magnetresonanztomografie auf die Elektrophysiologie des motorischen Kortex: eine Studie mit transkranieller Magnetstimulation

    Energy Technology Data Exchange (ETDEWEB)

    Schlamann, Marc; Pietrzyk, T. [Universitaetsklinikum Essen (Germany). Inst. fuer Diagnostische und Interventionelle Radiologie und Neuroradiologie; Yoon, M.S.; Gerwig, M.; Kastrup, O. [Universitaetsklinikum Essen (Germany). Neurologische Klinik; Maderwald, S.; Forsting, M.; Ladd, S.C. [Universitaetsklinikum Essen (Germany). Inst. fuer Diagnostische und Interventionelle Radiologie und Neuroradiologie; Duisburg-Essen Univ. (Germany). Erwin-L.-Hahn-Inst. fuer Magnetresonanz; Bitz, A.; Ladd, M.E. [Duisburg-Essen Univ. (Germany). Erwin-L.-Hahn-Inst. fuer Magnetresonanz


    The increasing spread of high-field and ultra-high-field MRI scanners encouraged a new discussion on safety aspects of MRI examinations. Earlier studies report altered acoustically evoked potentials. This finding was not able to be confirmed in later studies. In the present study transcranial magnetic stimulation (TMS) was used to evaluate whether motor cortical excitability may be altered following MRI examination even at field strength of 1.5 T. In 12 right-handed male volunteers individual thresholds for motor responses and then the length of the post-excitatory inhibition (silent period) were determined. Subsequently the volunteers were examined in the MRI scanner (Siemens Avanto, 1.5 T) for 63 minutes using gradient and spin echo sequences. MRI examination was immediately followed by another TMS session and a third 10 minutes later. As a control condition, the 12 subjects spent one hour in the scanner without examination and one hour on a couch without the presence of a scanner. After MRI examination, the silent period was significantly lengthened in all 12 subjects and then tended to the initial value after 10 min. Motor thresholds were significantly elevated and then normalized after 10 minutes. No significant effects were found in the control conditions. (orig.)

  3. Die waarde van tolking vir tersiêre onderrig en leer. 'n Ondersoek na ...

    African Journals Online (AJOL)

    Kate H

    tesis in. Tolkstudie. ..... Clausen (2011) het in haar M-tesis die potensiaal van tolking in die Fakulteit Lettere en Sosiale. Wetenskappe aan die US ...... Mouton, J. 2001. How to succeed in your master's and doctoral studies: A South African guide.

  4. a studyof faecal of faecal coliform die coliform die coliform die-off

    African Journals Online (AJOL)


    COLIFORM DIE-OFF IN SEWAGE SLUDGE DRYING BED. OFF IN SEWAGE SLUDGE ..... This method was used to measure evaporation from the bed because of .... thermometer with external sensor probe, model No. ST-9283A/B/C and a ...

  5. Die spel van assosiasies in en om 'Die verlossing van die beeld' van Breyten Breytenbach

    Directory of Open Access Journals (Sweden)

    P.A. du Toit


    Full Text Available The play of association in and around 'The liberation of the image' by Breyten Breytenbach This analysis focuses on the conjunction of memory and imagination, which is an important impulse in, and key to, Breytenbach’s work. The play with language and with associations, the foregrounding, in the short story, “Die verlossing van die beeld” (Breytenbach, 1983 with its metafictional title and apparently divergent motifs (rain/water, watch, onion, the death and burial of a grandfather acts, as it were, as an invitation to the reader to become a co-player. The reader ventures on a search for traces, intertextual links within the Breytenbach oeuvre and for already acknowledged influences such as Surrealism (which in turn casts some light on the strange title of the story and the Eastern philosophies such as Zen and the even older Taoism. The analysis also takes into account the context in which “Mouroir” was written, namely Breytenbach’s term in prison (1975-1982. Seeing that the writer had to hand in his manuscripts to the jail authorities regularly, he might have decided, consciously or by intuition, to hide some thoughts and feelings behind a screen or a mask, in, for example in “Die verlossing van die beeld”, a lighter tone and irony.

  6. Die Romeinse nastrewing van onsterflikheid deur middel van memoria

    Directory of Open Access Journals (Sweden)

    D. R. Fouché


    Full Text Available Benewens die omvangryke en nasionale manifestasies van die oorspronklike onsterflikheidsgedagte in die Romeinse gemeenskap, vind ons by die Romein op kleiner skaal in groepe of indiwidueel ’n strewe na onsterflikheid langs die weg van memoria. Soos aangetoon sal word, verskil die pogings van die verskillende groepe radikaal van mekaar, hoewel die strewe en einddoel dieselfde bly, naamlik om deur die daarstelling van memoria op die gebied van woord of daad onsterflikheid te bekom.

  7. Retrospective study on radiotherapy efficacy in case of painful heel spur; Retrospektive Studie ueber die Wirksamkeit der Strahlentherapie beim schmerzhaftem Fersensporn

    Energy Technology Data Exchange (ETDEWEB)

    Klossok-Niethammer, Ruth Giuliana


    Objective: The effect of radiotherapy in context of a plantar fasciitis in order to reduce pain was evaluated in this retrospective study. Patients and methods: The data of 188 patients who suffered of heel spur pain and who were irradiated in the period from 1994 to 2009 were evaluated in this study. All of them had at least one follow up examination after radiatiotherapy. The mean age amounted to 57 years. 76.5% of the patients were female. All patients described a local pain which was the basis for the indication. 74.4 % of the patients described pain especially under stress. The duration of anamnesis was averaged as follows: 15 % of the patients had pain for some weeks to 3 months, 43 % for 4 to 6 months, 28% even for 7 to 12 months. The period of medical history was longer than 12 months for 12 % of the patients in this study. 122 of 188 patients received orthopedic arch support (shoe inlays) as first therapy method. Most of the patients were irradiated using regular lateral opposing fields with photons of the energy 4 MV and 6 MV of a linear accelerator, applying a total dose of 6Gy in 6 fractions to 1,0Gy twice weekly. Only one patient was irradiated using a Co{sup 60} machine. The acquisition of data regarding the effect was performed on the last day of the radiotherapy and in 3 to 6 monthly follow ups. Additionally the doctors who attended the patients beyond the radiotherapy received a special questionnaire about the pain reduction, so that the follow up data could be completed. Results: On the last day of radiotherapy 120/188 patients (63,8%)reported an improvement of pain reduction, 7/188 patients (3,7%) absence of pain. For 52/188 patients (27.6 %) pain remained constant. At the second follow up examination after in the median 100 days the effect of radiotherapy of 165 patients could be evaluated, 43/165 patients (26 %) were pain free, 79/165 patients (47,8 %) reported an obvious pain reduction, and for 33/165 patients there was no pain improvement. At

  8. Die invloed van die Tweede Vryheidsoorlog (1899-1902 op die Teologiese Skool Burgersdorp

    Directory of Open Access Journals (Sweden)

    P. Krüger


    Full Text Available The influence of the Second War of Independence (1899-1902 on the Theological Seminary of Burgersdorp In this article the reasons for the War are pinpointed as England’s imperialism and the underlying motif of getting hold of the riches and gold of the ZAR. At the outbreak of the War the students and lecturers of the Burgersdorp Theological Seminary, as most Boers in the Cape Colony, had to make a decisive choice: loyalty to the Government of the Cape Colony or to their fellow kinsmen in the North (and thus siding with the latter. Varying facets of the war-torn situation are touched upon in this article: the lecturers were for example accused of treason but acquitted. The outcome of the 30 students’ situation, however, differed. Those students origally from the northern Republics returned home to join their commandos. Some of these students were taken prisoners of war. Most of the Cape students showed their solidarity with their northern compatriots by joining the Ambulance Corps. Three students and two former students eventually died (one was the son of Prof. Lion Cachet. In honour of these students a monument was erected in 1906. Only one student and three former students were rebels, as far as is presently known. At a later stage three students were able to continue their studies in the Netherlands. Two of these, J.D. du Toit and F. Postma, later returned to South Africa and committed their lives to the Theological Seminary at Potchefstroom and the Potchefstroom University for CHE.

  9. How do young people evaluate nuclear energy at nuclear power plant sites? An empirical study; Wie bewerten junge Menschen an Standorten von Kernkraftwerken die Kernenergie? Eine empirische Studie

    Energy Technology Data Exchange (ETDEWEB)

    Kretz, Simon [Karlsruher Institut fuer Technologie (KIT), Karlsruhe (Germany). Inst. fuer Geographie und Geooekologie; Kramer, Caroline [Karlsruher Institut fuer Technologie (KIT), Karlsruhe (Germany). Professur fuer Humangeographie


    How does the younger generation evaluate nuclear power at sites with nuclear power plants? This has been examined at four sites with different decommissioning stages, as the presence of a nuclear power plant in young people's daily life represents a potential employer as well as a potential risk factor. The attitude of this generation will expectedly and sustainably influence the development of communities. The decommissioning of a nuclear power plant is currently, optimistically estimated by different energy supplying companies with a time period of 15 to 20 year. Thus the resident population will deal with this topic until the year 2040. Furthermore the decision on a repository exploration has been sighted for the year 2013. As a final repository will not be ready for operation at that time, communities will have to deal with the storage of radioactive waste in local interim-storage facilities. The next generation has the opportunity to shape their future as well as the future of their community. Nevertheless the preconditions are to stay at the side as well as the political and social engagement of these young people. n order to study this aspect and the opportunities of action of young people, data was gathered by carrying out a standardised survey, interviewing 762 pupils in February 2014.

  10. Die bevordering van woordeskat en leesbegrip by Xhosa-moedertaalsprekers in graad 4-6 in Afrikaanse skole


    Basson, Maylene; le Cordeur, Michael


    Die uitslae van die Jaarlikse Nasionale Assesseringstoeste toon dat slegs 28% van alle leerders in Suid-Afrika op ' n aanvaarbare internasionale vlak presteer het. Die probleem word verder vererger deurdat Xhosasprekende ouers hul demokratiese reg om hul kinders by Engelse skole in te skryf, uitoefen. Die doel van hierdie studie was om 'n geletterdheidsintervensieprogram te ontwikkel wat 'n verbetering kan bring in die woordeskat en leesbegrip van Xhosa-moedertaalsprekers in graad 4 tot 6-Afr...

  11. Professionalisme met verwysing na die posisie van bedryfsielkunde en die bedryfsielkundige in Suid-Afrika

    Directory of Open Access Journals (Sweden)

    A. van der Merwe


    Bedryfsielkunde, as relatief jong maar snelgroeiende wetenskap, word aan die hand van ses kriteria vir 'n professie evalueer. Resultate in hierdie verband dui in die algemeen daarop dat die vakgebied alreeds vir 'n aantal jare in 'n oorgangsfase tot ‘n volwaardige professie is en dat daar in hierdie proses reeds ver op die professionele kontinuum gevorder is. Verdere onder-soeke ten opsigte van professionele opleiding, die statutêre organisering van Bedryfsielkunde asook 'n professionele kode en vereniging vir die Bedryfsielkunde word bepleit ten einde die professionele posisie van die vakgebied volledig te konsolideer.

  12. The German lignite industry. Historical development, resources, technology, economic structures and environmental impact. Study; Die deutsche Braunkohlenwirtschaft. Historische Entwicklungen, Ressourcen, Technik, wirtschaftliche Strukturen und Umweltauswirkungen. Studie

    Energy Technology Data Exchange (ETDEWEB)



    Lignite has a key role to play in the transformation of the energy system due to its specific structural features in terms of industry, company history, policy, economics, the environment and regional structures. Understanding these structural features of the German lignite industry is an important requirement for classifying the significance of the lignite industry up to now and for the redesigning of this industrial sector. From these environmental, economic and regulatory structural characteristics, which are interwoven in a variety of ways, the incentives arise for the mining and power plant operators to react to energy price signals or energy policy steering. The aim of this research study is to define these structural features, to compile comprehensively the basic data and information that is not always transparently available, to understand the interactions, to enable the navigation of issues that are partly very complex, and to classify into the long-term developments that are especially important for political and social processes. In 2016 approx. 12 percent of German primary energy consumption was met using lignite. At the same time, lignite has the highest carbon dioxide (CO2) emissions of the fossil fuels; it currently accounts for approx. 19 percent of Germany's total greenhouse gas emissions as well as approx. 46 percent of the total CO2 emissions of the electricity sector. As a result of the mining of lignite and its conversion into electricity, substantial adverse impacts beyond the entry of greenhouse gases into the Earth's atmosphere arise for other environmental media. These impacts include half of Germany's mercury emissions, approx. a third of its sulfur dioxide emissions and approx. a tenth of its nitrogen oxide emissions. Lignite mining in open-cast mines takes up a substantial amount of landscape and soil and requires huge interventions in the water balance. Relatively high costs arise for the recultivation and rehabilitation

  13. Killing, letting die and euthanasia. (United States)

    Husak, D N


    Medical ethicists debate whether or not the moral assessment of cases of euthanasia should depend on whether the patient is 'killed' or 'allowed to die'. The usual presupposition is that a clear distinction between killing and letting die can be drawn so that this substantive question is not begged. I contend that the categorisation of cases of instances of killing rather than as instances of letting die depends in part on a prior moral assessment of the case. Hence is it trivially rather than substantively true that the distinction has moral significance. But even if a morally neutral (ie non-question begging) distinction could be drawn, its application to the euthanasia controversy is problematic. I illustrate the difficulties of employing this distinction to reach moral conclusions by critically discussing Philippa Foot's recent treatment of euthanasia. I conclude that even if an act of euthanasia is an instance of killing, and there exists a prima facie moral duty not to kill, and no more stringent duty overrides this duty, one still cannot determine such an act to be morally impermissible.

  14. Killing, letting die and euthanasia. (United States)

    Husak, D N


    Medical ethicists debate whether or not the moral assessment of cases of euthanasia should depend on whether the patient is 'killed' or 'allowed to die'. The usual presupposition is that a clear distinction between killing and letting die can be drawn so that this substantive question is not begged. I contend that the categorisation of cases of instances of killing rather than as instances of letting die depends in part on a prior moral assessment of the case. Hence is it trivially rather than substantively true that the distinction has moral significance. But even if a morally neutral (ie non-question begging) distinction could be drawn, its application to the euthanasia controversy is problematic. I illustrate the difficulties of employing this distinction to reach moral conclusions by critically discussing Philippa Foot's recent treatment of euthanasia. I conclude that even if an act of euthanasia is an instance of killing, and there exists a prima facie moral duty not to kill, and no more stringent duty overrides this duty, one still cannot determine such an act to be morally impermissible. PMID:541821

  15. Die ausbildung von wertbedeutungen im schuljugendalter*

    Directory of Open Access Journals (Sweden)

    Siegfried Heusinger


    Full Text Available Die folgenden Darlegungen stützen sich auf Untersuchungsergebnisse des Verlassers zur Sprachentwicklung in der Ontogenese. Angeregt wurde die UnterSuchung durch die besonders in den letzten Jahren in mehreren Ländern verstärkt erhobenen Forderungen, nicht nur die Sprache des Klein­ kindes, sondern vornehmlich den Entwicklungsstand der Schülersprache auf den einzelnen Klassenstufen zu erforschen und den Prozeß der Sprachentwicklung des Schülers genauer zu bestimmen. Die Forderungen sind (so z. B. in der DDR durch das Bestreben motiviert, weitere wissenschaftliche Voraussetzungen für die Verbesserung der muttersprachlichen Bildung und Erzliehung zu schaffen. Es geht also vor allem um Bedürfnisse des Muttersprachunterrichts, die aus der gesellschaftlichen Bedeutung der Sprache überhaupt und den steigenden Anforderungen an die gesellschaftliche Kommunikation insbesondere erwachsen.


    African Journals Online (AJOL)

    soortnaam plus soortnaam" kan albei komponente in Engels. 'n hoofletter kry, in Afrikaans slegs die eerste lid. Vergelyk Cash. Sale,. Kontantultverkoping. Uit 'n reklame-oogpunt Is die Engelse model bulgsamer, funksioneler en doelmatiger as ...

  17. [Die Gründung...] / Anders Henriksson

    Index Scriptorium Estoniae

    Henriksson, Anders


    Rets.: Karsten Brüggemann. Die Gründung der Republik Estland und das Ende des "Einen und unteilbaren Russland" : die Petrograder Front des Russischen Bürgerkrieges, 1918-1920. Wiesbaden : Harrassowitz, 2002


    Directory of Open Access Journals (Sweden)

    Robertus Suryo Bisono


    Full Text Available Telah dilakukan pelapisan menggunakan Titanium Alumunium Nitrid (TIAlN dengan metode PVD Coating (Physical Vapour Diposition dan TD (Thermal Difusion  untuk perlakuan permukaan baja perkakas SKD11 sebagai material Insert Die komponen mesin Stamping Press setelah perlakuan hardening. Perlakuan permukaan dimaksudkan untuk meningkatkan kualitas permukaan khususnya kekerasan dan perubahan struktur mikro yang terjadi. Untuk mengetahui tingkat keberhasilan dari perlakuan permukaan tersebut dilakukan dengan memvariasi waktu proses, masing masing 2 sample diproses pada 4 jam, 5 jam dan 6 jam dengan temperatur  proses masing-masing  400ᴼ C. Kemudian satu dari tiap variable sample tersebut di panaskan pada suhu 1000ᴼ C selama 1 jam, pendinginan dilalukan dengan udara bebas tanpa proses quenching Untuk mengetahui hasilnya dilakukan uji kekerasan mikro Vickers, pengamatan struktur mikro Scanning Eectron Microscope (SEM, dan pengujian komposisi dengan Energy Defersif Sepectroscopy (EDS untuk mengetahui tingkat penyerapan material terdifusi. Hasil menunjukan bahwa SKD11 yang dilapisi TiAlN dengan metode PVD selama 6 jam menghasilkan lapisan yang paling keras yaitu 1363 HV dengan ketebalan lapisan 5,3µm. Proses pemanasan 1000⁰C selama 1 jam pada sample mengakibatkan penurunan kekerasan sample dan lapisan permukaan sample menjadi lebih tebal hingga 50µm. Penambahan lapisan diakibatkan oleh terdifusinya atom atom yang menyusun lapisan TiAlN ke dalam substrat serta keluarnya atom atom penyusun lapisan hingga membentuk lapisan kompleks.

  19. 'I think you just learnt as you went along' - community clergy's experiences of and attitudes towards caring for dying people: A pilot study. (United States)

    Goodhead, Andrew; Speck, Peter; Selman, Lucy


    Spiritual distress is a factor associated with poor outcomes at the end of life. Timely interventions, assessing and meeting spiritual distress, among patients are contained within nationally agreed guidance. Community clergy are well placed to work alongside healthcare professionals and chaplains to meet spiritual needs. Qualitative interviews among Christian clergy in two South East London boroughs and a self-completed Death Anxiety Questionnaire. Fourteen clergy were interviewed from six Christian denominations. Participants described their experiences of ordination training and how helpful this had been for their work among Christian communities. Respondents were invited to discuss their knowledge of and involvement with palliative care services. Each interviewee also accounted for their understanding of pastoral care and spiritual care and considered whether any differences existed between these terms and, if so, what they were. Overall, clergy lacked any detailed formal training and had little experience of working with or relating to palliative care providers. Recommendations are made to improve educational opportunities and working relationships. Creating opportunities for clergy and palliative care staff to meet and undertake shared training will enhance the quality and level of care for people dying at home who wish to receive spiritual support. Enabling clergy to develop links with local palliative care centres will enhance confidence for both clergy and staff. © The Author(s) 2016.

  20. Studies on the use of SIR-C and X-SAR data for identification, demarcation, and assessment of forest ecosystems. Final report; Untersuchungen zum Einsatz von SIR-C und X-SAR Daten fuer die Identifizierung, Abgrenzung und Beurteilung von Waldoekosystemen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Johlige, A.; Foerster, B.; Ammer, U.


    The purpose of the present evaluation was to use SIR-C and X-SAR data for forest surveying and assess their suitability for this task. Amongst other work this included the discrimination of forest and non-forest, demarcation of cleared areas within forests, discrimination of different forest types, and assessment of the influence of foliation. The chief steps of the study were the preparation of radar data, accompanying aerial photo evaluation for the extraction of training and verification areas, and detailed signature analysis. Evaluation trials in ``Oberpfaffenhofen`` supertest area yielded unsatisfactory results when it came to discriminating different forest ecosystems. This can be attributed to the very heterogeneous and small-scale structure of the area and the absence of topographically coded X, C, and L band data. In the second study area, located in the ``Bavarian Forest National Park``, geocoded data of all three bands were available in the form of combined products. This permitted using the mask of the local angles of incidence to reduce the influence of relief. In this case distinguishability within wooded regions was also enhanced. A general finding was that ground resolution as it presents to the user is clearly poorer than the nominal resolution. What impressed us most was the high degree of weather-independence of the radar data. All data handled in this study were recorded under conditions that would have made photography impossible. (orig.) [Deutsch] Ziel der Auswertung ist es SIR-C/X-SAR Daten fuer die Waldbeobachtung einzusetzen und ihre Eignung dafuer zu bewerten. Zu loesende Teilaufgaben waren u.a. die Wald-Nichtwaldtrennung, die Abtrennung unbestockter Flaechen im Wald, Unterscheidung verschiedener Waldtypen selbst und die Beurteilung des Einflusses des Belaubungszustndes. Die zentralen Arbeitsschritte waren die Aufbereitung der Radardaten, die begleitende Luftbildauswertung zur Extraktion von Trainings- und Verifizierungsgebieten und die

  1. Studies on the use of SIR-C and X-SAR data for identification, demarcation, and assessment of forest ecosystems. Final report; Untersuchungen zum Einsatz von SIR-C und X-SAR Daten fuer die Identifizierung, Abgrenzung und Beurteilung von Waldoekosystemen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Johlige, A; Foerster, B; Ammer, U


    The purpose of the present evaluation was to use SIR-C and X-SAR data for forest surveying and assess their suitability for this task. Amongst other work this included the discrimination of forest and non-forest, demarcation of cleared areas within forests, discrimination of different forest types, and assessment of the influence of foliation. The chief steps of the study were the preparation of radar data, accompanying aerial photo evaluation for the extraction of training and verification areas, and detailed signature analysis. Evaluation trials in ``Oberpfaffenhofen`` supertest area yielded unsatisfactory results when it came to discriminating different forest ecosystems. This can be attributed to the very heterogeneous and small-scale structure of the area and the absence of topographically coded X, C, and L band data. In the second study area, located in the ``Bavarian Forest National Park``, geocoded data of all three bands were available in the form of combined products. This permitted using the mask of the local angles of incidence to reduce the influence of relief. In this case distinguishability within wooded regions was also enhanced. A general finding was that ground resolution as it presents to the user is clearly poorer than the nominal resolution. What impressed us most was the high degree of weather-independence of the radar data. All data handled in this study were recorded under conditions that would have made photography impossible. (orig.) [Deutsch] Ziel der Auswertung ist es SIR-C/X-SAR Daten fuer die Waldbeobachtung einzusetzen und ihre Eignung dafuer zu bewerten. Zu loesende Teilaufgaben waren u.a. die Wald-Nichtwaldtrennung, die Abtrennung unbestockter Flaechen im Wald, Unterscheidung verschiedener Waldtypen selbst und die Beurteilung des Einflusses des Belaubungszustndes. Die zentralen Arbeitsschritte waren die Aufbereitung der Radardaten, die begleitende Luftbildauswertung zur Extraktion von Trainings- und Verifizierungsgebieten und die

  2. Die woordeboek vir meganiese ingenieurs: Vorderingsverslag

    Directory of Open Access Journals (Sweden)

    Editorial Office


    Full Text Available Die komitee van die Nasionale Vakterminologiediens (NVD wat ’n woordeboek vir meganiese ingenieurswese saamstel en in Januarie 1986 met sy werksaamhede begin het, maak goeie vordering. Die dag-tot-dag-werk word deur 'n redaksiekomitee behartig wat twee keer maandeliks vergader en uit verteenwoordigers van universiteite, SAVD, YSKOR, SABS en ander instansies bestaan.

  3. Die Reformdiskussion in der senegalesischen Sprachplanungs- politik

    African Journals Online (AJOL)

    Die Reformdiskussion in der senegalesischen Sprachplanungspolitik 13 hatten afrikanische Bildungspolitiker und Kulturtheoretiker (Senghor, Nkrumah, Kenyatta, etc.) sehr früh die Rolle der Sprache und Bildung in einem zukünftigen souveränen afrikanischen Staat anerkannt. Die damals geführten staatsrechtlichen ...

  4. Taalgesindhede en die onderrig van Afrikaans

    Directory of Open Access Journals (Sweden)

    Barbara Bosch


    Full Text Available In die onderrig aan en aanleer van Afrikaans deur nie-moedertaalsprekers behoort daar in 'n multi-kulturele omgewing met taalgesindhede rekening gehou te word: die taalaanleerder se gesindheid teenoor en stereotipiese sienswyses van die sprekers van die teikentaal en die teikentaal self beinvloed die sukses van die verskil/ende stadia van die aanleerproses. Hierdie beinvloeding vind plaas omdat gesindhede motivering beinvloed en as sosio-affektiewe filter in die taalaanleerproses kan optree. Die implikasies van heersende gesindhede teenoor Afrikaans vir die onderrig en aanleer van die taal in 'n multitalige situasie word indringend bespreek. In the teaching of Afrikaans to and the acquisition of the language by non-mother tongue speakers in a multi-lingual environment, cognizance should be taken of prevailing attitudes: the attitudes of the learner towards the target language and his/her stereotypical perceptions of the target language and its speakers which influence the success of the language learning process in various stages. This influence takes place because attitudes affect motivation and can also act as a socio-ajjective filter in the language acquisition process. The implications of existing attitudes towards Afrikaans for the teaching and acquisition of the language in a multi-lingual situation are discussed in depth.

  5. Die ontwerp van ʼn Afrikaanse taakgebaseerde rekenaaronderrig ...

    African Journals Online (AJOL)

    Kate H

    gelewer word, is om die moontlike ontwerp van ʼn taakgebaseerde rekenaarprogram vir die kursus. Beginner Afrikaans Vlak 1 te ... to transfer the required amount of credits back to their home universities. The Language Centre ..... 3.1.1 Die tweeledige kanaal-aanname (“dual channel assumption”). Hierdie aanname ...

  6. Leibniz und die Psychophysik des Gehirns

    NARCIS (Netherlands)

    S. Tuinen (Sjoerd)


    textabstract1. Das Gehirn als Medium allen Denkens Die Probleme der Philosophie sind laut Deleuze niemals von sich aus philosophisch. Bereits eine Antwort auf die Frage Was ist Philosophie? setzt ein nicht-philosophisches 'Bild des Denkens' voraus, eine Art absoluten Hintergrund, in den die

  7. uniform van die staatspresidentswag - herkoms en tradisie

    African Journals Online (AJOL)

    A blue uniform was inter alia proposed in 1980 but finally rejected by the Prime Minister in 1984. Instructions were issued to put forth new ideas. All the arguments in ..... In 1896 Is die rang van kommandant van die Staatsartlllerie verhoog tot die van lultenant-kolonel. Henning Pretorlus, father and first commandant of the.

  8. Straatsburg en artikel 2 van die dordtse kerkorde

    Directory of Open Access Journals (Sweden)

    L. F. Schulze


    Full Text Available In art. 2 K.O. word daar vier soorte kerklike dienste on dcrskei, nl. „dié van die bedienaars van die Woord, dié van die professore aan die teologiese skool, die van die ouderlinge, en dié van die diakens”.

  9. Die skrywer. Esta Steyn. Kaapstad: Tafelberg, 2012. 214 pp. ISBN ...

    African Journals Online (AJOL)

    ningsromans in Duits, is die Christelike ele- mente en die humor. Die straatslim Anabella wat twee plaaswerkers aansê om nie die Here se naam te misbruik nie, toon kenmerke van die heldin in 'n Afrikaanse liefdesverhaal. Hierdie roman sal byval vind by lesers wat. Esta Steyn se vorige romans geniet het. Die humor in die ...

  10. Logistieke bestuur: die oorsprong, konseptuele ontwikkeling en betekenis daarvan as ’n hedendaagse studiegebied

    Directory of Open Access Journals (Sweden)

    W. J. Pienaar


    Full Text Available

    Hierdie artikel beskryf die oorsprong van die woord logistiek, stip die ontwikkeling daarvan uit, en verklaar die hedendaagse betekenis daarvan as ’n studiegebied in ’n bestuurskonteks. Die ontwikkelingsgang van die begrip word aangedui vanaf die oorsprong daarvan in Grieks, met inagneming van die opeenvolgende opname daarvan in Laat Latyn, Frans en Nederlands, tot by die huidige gebruik daarvan in Afrikaans. Die vestiging van die Franse logistique gedurende die Napoleontiese oorloë, en die uitbreiding daarvan na ’n bedryfsbegrip ná afloop van die Tweede Wêreldoorlog word verduidelik. Die ontwikkelingsgang wat die betekenis van die konsep sedertdien in bedryfsverband ondergaan het, word bespreek. Betekenisse van logistiek, soos dit tans in die bedryfslewe gebesig word, word verskaf. Vervolgens bied die artikel ’n eietydse definisie van logistiek in bedryfsverband. Daar word aangetoon hoe doeltreffende bedryfslogistiek waarde toevoeg. Ten slotte word die primêre aktiwiteite wat in die logistieke voorsieningskanaal van produkte voorkom kortliks bespreek.


    Logistics management: its origin, conceptual evolution and meaning as a contemporary field of study

    This article traces the origin of the word logistics, outlines its conceptual evolution, and explains the meaning thereof as a field of study in a contemporary management context. The contextual development of the concept is traced from its origin in Greek, along with its successive adoption in Late Latin, French and Dutch, up to its contemporary usage in Afrikaans. The article describes the establishment of the word logistique in French as a military concept during the Napoleonic wars, and its later extension to commercial usage subsequent to the Second World War. The development of the concept in a commercial context since then is detailed. Contemporary descriptions of logistics relating to its meaning in a

  11. Patients who die during palliative radiotherapy. Status survey

    Energy Technology Data Exchange (ETDEWEB)

    Berger, B.; Ankele, H.; Bamberg, M.; Zips, D. [University of Tuebingen, Department of Radiation Oncology, Tuebingen (Germany)


    Palliative radiotherapy (RT) is routinely used in end of life care of patients with advanced malignancies; however, unnecessarily burdensome treatment shortly before death should be avoided. There is little knowledge on incidence and causes of intercurrent deaths during palliative RT. In this study death events among inpatients receiving palliative RT between January 2009 and December 2011 at this department were retrospectively analyzed. Among epidemiological factors, treatment schedule and chronology, latency and duration of treatment in relation to the actual survival were identified. In this study 52 patients died during or shortly after palliative RT. Symptomatic bone metastases and brain metastases represented the most common RT indications. The general health status was poor with a median Karnofsky performance score of 50 %, RT was realized with a median single dose of 2.5 Gy to a median total dose of 30.5 Gy and was stopped prematurely in 73 % of patients. On average 53 % of the remaining lifetime was occupied by latency to starting RT. Once RT was begun the treatment duration required a median 64 % of the still remaining lifetime. The majority of patients who died had explicitly adverse pre-existing factors and rarely completed RT as scheduled. Latency to RT and RT duration occupied more than half of the remaining lifetime. (orig.) [German] Die palliative Radiotherapie (RT) hat einen hohen Stellenwert in der Symptomenkontrolle terminal erkrankter Tumorpatienten. Unnoetig belastende Therapien kurz vor Lebensende sollten jedoch vermieden werden. Bislang gibt es kaum strukturierte Daten ueber Sterbefaelle unter palliativer RT. Im Rahmen der vorgestellten Studie wurden die Sterbefaelle unter stationaer palliativ bestrahlten Patienten der eigenen Abteilung zwischen Januar 2009 und Dezember 2011 analysiert. Ausgewertet wurden epidemiologische Faktoren, Behandlungskonzept und -verlauf. Zeit bis zum RT-Beginn und RT-Dauer wurden ins Verhaeltnis zur tatsaechlichen

  12. Paleontologie en die Suid-Afrikaanse samelewing vandag


    Durand, JF


    Die huidige oënskynlike ondersteuning van paleontologie deur die regering en die insluiting en beklemtoning van evolusie in die skoolleerplan word bespreek in die lig van sekere politieke ontwikkelings wat oor die laaste twee dekades in Suid-Afrika plaasgevind het. Dit sluit die regering se ondersteuning van paleontologiese ontdekkings in die media, die ontwikkeling van fossielterreine en paleotoerisme in. Ondanks hierdie positiewe inisiatiewe gedy paleontologie nie in Suid-Afrika nie en is d...


    African Journals Online (AJOL)


    as 'n volk in daardie sin aangemerk kon word, en in die O.T. Israel dan ook 'n paar maal, teen die reël wat ons as beginnende studente geleer het,. 1) Die leser vind hier die lesing, deur die skrywer op 29 Februarie 1956 vir die Predikante- vergadering te Pretoria gehou. Die formulering van die titel was van die skriba van.

  14. Die wet is evangelie: Die Heidelbergse Kategismus steeds aktueel na 450 jaar

    Directory of Open Access Journals (Sweden)

    Piet Strauss


    Full Text Available In die denke van Martin Luther bestaan daar spanning tussen die wet van God en die evangelie. Vir Luther is liefde die eie werk en die wet die vreemde werk van God. Daarteenoor integreer of versoen Johannes Calvyn God se wet met die evangelie. Hy vertolk die openingswoorde van die wet byvoorbeeld as liefdevol en bevrydend en daarom evangelies. Calvyn beskou die wet as die manier waarop ’n Christen sy liefde vir God uitleef en sy dankaarheid teenoor God vir sy verlossing betoon. Calvyn se siening oor die verhouding tussen die wet en die evangelie het ’n betekenisvolle invloed op die Heidelbergse Kategismus se formulering ten opsigte van hierdie saak. Volgens die Kategismus is die wet evangelie, of die vorm wat die evangelie in die lewe van die mens aanneem. In the thought of Martin Luther tension exists between the law of God and the gospel. Luther regards love as the own work of God and the law as something strange to the Lord. John Calvin, however, integrates Gods law and the gospel to the extent that the opening words of the ten commandments are regarded as words of love and redemption and therefore evangelical. To Calvin the law becomes the way in which a converted Christian lives and shows his gratitude to God for his salvation. Calvin’s view on the relationship between law and gospel had a significant influence on the way in which the Heidelberg Cathecism formulates these two concepts. For the Cathecism the law is gospel or the form in which the gospel takes shape in human life.

  15. Die impak van die verbond op 'n paradigma vir pastoraat: research ...

    African Journals Online (AJOL)

    Die verbond het 'n meer omvattende impak op pastorale sorg as ander paradigmas. Genoemde stelling word in hierdie artikel beredeneer. Daar word aangetoon dat die inhoud wat aan die gelowige gekommunikeer word, asook die tegnieke wat gebruik word, deur 'n verbondmatige paradigma vir pastorale sorg be?nvloed ...

  16. Die rol van kapitaal in die ekonomiese groei en ontwikkeling van onderontwikkelde gebiede*

    Directory of Open Access Journals (Sweden)

    F. J. du Plessis


    Full Text Available In die teorie oor ekonomiese groei speel kapitaal ’n besonder prominente rol. Kapitaal met die daarby behorende tegnologiese ontwikkeling, word beskou as die belangrikste enkele faktor verantwoordelik vir die bereiking en instandhouding van ’n „ten voile ontwikkelde” volkshuishouding.

  17. Die taak van akademiese geletterdheid/hede binne die konteks van ...

    African Journals Online (AJOL)

    Opsomming. Die vestiging van Akademiese Geletterdheid by tersiêre instansies in Suid-Afrika het gegroei uit die besef dat 'n goedontwikkelde akademiese taalvermoë essensieel is vir akademiese prestasie. Gepubliseerde literatuur getuig van die belangrike verskuiwings wat oor die afgelope aantal dekades plaasgevind ...

  18. Ek wil hier graag van die geleentheid gebruik maak am die ...

    African Journals Online (AJOL)

    die wildlewe am van die jagters nie eers mel- ding te maak nie en in Lucas se werk kan hulle ure van genot deurbring. Wat ons veral in Lucas se publikasie interes- seer is sy deelname aan die agste grensoor~' log (1850-1853), sy aantekeninge in verband met die slag by Berea (20 Oesember 1852) en sy indrukke van ...

  19. Die dinamika van die beperkte drie-deeltjie-probleem in sterrekunde

    Directory of Open Access Journals (Sweden)

    Keegan D. Anderson


    Full Text Available Die beperkte drie-deeltjie-probleem is een van die oudste probleme in klassieke fisika en is alvir ongeveer die afgelope honderd jaar bestudeer. Die probleem is nie oplosbaar op ‘n geslote analitiese wyse nie, alhoewel ’n oneindige reeks oplossing bestaan.

  20. Die reg van die homoseksuele ouer om beheer en toesig oor 'n kind ...

    African Journals Online (AJOL)


    regtens seëvier sodat die grondwetlike verbod op onbillike diskriminasie teen mense op grond van hul seksuele georiënteerdheid so .... gerig teen die homoseksueel self en die homoseksuele daad wat hy/sy beoefen, maar dat daar ook gediskrimineer ..... Die Uniform Marriage and Divorce Act,. 60 aangeneem in verskeie ...