WorldWideScience

Sample records for rhodopseudomonas palustris eine

  1. Photometabolism of Heterocyclic Aromatic Compounds by Rhodopseudomonas palustris OU 11

    Science.gov (United States)

    Sasikala, C.; Ramana, C. V.; Rao, P. Raghuveer

    1994-01-01

    Rhodopseudomonas palustris OU 11 (ATCC 51186; DSM 7375) isolated from a pond of chemical industry effluent could anaerobically photometabolize heterocyclic aromatic compounds belonging to the pyridine and pyrazine groups only after a period of adaptation on pyrazinoic acid of 5 to 6 weeks. Growth on heterocyclic compounds was light dependent. The effects of various concentrations of heterocyclic compounds on growth suggest that higher concentrations of these compounds inhibit growth and are toxic. PMID:16349307

  2. Acclimation strategy of Rhodopseudomonas palustris to high light irradiance.

    Science.gov (United States)

    Muzziotti, Dayana; Adessi, Alessandra; Faraloni, Cecilia; Torzillo, Giuseppe; De Philippis, Roberto

    2017-04-01

    The ability of Rhodopseudomonas palustris cells to rapidly acclimate to high light irradiance is an essential issue when cells are grown under sunlight. The aim of this study was to investigate the photo-acclimation process in Rhodopseudomonas palustris 42OL under different culturing conditions: (i) anaerobic (AnG), (ii) aerobic (AG), and (iii) under H 2 -producing (HP) conditions both at low (LL) and high light (HL) irradiances. The results obtained clearly showed that the photosynthetic unit was significantly affected by the light irradiance at which Rp. palustris 42OL was grown. The synthesis of carotenoids was affected by both illumination and culturing conditions. At LL, lycopene was the main carotenoid synthetized under all conditions tested, while at HL under HP conditions, it resulted the predominant carotenoid. Oppositely, under AnG and AG at HL, rhodovibrin was the major carotenoid detected. The increase in light intensity produced a deeper variation in light-harvesting complexes (LHC) ratio. These findings are important for understanding the ecological distribution of PNSB in natural environments, mostly characterized by high light intensities, and for its growth outdoors. Copyright © 2017 Elsevier GmbH. All rights reserved.

  3. Final report: 'Rhodopseudomonas palustris' genome workshop to be held in Spring of 2001; FINAL

    International Nuclear Information System (INIS)

    Harwood, Caroline S.

    2002-01-01

    The 'Rhodopseudomonas palustris' genome workshop took place in Iowa City on April 6-8, 2001. The purpose of the meeting was to instruct members of the annotation working group in approaches to accomplishing the 'human' phase of the 'R. palustris' genome annotation. A partial draft of a paper describing the 'Rhodopseudomonas palustris' genome has been written and a full version of the paper should be ready for submission by the end of the summer 2002

  4. The anaerobic phototrophic metabolism of 3-chlorobenzoate by Rhodopseudomonas palustris

    Energy Technology Data Exchange (ETDEWEB)

    Kamal, V S

    1992-10-09

    The degradation of chlorinated aromatic compounds by anaerobic bacteria is now known to be an important mechanism of bioremediation. In an experimental study, a mixed phototrophic culture was found to metabolize 3-chlorobenzoate in the presence of benzoate following adaptation on a benzoate and 3-chlorobenzoate medium for 7 weeks. The dominant bacterial isolate was identified as Rhodopseudomonas palustris. Radioisotopic studies showed [sup 14]C-3-chlorobenzoate was converted by the isolate to [sup 14]CO[sub 2] and cell biomass in the absence of oxygen and in the presence of a cosubstrate red light. Cyclohexane carboxylate was able to replace the cosubstrate, benzoate. The isolate also metabolized 3-chlorobenzoate in the presence of pimelic acid, sodium acetate, and sodium succinate; however, the metabolic rate was reduced. Gas chromatography mass spectrometry and high pressure liquid chromatography indicated the intracellular presence of 3-chlorobenzoate and benzoyl-CoA. Cell-free extracts produced benzoate and benzoyl-CoA. A probable route of 3-chlorobenzoate metabolism via dehalogenation followed by steps similar to the benzoate reductive ring fission pathway is suggested. Comparison of kinetic coefficients showed a higher affinity of the isolate for benzoate. Isolates from representative samples of various freshwater and wastewater ecosystems indicated widespread ecological distribution of R. palustris and the common occurrence of the 3-chlorobenzoate metabolic phenotype. R. palustris was found to grow in mixed anaerobic cultures and retained its 3-chlorobenzoate degradation property. 91 refs., 25 figs., 14 tabs.

  5. Acquisition of the ability for Rhodopseudomonas palustris to degrade chlorinated benzoic acids as the sole carbon source

    NARCIS (Netherlands)

    Oda, Y; de Vries, YP; Forney, LJ; Gottschal, JC

    2001-01-01

    Three strains of Rhodopseudomonas palustris were isolated from phototrophic enrichment cultures containing 3-chlorobenzoate (3-CBA) and benzoate (BA). These new strains as well as several previously described strains of R. palustris were tested in this study and shown to degrade 3-CBA if grown in

  6. Revealing the functions of the transketolase enzyme isoforms in Rhodopseudomonas palustris using a systems biology approach.

    Directory of Open Access Journals (Sweden)

    Chia-Wei Hu

    Full Text Available BACKGROUND: Rhodopseudomonas palustris (R. palustris is a purple non-sulfur anoxygenic phototrophic bacterium that belongs to the class of proteobacteria. It is capable of absorbing atmospheric carbon dioxide and converting it to biomass via the process of photosynthesis and the Calvin-Benson-Bassham (CBB cycle. Transketolase is a key enzyme involved in the CBB cycle. Here, we reveal the functions of transketolase isoforms I and II in R. palustris using a systems biology approach. METHODOLOGY/PRINCIPAL FINDINGS: By measuring growth ability, we found that transketolase could enhance the autotrophic growth and biomass production of R. palustris. Microarray and real-time quantitative PCR revealed that transketolase isoforms I and II were involved in different carbon metabolic pathways. In addition, immunogold staining demonstrated that the two transketolase isoforms had different spatial localizations: transketolase I was primarily associated with the intracytoplasmic membrane (ICM but transketolase II was mostly distributed in the cytoplasm. Comparative proteomic analysis and network construction of transketolase over-expression and negative control (NC strains revealed that protein folding, transcriptional regulation, amino acid transport and CBB cycle-associated carbon metabolism were enriched in the transketolase I over-expressed strain. In contrast, ATP synthesis, carbohydrate transport, glycolysis-associated carbon metabolism and CBB cycle-associated carbon metabolism were enriched in the transketolase II over-expressed strain. Furthermore, ATP synthesis assays showed a significant increase in ATP synthesis in the transketolase II over-expressed strain. A PEPCK activity assay showed that PEPCK activity was higher in transketolase over-expressed strains than in the negative control strain. CONCLUSIONS/SIGNIFICANCE: Taken together, our results indicate that the two isoforms of transketolase in R. palustris could affect photoautotrophic growth

  7. Effects of metal ions on biomass and 5-aminolevulinic acid production in Rhodopseudomonas palustris wastewater treatment.

    Science.gov (United States)

    Liu, Shuli; Zhang, Guangming; Li, Jianzheng; Li, Xiangkun; Zhang, Jie

    2016-01-01

    This work investigated the effects of eight metal ions on Rhodopseudomonas palustris growth and 5-aminolevulinic acid (ALA) yield in wastewater treatment. Results show that metal ions (Mg(2+) of 15 mmol/L, Fe(2+) of 400 μmol/L, Co(2+) of 4 μmol/L, Ni(2+) of 8 μmol/L and Zn(2+) of 4 μmol/L) could effectively improve the chemical oxygen demand (COD) removal, Rp. palustris biomass and ALA yield. The highest ALA yield of 13.1 mg/g-biomass was achieved with Fe(2+) of 400 μmol/L. ALA yields were differentially increased under different metal ions in the following order: Fe(2+) group > Mg(2+) group > Co(2+) group = Ni(2+) group > Zn(2+) group = Mo(2+) group > control. Cu(2+) and Mn(2+) inhibited Rp. palustris growth and ALA production. Mechanism analysis revealed that metal ions changed ALA yields by influencing the activities of ALA synthetase and ALA dehydratase.

  8. Uranium interaction with two multi-resistant environmental bacteria: Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris.

    Science.gov (United States)

    Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie

    2012-01-01

    Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations.

  9. Uranium Interaction with Two Multi-Resistant Environmental Bacteria: Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris

    Science.gov (United States)

    Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie

    2012-01-01

    Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations. PMID:23251623

  10. How Posttranslational Modification of Nitrogenase Is Circumvented in Rhodopseudomonas palustris Strains That Produce Hydrogen Gas Constitutively

    Science.gov (United States)

    Heiniger, Erin K.; Oda, Yasuhiro; Samanta, Sudip K.

    2012-01-01

    Nitrogenase catalyzes the conversion of dinitrogen gas (N2) and protons to ammonia and hydrogen gas (H2). This is a catalytically difficult reaction that requires large amounts of ATP and reducing power. Thus, nitrogenase is not normally expressed or active in bacteria grown with a readily utilized nitrogen source like ammonium. nifA* mutants of the purple nonsulfur phototrophic bacterium Rhodopseudomonas palustris have been described that express nitrogenase genes constitutively and produce H2 when grown with ammonium as a nitrogen source. This raised the regulatory paradox of why these mutants are apparently resistant to a known posttranslational modification system that should switch off the activity of nitrogenase. Microarray, mutation analysis, and gene expression studies showed that posttranslational regulation of nitrogenase activity in R. palustris depends on two proteins: DraT2, an ADP-ribosyltransferase, and GlnK2, an NtrC-regulated PII protein. GlnK2 was not well expressed in ammonium-grown NifA* cells and thus not available to activate the DraT2 nitrogenase modification enzyme. In addition, the NifA* strain had elevated nitrogenase activity due to overexpression of the nif genes, and this increased amount of expression overwhelmed a basal level of activity of DraT2 in ammonium-grown cells. Thus, insufficient levels of both GlnK2 and DraT2 allow H2 production by an nifA* mutant grown with ammonium. Inactivation of the nitrogenase posttranslational modification system by mutation of draT2 resulted in increased H2 production by ammonium-grown NifA* cells. PMID:22179236

  11. Two Distinct Aerobic Methionine Salvage Pathways Generate Volatile Methanethiol in Rhodopseudomonas palustris

    Science.gov (United States)

    Miller, Anthony R.; North, Justin A.; Wildenthal, John A.

    2018-01-01

    ABSTRACT 5′-Methyl-thioadenosine (MTA) is a dead-end, sulfur-containing metabolite and cellular inhibitor that arises from S-adenosyl-l-methionine-dependent reactions. Recent studies have indicated that there are diverse bacterial methionine salvage pathways (MSPs) for MTA detoxification and sulfur salvage. Here, via a combination of gene deletions and directed metabolite detection studies, we report that under aerobic conditions the facultatively anaerobic bacterium Rhodopseudomonas palustris employs both an MTA-isoprenoid shunt identical to that previously described in Rhodospirillum rubrum and a second novel MSP, both of which generate a methanethiol intermediate. The additional R. palustris aerobic MSP, a dihydroxyacetone phosphate (DHAP)-methanethiol shunt, initially converts MTA to 2-(methylthio)ethanol and DHAP. This is identical to the initial steps of the recently reported anaerobic ethylene-forming MSP, the DHAP-ethylene shunt. The aerobic DHAP-methanethiol shunt then further metabolizes 2-(methylthio)ethanol to methanethiol, which can be directly utilized by O-acetyl-l-homoserine sulfhydrylase to regenerate methionine. This is in contrast to the anaerobic DHAP-ethylene shunt, which metabolizes 2-(methylthio)ethanol to ethylene and an unknown organo-sulfur intermediate, revealing functional diversity in MSPs utilizing a 2-(methylthio)ethanol intermediate. When MTA was fed to aerobically growing cells, the rate of volatile methanethiol release was constant irrespective of the presence of sulfate, suggesting a general housekeeping function for these MSPs up through the methanethiol production step. Methanethiol and dimethyl sulfide (DMS), two of the most important compounds of the global sulfur cycle, appear to arise not only from marine ecosystems but from terrestrial ones as well. These results reveal a possible route by which methanethiol might be biologically produced in soil and freshwater environments. PMID:29636438

  12. Hydrogen production under salt stress conditions by a freshwater Rhodopseudomonas palustris strain.

    Science.gov (United States)

    Adessi, Alessandra; Concato, Margherita; Sanchini, Andrea; Rossi, Federico; De Philippis, Roberto

    2016-03-01

    Hydrogen represents a possible alternative energy carrier to face the growing request for energy and the shortage of fossil fuels. Photofermentation for the production of H2 constitutes a promising way for integrating the production of energy with waste treatments. Many wastes are characterized by high salinity, and polluted seawater can as well be considered as a substrate. Moreover, the application of seawater for bacterial culturing is considered cost-effective. The aims of this study were to assess the capability of the metabolically versatile freshwater Rhodopseudomonas palustris 42OL of producing hydrogen on salt-containing substrates and to investigate its salt stress response strategy, never described before. R. palustris 42OL was able to produce hydrogen in media containing up to 3 % added salt concentration and to grow in media containing up to 4.5 % salinity without the addition of exogenous osmoprotectants. While the hydrogen production performances in absence of sea salts were higher than in their presence, there was no significant difference in performances between 1 and 2 % of added sea salts. Nitrogenase expression levels indicated that the enzyme was not directly inhibited during salt stress, but a regulation of its expression may have occurred in response to salt concentration increase. During cell growth and hydrogen production in the presence of salts, trehalose was accumulated as a compatible solute; it protected the enzymatic functionality against salt stress, thus allowing hydrogen production. The possibility of producing hydrogen on salt-containing substrates widens the range of wastes that can be efficiently used in production processes.

  13. Sequence Analysis of the Cryptic Plasmid pMG101 from Rhodopseudomonas palustris and Construction of Stable Cloning Vectors

    Science.gov (United States)

    Inui, Masayuki; Roh, Jung Hyeob; Zahn, Kenneth; Yukawa, Hideaki

    2000-01-01

    A 15-kb cryptic plasmid was obtained from a natural isolate of Rhodopseudomonas palustris. The plasmid, designated pMG101, was able to replicate in R. palustris and in closely related strains of Bradyrhizobium japonicum and phototrophic Bradyrhizobium species. However, it was unable to replicate in the purple nonsulfur bacterium Rhodobacter sphaeroides and in Rhizobium species. The replication region of pMG101 was localized to a 3.0-kb SalI-XhoI fragment, and this fragment was stably maintained in R. palustris for over 100 generations in the absence of selection. The complete nucleotide sequence of this fragment revealed two open reading frames (ORFs), ORF1 and ORF2. The deduced amino acid sequence of ORF1 is similar to sequences of Par proteins, which mediate plasmid stability from certain plasmids, while ORF2 was identified as a putative rep gene, coding for an initiator of plasmid replication, based on homology with the Rep proteins of several other plasmids. The function of these sequences was studied by deletion mapping and gene disruptions of ORF1 and ORF2. pMG101-based Escherichia coli-R. palustris shuttle cloning vectors pMG103 and pMG105 were constructed and were stably maintained in R. palustris growing under nonselective conditions. The ability of plasmid pMG101 to replicate in R. palustris and its close phylogenetic relatives should enable broad application of these vectors within this group of α-proteobacteria. PMID:10618203

  14. Hydrogen production using Rhodopseudomonas palustris WP 3-5 with hydrogen fermentation reactor effluent

    International Nuclear Information System (INIS)

    Chi-Mei Lee; Kuo-Tsang Hung

    2006-01-01

    The possibility of utilizing the dark hydrogen fermentation stage effluents for photo hydrogen production using purple non-sulfur bacteria should be elucidated. In the previous experiments, Rhodopseudomonas palustris WP3-5 was proven to efficiently produce hydrogen from the effluent of hydrogen fermentation reactors. The highest hydrogen production rate was obtained at a HRT value of 48 h when feeding a 5 fold effluent dilution from anaerobic hydrogen fermentation. Besides, hydrogen production occurred only when the NH 4 + concentration was below 17 mg-NH 4 + /l. Therefore, for successful fermentation effluent utilization, the most important things were to decrease the optimal HRT, increase the optimal substrate concentration and increase the tolerable ammonia concentration. In this study, a lab-scale serial photo-bioreactor was constructed. The reactor overall hydrogen production efficiency with synthetic wastewater exhibiting an organic acid profile identical to that of anaerobic hydrogen fermentation reactor effluent and with effluent from two anaerobic hydrogen fermentation reactors was evaluated. (authors)

  15. Optimization of phototrophic hydrogen production by Rhodopseudomonas palustris PBUM001 via statistical experimental design

    Energy Technology Data Exchange (ETDEWEB)

    Jamil, Zadariana [Department of Civil Engineering, Faculty of Engineering, University of Malaya (Malaysia); Faculty of Civil Engineering, Technology University of MARA (Malaysia); Mohamad Annuar, Mohamad Suffian; Vikineswary, S. [Institute of Biological Sciences, University of Malaya (Malaysia); Ibrahim, Shaliza [Department of Civil Engineering, Faculty of Engineering, University of Malaya (Malaysia)

    2009-09-15

    Phototrophic hydrogen production by indigenous purple non-sulfur bacteria, Rhodopseudomonas palustris PBUM001 from palm oil mill effluent (POME) was optimized using response surface methodology (RSM). The process parameters studied include inoculum sizes (% v/v), POME concentration (% v/v), light intensity (klux), agitation (rpm) and pH. The experimental data on cumulative hydrogen production and COD reduction were fitted into a quadratic polynomial model using response surface regression analysis. The path to optimal process conditions was determined by analyzing response surface three-dimensional surface plot and contour plot. Statistical analysis on experimental data collected following Box-Behnken design showed that 100% (v/v) POME concentration, 10% (v/v) inoculum size, light intensity at 4.0 klux, agitation rate at 250 rpm and pH of 6 were the best conditions. The maximum predicted cumulative hydrogen production and COD reduction obtained under these conditions was 1.05 ml H{sub 2}/ml POME and 31.71% respectively. Subsequent verification experiments at optimal process values gave the maximum yield of cumulative hydrogen at 0.66 {+-} 0.07 ml H{sub 2}/ml POME and COD reduction at 30.54 {+-} 9.85%. (author)

  16. Arsenic-Redox Transformation and Plant Growth Promotion by Purple Nonsulfur Bacteria Rhodopseudomonas palustris CS2 and Rhodopseudomonas faecalis SS5.

    Science.gov (United States)

    Batool, Kanza; Tuz Zahra, Fatima; Rehman, Yasir

    2017-01-01

    Arsenic (As) is a well-known toxic metalloid found naturally and released by different industries, especially in developing countries. Purple nonsulfur bacteria (PNSB) are known for wastewater treatment and plant growth promoting abilities. As-resistant PNSB were isolated from a fish pond. Based on As-resistance and plant growth promoting attributes, 2 isolates CS2 and SS5 were selected and identified as Rhodopseudomonas palustris and Rhodopseudomonas faecalis , respectively, through 16S rRNA gene sequencing. Maximum As(V) resistance shown by R. faecalis SS5 and R. palustris CS2 was up to 150 and 100 mM, respectively. R . palustris CS2 showed highest As(V) reduction up to 62.9% (6.29 ± 0.24 mM), while R. faecalis SS5 showed maximum As(III) oxidation up to 96% (4.8 ± 0.32 mM), respectively. Highest auxin production was observed by R. palustris CS2 and R. faecalis SS, up to 77.18 ± 3.7 and 76.67 ± 2.8  μ g mL -1 , respectively. Effects of these PNSB were tested on the growth of Vigna mungo plants. A statistically significant increase in growth was observed in plants inoculated with isolates compared to uninoculated plants, both in presence and in absence of As. R. palustris CS2 treated plants showed 17% (28.1 ± 0.87 cm) increase in shoot length and 21.7% (7.07 ± 0.42 cm) increase in root length, whereas R. faecalis SS5 treated plants showed 12.8% (27.09 ± 0.81 cm) increase in shoot length and 18.8% (6.9 ± 0.34 cm) increase in root length as compared to the control plants. In presence of As, R. palustris CS2 increased shoot length up to 26.3% (21.0 ± 1.1 cm), while root length increased up to 31.3% (5.3 ± 0.4 cm), whereas R. faecalis SS5 inoculated plants showed 25% (20.7 ± 1.4 cm) increase in shoot length and 33.3% (5.4 ± 0.65 cm) increase in root length as compared to the control plants. Bacteria with such diverse abilities could be ideal for plant growth promotion in As-contaminated sites.

  17. A novel electrophototrophic bacterium Rhodopseudomonas palustris strain RP2, exhibits hydrocarbonoclastic potential in anaerobic environments

    Directory of Open Access Journals (Sweden)

    Krishnaveni Venkidusamy

    2016-07-01

    Full Text Available An electrophototrophic, hydrocarbonoclastic bacterium Rhodopseudomonas palustris stain RP2 was isolated from the anodic biofilms of hydrocarbon fed microbial electrochemical remediation systems (MERS. Salient properties of the strain RP2 were direct electrode respiration, dissimilatory metal oxide reduction, spore formation, anaerobic nitrate reduction, free living diazotrophy and the ability to degrade n-alkane components of petroleum hydrocarbons in anoxic, photic environments. In acetate fed microbial electrochemical cells, a maximum current density of 305±10 mA/m2 (1000Ω was generated (power density 131.65±10 mW/m2 by strain RP2 with a coulombic efficiency of 46.7 ± 1.3%. Cyclic voltammetry studies showed that anaerobically grown cells of strain RP2 is electrochemically active and likely to transfer electrons extracellularly to solid electron acceptors through membrane bound compounds, however, aerobically grown cells lacked the electrochemical activity. The ability of strain RP2 to produce current (maximum current density 21±3 mA/m2; power density 720±7 µW/m2, 1000Ω using petroleum hydrocarbon (PH as a sole energy source was also examined using an initial concentration of 800 mg l-1 of diesel range hydrocarbons (C9- C36 with a concomitant removal of 47.4 ± 2.7% hydrocarbons in MERS. Here, we also report the first study that shows an initial evidence for the existence of a hydrocarbonoclastic behavior in the strain RP2 when grown in different electron accepting and illuminated conditions (anaerobic and MERS degradation. Such observations reveal the importance of photoorganotrophic growth in the utilization of hydrocarbons from contaminated environments. Identification of such novel petrochemical hydrocarbon degrading electricigens, not only expands the knowledge on the range of bacteria known for the hydrocarbon bioremediation but also shows a biotechnological potential that goes well beyond its applications to MERS.

  18. High-throughput transcriptome sequencing analysis provides preliminary insights into the biotransformation mechanism of Rhodopseudomonas palustris treated with alpha-rhamnetin-3-rhamnoside.

    Science.gov (United States)

    Bi, Lei; Guan, Chun-jie; Yang, Guan-e; Yang, Fei; Yan, Hong-yu; Li, Qing-shan

    2016-04-01

    The purple photosynthetic bacterium Rhodopseudomonas palustris has been widely applied to enhance the therapeutic effects of traditional Chinese medicine using novel biotransformation technology. However, comprehensive studies of the R. palustris biotransformation mechanism are rare. Therefore, investigation of the expression patterns of genes involved in metabolic pathways that are active during the biotransformation process is essential to elucidate this complicated mechanism. To promote further study of the biotransformation of R. palustris, we assembled all R. palustris transcripts using Trinity software and performed differential expression analysis of the resulting unigenes. A total of 9725, 7341 and 10,963 unigenes were obtained by assembling the alpha-rhamnetin-3-rhamnoside-treated R. palustris (RPB) reads, control R. palustris (RPS) reads and combined RPB&RPS reads, respectively. A total of 9971 unigenes assembled from the RPB&RPS reads were mapped to the nr, nt, Swiss-Prot, Gene Ontology (GO), Clusters of Orthologous Groups (COGs) and Kyoto Encyclopedia of Genes and Genomes (KEGG) (E-value biotransformation in R. palustris. Furthermore, we propose two putative ARR biotransformation mechanisms in R. palustris. These analytical results represent a useful genomic resource for in-depth research into the molecular basis of biotransformation and genetic modification in R. palustris. Copyright © 2016 Elsevier GmbH. All rights reserved.

  19. Phenotype fingerprinting suggests the involvement of single-genotype consortia in degradation of aromatic compounds by Rhodopseudomonas palustris.

    Directory of Open Access Journals (Sweden)

    Tatiana V Karpinets

    Full Text Available Anaerobic degradation of complex organic compounds by microorganisms is crucial for development of innovative biotechnologies for bioethanol production and for efficient degradation of environmental pollutants. In natural environments, the degradation is usually accomplished by syntrophic consortia comprised of different bacterial species. This strategy allows consortium organisms to reduce efforts required for maintenance of the redox homeostasis at each syntrophic level. Cellular mechanisms that maintain the redox homeostasis during the degradation of aromatic compounds by one organism are not fully understood. Here we present a hypothesis that the metabolically versatile phototrophic bacterium Rhodopseudomonas palustris forms its own syntrophic consortia, when it grows anaerobically on p-coumarate or benzoate as a sole carbon source. We have revealed the consortia from large-scale measurements of mRNA and protein expressions under p-coumarate, benzoate and succinate degrading conditions using a novel computational approach referred as phenotype fingerprinting. In this approach, marker genes for known R. palustris phenotypes are employed to determine the relative expression levels of genes and proteins in aromatics versus non-aromatics degrading condition. Subpopulations of the consortia are inferred from the expression of phenotypes and known metabolic modes of the R. palustris growth. We find that p-coumarate degrading conditions may lead to at least three R. palustris subpopulations utilizing p-coumarate, benzoate, and CO2 and H2. Benzoate degrading conditions may also produce at least three subpopulations utilizing benzoate, CO2 and H2, and N2 and formate. Communication among syntrophs and inter-syntrophic dynamics in each consortium are indicated by up-regulation of transporters and genes involved in the curli formation and chemotaxis. The N2-fixing subpopulation in the benzoate degrading consortium has preferential activation of the

  20. Promoting effects of a single Rhodopseudomonas palustris inoculant on plant growth by Brassica rapa chinensis under low fertilizer input.

    Science.gov (United States)

    Wong, Wai-Tak; Tseng, Ching-Han; Hsu, Shu-Hua; Lur, Huu-Sheng; Mo, Chia-Wei; Huang, Chu-Ning; Hsu, Shu-Chiung; Lee, Kung-Ta; Liu, Chi-Te

    2014-09-17

    Several Rhodopseudomonas palustris strains have been isolated from rice paddy fields in Taiwan by combining the Winogradsky column method and molecular marker detection. These isolates were initially screened by employing seed germination and seedling vigor assays to evaluate their potential as inoculants. To fulfill the demand in the present farming system for reducing the application of chemical fertilizers, we assessed the plant growth-promoting effects of the R. palustris YSC3, YSC4, and PS3 inoculants on Brassica rapa chinensis (Chinese cabbage) cultivated under a half quantity of fertilizer. The results obtained showed that supplementation with approximately 4.0×10(6) CFU g(-1) soil of the PS3 inoculant at half the amount of fertilizer consistently produced the same plant growth potential as 100% fertility, and also increased the nitrogen use efficiency of the applied fertilizer nutrients. Furthermore, we noted that the plant growth-promotion rate elicited by PS3 was markedly higher with old seeds than with new seeds, suggesting it has the potential to boost the development of seedlings that were germinated from carry-over seeds of poor quality. These beneficial traits suggest that the PS3 isolate may serve as a potential PGPR inoculant for integrated nutrient management in agriculture.

  1. Transfer of the high-GC cyclohexane carboxylate degradation pathway from Rhodopseudomonas palustris to Escherichia coli for production of biotin.

    Science.gov (United States)

    Bernstein, Jeffrey R; Bulter, Thomas; Liao, James C

    2008-01-01

    This work demonstrates the transfer of the five-gene cyclohexane carboxylate (CHC) degradation pathway from the high-GC alphaproteobacterium Rhodopseudomonas palustris to Escherichia coli, a gammaproteobacterium. The degradation product of this pathway is pimeloyl-CoA, a key metabolite in E. coli's biotin biosynthetic pathway. This pathway is useful for biotin overproduction in E. coli; however, the expression of GC-rich genes is troublesome in this host. When the native R. palustris CHC degradation pathway is transferred to a DeltabioH pimeloyl-CoA auxotroph of E. coli, it is unable to complement growth in the presence of CHC. To overcome this expression problem we redesigned the operon with decreased GC content and removed stretches of high-GC intergenic DNA which comprise the 5' untranslated region of each gene, replacing these features with shorter low-GC sequences. We show this synthetic construct enables growth of the DeltabioH strain in the presence of CHC. When the synthetic degradation pathway is overexpressed in conjunction with the downstream genes for biotin biosynthesis, we measured significant accumulation of biotin in the growth medium, showing that the pathway transfer is successfully integrated with the host metabolism.

  2. Identification of protein W, the elusive sixth subunit of the Rhodopseudomonas palustris reaction center-light harvesting 1 core complex.

    Science.gov (United States)

    Jackson, Philip J; Hitchcock, Andrew; Swainsbury, David J K; Qian, Pu; Martin, Elizabeth C; Farmer, David A; Dickman, Mark J; Canniffe, Daniel P; Hunter, C Neil

    2018-02-01

    The X-ray crystal structure of the Rhodopseudomonas (Rps.) palustris reaction center-light harvesting 1 (RC-LH1) core complex revealed the presence of a sixth protein component, variably referred to in the literature as helix W, subunit W or protein W. The position of this protein prevents closure of the LH1 ring, possibly to allow diffusion of ubiquinone/ubiquinol between the RC and the cytochrome bc 1 complex in analogous fashion to the well-studied PufX protein from Rhodobacter sphaeroides. The identity and function of helix W have remained unknown for over 13years; here we use a combination of biochemistry, mass spectrometry, molecular genetics and electron microscopy to identify this protein as RPA4402 in Rps. palustris CGA009. Protein W shares key conserved sequence features with PufX homologs, and although a deletion mutant was able to grow under photosynthetic conditions with no discernible phenotype, we show that a tagged version of protein W pulls down the RC-LH1 complex. Protein W is not encoded in the photosynthesis gene cluster and our data indicate that only approximately 10% of wild-type Rps. palustris core complexes contain this non-essential subunit; functional and evolutionary consequences of this observation are discussed. The ability to purify uniform RC-LH1 and RC-LH1-protein W preparations will also be beneficial for future structural studies of these bacterial core complexes. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  3. A two-step fermentation of distillers' grains using Trichoderma viride and Rhodopseudomonas palustris for fish feed.

    Science.gov (United States)

    Zhang, Jian; Zhang, Wen-Xue; Li, Shun-Zhou; You, Ling; Zhang, Chao; Sun, Chuan-Ze; Liu, Xiao-Bin

    2013-10-01

    It is important to provide added value or to make full use of the co-product of grains from ethanol production. In order to convert distillers' grains into a high-quality feed, the Trichoderma viride and Rhodopseudomonas palustris fermentation were combined and investigated in this study. The T. viride fermentation was carried out in an aerobic fermentation installation in favoring of the growth of the fungi and the degradation of the cellulose, and then the fermentation of R. palustris was performed to increase the content of protein with an anaerobic installation. After the two step fermentations, the true protein content of dried distiller' grains increased from 11.4 to 33.6 % (w/w) (the content of crude protein from 14.5 to 39.7 %), the crude fiber content decreased from 21.3 to 7.6 % (w/w), the crude fat content increased from 5.5 to 7.9 % (w/w), the crude ash decreased from 14.6 to 10.2 % (w/w), the total phosphorus content increased from 0.4 to 1.2 % (w/w), and the water content was 11.8 % (w/w). The dried and fermented grains contain the R. palustris viable count of 5.3 × 10¹¹ CFU/g dry matter. The results may support a new application of an active photosynthetic bacteria fish feed in fisheries industry and offer a reference for the further study of lignocellulosic materials as raw materials converting into high-quality feed.

  4. Cloning and characterization of a pyrethroid pesticide decomposing esterase gene, Est3385, from Rhodopseudomonas palustris PSB-S.

    Science.gov (United States)

    Luo, Xiangwen; Zhang, Deyong; Zhou, Xuguo; Du, Jiao; Zhang, Songbai; Liu, Yong

    2018-05-09

    Full length open reading frame of pyrethroid detoxification gene, Est3385, contains 963 nucleotides. This gene was identified and cloned based on the genome sequence of Rhodopseudomonas palustris PSB-S available at the GneBank. The predicted amino acid sequence of Est3385 shared moderate identities (30-46%) with the known homologous esterases. Phylogenetic analysis revealed that Est3385 was a member in the esterase family I. Recombinant Est3385 was heterologous expressed in E. coli, purified and characterized for its substrate specificity, kinetics and stability under various conditions. The optimal temperature and pH for Est3385 were 35 °C and 6.0, respectively. This enzyme could detoxify various pyrethroid pesticides and degrade the optimal substrate fenpropathrin with a Km and Vmax value of 0.734 ± 0.013 mmol·l -1 and 0.918 ± 0.025 U·µg -1 , respectively. No cofactor was found to affect Est3385 activity but substantial reduction of enzymatic activity was observed when metal ions were applied. Taken together, a new pyrethroid degradation esterase was identified and characterized. Modification of Est3385 with protein engineering toolsets should enhance its potential for field application to reduce the pesticide residue from agroecosystems.

  5. Different Metabolomic Responses to Carbon Starvation between Light and Dark Conditions in the Purple Photosynthetic Bacterium, Rhodopseudomonas palustris.

    Science.gov (United States)

    Kanno, Nanako; Matsuura, Katsumi; Haruta, Shin

    2018-03-29

    Purple photosynthetic bacteria utilize light energy for growth. We previously demonstrated that light energy contributed to prolonging the survival of multiple purple bacteria under carbon-starved conditions. In order to clarify the effects of illumination on metabolic states under carbon-starved, non-growing conditions, we herein compared the metabolic profiles of starved cells in the light and dark using the purple bacterium, Rhodopseudomonas palustris. The metabolic profiles of starved cells in the light were markedly different from those in the dark. After starvation for 5 d in the light, cells showed increases in the amount of ATP and the NAD + /NADH ratio. Decreases in the amounts of most metabolites related to glycolysis and the TCA cycle in energy-rich starved cells suggest the active utilization of these metabolites for the modification of cellular components. Starvation in the dark induced the consumption of cellular compounds such as amino acids, indicating that the degradation of these cellular components produced ATP in order to maintain viability under energy-poor conditions. The present results suggest that intracellular energy levels alter survival strategies under carbon-starved conditions through metabolism.

  6. Preservation of H2 production activity in nanoporous latex coatings of Rhodopseudomonas palustris CGA009 during dry storage at ambient temperatures: Preservation of R. palustris latex coatings

    Energy Technology Data Exchange (ETDEWEB)

    Piskorska, M. [Univ. of South Carolina, Aiken, SC (United States); Soule, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Gosse, J. L. [North Carolina State Univ., Raleigh, NC (United States); Milliken, C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Flickinger, M. C. [North Carolina State Univ., Raleigh, NC (United States); Smith, G. W. [Univ. of South Carolina, Aiken, SC (United States); Yeager, C. M. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2013-01-21

    To assess the applicability of latex cell coatings as an ‘off-the-shelf’ biocatalyst, the effect of osmoprotectants, temperature, humidity and O2 on preservation of H2 production in Rhodopseudomonas palustris coatings was evaluated. Immediately following latex coating coalescence (24 h) and for up to 2 weeks of dry storage, rehydrated coatings containing different osmoprotectants displayed similar rates of H2 production. Beyond 2 weeks of storage, sorbitol-treated coatings lost all H2 production activity, whereas considerable H2 production was still detected in sucrose- and trehalose-stabilized coatings. The relative humidity level at which the coatings were stored had a significant impact on the recovery and subsequent rates of H2 production. After 4 weeks storage under air at 60% humidity, coatings produced only trace amounts of H2 (0–0.1% headspace accumulation), whereas those stored at < 5% humidity retained 27–53% of their H2 production activity after 8 weeks of storage. In conWhen stored in argon at < 5% humidity and room temperature, R. palustris coatings retained full H2 production activity for 3 months, implicating oxidative damage as a key factor limiting coating storage. Overall, the results demonstrate that biocatalytic latex coatings are an attractive cell immobilization platform for preservation of bioactivity in the dry state.

  7. Single-molecule spectroscopy reveals that individual low-light LH2 complexes from Rhodopseudomonas palustris 2.1.6. have a heterogeneous polypeptide composition.

    Science.gov (United States)

    Brotosudarmo, Tatas H P; Kunz, Ralf; Böhm, Paul; Gardiner, Alastair T; Moulisová, Vladimíra; Cogdell, Richard J; Köhler, Jürgen

    2009-09-02

    Rhodopseudomonas palustris belongs to the group of purple bacteria that have the ability to produce LH2 complexes with unusual absorption spectra when they are grown at low-light intensity. This ability is often related to the presence of multiple genes encoding the antenna apoproteins. Here we report, for the first time to our knowledge, direct evidence that individual low-light LH2 complexes have a heterogeneous alphabeta-apoprotein composition that modulates the site energies of Bchl a molecules, producing absorption bands at 800, 820, and 850 nm. The arrangement of the Bchl a molecules in the "tightly coupled ring" can be modeled by nine alphabeta-Bchls dimers, such that the Bchls bound to six alphabeta-pairs have B820-like site energies and the remaining Bchl a molecules have B850-like site energies. Furthermore, the experimental data can only be satisfactorily modeled when these six alphabeta-pairs with B820 Bchl a molecules are distributed such that the symmetry of the assembly is reduced to C(3). It is also clear from the measured single-molecule spectra that the energies of the electronically excited states in the mixed B820/850 ring are mainly influenced by diagonal disorder.

  8. Anaerobic p-coumarate degradation by Rhodopseudomonas palustris and identification of CouR, a MarR repressor protein that binds p-coumaroyl coenzyme A.

    Science.gov (United States)

    Hirakawa, Hidetada; Schaefer, Amy L; Greenberg, E Peter; Harwood, Caroline S

    2012-04-01

    The phenylpropanoid p-coumarate and structurally related aromatic compounds are produced in large amounts by green plants and are excellent carbon sources for many soil bacteria. Aerobic bacteria remove the acyl side chain from phenylpropanoids to leave an aromatic aldehyde, which then enters one of several possible central pathways of benzene ring degradation. We investigated the pathway for the anaerobic degradation of p-coumarate by the phototrophic bacterium Rhodopseudomonas palustris and found that it also follows this metabolic logic. We characterized enzymes for the conversion of p-coumarate to p-hydroxybenzaldehyde and acetyl coenzyme A (acetyl-CoA) encoded by the couAB operon. We also identified a MarR family transcriptional regulator that we named CouR. A couR mutant had elevated couAB expression. In addition, His-tagged CouR bound with high affinity to a DNA fragment encompassing the couAB promoter region, and binding was abrogated by the addition of nanomolar quantities of p-coumaroyl-CoA but not by p-coumarate. Footprinting demonstrated binding of CouR to an inverted repeat sequence that overlaps the -10 region of the couAB promoter. Our results provide evidence for binding of a CoA-modified aromatic compound by a MarR family member. Although the MarR family is widely distributed in bacteria and archaea and includes over 12,000 members, ligands have been identified for relatively few family members. Here we provide biochemical evidence for a new category of MarR ligand.

  9. Hydrogen photo-evolution by Rhodopseudomonas palustris 6A using pre-treated olive mill wastewater and a synthetic medium containing sugars

    International Nuclear Information System (INIS)

    Pintucci, Cristina; Padovani, Giulia; Giovannelli, Alessio; Traversi, Maria Laura; Ena, Alba; Pushparaj, Benjamin; Carlozzi, Pietro

    2015-01-01

    Highlights: • Adsorbent matrices to convert fresh olive mill wastewater (OMW F ) in feedstock. • Dry-Azolla and granular active carbon for adsorbing polyphenols from OMW F . • Photofermentative processes for biohydrogen production. • Culture mixing by means of an impeller or a magnetic stir bar. • A 30% of dephenolised OMW containing medium suits the photofermentative process. - Abstract: Increasing costs of petroleum, associated with the escalating problems of global climate change, require always greater efforts in order to produce an energy carrier as bioH 2 . In this study, bioH 2 production using photofermentative process was investigated. Two culture broths were used: (a) a synthetic medium rich in sugars (glucose and fructose) and (b) a pre-treated fresh olive-mill wastewater (OMW F ) diluted with water (30%, v:v). The pre-treatment was carried out using two different vegetable matrices (dry-Azolla and granular active carbon) to decrease both the content of polyphenols and the dark colour of wastewater. Rhodopseudomonas palustris 6A isolated from soil spread with OMW was utilized for batch growth experiments, carried out indoors under continuous light (200 μE/m 2 /s). When synthetic medium was used, the culture mixing was performed using either (i) a magnetic stir bar, and (ii) an impeller equipped with five turbines. The latter system made it possible to increase the bioH 2 photo-evolution by 1.4 times. The specific hydrogen photo-evolution rate was 13.5 mL/g(dw)/h in the broth containing diluted OMW F and 11.8 mL/g(dw)/h in the synthetic medium containing sugars (glucose and fructose)

  10. Effect of dilution and L-malic acid addition on bio-hydrogen production with Rhodopseudomonas palustris from effluent of an acidogenic anaerobic reactor

    International Nuclear Information System (INIS)

    Azbar, N.; Tuba, F.; Dokgoz, C.

    2009-01-01

    In this study, H 2 was produced in a two-stage biological process: I) first stage; the dark fermentation of cheese whey wastewater, which is rich in lactose, by mixed anaerobic culture grown at thermophilic temperature in a continuously running fermentor and ii) second stage; the photo-fermentation of the residual medium by R. palustris strain (DSM 127) at 31 o C under illumination of 150 W in batch mode, respectively. In the first part of the study, the effluent from the dark fermentation reactor was used either as it is (no dilution) or after dilution with distilled water at varying ratios such as 1/2 , 1/5, 1/10 (1 volume effluent/5 volume distilled water) before used in photo-fermentation experiments. In the second part of the study, L-malic acid at varying amounts was added into the hydrogen production medium in order to have L-malic acid concentrations ranging from 0 to 4 g/l. Non-diluted and pre-diluted mediums with or without L-malic acid addition were also tested for comparison purpose (as controls). Prior to the hydrogen production experiments, all samples were subjected to pH adjustment, (pH 6.7) and sterilized by autoclave at 121 o C for 15 min. In regards to the experiments in which the effect of dilution of the effluent from dark fermentation was studied, it was observed that dilution of the effluent from dark fermentation resulted in much better hydrogen productions. Among the dilution rates used, the experiments operated with 1/5 dilution ratio produced the best hydrogen production (241 ml H 2 / g COD fed ). On the other hand, it was seen that the mixing the effluent with L-malic acid (0 - 4 g/l) at increasing ratios (studied from 0% L-malic acid up to 100% by volume in the mixture) had further positive effect and improved the hydrogen production. The bioreactors containing only L-malic acid media resulted in the best hydrogen production (438 ml H 2 / g COD fed ). It was found that, undiluted raw cheese whey wastewater effluent from dark hydrogen

  11. Effect of dilution and L-malic acid addition on bio-hydrogen production with Rhodopseudomonas palustris from effluent of an acidogenic anaerobic reactor

    Energy Technology Data Exchange (ETDEWEB)

    Azbar, N.; Tuba, F.; Dokgoz, C. [Bioengineering Dept., Faculty of Engineering, Ege Univ., Izmir (Turkey)], E-mail: nuri.azbar@ege.edu.tr

    2009-07-01

    In this study, H{sub 2} was produced in a two-stage biological process: I) first stage; the dark fermentation of cheese whey wastewater, which is rich in lactose, by mixed anaerobic culture grown at thermophilic temperature in a continuously running fermentor and ii) second stage; the photo-fermentation of the residual medium by R. palustris strain (DSM 127) at 31{sup o}C under illumination of 150 W in batch mode, respectively. In the first part of the study, the effluent from the dark fermentation reactor was used either as it is (no dilution) or after dilution with distilled water at varying ratios such as 1/2 , 1/5, 1/10 (1 volume effluent/5 volume distilled water) before used in photo-fermentation experiments. In the second part of the study, L-malic acid at varying amounts was added into the hydrogen production medium in order to have L-malic acid concentrations ranging from 0 to 4 g/l. Non-diluted and pre-diluted mediums with or without L-malic acid addition were also tested for comparison purpose (as controls). Prior to the hydrogen production experiments, all samples were subjected to pH adjustment, (pH 6.7) and sterilized by autoclave at 121{sup o}C for 15 min. In regards to the experiments in which the effect of dilution of the effluent from dark fermentation was studied, it was observed that dilution of the effluent from dark fermentation resulted in much better hydrogen productions. Among the dilution rates used, the experiments operated with 1/5 dilution ratio produced the best hydrogen production (241 ml H{sub 2}/ g COD{sub fed}). On the other hand, it was seen that the mixing the effluent with L-malic acid (0 - 4 g/l) at increasing ratios (studied from 0% L-malic acid up to 100% by volume in the mixture) had further positive effect and improved the hydrogen production. The bioreactors containing only L-malic acid media resulted in the best hydrogen production (438 ml H{sub 2} / g COD{sub fed}). It was found that, undiluted raw cheese whey wastewater

  12. Ecosystem carbon stocks in Pinus palustris forests

    Science.gov (United States)

    Lisa Samuelson; Tom Stokes; John R. Butnor; Kurt H. Johnsen; Carlos A. Gonzalez-Benecke; Pete Anderson; Jason Jackson; Lorenzo Ferrari; Tim A. Martin; Wendell P. Cropper

    2014-01-01

    Longleaf pine (Pinus palustris Mill.) restoration in the southeastern United States offers opportunities for carbon (C) sequestration. Ecosystem C stocks are not well understood in longleaf pine forests, which are typically of low density and maintained by prescribed fire. The objectives of this research were to develop allometric equations for...

  13. Moessbauer spectroscopy on the reaction center of Rhodopseudomonas viridis

    International Nuclear Information System (INIS)

    Frolov, E.; Goldanskii, V.I.; Birk, A.; Parak, F.; Fritzsch, G.; Sinning, I.; Michel, H.

    1992-01-01

    Proteins called 'reaction centers' (RC) can be isolated from many photosynthetic bacteria. They have one non-heme iron in a quinone acceptor region. The RC of Rhodopseudomonas viridis contains an additional tightly bound tetra-heme cytochrome c subunit. The electronic configuration of both cytochrome and the non-heme iron has been studied in the crystallized protein by Moessbauer spectroscopy at different redox potentials, pH-values, and with an addition of o-phenanthroline. At high potentials (E h =+500 mV) all heme irons are in the low spin Fe 3+ -state, and at low potential (E h = 1 50 mV) they are low spin Fe 2+ with the same Moessbauer parameters for all hemes independent of pH. Redox titrations change the relative area of the reduced and oxidized states in agreement with other methods. The non-heme iron shows a high spin Fe 2+ configuration independent of E h and pH with parameters comparable to those of Rhodopseudomonas sphaeroides. Surprisingly, there is strong evidence for another non-heme iron species in part of the molecules with a Fe 2+ low spin configuration. Incubation with o-phenanthroline decreases the relative Fe 2+ hs-area and increases the contribution of Fe 2+ ls-area. Above 210 K the mean square displacement, 2 >, of the RC-crystals increases more than linearly with temperature. This may be correlated with the increase of the electron transfer rate and indicates that intramolecular mobility influences the functional activity of a protein. (orig.)

  14. Eine Zeit der Stille

    OpenAIRE

    Leibfried, Peter

    2013-01-01

    Rechtzeitig zu Weihnachten hat das IASB am 18. Dezember 2012 die Ergebnisse seines Agenda-Consultation-Projekts vorgestellt. Für aufmerksame Beobachter waren die Resultate kaum überraschend: Angestrebt werden unter anderem eine "period of calm to let the dust settle" anstatt neuer Regelungen, eine stärker prinzipienorientierte Ausrichtung auf das Rahmenkonzept und eine frühzeitigere Abstimmung mit den Betroffenen mit Blick auf Kosten-Nutzen-Überlegungen. Das 40-seitige Dokument ist die erste ...

  15. Variability of Caltha palustris L. populations in garden culture

    Directory of Open Access Journals (Sweden)

    Krystyna Falińska

    2014-01-01

    Full Text Available On the basis of studies performed in the experimental garden the character of the variability of Caltha palustris L. populations is described. Individuals were bred under uniform conditions from diaspores of meadow, springwood, flood-plain forest and alder forest populations. The results obtained allow to evaluate the hypothesis concerning the ecological preference of cytotypes (S m i t 1967, 1968 and the somewhat different ecological requirements of two subspecies: C. palustris ssp. palustris and C. palustris ssp. cornuta. It was found that each population includes individuals with different cytotypes. The situation is similar as far as subspecies are concerned, distinguished on the basis of fruit morphology (Fig. 1. It should be stressed, however, that, investigations of many years duration raised serious doubts as to the diagnostic value of fruit morphology (Figs. 2, 3. On the basis of the preserved differences between the populations in shoot habitus, reproduction and phenology in garden culture, a springwood and an alder forest ecotype were distinguished. Meadow and flood-plain populations exhibited a transitional character with certain similarities both to the alder forest and to the springwood populations.

  16. Aberrante Epigynenbildungen bei der Wolfspinne Pardosa palustris (Araneae, Lycosidae

    Directory of Open Access Journals (Sweden)

    Martin, Dieter

    2013-11-01

    Full Text Available Two cases of aberrant epigyne shape in Pardosa palustris (Linnaeus, 1758 are described. Characteristic is the absence of the posterior lateral parts of the septum. Possible causes, such as `genital damage` during mating or the effects of parasite infestation, are discussed.

  17. Eine Homepage erstellen

    OpenAIRE

    Plieninger, Jürgen

    2005-01-01

    Wie man für eine kleine Bibliothek eine Homepage plant, konzipiert, gestaltet, erstellt, inhaltlich füllt, pflegt und evaluiert, wird hier in knappen Stichpunkten erläutert. This tutorial deals with how to plan, concept, create, fill with informations and services a homepage for a small library.

  18. Nietzsche ein Immanentist?

    Directory of Open Access Journals (Sweden)

    Andreas Urs Sommer

    2017-12-01

    Full Text Available Mein Artikel besteht aus drei Abschnitten: Der erste Teil beschäftigt sich mit Nietzsches Gebrauch des Begriffs der „Immanenz“; ich werde diesen Gebrauch nachzeichnen. Mein zweiter Punkt ist ein allgemeinerer: Ich möchte den Fokus auf die Frage legen, ob es für Nietzsche möglich ist, ein starkes Konzept von Immanenz zu vertreten, insbesondere wenn wir uns in Erinnerung rufen, dass Nietzsche eine deutliche Opposition zu allen Vorstellungen von Transzendenz formuliert. Soll hier irgendeine Art von Immanenz bewahrt werden? Der dritte Abschnitt beinhaltet eine eingehendere Untersuchung von zwei Passagen aus Jenseits von Gut und Böse (Abschnitte 2 und 6. Ich denke, dass sich in diesen Passagen wichtige Aspekte aufzeigen lassen, insbesondere mit Hinblick auf die Frage, ob Nietzsche irgendeine Art von Vorstellung oder ein Konzept der Immanenz vertritt.

  19. Fluorescence spectral fluctuations of single LH2 complexes from Rhodopseudomonas acidophila strain 10050

    NARCIS (Netherlands)

    Rutkauskas, D.; Novoderezkhin, V.; Cogdell, R.J.; van Grondelle, R.

    2004-01-01

    We have investigated the energy landscape of the bacterial photosynthetic peripheral light-harvesting complex LH2 of purple bacterium Rhodopseudomonas acidophila by monitoring sequences of fluorescence spectra of single LH2 assemblies, at room temperature, with different excitation intensities as

  20. Zeit ein Sachcomic

    CERN Document Server

    Callender, Craig

    2016-01-01

    Die Zeit ist ein großer Lehrmeister! Das Dumme ist nur, dass sie auf Dauer alle ihre Schüler tötet. (nach Hector Berlioz) „Solange mich niemand fragt, weiß ich, was Zeit ist“, hat der Heilige Augustus gesagt. Damit ist er fast modern, denn die Quantenphysiker behaupten sogar, „Zeit, das gibt es gar nicht!“ Je genauer man es wissen will, desto komplizierter wird das mit der Zeit: Ist die Zeit wirklich eine vierte Dimension, ähnlich wie ein Raum oder „fließt“ sie sozusagen nur dahin? Und wenn sie fließt, kann man dann sagen, wie schnell? Gibt es die Zukunft? Sind Zeitreisen möglich? Und warum scheint die Zeit sich nur in eine Richtung zu bewegen. Schwierige Probleme: aber hier, wie immer in dieser Reihe, seriös, leicht und locker erklärt.

  1. ?-Oryzanols of North American Wild Rice (Zizania palustris)

    OpenAIRE

    Aladedunye, Felix; Przybylski, Roman; Rudzinska, Magdalena; Klensporf-Pawlik, Dorota

    2013-01-01

    ?-Oryzanol, a natural mixture of ferulic acid esters of triterpene alcohols and sterols, are an important bioactive components present in rice bran oil. In light of the recent increase in the popularity of wild rice among consumers, and the possibility of a direct relationship between ?-oryzanol composition and its bioactivity, the oryzanol profile of major wild rice (Zizania palustris) grown in North America was studied and compared to regular brown rice (Oryza sativa L.). A total of twenty-...

  2. A new marsh plant community of Eleocharito palustris-Alismatetum lanceolati (Eleocharito palustris-Sagittarion sagittifoliae alliance in Slovakia

    Directory of Open Access Journals (Sweden)

    Richard Hrivnák

    2015-10-01

    Full Text Available Open and species-poor stands with a dominance of Alisma lanceolatum were recorded in periodically flooded habitats of the southern part of central Slovakia (Ipeľ River catchment area during the summer of 2013. Phytosociological relevés correspond to the association Eleocharito palustris-Alismatetum lanceolati (alliance Eleocharito palustris-Sagittarion sagittifoliae, which is reported and documented here for the first time from the territory of Slovakia. It inhabits predominantly temporarily flooded depressions on agricultural land – wet arable fields and extensively used pastures. Detrended correspondence analysis showed that the variability in species composition was most significantly influenced by water depth, the presence of arable fields in the contact area and water conductivity. Special attention was paid to a detailed description of the floristic composition, habitat requirements, distribution patterns and nomenclature of the community.

  3. Louisiana’s Palustris Experimental Forest: 75 years of research that transformed the South

    Science.gov (United States)

    James P. Barnett; James D. Haywood; Henry A. Pearson

    2011-01-01

    The Palustris Experimental Forest, located on Kisatchie National Forest, has been in existence for 75 years. Research at Palustris has focused on southern pine reforestation technology, including seed production, bareroot nursery production, direct seeding, and planting container seedlings. After establishing pine plantations, researchers developed stand management...

  4. Prostatitis - eine endlose Geschichte?

    Directory of Open Access Journals (Sweden)

    Riedl CR

    2001-01-01

    Full Text Available Aktuelle epidemiologische Daten aus den USA zeigen, daß der urogenitale Symptomenkomplex, der langläufig als "Prostatitis" bezeichnet wird, ein nicht unbeträchtliches volksgesundheitliches und volkswirtschaftliches Problem darstellt: dieses Krankheitsbild ist jährlich für 2 Millionen Arztbesuche und für 8% aller urologischen Konsulationen in den USA verantwortlich. Umgekehrt sieht jeder Urologe im Jahr zwischen 150 und 250 Patienten mit "Prostatitis".

  5. Isoprenoid hydrocarbons produced by thermal alteration of Nostoc muscorum and Rhodopseudomonas spheroides

    Science.gov (United States)

    Philp, R. P.; Brown, S.; Calvin, M.

    1978-01-01

    The potential of algae and photosynthetic bacteria to serve as precursors of kerogen was studied to determine what factors affect the relative rates of formation of precursor hydrocarbons. Cells of Nostoc muscorum and Rhodopseudomonas spheroides were subjected to thermal alteration (by heating samples in glass tubes sealed under nitrogen) for two, four, and twelve weeks. Both unextracted and extracted cells in the absence and presence of montmorillonite were investigated, and the isoprenoid hydrocarbons produced in these experiments were determined. Phytane and five isomeric phytenes were the main hydrocarbons observed; their relative rates of formation in the different experimental conditions are described. No phytadienes, pristane, or pristenes were detected.

  6. Marketing : eine fallstudienbasierte Einführung

    NARCIS (Netherlands)

    Griese, K.M.; Bröring, S.

    2011-01-01

    Studenten sowie Praktiker erhalten eine praxisorientierte Einführung in die zentralen Grundlagen des Marketing. Ausgangspunkt jedes Kapitels ist eine Fallstudie, die eine konkrete praktische Rahmenbedingung eines Unternehmens vorstellt. Diese Situation wird in den Ausführungen dann mit den

  7. Entwicklung eines kontinuierlichen Verfahrens zur enzymkatalysierten Synthese eines strukturierten Triglycerides

    OpenAIRE

    Stadler, Hans-Gerhard

    2005-01-01

    Ausgangspunkt für die in der vorliegenden Arbeit durchgeführten Entwicklung eines kontinuierlichen Verfahrens zur Synthese des strukturierten Triglycerides 1,3-Oleyl-2-palmitoylglycerin war die von Schmid [Schmid 1999] entwickelte lipase-katalysierte Zwei-Schritt-Synthese für strukturierte Triglyceride vom Typ ABA [European Patent Application; EP 0 882 797 A2]. In der ersten Reaktionsstufe dieser zweistufigen Umesterung wird in einer Folgereaktion das Substrat Tripalmitin mit Hilfe ein...

  8. Quantentheorie ein Sachcomic

    CERN Document Server

    McEvoy, J P

    2016-01-01

    Man kommt auch durchs Leben, wenn man nichts über Quantentheorie weiß. Es geht ja auch nur um Kleinigkeiten (Elektronik, Kernspin, Atomwaffen und andere Winzigkeiten). Elementarteilchen können unsere Alltagslogik doch nicht aus der Bahn werfen?! Probieren Sie es aus, kommen Sie mit in Welten, wo nichts wirklich unmöglich ist – irgendwo. Wo etwas mit den Eigenschaften von Teilchen oder von Wellen beschrieben werden kann, wo es auch Viertelwahrheiten gibt. Und Schrödingers Katze ist auch dabei – oder nicht? Quantentheorie ist zugegeben nicht einfach zu verstehen, aber sie ist ein faszinierendes intellektuelles Abenteuer. Dieser Sachcomic begleitet Ihre Entdeckungsreise auch visuell. Schwieriges wird hier mit Geduld, Witz und vor allen Dingen verständlich erklärt.

  9. Speicherbibliotheken: eine Nachlese

    Directory of Open Access Journals (Sweden)

    Andreas Ledl

    2015-01-01

    Full Text Available Der Beitrag nähert sich dem Thema Speicherbibliothek aus systematischer Perspektive. Ausgehend von einer Begriffsanalyse arbeitet er fünf verschiedene Typen von Speicherbibliotheken heraus und diskutiert deren Vor- und Nachteile. Am Beispiel der in der Planungsphase stecken gebliebenen Hessischen Speicherbibliothek werden Faktoren aufgezeigt, die den Erfolg oder Misserfolg eines solchen Projektes ausmachen können. Schliesslich geben die Autoren Empfehlungen ab, wie ein Interessenausgleich zwischen den verschiedenen Stakeholdern einer Speicherbibliothek hergestellt und so die Akzeptanz solcher Einrichtungen erhöht werden kann. The following article provides a systematic approach to storage libraries. Starting from an analysis of the terminology, the authors define five types of storage systems and discuss their advantages and disadvantages. Taking the example of the planning phase of the Hessian storage library, the authors elaborate on factors which decide upon success and failure of a project on this scale. To conclude, they propose how diverging interests of different stakeholders can be evened out and how the acceptance of storage facilities can be raised. Cet article offre une approche systématique de la thématique des bibliothèques dépôts. Partant d’une analyse du terme lui-même, cinq types différents de bibliothèques dépôts sont identifiés et comparés. L’exemple de la bibliothèque dépôt du Land de Hesse, dont la réalisation a été suspendue en cours de planification, permet d’identifier les facteurs déterminant le succès ou l’échec de ce genre de projet. Les auteurs formulent des recommandations permettant de trouver un équilibre entre les intérêts des différentes parties prenantes et de développer ainsi le soutien à un projet de bibliothèque dépôt.

  10. Mortalidade em florestas de Pinus palustris causada por tempestade de raios

    Science.gov (United States)

    Kenneth W. Outcalt; Jorge Paladino Corrêa de Lima; Jose Américo de Mello Filho

    2002-01-01

    The importance of lightning as an ignition source for the fire driven Pinus palustris ecosystem is widely recognized. Lightning also impacts this system on a smaller scale by causing individual tree mortality. The objective of this study was to determine the level of mortality due to lightning activity at the Department of Energy's Savannah...

  11. Population Genetic Structure of Cochliobolus miyabeanus on Cultivated Wild Rice (Zizania palustris L.) in Minnesota

    Science.gov (United States)

    Cochliobolus miyabeanus (Bipolaris oryzae) is the causal agent of fungal brown spot (FBS) in wild rice (Zizania palustris L.), an aquatic grass, endemic in Minnesota, Wisconsin, and parts of Canada. Grain yield losses can reach up to 74% when the disease starts at the boot stage and continues until ...

  12. Forest floor depth mediates understory vigor in xeric Pinus palustris ecosystems

    Science.gov (United States)

    J. Kevin Hiers; Joseph J. O' Brien; Rodney E. Will; Robert J. Mitchell

    2007-01-01

    Longleaf pine (Pinus palustris) woodlands and savannas are among the most frequently burned ecosystems in the world with fire return intervals of 1–10 years. This fire regime has maintained high levels of biodiversity in terms of both species richness and endemism. Land use changes have reduced the area of this ecosystem by .95%, and inadequate fire...

  13. Assessing longleaf pine (Pinus palustris) restoration after southern pine beetle kill using a compact experimental design

    Science.gov (United States)

    J.-P. Berrill; C.M. Dagley

    2010-01-01

    A compact experimental design and analysis is presented of longleaf pine (Pinus palustris) survival and growth in a restoration project in the Piedmont region of Georgia, USA. Longleaf pine seedlings were planted after salvage logging and broadcast burning in areas of catastrophic southern pine beetle (Dendroctonus frontalis) attacks on even-aged mixed pine-hardwood...

  14. Nursery response of container Pinus palustris seedlings to nitrogen supply and subsequent effects on outplanting performance

    Science.gov (United States)

    D. Paul Jackson; R. Kasten Dumroese; James P. Barnett

    2012-01-01

    Container longleaf pine (Pinus palustris) seedlings often survive and grow better after outplanting than bareroot seedlings. Because of this, most longleaf pine are now produced in containers. Little is known about nursery fertilization effects on the quality of container longleaf pine seedlings and how that influences outplanting performance. We compared various...

  15. Assembly and structural organization of pigment-protein complexes in membranes of Rhodopseudomonas sphaeroides

    International Nuclear Information System (INIS)

    Hunter, C.N.; Pennoyer, J.D.; Niederman, R.A.

    1982-01-01

    The B875 and B800-850 light-harvesting pigment-protein complexes of Rhodopseudomonas sphaeroides are characterized further by lithium dodecyl sulfate/polyacrylamide gel electrophoresis at 4 degrees C. Bacteriochlorophyll a was shown in reconstruction studies to remain complexed with its respective binding proteins during this procedure. From distributions in these gels, a quantitative description for the arrangement of the complexes is proposed. Assembly of the complexes was examined in delta-aminolevulinate-requiring mutant H-5 after a shift from high- to low-light intensity. After 10 h of delta-[ 3 H]aminolevulinate labeling, the specific radioactivity of bacteriochlorophyll in a fraction containing putative membrane invaginations reached the maximal level, while that of the mature photosynthetic membrane was at only one-third this level. This suggests that membrane invaginations are sites of preferential bacteriochlorophyll synthesis in which completed pigment-proteins exist transiently. Analysis of the 3 H distribution after electrophoretic separation further suggests that photosynthetic membranes grow mainly by addition of B800-850 to preformed membrane consisting largely of B875 and photochemical reaction centers. These results corroborate the above model for the structural organization of the light-harvesting system and indicate that the structurally and functionally discrete B800-850 pool is not completely assembled until all B875 sites for B800-850 interactions are occupied

  16. Ferrochelatase from Rhodopseudomonas sphaeroides: substrate specificity and role of sulfhydryl and arginyl residues

    International Nuclear Information System (INIS)

    Dailey, H.A.; Fleming, J.E.; Harbin, B.M.

    1986-01-01

    Purified ferrochelatase from the bacterium Rhodopseudomonas sphaeroides was examined to determine the roles of cationic and sulfhydryl residues in substrate binding. Reaction of the enzyme sulfhydryl residues with N-ethylmaleimide or monobromobimane resulted in a rapid loss of enzyme activity. Ferrous iron, but not porphyrin substrate, had a protective effect against inactivation by these two reagents. Quantitation with 3 H-labeled N-ethylmaleimide revealed that inactivation required one to two sulfhydryl groups to be modified. Modification of arginyl residues with either 2,3-butanedione or camphorquinone 10-sulfonate resulted in a loss of ferrochelatase activity. A kinetic analysis of the modified enzyme showed that the K/sub m/ for ferrous iron was not altered but that the K/sub m/ for the prophyrin substrate was increased. These data suggested that arginyl residues may be involved in porphyrin binding, possibly via charge pair interactions between the arginyl residue and the anionic porphyrin propionate side chain. Modification of lysyl residues had no effect on enzyme activity. The authors also examined the ability of bacterial ferrochelatase to use various 2,4-disubstituted porphyrins as substrates. The authors found that 2,4-bis-acetal- and 2,4-disulfonate deuteroporphyrins were effective substrates for the purified bacterial enzyme and that N-methylprotoporphyrin was an effective inhibitor of the enzyme. Data for the ferrochelatase of R. sphaeroides are compared with previously published data for the eucaryotic enzyme

  17. Cholinesterase inhibitory activity and chemical constituents of Stenochlaena palustris fronds at two different stages of maturity

    Directory of Open Access Journals (Sweden)

    Nelson Jeng-Yeou Chear

    2016-04-01

    Full Text Available Stenochlaena palustris fronds are popular as a vegetable in Southeast Asia. The objectives of this study were to evaluate the anticholinesterase properties and phytochemical profiles of the young and mature fronds of this plant. Both types of fronds were found to have selective inhibitory effect against butyrylcholinesterase compared with acetylcholinesterase. However, different sets of compounds were responsible for their activity. In young fronds, an antibutyrylcholinesterase effect was observed in the hexane extract, which was comprised of a variety of aliphatic hydrocarbons, fatty acids, and phytosterols. In the mature fronds, inhibitory activity was observed in the methanol extract, which contained a series of kaempferol glycosides. Our results provided novel information concerning the ability of S. palustris to inhibit cholinesterase and its phytochemical profile. Further research to investigate the potential use of this plant against Alzheimer's disease is warranted, however, young and mature fronds should be distinguished due to their phytochemical differences.

  18. Theraplay - eine direktive kommunikative Spieltherapie

    OpenAIRE

    Franke, Ulrike

    1990-01-01

    Anhand der Kasuistik eines entwicklungsverzögerten, kontaktverweigernden siebenjährigen Zwillingsmädchens wird die neue, aus den USA stammende, Kurz-Spieltherapie Theraplay vorgestellt. Die auf der natürlichen Eltern-Kind Interaktion basierende direktive Therapie versucht sowohl das Selbstbild als auch das Fremdbild des Kindes zu beeinflussen, indem sie sich nur auf das Positive konzentriert und Situationen herbeiführt, in denen das frühere Verhalten nicht mehr praktiziert werden kann.

  19. Ein Kredit für Weihnachtsbaumkugeln

    Science.gov (United States)

    Tutsch, Sina

    Eine Mathematikerin aus dem DFG-Forschungszentrum Matheon arbeitet an Methoden zur dreidimensionalen Visualisierung. Sie hat die Geschäftsidee, Weihnachtsbaumkugeln mit bewegten Hologrammen herzustellen, die sich individuell gestalten lassen, und plant eine Existenzgründung. Aus einem öffentlichen Förderprogramm erhält sie ein günstiges Darlehen in Höhe von 50 000 Euro. Für die Startphase ihres Unternehmens benötigt sie jedoch den vierfachen Betrag.

  20. Verfahren zur genbasierten Diagnose eines Legasthenierisikos

    OpenAIRE

    Wilcke, Arndt; Ahnert, Peter; Kirsten, Holger; Ligges, Carolin; Boltze, Johannes

    2016-01-01

    Die vorliegende Erfindung betrifft ein Verfahren zur Diagnose eines Legasthenierisikos, umfassend die Schritte: a) Bereitstellung einer Nukleinsäure beinhaltenden Probe von einem zu diagnostizierenden Menschen, b) Bestimmung des Genotyps der Nukleinsäure der Probe für mindestens eine chromosomale Region, ausgewählt aus der Gruppe bestehend aus der Region von Nukleotid 12091000 bis 12200000 des Chromosoms 1, der Region von Nukleotid 89066000 bis 89088000 des Chromosoms 15, der Region von Nukle...

  1. Molar extinction coefficients and other properties of an improved reaction center preparation from Rhodopseudomonas viridis

    Energy Technology Data Exchange (ETDEWEB)

    Clayton, R.K.; Clayton, B.J.

    1978-01-01

    Reaction centers have been purified from chromatophores of Rhodopseudomonas viridis by treatment with lauryl dimethyl amine oxide followed by hydroxyapatite chromatography and precipitation with ammonium sulfate. The absorption spectrum at low temperature shows bands at 531 and 543 nm, assigned to two molecules of bacteriopheophytin b. The 600 nm band of bacteriochlorophyll b is resolved at low temperature into components at 601 and 606.5 nm. At room temperature the light-induced difference spectrum shows a negative band centered at 615 nm, where the absorption spectrum shows only a week shoulder adjacent to the 600 nm band. The fluorescence spectrum shows a band at 1000 nm and no fluorescence corresponding to the 830 nm absorption band. Two molecules of cytochrome 558 and three of cytochrome 552 accompany each reaction center. The differential extinction coefficient (reduced minus oxidized) of cytochrome 558 nm was estimated as 20 +- 2 mM/sup -1/.cm/sup -1/ through a coupled reaction with equine cytochrome c. The extinction coefficient of reaction centers at 960 nm was determined to be 123 +- 25 mM/sup -1/.cm/sup -1/ by measuring the light-induced bleaching of P-960 and the coupled oxidation of cytochrome 558. The corresponding extinction coefficient at 830 nm is 300 +- 65 mM/sup -1/.cm/sup -1/. The absorbance ratio ..cap alpha../sub 280nm/..cap alpha../sub 830nm/ in our preparations was 2.1, and there was 190 kg protein per mol of reaction centers. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis showed three major components of apparent molecular weights 31,000, 37,000, and 41,000.

  2. The usage of sulfide and thiosulfate ions by purple non-sulfur bacteria Rhodopseudomonas yavorovii

    Directory of Open Access Journals (Sweden)

    O. V. Tarabas

    2017-07-01

    Full Text Available This article covers the patterns of oxidation of sulfide and thiosulfate ions by bacteria Rhodopseudomonas yavorovii Ya-2016 under different cultivation conditions. In the environments with 1.4–5.6 мМ Na2S2O3, R. yavorovii Ya-2016 bacteria accumulated biomass of 1.4–1.6 g/l, which was higher than biomass (1.2-0.6 g/l accumulated by the bacteria with the same concentrations of Na2S × 9H2O. The efficiency of oxidation of 1.4, 2.8, 5.6 мМ sulfide- and thiosulfate-ions as donors of electrons by the bacteria equaled 97.4, 42.6, 18.7 and 68.8, 28.0, 3.7%, respectively. As a result of bacterial oxidation of 1.4 мМ hydrogen sulfide and sodium thiosulphate in the environment accumulation of 0.13–1.30 мМ sulfate-ions occurs, and the element sulfur becomes an intermediate metabolite in the environment with Na2S×9H2O. R. yavorovii Ya-2016 bacteria are capable of using sulfate-ions as a single source of sulfate at increase in photptrophs. In the environment with 2.5 мМ sulfate-ions concentration the bacteria biomass was 1.4 g/l, the bacteria assimilated 17.7% of sulfates. Because purple non-sulfur bacteria R. yavorovii Ya-2016 are capable of using sulfide-ions as donors of electrons of anoxygenic photosynthesis and using sulfate-ions as a single source of sulfate, they could be successfully used in the technologies of remediating the environment from compounds of sulfur.

  3. The role of oxalic acid in tolerance to N’N-napthaloylhydroxylamine in Tyromyces palustris

    Science.gov (United States)

    R.A. Arango; C.A. Clausen; Frederick Green

    2006-01-01

    Certain wood decay fungi exhibit tolerance to one or more wood preservatives. Copper tolerance of brown-rot fungi has been studied in our laboratory for the past six years. We have observed some degree of tolerance to N’N-naphthaloylhydroxamine (NHA), a recently patented termite bait, by the brown-rot fungus Tyromyces palustris TYP-6137. In an effort to try and confirm...

  4. Development of antioxidative effect in ice cream with Kalakai (Stenochlaena palustris) water extract

    Science.gov (United States)

    Hadhiwaluyo, Kristania; Rahmawati, Della; Gunawan Puteri, Maria D. P. T.

    2017-11-01

    Kalakai (Stenochlaena. palustris) extract was used to develop the ice cream. The antioxidant activity of the extracts and its stability over process and storage were evaluated through various antioxidant assay including DPPH assay, Folin-Ciocalteau assay and aluminum chloride colorimetric method. In general, the leaves of S. palustris had a significantly higher antioxidant activity (p ice cream without affecting the sensory properties of the ice cream. In addition, the high phenolic and flavonoid content also suggest the more compounds that were capable to act as an antioxidant. The result of the stability test also suggested the ability low temperature storage and processing in maintaining the stability of the antioxidant activity of the extract (p > 0.05) over processing and storage. Thus, this strengthen the feasibility of S. palustris to be used as a potential functional food ingredient that is low cost and easily accessible with an antioxidant activity and safe iron content that is beneficial to increase the quality of food produced including in ice cream.

  5. Gestaltung und Erforschung eines Mixed Reality Lernsystems.

    NARCIS (Netherlands)

    Hochberg, Jana; Vogel, Cathrin; Bastiaens, Theo

    2018-01-01

    In diesem Artikel wird ein Entwurf eines Lernsystems vorgestellt, in welchem Mixed- Reality (MR) Technologien und didaktischen Modelle für den Einsatz in der industriellen Weiterbildung kombiniert werden. Mit diesem System soll das Erlernen von Problemlösekompetenzen über visuelle Einblendung

  6. Ueber eine Anomalie von Acromitus flagellatus (Stiasny)

    NARCIS (Netherlands)

    Stiasny, G.

    1934-01-01

    Bei erneuter Durchsicht des reichhaltigen Materiales von Acromitus flagellatus (Stiasny) in der Scyphomedusen-Sammlung des Rijksmuseum van Natuurlijke Historie in Leiden (vergl. meine Mitteilungen daruber, 1920, Uebersichtstabelle III und 1921, p. 131/136) fand ich ein Exemplar, das eine

  7. Evidence for a Very Early Intermediate in Bacterial Photosynthesis. A Photon-Echo and Hole-Burning Study of the Primary Donor Band in Rhodopseudomonas Sphaeroides

    NARCIS (Netherlands)

    Meech, S.R.; Hoff, A.J.

    1985-01-01

    Two coherent spectroscopic methods, accumulated photon echo and population bottleneck hole-burning, have been employed in a study of the decay rate of the primary donor (P) of Rhodopseudomonas sphaeroides at 1.5 K. The decay rate is instrument-limited in the photon-echo experiment, implying a

  8. Phosphoenolpyruvate-Dependent Fructose Phosphotransferase System of Rhodopseudomonas sphaeroides : Purification and Physicochemical and Immunochemical Characterization of a Membrane-Associated Enzyme I

    NARCIS (Netherlands)

    Brouwer, Marius; Elferink, Marieke G.L.; Robillard, George T.

    1982-01-01

    The phosphotransferase system (PTS) of the phototrophic bacterium Rhodopseudomonas sphaeroides consists of a component located in the cytoplasmic membrane and a membrane-associated enzyme called “soluble factor” (SF). SF has been partially purified by a combination of hydrophobic interaction and

  9. Muscle senescence in short-lived wild mammals, the soricine shrews Blarina brevicauda and Sorex palustris.

    Science.gov (United States)

    Hindle, Allyson G; Lawler, John M; Campbell, Kevin L; Horning, Markus

    2009-06-01

    Red-toothed (soricine) shrews are consummate predators exhibiting the highest energy turnovers and shortest life spans (ca. 18 months) of any mammal, yet virtually nothing is known regarding their physiological aging. We assessed the emerging pattern of skeletal muscle senescence (contractile/connective tissue components) in sympatric species, the semi-aquatic water shrew (WS), Sorex palustris, and the terrestrial short-tailed shrew (STS), Blarina brevicauda, to determine if muscle aging occurs in wild, short-lived mammals (H(0): shrews do not survive to an age where senescence occurs), and if so, whether these alterations are species-specific. Gracilis muscles were collected from first-year (n=17) and second-year (n=17) field-caught shrews. Consistent with typical mammalian aging, collagen content (% area) increased with age in both species (S. palustris: approximately 50%; B. brevicauda: approximately 60%). Muscle was dominated by stiffer Type I collagen, and the ratio of collagen Type I:Type III more than doubled with age. The area ratio of muscle:collagen decreased with age in both species, but was considerably lower in adult STS, suggesting species-specificity of senescence. Extracellular space was age-elevated in B. brevicauda, but was preserved in S. palustris ( approximately 50 vs. 10% elevation). Though juvenile interspecific comparisons revealed no significance, adult WS myocytes had 68% larger cross-sectional area and occurred at 28% lower fibers/area than those of adult STS. We demonstrate that age-related muscle senescence does occur in wild-caught, short-lived mammals, and we therefore reject this classic aging theory tenet. Our findings moreover illustrate that differential age adjustments in contractile/connective tissue components of muscle occur in the two species of wild-caught shrews. (c) 2009 Wiley-Liss, Inc.

  10. Muscle Senescence in Short-Lived Wild Mammals, the Soricine Shrews Blarina brevicauda and Sorex palustris

    Science.gov (United States)

    HINDLE, ALLYSON G.; LAWLER, JOHN M.; CAMPBELL, KEVIN L.; HORNING, MARKUS

    2015-01-01

    Red-toothed (soricine) shrews are consummate predators exhibiting the highest energy turnovers and shortest life spans (ca. 18 months) of any mammal, yet virtually nothing is known regarding their physiological aging. We assessed the emerging pattern of skeletal muscle senescence (contractile/connective tissue components) in sympatric species, the semi-aquatic water shrew (WS), Sorex palustris, and the terrestrial short-tailed shrew (STS), Blarina brevicauda, to determine if muscle aging occurs in wild, short-lived mammals (H0: shrews do not survive to an age where senescence occurs), and if so, whether these alterations are species-specific. Gracilis muscles were collected from first-year (n = 17) and second-year (n = 17) field-caught shrews. Consistent with typical mammalian aging, collagen content (% area) increased with age in both species (S. palustris: ~50%; B. brevicauda: ~60%). Muscle was dominated by stiffer Type I collagen, and the ratio of collagen Type I:Type III more than doubled with age. The area ratio of muscle:collagen decreased with age in both species, but was considerably lower in adult STS, suggesting species-specificity of senescence. Extracellular space was age-elevated in B. brevicauda, but was preserved in S. palustris (~50 vs. 10% elevation). Though juvenile interspecific comparisons revealed no significance, adult WS myocytes had 68% larger cross-sectional area and occurred at 28% lower fibers/area than those of adult STS. We demonstrate that age-related muscle senescence does occur in wild-caught, short-lived mammals, and we therefore reject this classic aging theory tenet. Our findings moreover illustrate that differential age adjustments in contractile/connective tissue components of muscle occur in the two species of wild-caught shrews. PMID:19296507

  11. Endemic Marsh Mongoose Herpestes palustris (Carnivora: Herpestidae of East Kolkata Wetlands, India: a status report

    Directory of Open Access Journals (Sweden)

    J.K. Mallick

    2009-04-01

    Full Text Available Marsh Mongoose Herpestes palustris is the only extant endemic mammal of the East Kolkata wetlands, which has been declared a RAMSAR site in 2002. Since its first description by the scientists of the Zoological Survey of India, the population of this species has dwindled to an alarming state due to reclamation of the Salt Lake City and Rajarhat expansion, as well as from other anthropogenic causes. Recently, during a field survey only a small population of this endangered mongoose was found in a single location. Immediate conservation measures are required to be taken by the concerned authorities to stop its probable extinction in the near future.

  12. The potential of Thelypteris palustris and Asparagus sprengeri in phytoremediation of arsenic contamination.

    Science.gov (United States)

    Anderson, LaShunda L; Walsh, Maud; Roy, Amitava; Bianchetti, Christopher M; Merchan, Gregory

    2011-02-01

    The potential of two plants, Thelypteris palustris (marsh fern) and Asparagus sprengeri (asparagus fern), for phytoremediation of arsenic contamination was evaluated. The plants were chosen for this study because of the discovery of the arsenic hyperaccumulating fern, Pteris vittata (Ma et al., 2001) and previous research indicating asparagus fern's ability to tolerate > 1200 ppm soil arsenic. Objectives were (1) to assess if selected plants are arsenic hyperaccumulators; and (2) to assess changes in the species of arsenic upon accumulation in selected plants. Greenhouse hydroponic experiments arsenic treatment levels were established by adding potassium arsenate to solution. All plants were placed into the hydroponic experiments while still potted in their growth media. Marsh fern and Asparagus fern can both accumulate arsenic. Marsh fern bioaccumulation factors (> 10) are in the range of known hyperaccumulator, Pteris vittata Therefore, Thelypteris palustris is may be a good candidate for remediation of arsenic soil contamination levels of arsenic. Total oxidation of As (III) to As (V) does not occur in asparagus fern. The asparagus fern is arsenic tolerant (bioaccumulation factors phytoremediation candidate.

  13. Entwurf, Herstellung und Charakterisierung eines mikromechanischen Quecksilbersensors

    OpenAIRE

    Schambach, Kwan

    2003-01-01

    In dieser Arbeit wird ein neuartiger Quecksilbersensor vorgestellt, mit dem die Quecksilberkonzentration in der Umgebungsluft gemessen werden kann. Das Meßverfahren dieses Sensors basiert auf der Adsorption von elementarem Quecksilberdampf auf dünnen Goldschichten. Bei der Begasung der Goldschicht mit Quecksilberdampf bildet sich an der Goldoberfläche Goldamalgam. Dieser Vorgang hat eine Widerstandsänderung der Goldschicht zur Folge. Der Sensor ist in Silizium-Mikromechanik aufgebaut. Neu an ...

  14. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Query: 350 RNEMTARRIVTADHTILVSGSGYVPKGDLTVDGKDNPEAVSSAMQLVRSALLCNDAQLRP 409 ... RNEMTARRIVTADHT...ILVSGSGYVPKGDLTVDGKDNPEAVSSAMQLVRSALLCNDAQLRP Sbjct: 1 ... RNEMTARRIVTADHTILVSGSGYVPKGDL... ... cation-transporting P-type ATPase [Rhodopseudomonas ... palustris CGA009] ... Length = 203 ...

  15. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Rhodopseudomonas palustris CGA009] ... Length = 102 ... Query: 14 ... ...MRDGEFLVSKTTAKGVITYINEPFIRMSGFTEQELVGQAHNIIRHPDMPPEAFADFWNTL 73 ... + DG ++VSKT ... KG +TY NE F++ SGF+EQ

  16. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Rhodopseudomonas palustris CGA009] ... Length = 150 ... Query: 1 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSD...RHFRRSGMDYLDQVSIVRHD 60 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSD...RHFRRSGMDYLDQVSIVRHD Sbjct: 1 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSDRHFRRSGMDYLDQVSIVRHD 60 ... Qu

  17. Ethylene regulates fast apoplastic acidification and expansin A transcription during submergence-induced petiole elongation in Rumex palustris

    NARCIS (Netherlands)

    Vreeburg, RAM; Benschop, JJ; Peeters, AJM; Colmer, TD; Ammerlaan, AHM; Staal, M; Elzenga, TM; Staals, RHJ; Darley, CP; McQueen-Mason, SJ; Voesenek, LACJ

    The semi-aquatic dicot Rumex palustris responds to complete submergence by enhanced elongation of young petioles. This elongation of petiole cells brings leaf blades above the water surface, thus reinstating gas exchange with the atmosphere and increasing survival in flood-prone environments. We

  18. Modeling silviculture after natural disturbance to sustain biodiversity in the longleaf pine (Pinus palustris) ecosystem : balancing complexity and implementation

    Science.gov (United States)

    Brian J. Palik; Robert J. Mitchell; J. Kevin Hiers

    2002-01-01

    Modeling silviculture after natural disturbance to maintain biodiversity is a popular concept, yet its application remains elusive. We discuss difficulties inherent to this idea, and suggest approaches to facilitate implementation, using longleaf pine (Pinus palustris) as an example. Natural disturbance regimes are spatially and temporally variable. Variability...

  19. Influence of residual basal area on longleaf pine (Pinus palustris Mill.) first year germination and establishment under selection silviculture

    Science.gov (United States)

    Ferhat Kara; Edward F. Loewenstein

    2015-01-01

    Even-aged silvicultural methods have been successfully used to manage longleaf pine (Pinus palustris Mill.) forests for wood production; however, successful use of uneven-aged methods to manage this ecosystem is less well documented. In this study, the effects of varying levels of residual basal area (RBA) (9.2, 13.8, and 18.4 m2...

  20. Phytodesalinization potential of Typha angustifolia, Juncus maritimus, and Eleocharis palustris for removal of de-icing salts from runoff water.

    Science.gov (United States)

    Guesdon, Gaëlle; de Santiago-Martín, Ana; Galvez-Cloutier, Rosa

    2016-10-01

    Typha angustifolia, Juncus maritimus, and Eleocharis palustris were evaluated for de-icing salt removal from runoff water. Plants were exposed to a range of de-icing salt levels (0.2, 0.7, 4, 8, and 13 dS m(-1)) in laboratory-scale subsurface constructed wetlands (CWs) for 2 months under greenhouse conditions. Effluent characteristics, plant height, biomass, and Cl and Na removal rates and uptake were monitored. More water volume was retained in CWs of T. angustifolia (∼60 %) than of J. maritimus and E. palustris (∼37.5 %), which accounted for the electrical conductivity increase in effluents (1.3-1.9-fold). Based on the NaCl removal rate, T. angustifolia showed the greatest phytodesalinization ability (31-60 %) with the highest removal at the lowest salt levels (0.2-0.7 dS m(-1)), followed by J. maritimus (22-36 %) without differences in removal among levels, and E. palustris (3-26 %) presenting a removal rate highly decreased with increasing salt levels. Plant height and biomass were stimulated at low de-icing salt levels, but, at higher levels, T. angustifolia and E. palustris growth was inhibited (tolerance index ∼67 and 10 %, respectively, in the worst cases). Salt amounts in aboveground biomass in g m(-2) differed among levels and ranged as follows: 13.6-29.1 (Cl), 4.2-9.3 (Na; T. angustifolia); 7.0-12.0 (Cl), 2.7-6.4 (Na; J. maritimus); and 0.9-7.6 (Cl), 0.3-1.6 (Na; E. palustris). Chloride and Na translocation decreased with de-icing salt increase in T. angustifolia, while no significant differences were found in J. maritimus, which is interesting for harvesting purposes.

  1. Experiments on accumulation of phosphorus in the plants Myosotis palustris, Glyceria maxima and Nasturtium officinale

    Directory of Open Access Journals (Sweden)

    O. Prokopchuk

    2016-10-01

    Full Text Available The problem of availability of quality water is highly relevant today, so the technologies of prediction and prevention of water pollution and purification are very important. Biological methods of cleaning, in paticular cleaning water by the so-called method of biosorption, have been increasingly used in the last decade. This method means the removal of dangerous substances and improvement of water condition by using aquatic organisms, in particular plants. Therefore, in view of the rich experience of research conducted in the biosorption sphere, we decided to predict the effectiveness of this method by using the cumulative ability of higher water plants to absorb phosphorus compounds. For this purpose, we selected water and plant samples (Glyceria maxima (C. Hartm. Holmb., Nasturtium officinale R. Br., Myosotis palustris (L. L. from the river Seret (Ternopil, Ukraine. The plants were placed into sterilized glass jars filled with 3 liters of water from the river Seret (control samples and still tap water with addition of sodium phosphate with phosphorus concentration of 3.5 mg/dm³ (research sample, which were cultured in laboratory conditions for four months. We determined the content of phosphates, permanganate and dichromate oxidation in the water and the total content of phosphorus in the plants. We traced the dynamic of organic substances and the content of phosphates in the water, the accumulation of phosphorus in plants and the rate of accumulation of phosphorus in the plants and in the water. We calculated correlation coefficients to detect the dependence between phosphorus indicators in the aquatic plants and the concentration of phosphate ions in the water. We found that M. palustris had the greatest capacity to accumulate phosphorus and the highest rate of phosphorus accumulation from water, which allows us to consider it the most effective aquatic plant for absorption of elements and decreasing water pollution. We also established

  2. Strategische Beschaffung: Grundlagen, Planung und Umsetzung eines integrierten Supply Management

    NARCIS (Netherlands)

    van Weele, A.J.; Eßig, M.

    2017-01-01

    Dieses Buch bietet – erstmalig in deutscher Übersetzung – eine umfassende und sehr anschauliche Darstellung zu Grundlagen, Planung und Umsetzung einer modernen Beschaffungsfunktion. Beschaffung und Supply Management werden dabei als wesentliches Bindeglied innerhalb des Managementsystems eines

  3. Current status of Marsh Crocodiles Crocodylus palustris (Reptilia: Crocodylidae in Vishwamitri River, Vadodara City, Gujarat, India

    Directory of Open Access Journals (Sweden)

    R. Vyas

    2012-11-01

    Full Text Available Data presented here is based on a three year study (2008-2010 on a population of Mugger Crocodylus palustris inhabiting Vishwamitri River near Vadodara City, Gujarat State, India. In total, 155 Muggers were counted in the 25km river stretch during 2010. In all, 40 burrows were observed along the river bank, and the same were clumped in certain sections of the river. Muggers fed eight species of birds, and domestic livestock in addition to scavenging. Eight instances of human-crocodile conflicts were observed including four human causalities. A total 90 Muggers were rescued from the urban areas and the same were relocated elsewhere in the river system. Various types of threats to Mugger were also noticed including habitat loss, alteration and soil erosion and mortality due to rail traffic. The present study suggests further research to propose strategies to conserve this population.

  4. Grand Prix Eurovision: Eine Fankultur im Medienzeitalter

    Directory of Open Access Journals (Sweden)

    Heinz Moser

    2017-06-01

    Full Text Available Der Grand Prix Eurovision ist seit Jahrzehnten eine der bekanntesten Unterhaltungssendungen im europäischen Raum. Dennoch erregte es Verwunderung, wenn der Schreibende Bekannten darüber berichtete, daß dies ein Forschungsgegenstand sei. Wurde von Interviews mit Grand Prix-Fans erzählt, so fielen schnell Aussagen wie: „Wie kann man sich nur für so etwas Abseitiges und Triviales wie den Grand Prix interessieren“. Dennoch bin ich der Meinung, daß Fankulturen für die entstehende Mediengesellschaft ein nicht unwichtiges Forschungsthema darstellen. Zwar geht es nicht um eine medienpädagogische Fragestellung im engeren Sinne; die Fans des Grand Prix Eurovision sind dem Jugendalter längst entwachsen. Dennoch handelt es sich bei Fangemeinschaften um Phänomene, die im Rahmen von Jugend- und Kinderkulturen von besonderer Relevanz sind. So meint Winter (1997, daß jugendliche Fanwelten eine bedeutende Rolle als Kristallisationspunkte kultureller Differenzierung spielen: ,Die Zugehörigkeit zu einer Fan weit ist Teil der jugendlichen Lebensbewältigung in der Postmoderne, denn in der Gemeinschaft der Fans können Jugendliche emotionale Allianzen eingehen, außeralltäglichen Beschäftigungen nachgehen, expressive Identitätsmuster gemeinschaftlich realisieren und sich mit ihrer Lebenssituation als Heranwachsende auseinandersetzen“ (Winter 1997, S. 51f..

  5. Differences in mycorrhizal communities between Epipactis palustris, E. helleborine and its presumed sister species E. neerlandica.

    Science.gov (United States)

    Jacquemyn, Hans; Waud, Michael; Lievens, Bart; Brys, Rein

    2016-07-01

    In orchid species that have populations occurring in strongly contrasting habitats, mycorrhizal divergence and other habitat-specific adaptations may lead to the formation of reproductively isolated taxa and ultimately to species formation. However, little is known about the mycorrhizal communities associated with recently diverged sister taxa that occupy different habitats. In this study, 454 amplicon pyrosequencing was used to investigate mycorrhizal communities associating with Epipactis helleborine in its typical forest habitat and with its presumed sister species E. neerlandica that almost exclusively occurs in coastal dune habitats. Samples of the phylogenetically more distant E. palustris, which co-occurred with E. neerlandica, were also included to investigate the role of habitat-specific conditions on mycorrhizal communities. A total of 105 operational taxonomic units (OTUs) of putative orchid mycorrhizal fungi were observed in the three studied species. The majority of these fungi were endophytic fungi of Helotiales and ectomycorrhizal fungi belonging to Thelephoraceae, Sebacinaceae and Inocybaceae. In addition, a large number of other ectomycorrhizal taxa were detected, including Cortinarius, Cenococcum, Tuber, Geopora, Wilcoxina, Meliniomyces, Hebeloma, Tricholoma, Russula and Peziza Mycorrhizal communities differed significantly between the three species, but differences were most pronounced between the forest species (E. helleborine) and the two dune slack species (E. neerlandica and E. palustris). The results clearly showed that recently diverged orchid species that occupy different habitats were characterized by significantly different mycorrhizal communities and call for more detailed experiments that aim at elucidating the contribution of habitat-specific adaptations in general and mycorrhizal divergence in particular to the process of speciation in orchids. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany

  6. Hin zu Utopia - eine empirische Spekulation

    Directory of Open Access Journals (Sweden)

    Wolfgang Frindte

    2017-04-01

    Full Text Available Hin zu Utopia - eine empirische Spekulation (von Wolfgang Frindte & Nico Dietrich Der vorliegende Text nutzt Befunde, die die Autoren im Rahmen einer Studie zu Einstellungen gegenüber Muslimen und dem Islam erhoben haben (Frindte/Dietrich 2017, um über die Möglichkeit einer kosmopolitischen Utopie zu spekulieren und nach den Akteuren der Zukunft und den künftigen Gestaltern eines friedlichen und menschenfreundlichen europäischen Kontinents zu fahnden. Im Ergebnis ihrer Suche kommen die Autoren zu dem Schluss: Es gibt noch immer gebildete und politisch informierte Menschen, die eine positive Sicht auf ethnische Minderheiten, Flüchtlinge im Allgemeinen und Muslime im Besonderen haben, autoritäre und machtorientierte Gesellschaftsstrukturen ablehnen und sich mit Europa identifizieren. Auf ihren persönlichen Einsatz, ihre Entschlossenheit, ihren Zusammenhalt über die Zeit und ihre Zukunftsorientierung kommt es an.

  7. Was macht erfolgreiche Bibliothekspolitik aus? Ein Seminarbericht

    Directory of Open Access Journals (Sweden)

    Rudolf Mumenthaler

    2015-04-01

    Full Text Available Im Rahmen eines Seminars an der HTW Chur wurden Möglichkeiten und Grenzen von Bibliothekspolitik in der Schweiz erläutert. Ausgehend von wenigen Fällen, bei denen es zu Protesten oder anderen Aktivitäten gekommen ist, wurden Akteurinnen und Akteure und ihr Einfluss untersucht, mögliche politische Instrumente analysiert und diskutiert, wie sich Bibliotheken aktiv beteiligen können. Im Ergebnis stellte sich heraus, dass Netzwerke in die Gesellschaft und die Politik von grosser Bedeutung sind. Im Falle eines Konflikts (Budgetkürzung, geplante Schliessung etc. kann sich dieses Netzwerk mit Hilfe der geeigneten politischen Instrumente für die Bibliothek einsetzen. Die Mobilisierung der Bevölkerung, die in den untersuchten Fällen klar auf der Seite der Bibliotheksanliegen war, ist dabei ein entscheidender Erfolgsfaktor.

  8. R-prime site-directed transposon Tn7 mutagenesis of the photosynthetic apparatus in Rhodopseudomonas capsulata

    Energy Technology Data Exchange (ETDEWEB)

    Youvan, D C [Univ. of California, Berkeley; Elder, J T; Sandlin, D E; Zsebo, K; Alder, D P; Panopoulos, N J; Marrs, B L; Hearst, J E

    1982-01-01

    Site-directed mutagenesis of the photosynthetic apparatus (PSA) genes in Rhodopseudomonas capsulata is presented utilizing a transposon Tn7 mutagenized R-prime. The R-prime, pRPS404, bears most of the genes necessary for the differentiation of the photosynthetic apparatus. Mutagenesis of the R-prime with Tn7 in Escherichia coli, conjugation into R. capsulata, and homologous recombination with the wild-type alleles efficiently generates photosynthetic apparatus lesions. Wild-type alleles are lost spontaneously and the Tn7-induced lesions are revealed by subsequent intramolecular recombination between IS21 insertion elements that bracket the prime sequences in direct repeat. The molecular nature of the intermediates involved in the transposition, recombination and deletion have been investigated by Southern hybridization analysis. The spontaneous loss of wild-type alleles after homologous recombination with the chromosome may be of general use to other prokaryotic site-directed transposon mutagenesis schemes. The IS21-mediated deletion of the prime DNA is dependent on the RecA protein in E. coli, generating the parental R-factor bearing one IS21 element. A genetic-physical map exists for a portion of the prime photosynthetic apparatus DNA. When Tn7 is inserted into a bacteriochlorophyll gene in the R-prime and then crossed into R. capsulata, mutants are produced that accumulate a bacteriochlorophyll precursor, which is in excellent agreement with the existing genetic-physical map. This corroborates the mutagenesis scheme.

  9. Traffic-emitted metal status and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in roadside turfy swamp in the Changbai Mountain area, China.

    Science.gov (United States)

    Wang, Hong; Nie, Lei; Xu, Yan; Li, Miao; Lv, Yan

    2018-04-26

    Six traffic-emitted metals (Cr, Zn, Cu, Cd, Pb, and Ni) were determined in soil and plants for below- and aboveground parts along different distances from highway to evaluate their behavior and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in turfy swamps. The results indicated that the different plant tissues showed significantly different levels of metal content. Nonlinear regression analysis indicated that metal contents leveled off at constant values before they decreased as the distance from the roadside increased. The high R 2 values of the regression model indicated good fit of the exponential function applied to depict the distribution pattern of the metal elements. It was deduced that Cr, Cu, and Cd in Thelypteris palustris var. pubescens Fernald were mainly derived from the soil; Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald absorbed Pb mainly through the stomata from atmospheric depositions; Cr, Cu, and Cd in Carex meyeriana Kunth and Zn in Thelypteris palustris var. pubescens Fernald were mainly affected by soil and atmospheric depositions. After excluding the effects of traffic, only the bioaccumulation factor of Cd (1.34) in Carex meyeriana Kunth and the translocation factor of Zn (1.13) in Thelypteris palustris var. pubescens Fernald were greater than 1, suggesting that Carex meyeriana Kunth could be a good candidate for assimilating Cd from soils and Thelypteris palustris var. pubescens Fernald could be suitable for the phytoextraction of Zn.

  10. Theoretische Grundlagen qualitativer Marktforschung – ein Überblick und eine integrative Perspektive

    OpenAIRE

    Frank, Dirk; Riedl, Peter

    2004-01-01

    Die ökonomische Bedeutung qualitativer Forschung nahm in den vergangenen Jahrzehnten kontinuierlich zu. Als eine der Hauptströmungen in der "Forschungsindustrie" stellt sie nicht nur ein wertvolles Erhebungs- und Analyseinstrumentarium zur Generierung grundlegender Einsichten in das Erleben und Verhalten von Verbrauchern dar, sondern bildet zugleich einen essentiellen Teil der jährlich generierten Umsätze von Forschungsinstituten. Hieraus folgt, dass es für die Anbieter qualitativer Forschung...

  11. Die drei Vorführungen eines geheimen Dokumentarfilms. Eine kritische Revision von Theresienstadt

    Directory of Open Access Journals (Sweden)

    Natascha Drubek

    2017-04-01

    Full Text Available Dieser Artikel liefert auf der Grundlage einer gründlichen Lektüre von tschechischen, deutschen und französischen Quellen eine neue Perspektive auf das Filmmaterial, das im Ghetto von Theresienstadt gedreht wurde und unter den Titeln Ghetto Theresienstadt, Theresienstadt 1942 und Theresienstadt. Ein Dokumentarfilm aus dem jüdischen Siedlungsgebiet bzw. auch als Der Führer schenkt den Juden eine Stadt bekannt ist.  In einer Revision des allgemeinen Konsensus der letzten zwei Jahrzehnte argumentiert der Artikel, dass die verschiedenen Filmaufnahmen zwischen 1942 und 1945 ein zusammenhängendes Filmprojekt bilden. Die Autorin schlägt Korrekturen der filmographischen Daten vor, wie etwa die Einbindung des letzten „Jewish Elder“ des Ghettos, Benjamin Murmelstein, als Ko-Autor des Scripts. Eine Rekonstruktion des Datums, des Zeitpunkts und des Orts der ersten offiziellen Vorführung des Films für Delegierte des Komitees des Internationalen Roten Kreuzes wird durch eine komparative Untersuchung von verschiedenen Quellen und auf Textanalyse basierenden Ausschlussverfahren möglich. Bisherige Auffassungen des beabsichtigten Effekts und der Zielgruppe des Films revidierend, lenkt der Artikel die Aufmerksamkeit auf den Fakt, dass der Film vom Reichssicherheitshauptamt (RSHA 1942 initiiert und zum Kriegsende drei sorgfältig ausgewählten Gruppen vorgeführt wurde. Eine Untersuchung des Publikums der Premiere am 6. April 1945 lässt eine Neubewertung der Frage zu, ob der Film als Propagandafilm eingestuft werden kann oder eher als Strategem des deutschen Geheimdienstes.

  12. Entwicklung von Cysteinproteaseinhibitoren - ein klassischer und ein kombinatorischer Ansatz zur Inhibitoroptimierung

    OpenAIRE

    Machon, Uwe Rainer

    2009-01-01

    Ziel der Dissertation „Entwicklung von Cysteinproteaseinhibitoren – ein klassischer und ein kombinatorischer Ansatz zur Inhibitoroptimierung“ war die Optimierung von neuen Inhibitoren von Falcipain-2 und Rhodesain als neue potentielle Wirkstoffe gegen Malaria bzw. die Schlafkrankheit über zwei verschiedene Methoden. Es handelt sich hierbei um einen klassischen und einen kombinatorischen Ansatz. Der klassische Ansatz basiert auf einer Struktur, deren Aktivität per Zufall entdeckt wurde. In Scr...

  13. Correlation between oxalic acid production and tolerance of Tyromyces palustris strain TYP-6137 to N',N-naphthaloylhydroxamine

    Science.gov (United States)

    Rachel A. Arango; Patricia K. Lebow; Frederick III Green

    2009-01-01

    Eleven strains of T. palustris were evaluated for mass loss and production of phosphate buffer soluble oxalic acid on pine wood blocks treated with 0.5% N’,N-naphthaloylhydroxamine (NHA) in a soil-block test. After 12 weeks higher percentage mass loss was observed in control groups for 10 strains, while TYP-6137 was shown to be tolerant with no difference between the...

  14. Eine neue Tornaria aus der Adria

    NARCIS (Netherlands)

    Stiasny, G.

    1928-01-01

    In einer kurzen Mitteilung über adriatische Tornarien habe ich (4) vor Jahren beiläufig erwähnt, dass im Plankton des Triester Golfes ausser den relativ grossen Tornarien des Balanoglossus clavigerus noch eine zweite kleine Larvenform vorkommt. Diese kleine Tornaria, über welche ich seinerzeit keine

  15. Toxicity of sulfide to early life stages of wild rice (Zizania palustris).

    Science.gov (United States)

    Fort, Douglas J; Todhunter, Kevin; Fort, Troy D; Mathis, Michael B; Walker, Rachel; Hansel, Mike; Hall, Scott; Richards, Robin; Anderson, Kurt

    2017-08-01

    The sensitivity of wild rice (Zizania palustris) to sulfide is not well understood. Because sulfate in surface waters is reduced to sulfide by anaerobic bacteria in sediments and historical information indicated that 10 mg/L sulfate in Minnesota (USA) surface water reduced Z. palustris abundance, the Minnesota Pollution Control Agency established 10 mg/L sulfate as a water quality criterion in 1973. A 21-d daily-renewal hydroponic study was conducted to evaluate sulfide toxicity to wild rice and the potential mitigation of sulfide toxicity by iron (Fe). The hydroponic design used hypoxic test media for seed and root exposure and aerobic headspace for the vegetative portion of the plant. Test concentrations were 0.3, 1.6, 3.1, 7.8, and 12.5 mg/L sulfide in test media with 0.8, 2.8, and 10.8 mg/L total Fe used to evaluate the impact of iron on sulfide toxicity. Visual assessments (i.e., no plants harvested) of seed activation, mesocotyl emergence, seedling survival, and phytoxicity were conducted 10 d after dark-phase exposure. Each treatment was also evaluated for time to 30% emergence (ET30), total plant biomass, root and shoot lengths, and signs of phytotoxicity at study conclusion (21 d). The results indicate that exposure of developing wild rice to sulfide at ≥3.1 mg sulfide/L in the presence of 0.8 mg/L Fe reduced mesocotyl emergence. Sulfide toxicity was mitigated by the addition of Fe at 2.8 mg/L and 10.8 mg/L relative to the control value of 0.8 mg Fe/L, demonstrating the importance of iron in mitigating sulfide toxicity to wild rice. Ultimately, determination of site-specific sulfate criteria taking into account factors that alter toxicity, including sediment Fe and organic carbon, are necessary. Environ Toxicol Chem 2017;36:2217-2226. © 2017 SETAC. © 2017 SETAC.

  16. Hydrogen gas production by fermentation from various organic wastewater using Clostridium butyricum NCIB 9576 and Rhodopseudomonas sphaeroides E15-1

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Young Sue; Kim, Hyun Kyung; Rye, Hye Yeon; Lee, In Gu; Kim, Mi Sun [Biomass Research Team, Korea Institute of Energy Research, Taejeon (Korea)

    2000-03-01

    Anaerobic fermentation using Clostidium butyricum NCIB 9576, and phto-fermentation using Rhodopseudomonas sphaeroides E15-1 were studied for the production of hydrogen from Makkoli, fruits (orange and apple, watermelon and melon) and Tofu wastewaters. From the Makkoli wastewater, which contained 0.94 g/liter sugars and 2.74 g/liter solubel starch, approximately 49 mM H{sub 2}/liter wastewater was produced during the initial 18h of the anaerobic fermentation with pH control between 6.5-7.0. Several organic acids such as butyric acid, acetic acid, propionic acid, lactic acid and ethanol were also produced. From watermelon and melon wastewater, which contained 43 g/liter sugars, generated about approximately 71 mM H{sub 2}/liter wastewater was produced during the initial 24h of the anaerobic fermentation. Tofu wastewater, pH 6.5, containing 12.6 g/liter soluble starch and 0.74 g/liter sugars, generated about 30mM H{sub 2}/liter wastewater, along with some organic acids, during the initial 24 h of anaerobic fermentation. Makkoli and Tofu wastewaters as substrates for the photo-fermentation by Rhodopseudomonas sphaeroides E15-1 produced approximately 37.9 and 22.2 {mu}M H{sub 2}/ml wastewaters, respectively for 9 days of incubation under the average of 9,000010,000 lux illumination at the surface of reactor using tungsten halogen lamps. Orange and apple wastewater, which contained 93.4 g/l produced approximately 13.1 {mu}M H{sub 2}/ml wastewater only for 2 days of photo-fermentation and the growth of Rhodopseudomonas spnaeroides E15-1 and hydrogen production were stopped. 22 refs, 4 figs., 2 tabs.

  17. Synchrotron small-angle x-ray scattering investigation on integral membrane protein light-harvesting complex LH2 from photosynthetic bacterium rhodopseudomonas acidophila

    International Nuclear Information System (INIS)

    Du Luchao; Weng Yuxiang; Hong Xinguo; Xian Dingchang; Kobayashi Katsumi

    2006-01-01

    Structures of membrane protein in solution are different from that in crystal phase. We present the primary results of small angle x-ray scattering (SAXS) resolved topological structures of a light harvesting antenna membrane protein complex LH2 from photosynthetic bacteria Rhodopseudomonas acidophila in detergent solution for the first time. Our results show that the elliptical shape of the LH2 complex in solution clearly deviates from its circular structure in crystal phase determined by x-ray diffraction. This result provides an insight into the structure and function interplay in LH2. (authors)

  18. Alter(n – ein vielschichtiger Begriff

    Directory of Open Access Journals (Sweden)

    Nicole Maly-Lukas

    2005-07-01

    Full Text Available Diese Veröffentlichung, die aus einer Vortragsreihe an der katholischen Fachhochschule Freiburg entstanden ist, führt die Leserinnen und Leser in die verschiedenen Sichtweisen des Alter(ns in der modernen Gesellschaft ein. Es handelt sich um eine gelungene Zusammenstellung von Beiträgen aus unterschiedlichen Disziplinen, die sich alle aus ihrer Sicht dem Thema Alter(n widmen. Die einzelnen Artikel sind zwischen 8 und 38 Seiten lang und recht schnell und einfach zu lesen. Je nach Hintergrund und Interessen werden die einzelnen Leserinnen und Leser dabei sicher unterschiedliche Beiträge favorisieren. Schade ist nur, dass durch die ungleichen Längen der Beiträge bestimmte thematische Schwerpunkte – ob gewollt oder nicht – gesetzt werden. Dies sollte die Leserinnen und Leser, die offen für unterschiedlichste Sichtweisen des Alter(ns sind, jedoch nicht davon abhalten, dieses Buch zu lesen.

  19. Aptitude of Lymnaea palustris and L. stagnalis to Fasciola hepatica larval development through the infection of several successive generations of 4-mm-high snails.

    Science.gov (United States)

    Vignoles, P; Rondelaud, D; Dreyfuss, G

    2016-06-01

    Bimiracidial infections of Lymnaea palustris and Lymnaea stagnalis (shell height at exposure, 4 mm) with Fasciola hepatica were carried out during six successive snail generations to determine if prevalence and intensity of snail infection increased over time through descendants issuing from eggs laid by parents already exposed to this digenean. Controls were constituted by a French population of Galba truncatula (a single generation) infected according to the same protocol. In a first experiment performed with the F1 to F5 generations of L. palustris, the prevalence and intensity of F. hepatica infection in snails progressively increased. Immature rediae and a few cercariae-containing rediae of the digenean were observed in L. stagnalis from the F3 generation, but no free cercaria was noted in the bodies of this lymnaeid from the F4 to F6 generations. In another experiment carried out with the F6 generation of L. palustris, the prevalence of F. hepatica infection and the number of shed cercariae were significantly lower in L. palustris than in G. truncatula. This mode of snail infection suggests an explanation for cases of human fasciolosis occurring in central France after the collection of wild watercress from beds where L. palustris was the sole lymnaeid.

  20. Untersuchungen zum Potential eines Verbrennungsmotors mit Druckwellenlader

    OpenAIRE

    Binder, Emanuel

    2015-01-01

    Mithilfe der Abgasturboaufladung lässt sich der Kraftstoffverbrauch im Fahrzeugbetrieb durch das Anheben der spezifischen Motorleistung senken. Im Gegensatz zur mechanischen Aufladung verschlechtert sich jedoch mit der Abgasturbolaufladung das Ansprechverhalten. Eine Möglichkeit den Zielkonflikt von Kraftstoffverbrauch und Ansprechverhalten zu lösen ist es, den Abgasturbolader durch einen Druckwellenladers zu ersetzen. Dieser überträgt die Abgasenergie direkt auf die Frischluft in Form von Dr...

  1. Pasireotid: Eine neue Therapieoption bei Morbus Cushing

    Directory of Open Access Journals (Sweden)

    Luger A

    2012-01-01

    Full Text Available Im Behandlungsalgorithmus des Morbus Cushing war bisher keine zugelassene pharmakologische Behandlungsmöglichkeit verfügbar. Mit dem Multirezeptor-Somatostatinanalogon Pasireotid steht nun mit der im April 2012 erfolgten Zulassung die erste, spezifisch für die Therapie dieses Krankheitsbildes entwickelte Substanz zur Verfügung. Die Studienevidenz belegt eine schnelle und nachhaltige Reduktion der ACTH- und Kortisolproduktion mit klinischer Besserung bei einem Großteil der Patienten.

  2. OP-Planungssysteme: Eine empirische Studie

    OpenAIRE

    Kristof, R.

    2001-01-01

    Die Studie - erstellt auf Basis einer Befragung von Softwareunternehmen - gibt Auskunft über relevante Parameter der OP-Planung im Krankenhaus, erforderliche Funktionalitäten eines entsprechenden DV-gestützten Planungssystems und den softwareseitigen Status quo bezüglich dieser Punkte. Wobei die OP-Planung sich hier auf die Ablauforganisation von Operationen und ihre ressourcen- sowie terminbezogene Planung bezieht.

  3. Wohnquartiersbeschreibung: ein Instrument zur Regionalisierung von Nachbarschaften

    OpenAIRE

    Hoffmeyer-Zlotnik, Jürgen H. P.

    2001-01-01

    'Ausgehend von der Annahme, daß soziale Differenzierung sich in räumlicher Differenzierung niederschlägt, bietet eine Beschreibung der Struktur des näheren Wohnumfeldes die Möglichkeit, das Wohnquartier als Handlungsraum und Sozialisationsinstanz zur Interpretation von Umfragedaten zu nutzen. Das vorliegende Instrumentarium erlaubt es, das Wohnquartier unabhängig von Zensusdaten über Merkmale, die in der eigenen Umfrage erhoben werden, zu charakterisieren.' (Autorenreferat) 'The general hy...

  4. Wilhelm Wundts Nachlass. Eine Übersicht.

    OpenAIRE

    Fahrenberg, Jochen

    2016-01-01

    Wilhelm Wundts Publikationen bilden wahrscheinlich das umfangreichste, zweifellos aber das vielseitigste Werk eines Psychologen. Auch sein wissenschaftlicher Nachlass an Manuskripten, Exzerpten und Korrespondenz hat einen ungewöhnlichen Umfang. Während es an guten Digitalisaten seiner Publikationen noch mangelt, ist der allergrößte Teil des Wundt-Nachlasses seit Ende 2015 dokumentiert und digitalisiert (Meyer, 2015). Die Übersicht hat 12 Abschnitte: (1) Wundts Publikationen, Bibliographie...

  5. Relativitätstheorie ein Sachcomic

    CERN Document Server

    Bassett, Bruce

    2012-01-01

    E = mc² – so einfach ist eine Revolution! Nichts ist schneller als Licht! Wie lange noch? Was fangen wir mit einer vierten Dimension an und mit krummen Räumen? Einstein gilt als größter Physiker der Neuzeit, das amerikanische Magazin „Time“ machte ihn sogar zum Mann des Jahrhunderts. Einstein ist das Lieblingsgenie vieler Menschen: ein Radikaler im wissenschaftlichen Arbeiten und engagierter sozialistischer Pazifist. Es ist nun gut hundert Jahre her, seit Einsteins Relativitätstheorie unseren Blick auf Raum, Zeit und Materie revolutionierte. Einsteins Gedankenexperimente sind berüchtigt für ihre Komplexität, aber sie bieten fesselnde Beschreibungen der Grundlagen, auf denen die Welt funktioniert. Relativitätstheorie und Quantentheorie sind die zwei Hauptsäulen der modernen Physik. Dieser Sachcomic nimmt Sie mit auf eine unterhaltsame Bildungsreise durch Raum und Zeit vorbei an Schwarzen Löchern und quer durch Gravitationsfelder (Je schneller Sie lesen, desto jünger werden Sie!!). Sie werden ...

  6. Linear-dichroism measurements on the LH2 antenna complex of Rhodopseudomonas Acidophila strain 10050 show that the transition dipole moment of the Carotenoid Rhodopin Glucoside us nit collinair with the long molecular axis

    NARCIS (Netherlands)

    Georgakopoulou, S.; Gogdell, R.J.; Grondelle, van R.; Amerongen, van H.

    2003-01-01

    We have applied linear-dichroism experiments to determine the orientation of the transition dipole moment, corresponding to the main absorption band of the carotenoid, rhodopin glucoside, in the light-harvesting complex LH2 from Rhodopseudomonas acidophila strain 10050. The crystal structure of this

  7. Gnotobiotic cultures of rice plants up to ear stage in the absence of combined nitrogen source but in the presence of free living nitrogen fixing bacteria Azotobacter vinelandii and Rhodopseudomonas capsulata

    International Nuclear Information System (INIS)

    Maudinas, B.; Chemardin, M.; Yovanovitch, E.; Gadal, P.

    1981-01-01

    An all glass tight growth chamber, entirely sterilizable, has been constructed to carry out axenic and gnotobiotic cultures of rice plants (Oryza sativa L.). When grown in liquid medium and in the absence of combined nitrogen but in the presence of the diazotrophs Azotobacter vinelandii and Rhodopseudomonas capsulata, rice plants exhibited a complete biological cycle from germination up to ear stage, during a period of time similiar to the one encountered in French paddy soil of Camargue. In one experiment, mannitol was given to rice culture medium together with Azotobacter vinelandii and Rhodopseudomonas capsulata. In another experiment, mannitol was not given together with Rhodopseudomonas, and still positive nitrogen gain was obtained, although it was less than culture with mannitol. When 15 N labeled cells of Rhodopseudomonas were added in rice culture medium, 15 N was partly transferred to rice plant. Among the nitrogen substances excreted from the bacteria in the rhizosphere medium, large organic molecules were shown to be the most abundant in our experimental conditions. Moreover, the concentration of free ammonia or aminoacids present in the rice rhizosphere were always compatible with a bacterial nitrogenase activity. (orig.)

  8. Hydraulic architecture and tracheid allometry in mature Pinus palustris and Pinus elliottii trees.

    Science.gov (United States)

    Gonzalez-Benecke, C A; Martin, T A; Peter, G F

    2010-03-01

    Pinus palustris Mill. (longleaf pine, LL) and Pinus elliottii Engelm. var. elliottii (slash pine, SL) frequently co-occur in lower coastal plain flatwoods of the USA, with LL typically inhabiting slightly higher and better-drained microsites than SL. The hydraulic architecture and tracheid dimensions of roots, trunk and branches of mature LL and SL trees were compared to understand their role in species microsite occupation. Root xylem had higher sapwood-specific hydraulic conductivity (k(s)) and was less resistant to cavitation compared with branches and trunk sapwood. Root k(s) of LL was significantly higher than SL, whereas branch and trunk k(s) did not differ between species. No differences in vulnerability to cavitation were observed in any of the organs between species. Across all organs, there was a significant but weak trade-off between water conduction efficiency and safety. Tracheid hydraulic diameter (D(h)) was strongly correlated with k(s) across all organs, explaining >73% of the variation in k(s). In contrast, tracheid length (L(t)) explained only 2.4% of the variability. Nevertheless, for trunk xylem, k(s) was 39.5% higher at 20 m compared with 1.8 m; this increase in k(s) was uncorrelated with D(h) and cell-wall thickness but was strongly correlated with the difference in L(t). Tracheid allometry markedly changed between sapwood of roots, trunks and branches, possibly reflecting different mechanical constraints. Even though vulnerability to cavitation was not different for sapwood of roots, branches or the trunks of LL and SL, higher sapwood to leaf area ratio and higher maximum sapwood-specific hydraulic conductivity in roots of LL are functional traits that may provide LL with a competitive advantage on drier soil microsites.

  9. Eine neue Tornaria aus dem Ostindischen Archipel (Tornaria Sunieri)

    NARCIS (Netherlands)

    Stiasny, G.

    1921-01-01

    Da aus dem malayischen Archipel durch die Siboga-Monographie Spengels (2) zwar eine Anzahl Enteropneusten, jedoch nur eine einzige Tornaria bekannt worden ist, war anzunehmen, dass noch andere Tornarien in diesem Gebiete nachzuweisen sein würden. Von dieser Erwartung ausgehend wandte ich mich an

  10. Pancreatitis. An update; Pankreatitis. Ein Update

    Energy Technology Data Exchange (ETDEWEB)

    Schreyer, A.G. [Universitaetsklinikum Regensburg, Institut fuer Roentgendiagnostik, Regensburg (Germany); Grenacher, L. [Diagnostik Muenchen, MVZ Radiologie, Muenchen (Germany); Juchems, M. [Klinikum Konstanz, Diagnostische und Interventionelle Radiologie, Konstanz (Germany)

    2016-04-15

    Acute and chronic pancreatitis are becoming increasingly more severe diseases in the western world with far-reaching consequences for the individual patient as well as the socioeconomic situation. This article gives an overview of the contribution of radiological imaging to the diagnostics and therapy of both forms of the disease. Acute pancreatitis can be subdivided into severe (20 %) and mild manifestations. The diagnostics should be performed with computed tomography (CT) or magnetic resonance imaging (MRI) for assessing necrosis or potential infections only in severe forms of pancreatitis. In chronic pancreatitis transabdominal ultrasound should initially be adequate for assessment of the pancreas. For the differential diagnosis between pancreatic carcinoma and chronic pancreatitis, MRI with magnetic resonance cholangiopancreatography (MRCP) followed by an endoscopic ultrasound-guided fine needle aspiration is the method of choice. For the primary diagnosis for acute and chronic pancreatitis ultrasound examination is the modality of first choice followed by radiological CT and MRI with MRCP examinations. (orig.) [German] Akute und chronische Pankreatitis sind in der westlichen Welt zunehmende schwere Krankheitsbilder mit tiefgreifenden Konsequenzen fuer den einzelnen Patienten sowie soziooekonomisch. Der Beitrag radiologischer Bildgebung zur Diagnostik und Therapie beider Erkrankungsformen soll im vorliegenden Uebersichtsbeitrag diskutiert werden. Die akute Pankreatitis kann in eine schwere (20 %) und milde Verlaufsform unterteilt werden. Lediglich bei den schweren Formen sollte eine CT- oder MRT-Diagnostik bzgl. der Beurteilung von Nekrosen und moeglichen Infektionen erfolgen. Bei der chronischen Pankreatitis genuegt zunaechst eine Beurteilung des Pankreas durch transabdominellen Ultraschall. Hier sind die MRT mit der Magnetresonanzcholangiopankreatikographie (MRCP) sowie die endosonographisch gesteuerte Feinnadelpunktion die Methode, um

  11. Entwicklungstrends bei landwirtschaftlichen Applikationen - ein Zwischenfazit

    Directory of Open Access Journals (Sweden)

    Christa Hoffmann

    2014-10-01

    Full Text Available Globalisierung, volatile Märkte und der vermehrte Rückzug der Agrarpolitik aus der Marktregulierung sorgen dafür, dass die Entscheidungsfindungsprozesse auf landwirtschaftlichen Betrieben an Komplexität zunehmen. Applikationen bieten durch ihre Mobilität und individuellen Ausgestaltungsmöglichkeiten Optionen, um den Landwirt bei seiner täglichen Arbeit zu unterstützen. In diesem Kontext nimmt diese Arbeit eine Bestandsaufnahme und Kategorisierung nativer Applikationen mit landwirtschaftlichem Bezug vor. Die Ergebnisse zeigen unter anderem einen Angebotsschwerpunkt im Produktionszweig Pflanzenbau und bei den Funktionen bestimmte häufig auftretende bedarfsbedingte Kombinationen (z. B. Planung und Analyse.

  12. Corporate Venture Capital im Bankensektor: Eine Fallstudie

    OpenAIRE

    Maxin, Hannes

    2015-01-01

    Die Digitalisierung der Gesellschaft beeinflusst zunehmend das klassische Bankgeschäft, was durch die Erfolge vieler junger FinTech-Unternehmen verdeutlicht wird. Der damit verbundene Innovationsdruck führte dazu, dass die Commerzbank AG im Oktober 2013 die Main Incubator GmbH gründete. Mithilfe dieser Corporate Venture Capital-Gesellschaft (CVC-Gesellschaft) versucht die Frankfurter Großbank, eine Kooperation mit den neuen Wettbewerbern einzugehen, um mögliche Synergiepotenziale für das eige...

  13. Ecosystem engineering potential of the gastropod Terebralia palustris (Linnaeus, 1767) in mangrove wastewater wetlands - A controlled mesocosm experiment

    Energy Technology Data Exchange (ETDEWEB)

    Penha-Lopes, Gil, E-mail: gil.penha-lopes@biology-research.co [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal); Department of Analytical and Environmental Chemistry, Vrije Universiteit Brussels, Brussels (Belgium); Bartolini, Fabrizio [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Limbu, Samwel [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Cannicci, Stefano [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Mgaya, Yunus [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Kristensen, Erik [Institute of Biology, University of Southern Denmark, DK-5230 Odense M (Denmark); Paula, Jose [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal)

    2010-01-15

    The effect of different sewage concentrations (0, 20, 60 and 100%), vegetation (Bare, Avicennia marina or Rhizophora mucronata) and immersion periods (immersion/emersion period of 12/12 h or 3/3 days just for 100%) conditions were studied for 6 months on survival and growth rates of Terebralia palustris (Linnaeus, 1767). Gastropods' activity and ecosystem engineering preformed at bare and A. marina planted cells and 3 sewage conditions (0, 20 and 60%) were determined. Survival rates were higher than 70% in all treatments. Growth rate decreased significantly with increasing sewage concentrations (mainly at unplanted conditions) and longer immersion periods. A complete shift (from immersion to emersion periods) and a significant decrease in mobility and consequently its engineer potential, due to sewage contamination, lead to a 3-4 fold decrease in the amount of sediment disturbed. Sewage contamination, primary producers' abundance and environmental conditions may have influenced the gastropods survival, growth and its ecosystem engineering potential. - Terebralia palustris high ecosystem engineering potential in constructed mangrove wetlands.

  14. Differential responses of the freshwater wetland species Juncus effusus L. and Caltha palustris L. to iron supply in sulfidic environments

    International Nuclear Information System (INIS)

    Welle, Marlies E.W. van der; Niggebrugge, Karla; Lamers, Leon P.M.; Roelofs, Jan G.M.

    2007-01-01

    Sulfur pollution can lead to serious problems in freshwater wetlands, including phosphorus eutrophication and sulfide toxicity. We tested the effects of anaerobic iron-rich groundwater discharge in fens, simulated by iron injection, on two characteristic species (Juncus effusus and Caltha palustris) in a sulfidic environment. Biomass production of C. palustris roots showed an optimum response to the combined addition of iron and sulfide, with highest values at intermediate concentrations of both substances. Iron deficiency apparently occurred at low iron concentrations, while at high iron concentrations, growth was decreased. For J. effusus, in contrast, no toxic effects were found of both iron and sulfide. This could be explained by larger radial oxygen loss (ROL) of J. effusus and could not be explained by differences in phosphorous concentrations. The results of our experiments confirm that iron-rich groundwater discharge has the potential to affect vegetation composition through toxicity modification in sulfidic environments. - Toxicity of iron and sulfide are interacting with each other and have the potential to affect vegetation composition

  15. Fluorescence-excitation and emission spectra from LH2 antenna complexes of Rhodopseudomonas acidophila as a function of the sample preparation conditions.

    Science.gov (United States)

    Kunz, Ralf; Timpmann, Kõu; Southall, June; Cogdell, Richard J; Köhler, Jürgen; Freiberg, Arvi

    2013-10-10

    The high sensitivity of optical spectra of pigment-protein complexes to temperature and pressure is well known. In the present study, we have demonstrated the significant influence of the environments commonly used in bulk and single-molecule spectroscopic studies at low temperatures on the LH2 photosynthetic antenna complex from Rhodopseudomonas acidophila. A transfer of this LH2 complex from a bulk-buffer solution into a spin-coated polymer film results in a 189 cm(-1) blue shift of the B850 excitonic absorption band at 5 K. Within the molecular exciton model, the origin of this shift could be disentangled into three parts, namely to an increase of the local site energies, a contraction of the exciton band, and a decrease of the displacement energy.

  16. Correlation of paramagnetic states and molecular structure in bacterial photosynthetic reaction centers: The symmetry of the primary electron donor in Rhodopseudomonas viridis and Rhodobacter sphaeroides R-26

    International Nuclear Information System (INIS)

    Norris, J.R.; Budil, D.E.; Gast, P.; Chang, C.H.; El-Kabbani, O.; Schiffer, M.

    1989-01-01

    The orientation of the principal axes of the primary electron donor triplet state measured in single crystals of photosynthetic reaction centers is compared to the x-ray structures of the bacteria Rhodobacter (Rb.) sphaeroides R-26 and Rhodopseudomonas (Rps.) viridis. The primary donor of Rps. viridis is significantly different from that of Rb. sphaeroides. The measured directions of the axes indicate that triplet excitation is almost completely localized on the L-subunit half of the dimer in Rps. viridis but is more symmetrically distributed on the dimeric donor in Rb. sphaeroides R-26. The large reduction of the zero field splitting parameters relative to monomeric bacteriochlorophyll triplet in vitro suggests significant participation of asymmetrical charge transfer electronic configurations in the special pair triplet state of both organisms

  17. Energiemessungen bei Aspergillus niger mit Hilfe eines automatischen Mikro-Kompensations-Calorimeters

    NARCIS (Netherlands)

    Algera, Leendert

    1932-01-01

    Beschrieben wurde ein Calorimeter. Das Prinzip der Warmemessung besteht darin, dasz die entwickelte Wärme, sobald sie entsteht, durch eine entsprechende Kältemenge kompensiert wird. Sobald die Temperatur des Kulturgefaszes ein wenig ansteigt, wird trockne Luft gepumpt durch ein mit Wasser gefulltes

  18. Eine Stanze positiv - Operieren wir zuviel?

    Directory of Open Access Journals (Sweden)

    Huber J

    2006-01-01

    Full Text Available Maßnahmen zur Früherkennung decken häufiger Karzinome auf, was bei vermeintlich klinisch nicht signifikanten Karzinomen zu "watchful waiting"- Strategien verleitet. Allerdings ist die Vorhersagbarkeit des Prostatakarzinomes hinsichtlich seines klinischen Verlaufes schwierig. Methodik und Technik: Das histologische Ergebnis nach radikaler Prostatektomie bei Patienten mit nur einer einzigen positiven Stanzbiopsie wurde von uns nachuntersucht. Die Biopsie erfolgte als Oktantenbiopsie nach den derzeit gültigen Schemata, radikal prostatektomiert wurde in auschließlich retropubischer aszendierender Form. Ergebnisse: Die Untersuchung der histologischen Ergebnisse zeigte in einem überraschend hohen Prozentsatz (58 % einen Karzinombefund in beiden Prostataseitenlappen (pT2c, in 12 % eine Organüberschreitung. Es fand sich in lediglich 18 % der Fälle ein kleines Karzinom in einem Seitenlappen (pT2a. Schlußfolgerung: Bei auch nur einer positiven Stanzbiopsie kann keine Vorhersage für das histologische Stadium nach Radikaloperation und damit den wahrscheinlichen klinischen Verlauf getroffen werden.

  19. Genome assembly of the fungus Cochliobolus miyabeanus, and transcriptome analysis during early stages of infection on American wild rice (Zizania palustris L.)

    Science.gov (United States)

    Cochliobolus miyabeanus causes a severe, yield-reducing leaf spot disease on rice (Oryza sativa) and two North American specialty crops, American wildrice (Zizania palustris) and switchgrass (Panicum virgatum). Despite the importance of the pathogen in wildrice, little is known about mechanisms of p...

  20. Long-term effects of fire and fire-return interval on population structure and growth of longleaf pine (Pinus palustris)

    Science.gov (United States)

    Chelcy R. Ford; Emily S. Minor; Gordon A. Fox

    2010-01-01

    We investigated the effect of fire and fire frequency on stand structure and longleaf pine (Pinus palustris P. Mill.) growth and population demography in an experimental research area in a southwest Florida sandhill community. Data were collected from replicated plots that had prescribed fire-return intervals of 1, 2, 5, or 7 years or were left...

  1. Effects of site preparation treatments on early growth and survival of planted longleaf pine (Pinus palustris Mill.) seedlings in North Carolina

    Science.gov (United States)

    Benjamin O. Knapp; G. Geoff Wang; Joan L. Walker; Susan Cohen

    2006-01-01

    We tested the effects of eight site preparation treatments on early growth and survival of container-grown longleaf pine (Pinus palustris Mill.) seedlings. Treatments included an untreated check, six combinations of two initial vegetation control treatments (chopping or herbicide) with three planting site conditions (flat [no additional treatment],...

  2. High-resolution bioactivity profiling combined with HPLC-HRMS-SPE-NMR: α-glucosidase inhibitors and acetylated ellagic acid rhamnosides from Myrcia palustris DC. (Myrtaceae)

    DEFF Research Database (Denmark)

    Wubshet, Sileshi Gizachew; Moresco, Henrique H.; Tahtah, Yousof

    2015-01-01

    , and therefore improved drug leads or functional foods containing α-glucosidase inhibitors are needed for management of blood glucose. In this study, leaves of Myrcia palustris were investigated by high-resolution α-glucosidase inhibition profiling combined with HPLC–HRMS–SPE–NMR. This led to identification...

  3. Purification, molecular cloning, and enzymatic properties of a family 12 endoglucanase (EG-II) from fomitopsis palustris: role of EG-II in larch holocellulose hydrolysis.

    Science.gov (United States)

    Shimokawa, Tomoko; Shibuya, Hajime; Nojiri, Masanobu; Yoshida, Shigeki; Ishihara, Mitsuro

    2008-09-01

    A family 12 endoglucanase with a molecular mass of 23,926 Da (EG-II) from the brown-rot basidiomycete Fomitopsis palustris was purified and characterized. One of the roles of EG-II in wood degradation is thought to be to loosen the polysaccharide network in cell walls by disentangling hemicelluloses that are associated with cellulose.

  4. Comparison of red-cockaded woodpecker (Picoides borealis) nestling diet in old-growth and old-field longleaf pine (Pinus palustris) habitats

    Science.gov (United States)

    James L. Hanula; R. Todd Engstrom

    2000-01-01

    Automatic cameras were used to record adult red-cockaded woodpecker (Picoides borealis) nest visits with food for nestlings. Diet of nestlings on or near an old-growth longleaf pine (Pinus palustris) remnant in southern Georgia was compared to that in longleaf pine stands established on old farm fields in western South Carolina....

  5. Nagelbefall kann bei Patienten mit Psoriasis auf eine Enthesiopathie hinweisen.

    Science.gov (United States)

    Castellanos-González, Maria; Joven, Beatriz Esther; Sánchez, Julio; Andrés-Esteban, Eva María; Vanaclocha-Sebastián, Francisco; Romero, Pablo Ortiz; Díaz, Raquel Rivera

    2016-11-01

    Obwohl subklinische Enthesiopathie ein gut etabliertes diagnostisches Merkmal der Psoriasisarthritis (PsA) ist, wird sie häufig übersehen, da viele Patienten asymptomatisch sind. Gäbe es klinische Hinweise auf das Vorliegen einer Enthesiopathie, würde dies den Klinikern die Möglichkeit eröffnen, eine PsA frühzeitig zu diagnostizieren. Es wurde eine monozentrische prospektive Studie mit insgesamt 90 Psoriasis-Patienten durchgeführt, um mittels Ultraschall das Vorliegen von Enthesenanomalien zu untersuchen und eine Korrelation mit dem Befall der Nägel festzustellen. Enthesenanomalien wurden bei 23 Patienten (25,5 %) gefunden, von denen 19 (82,6 %) Nagelbefall aufwiesen. Bei 4 Patienten waren die Nägel nicht betroffen. Enthesiopathie lag bei 31,1 % (19/61) der Patienten mit Onychopathie vor, von den Patienten ohne Nagelbefall litten nur 13,8 % (4/29) an Enthesiopathie (p = 0,07). Zwischen dem Target-NAPSI-Score und dem Vorliegen einer Enthesiopathie bestand eine signifikante Korrelation. Eine signifikante Korrelation bestand darüber hinaus auch zwischen dem Vorliegen einer Enthesiopathie und der Anzahl der betroffenen Nägel (p = 0,035). Klinische Belege für eine Onychopathie können der Schlüssel für die frühe Diagnose einer Enthesiopathie bei Psoriasis-Patienten sein. © 2016 Deutsche Dermatologische Gesellschaft (DDG). Published by John Wiley & Sons Ltd.

  6. Eine selbstkonsistente Carleman Linearisierung zur Analyse von Oszillatoren

    Directory of Open Access Journals (Sweden)

    H. Weber

    2017-09-01

    Full Text Available Die Analyse nichtlinearer dynamischer Schaltungen ist bis heute eine herausfordernde Aufgabe, da nur selten analytische Lösungen angegeben werden können. Daher wurden eine Vielzahl von Methoden entwickelt, um eine qualitative oder quantitative Näherung für die Lösungen der Netzwerkgleichung zu erhalten. Oftmals wird beispielsweise eine Kleinsignalanalyse mit Hilfe einer Taylorreihe in einem Arbeitspunkt durchgeführt, die nach den Gliedern erster Ordnung abgebrochen wird. Allerdings ist diese Linearisierung nur in der Nähe des stabilen Arbeitspunktes für hyperbolische Systeme gültig. Besonders für die Analyse des dynamischen Verhaltens von Oszillatoren treten jedoch nicht-hyperbolische Systeme auf, sodass diese Methode nicht angewendet werden kann Mathis(2000. Carleman hat gezeigt, dass nichtlineare Differentialgleichungen mit polynomiellen Nichtlinearitäten in ein unendliches System von linearen Differentialgleichungen transformiert werden können Carleman(1932. Wird das unendlichdimensionale Gleichungssystem für numerische Zwecke abgebrochen, kann bei Oszillatoren der Übergang in eine stationäre Schwingung (Grenzzyklus nicht wiedergegeben werden.In diesem Beitrag wird eine selbstkonsistente Carleman Linearisierung zur Untersuchung von Oszillatoren vorgestellt, die auch dann anwendbar ist, wenn die Nichtlinearitäten keinen Polynomen entsprechen. Anstelle einer linearen Näherung um einen Arbeitspunkt, erfolgt mit Hilfe der Carleman Linearisierung eine Approximation auf einem vorgegebenen Gebiet. Da es jedoch mit der selbstkonsistenten Technik nicht möglich ist, das stationäre Verhalten von Oszillatoren zu beschreiben, wird die Berechnung einer Poincaré-Abbildung durchgeführt. Mit dieser ist eine anschließende Analyse des Oszillators möglich.

  7. Eine selbstkonsistente Carleman Linearisierung zur Analyse von Oszillatoren

    Science.gov (United States)

    Weber, Harry; Mathis, Wolfgang

    2017-09-01

    Die Analyse nichtlinearer dynamischer Schaltungen ist bis heute eine herausfordernde Aufgabe, da nur selten analytische Lösungen angegeben werden können. Daher wurden eine Vielzahl von Methoden entwickelt, um eine qualitative oder quantitative Näherung für die Lösungen der Netzwerkgleichung zu erhalten. Oftmals wird beispielsweise eine Kleinsignalanalyse mit Hilfe einer Taylorreihe in einem Arbeitspunkt durchgeführt, die nach den Gliedern erster Ordnung abgebrochen wird. Allerdings ist diese Linearisierung nur in der Nähe des stabilen Arbeitspunktes für hyperbolische Systeme gültig. Besonders für die Analyse des dynamischen Verhaltens von Oszillatoren treten jedoch nicht-hyperbolische Systeme auf, sodass diese Methode nicht angewendet werden kann Mathis (2000). Carleman hat gezeigt, dass nichtlineare Differentialgleichungen mit polynomiellen Nichtlinearitäten in ein unendliches System von linearen Differentialgleichungen transformiert werden können Carleman (1932). Wird das unendlichdimensionale Gleichungssystem für numerische Zwecke abgebrochen, kann bei Oszillatoren der Übergang in eine stationäre Schwingung (Grenzzyklus) nicht wiedergegeben werden. In diesem Beitrag wird eine selbstkonsistente Carleman Linearisierung zur Untersuchung von Oszillatoren vorgestellt, die auch dann anwendbar ist, wenn die Nichtlinearitäten keinen Polynomen entsprechen. Anstelle einer linearen Näherung um einen Arbeitspunkt, erfolgt mit Hilfe der Carleman Linearisierung eine Approximation auf einem vorgegebenen Gebiet. Da es jedoch mit der selbstkonsistenten Technik nicht möglich ist, das stationäre Verhalten von Oszillatoren zu beschreiben, wird die Berechnung einer Poincaré-Abbildung durchgeführt. Mit dieser ist eine anschließende Analyse des Oszillators möglich.

  8. Eine Test- und Ansteuerschaltung für eine neuartige 3D Verbindungstechnologie

    Directory of Open Access Journals (Sweden)

    M. Bschorr

    2005-01-01

    Full Text Available In der vorliegenden Arbeit wird eine Built-In Self-Test Schaltung (BIST vorgestellt, welche die vertikalen Inter-Chip-Verbindungen in einer neuartigen 3D Schaltungstechnologie auf ihre Funktionalität zur Datenübertragung überprüft. Die 3D Technologie beruht auf der Stapelung mehrerer aktiver Silizium-CMOS-ICs, welche durch das Siliziumsubstrat hindurch vertikal miteinander elektrisch verbunden sind. Bei diesen Vias sind die zu erwartenden Defekte hochohmige Verbindungen und Kurzschlüsse. Die entwickelte Testschaltung ermöglicht es, beliebige Konstellationen von vertikalen Verbindungen auf Fehler zu untersuchen, und das Ergebnis entweder zur Analyse der 3D Technologie auszulesen oder innerhalb des Chipstapels zu verwenden, um defekte Vias zu umgehen. Die Schaltung wurde in einer 0,13μm Technologie entworfen und simuliert. Ein Testchip ist momentan in Produktion.

  9. "Wikia Search": eine neue Suchmaschine für Bibliotheken

    OpenAIRE

    Ball, Rafael

    2008-01-01

    Mit „ Wikia Search" ist seit 2008 eine (weitere) Suchmaschine auf den Markt gekommen. Die vorliegende Arbeit untersucht die Möglichkeiten eines allfälligen Zusatznutzens von „ Wikia Search" gegenüber den etablierten Suchmaschinen und legt den Fokus auf die Suchstrategien in Bibliotheken. Die zentrale Fragestellung dabei war es, herauszufinden, wie sich die Suchbedürfnisse von Bibliotheken mit den Möglichkeiten von „ Wikia Search " vereinbaren lassen und ein abschließendes Fazit über die Eignu...

  10. Zusammenarbeit aus Sicht eines outgesourcten Instandhalters

    Science.gov (United States)

    Grüßer, Stefan; Loeven, Heinz-Wilhelm

    Dauerhafter Unternehmenserfolg ist nur mit einer fortschrittlichen Instandhaltung zu erzielen. Durch den enormen Kostendruck infolge der Globalisierung und die Innovationssprünge auf der technischen Seite wird auch die Frage nach der modernen Organisationsform für die Instandhaltung gestellt. Eine Möglichkeit der Kostenoptimierung ist das Outsourcing von Instandhaltungsleistungen. Hierbei ist es unerlässlich, dass sich die Mitarbeiter zum Dienstleister entwickeln. In diesem Beitrag wird die Entwicklung der InfraServ Knapsack von einer internen Instandhaltungsabteilung hin zu einem Industriellen Dienstleister beschrieben und Aspekte der Zusammenarbeit mit externen Kunden aus der Sicht des outgesourcten Instandhalters geschildert. Es werden die wichtigen Entwicklungsschritte zur Dienstleistungsorientierung der früheren Eigeninstandhaltung aufgezeigt. Dieser Beitrag ist nicht als "Königsweg“ zu verstehen, er soll vielmehr anhand der Erfahrungen einer outgesourcten Eigeninstandhaltung Anregungen für die Entwicklung der eigenen Instandhaltungsorganisation liefern.

  11. Autoimmune pancreatitis. An update; Autoimmunpankreatitis. Ein Update

    Energy Technology Data Exchange (ETDEWEB)

    Helmberger, T. [Klinikum Bogenhausen, Staedt. Klinikum, Institut fuer Diagnostische und Interventionelle Radiologie, Neuroradiologie und Nuklearmedizin, Muenchen (Germany)

    2016-04-15

    have to be aware of the clinical, serological and histological parameters for AIP in order to guide clinicians towards the correct diagnosis. Only in this way can the highly efficient steroid therapy be initiated and otherwise possibly severe forms of therapy be avoided. (orig.) [German] Die Autoimmunpankreatitis (AIP) ist eine seltene Erkrankung, deren Verstaendnis sich in den letzten Jahren deutlich vertieft hat. Die haeufigste Form, die Typ-1-AIP, gehoert zu den IgG4-assoziierten Erkrankungen, die viel seltenere Typ-2-AIP ist hiervon zu differenzieren und steht mit chronisch entzuendlichen Darmerkrankungen in Verbindung. Bildgebend und klinisch besteht eine Ueberlappung zum Pankreaskarzinom. Aufgabe der Bildgebung und weiterer Parameter wie Serologie und Histologie ist es deshalb, eine Differenzierung zwischen den beiden Erkrankungsentitaeten zu schaffen, um sie jeweils der adaequaten Therapie zuzufuehren und die geringe, aber letztlich unnoetige Anzahl an Pankreatektomien wegen einer AIP zu verhindern. Die Diagnose der AIP ist komplex, wobei sich in den letzten Jahren die Konsensuskriterien der International Association of Pancreatology als Entscheidungsparameter vielfach durchgesetzt haben. Diese umfassen 5 Kardinalkriterien und ein therapeutisches Kriterium. Unter Verwendung dieser Parameter kann die AIP mit einer Sensitivitaet von 84,9 %, Spezifitaet von 100 % und Treffsicherheit von 93,8 % diagnostiziert werden. Die Diagnose einer AIP setzt sich aus verschiedenen Parametern zusammen, von denen 2 die Bildgebung betreffen. Wie bei der sonstigen Diagnostik des Pankreas sind dies Ultraschall, CT und MRT. Wesentlich fuer die Differenzialdiagnose ist der Ausschluss sekundaerer Malignitaetskriterien, wofuer CT und MRT etabliert sind. Das wesentliche diagnostische Kriterium der Histologie erfordert ausreichend Material, was in der Regel durch eine endoskopische Feinnadelpunktion (FNP) nicht gewonnen werden kann. Fuer die Identifikation des optimalen Punktionsorts und

  12. 2015 - das Jahr der RDA - ein erster Statusbericht

    Directory of Open Access Journals (Sweden)

    Inge Neuböck

    2015-06-01

    geben. Manchmal bin ich selbst erstaunt, wieviel eine so kleine Gruppe bewegen kann – Motor dazu ist das wirklich intensive Interesse und die Freude an der Mitarbeit von etwas Neuem bei jedem einzelnen Mitglied der AGs...

  13. Vereinbarkeit zwischen Erwerbsarbeit und Familienleben: Eine Frage der Gerechtigkeit

    Directory of Open Access Journals (Sweden)

    Hohl Sabine

    2015-12-01

    Full Text Available In diesem Beitrag argumentiere ich, dass die Ermöglichung von Vereinbarkeit zwischen Erwerbsarbeit und Familienleben ein Erfordernis der Gerechtigkeit bildet. Eltern besitzen einen Anspruch auf Vereinbarkeit, der auf zwei Interessen gründet: Dem Interesse am Zugang zur Erwerbstätigkeit und dem Interesse an der Pflege der Eltern-Kind-Beziehung, durch die besondere Güter realisiert werden. Eine staatliche Politik der Vereinbarkeit lässt sich auch gegenüber denjenigen Gruppen rechtfertigen, die kein besonderes Interesse daran haben – gegenüber Erwachsenen, die keine Kinder haben, und gegenüber Eltern, die ein ‚Ernährermodell‘ mit einer klaren Aufgabenteilung zwischen den Partnern bevorzugen. Eine entsprechende Politik muss allerdings die Dimension des Geschlechts beachten, um nicht zu einer Verschärfung der geschlechtsspezifischen Arbeitsteilung zu führen.

  14. Satzglieder, Kasus und semantische Rollen: Eine Einführung

    DEFF Research Database (Denmark)

    Engels, Eva; Vikner, Sten

    2006-01-01

    German/Deutsch/Tysk: Abschnitt 1 führt die Konzepte Satzglied, Kasus und semantische Rolle ein. Am Beispiel des Deutschen und Dänischen wird in Abschnitt 2 gezeigt, dass diese zwar miteinander verknüpft sind, jedoch nicht strikt miteinander korrelieren. Ein kurzer Blick auf das Finnische im...... Abschnitt 3 weist darauf hin, dass dies selbst in Sprachen mit weitaus ausgeprägterem Kasussystem der Fall ist....

  15. Konstruktion, Analyse und Inbetriebnahme eines Gelenks zur rotatorischen Entkopplung für ein UAV-Helikopter-Landesystem

    OpenAIRE

    Pham, Viet Duc

    2015-01-01

    Im Rahmen dieser Bachelorarbeit werden für ein Helikopter-Landesystem mehrere Gelenke entworfen, welche bei geschlossenem Kontakt ein unbemanntes Flugfahrzeug (UAV) und einen Manipulator rotatorisch entkoppeln und nur die translatorischen Freiheitsgrade des UAVs einschränken. Einzelne Komponenten der Konstruktion werden mithilfe von 3D-Druck-Verfahren gefertigt. Anschließend werden die Entwürfe kinematisch untersucht und verglichen. Das im Hinblick auf Arbeitsraum, Leichtgängigkeit, Gewicht u...

  16. Review: Anja Weiß (2001). Rassismus wider Willen. Ein anderer Blick auf eine Struktur sozialer Ungleichheit

    OpenAIRE

    Bremer, Helmut

    2002-01-01

    Die Arbeit liefert einen Beitrag zur Debatte um Rassismus und Interkulturalität sowie zur Anwendung qualitativer Forschungsverfahren im Rahmen der Theorie BOURDIEUs. Rassismus und Anti-Rassismus werden nicht isoliert betrachtet, sondern als eine Dimension sozialer Ungleichheit, die in eine umfassende Theorie sozialer Ungleichheit eingebunden werden muss. Vorgeschlagen wird BOURDIEUs Konzept von Habitus, Feld und Kapital. Das ermöglicht einen anderen Blick auf das Phänomen. Rassismus reproduzi...

  17. Die Grundlagen der Arithmetik. Eine logisch mathematische Untersuchung über den Begriff der Zahl

    OpenAIRE

    Frege, Gottlob

    1996-01-01

    Auf die Frage, was die Zahl Eins sei, oder was das Zeichen 1 bedeute, wird man meistens die Antwort erhalten: nun, ein Ding. Und wenn man dann darauf aufmerksam macht, dass der Satz "die Zahl Eins ist ein Ding" keine Definition ist, weil auf der einen Seite der bestimmte Artikel, auf der andern der unbestimmte steht, dass er nur besagt, die Zahl Eins gehöre zu den Dingen, aber nicht, welches Ding sie sei, so wird man vielleicht aufgefordert, sich irgendein Ding zu wählen, das man Eins nenn...

  18. Size-dependent distribution and feeding habits of Terebralia palustris in mangrove habitats of Gazi Bay, Kenya

    Science.gov (United States)

    Pape, Ellen; Muthumbi, Agnes; Kamanu, Chomba Peter; Vanreusel, Ann

    2008-03-01

    The gastropod Terebralia palustris often dominates the surface of muddy to sandy substrates of intertidal mudflats and mangrove forests, where they clearly destabilize the sediment. In the present study, it was investigated whether and to what extent the behaviour of juvenile and adult snails differs among habitats (mudflat vs. mangrove stand) in a Sonneratia alba mangal at Gazi Bay, Kenya. For this purpose we: (1) examined their distribution along three land-sea transects; and (2) applied stable isotope analysis to determine the feeding patterns of different-sized snails from the mangrove and mudflat habitats. Additionally, we investigated if these gastropods exert an impact on microphytobenthic (diatom) biomass, and whether this is size-dependent. The latter objective was met by either enclosing or excluding different-sized snails from experimental cages on the intertidal mudflat and the subsequent assessment of a change in pigment concentration of the sediment surface. In agreement with several previous studies conducted in other mangroves and geographical locations, a spatial segregation was demonstrated between juveniles (more common on the mudflat) and adults (more common in the mangrove forest). On the intertidal mudflat juveniles avoided sediment patches characterized by highly saline water in intertidal pools and a high mud content, while adults tended to dwell on substrates covered by a high amount of leaf litter. Stable carbon isotope analysis of the foot tissue of snails sampled from the S. alba stand and the mudflat indicated a transition in food source when a shell length of 51 mm is reached. Considering the δ13C value of juveniles, it seems they might be selecting for microphytobenthos, which might explain their preference for the mudflat. The diet of size classes found in both habitats did not differ significantly, although juveniles inhabiting the mangrove forest were slightly more depleted in 13C compared to those residing on the mudflat

  19. Medienkompetenz multiplizieren? Entwicklung eines Multiplikator/-innenkonzepts im Lehramtsstudium

    Directory of Open Access Journals (Sweden)

    Antje Müller

    2017-02-01

    Full Text Available Zur Förderung von Medienkompetenz und medienpädagogischer Kompetenz in der universitären Lehramtsausbildung wurde an der Justus-Liebig-Universität Gießen ein Lehrprojekt initiiert, das an der aktuellen technologischen Ausstattung von deutschen Schulen ansetzt. Als Zugang wurde die Technologie der interaktiven Whitebords gewählt, um gegenwärtige Entwicklungen der Digitalisierung von Unterrichtsräumen zu thematisieren und dabei ausgewählte Aspekte von Medienkompetenz zu fördern. In dem Projekt haben verschiedene Einrichtungen der Universität und der Lehrerbildung kooperiert, um eine Multiplikator/-innenschulung für Studierende zu erarbeiten und zu etablieren. Es wurde eine 28-stündige Qualifizierungsreihe entwickelt, die sich aus modularisierten Workshops zur medientechnischen und -didaktischen Auseinandersetzung mit interaktiven Whiteboards, Elementen der Tutor/-innenausbildung sowie der Erarbeitung eines eigenen Unterrichtsentwurfes zusammensetzt. In dem Artikel werden die entwickelten Module vorgestellt und bewertet, inwieweit sie den von Herzig, Aßmann und Klar (2014 formulierten Zielvorstellungen zur Medienkompetenzförderung für das Lehramtsstudium entsprechen. Im Abgleich mit diesen Zielvorstellungen werden Entwicklungspotentiale des Konzepts identifiziert. Darüber hinaus fliessen Ergebnisse der praktischen Durchführung in Optimierungsvorschläge zur Steigerung der Nachhaltigkeit und Qualität der didaktischen Kompetenzen zum Einsatz von interaktiven Whiteboards in der Lehramtsausbildung – und darüber vermittelt im Schulunterricht – ein.

  20. Fallbericht: Seltene Raumforderungen der Leiste in der klinischen Erscheinung inguinaler Hernien: eine seminomatöse Lymphknotenmetastase und ein Liposarkom des Samenstranges

    Directory of Open Access Journals (Sweden)

    Burger M

    2005-01-01

    Full Text Available Einleitung: Wir berichten über eine seminomatöse inguinale Lymphknotenmetastase und ein Liposarkom des Samenstranges, die sich klinisch als eine inguinale Hernie präsentierten. Kasuistik: Fall 1: Ein 53jähriger Patient wurde unter der Annahme einer inguinalen Hernie links in einer chirurgischen Abteilung operiert. Es fand sich eine Raumforderung, welche in der Schnellschnittuntersuchung den Befund einer seminomatösen Lymphknotenmetastase ergab. In der folgenden Abklärung ergab sich ein linksseitiges pT2-Seminom. Anamnestisch wurde vor 26 Jahren eine inguinale Varikozelektomie links vorgenommen. Fall 2: Ein 61jähriger Patient stellte sich mit einer schmerzlosen Raumforderung der rechten Leiste vor, die klinisch als inguinale Hernie imponierte und seit drei Jahren größenprogredient war. Die Ultraschall- und MRT-Befunde wurden als eine inguinale Hernie mit einem Peritonealfett enthaltenden Bruchsack gedeutet. Intraoperativ fand sich ein Liposarkom des Samenstranges. Schlußfolgerung: Trotz der Häufigkeit inguinaler Herniotomien sind überraschende maligne Raumforderungen selten. Man sollte diese Möglichkeit aber bei transskrotalen Eingriffen in der Anamnese und bei nicht eindeutig einzuordnenden Befunden differentialdiagnostisch bedenken. Inguinale Lymphknotenmetastasen testikulärer Neoplasien sind selten, in der Literatur ist ein eindeutiger Zusammenhang mit Eingriffen im Skrotal- und Leistenbereich beschrieben. Die klinische Erscheinung einer solchen als Leistenhernie ist bisher noch nicht beschrieben worden. Liposarkome des Samenstranges sind ebenfalls selten. Therapeutisch sollte eine radikale chirurgische Exzision und in Fällen unklarer Absetzungsränder eine Radiatio erfolgen. Lokalrezidive treten häufig und eventuell auch spät auf.

  1. Deutsches Wortgut in rumänischen Pflanzennamen. Ein Bericht aus ...

    African Journals Online (AJOL)

    vorgehoben wird (da der einzelne Sprecher Schöpfer der Sprache/Poesie wurde, wann immer er eine Blume nannte). Unserer Meinung nach ist ein botanisches Lexikon einer bestimmten Region, einmal bekannt, nicht nur ein Thesaurus, aber auch ...

  2. Differentiation of epipactis palustris (l.) crantz (orchidaceae) in habitats altered by man based on species populations within poznan city (poland)

    International Nuclear Information System (INIS)

    Wieloch, M.K.; Raszewska, M.W.; Drapikowska, M.

    2017-01-01

    The aim of the study was to compare two populations of Epipactis palustris (Orchidaceae) growing in the valley of Junikowski Stream, in the south-western part of the Poznan city (square of ATPOL BD08) and to compare current results to data on the species described in the literature. Group characteristics of both populations, such as population size, average density and congestion factor, as well as the average coefficient of dispersion, were defined. Specimen variability was determined by measuring 250 generative ramets in each population. The following plant traits were included: stem length, inflorescence length, number of flowers per inflorescence, number of leaves per stem and length and width of the largest leaf. Obtained data were subjected to statistical analyses. Descriptive statistics were calculated (arithmetic average, standard deviation, minimum and maximum). The variation coefficient (V) was established to determine the variation degree of each trait. In order to determine statistical significance of average values of traits of the samples in question, the factor variance ANOVA F-statistics was used. The significance degree was examined with Scheffe's test. Principal component analysis (PCA) enabled the examination of mutual relations between the samples in the system of two first principal components. This work confirmed previous information about low variability of marsh helleborine. Individual traits in both populations were very similar. The differences concerned the group characteristics. The plants were in good condition irrespective of occupied habitat. (author)

  3. An evaluation of memory accuracy in food hoarding marsh tits Poecile palustris--how accurate are they compared to humans?

    Science.gov (United States)

    Brodin, Anders; Urhan, A Utku

    2013-07-01

    Laboratory studies of scatter hoarding birds have become a model system for spatial memory studies. Considering that such birds are known to have a good spatial memory, recovery success in lab studies seems low. In parids (titmice and chickadees) typically ranging between 25 and 60% if five seeds are cached in 50-128 available caching sites. Since these birds store many thousands of food items in nature in one autumn one might expect that they should easily retrieve five seeds in a laboratory where they know the environment with its caching sites in detail. We designed a laboratory set up to be as similar as possible with previous studies and trained wild caught marsh tits Poecile palustris to store and retrieve in this set up. Our results agree closely with earlier studies, of the first ten looks around 40% were correct when the birds had stored five seeds in 100 available sites both 5 and 24h after storing. The cumulative success curve suggests high success during the first 15 looks where after it declines. Humans performed much better, in the first five looks most subjects were 100% correct. We discuss possible reasons for why the birds were not doing better. Copyright © 2013 Elsevier B.V. All rights reserved.

  4. Akad On Air: Radio als Schulfach. - Ein Projektbericht aus Salzburg.

    Directory of Open Access Journals (Sweden)

    Mirjam Winter

    2010-03-01

    Full Text Available Spätestens seit „Beverly Hills 90210“, der beliebten US-Teenie-Serie der 90er Jahre, kennt man es: das Schulradio. Ein eigenes Radiostudio kann sich keine Schule in Österreich leisten. Trotzdem ist es in Salzburg gelungen, ein Schulradio auf die Beine zu stellen – als eigenes Schulfach, in dem die Schülerinnen und Schüler praktisch mit dem Medium arbeiten und es für ihre Zwecke nutzen lernen. Der folgende Projektbericht skizziert, wie Medienpädagogik und die Vermittlung von Medienkompetenz an Schulen aussehen können.

  5. Skype for Business - Eine Einschätzung: Kurzstudie

    OpenAIRE

    Messerer, Thomas

    2016-01-01

    Die Firma Microsoft bietet mit Skype for Business ein Kommunikationssystem für die geschäftliche Nutzung an. Die Entwicklung von Skype for Business begann im Jahre 2002/2003 unter dem Namen Live Communications Server (LCS). Spätere Versionen wurden unter den Bezeichnungen OCS (Office Communications Server) und schließlich Lync vertrieben. Das System ist ein lokal installierter VoIP- und IM-Server, der in lokale Windows-Infrastrukturen eingebunden ist. Die Kommunikation im lokalen Netz erfolgt...

  6. Game-based Learning im Bildungskontext einer Hochschule. Ein Praxisbericht

    Directory of Open Access Journals (Sweden)

    Jochen Pfannstiel

    2009-04-01

    Full Text Available Das Fach Software-Engineering stellt Lernende und Lehrende gleichermassen vor eine grosse Herausforderung, da eine Vielzahl von abstrakten Methoden und Modellen zu erlernen sind. An der Hochschule Offenburg wurde das Lernspiel «Software Engineering in the Future» als Ergänzung zur Präsenzveranstaltung entwickelt. Die Studierenden sollen über das Lernspiel motiviert werden, sich mit der Thematik zu befassen, um dann in ansprechend gestalteten authentischen Szenarien einzelne Methoden zu erlernen und zu vertiefen. Der Artikel stellt die zentralen Aspekte der Spielentwicklung und Ergebnisse einer ersten Befragung der Studierenden vor.

  7. Das Nationale Bildungspanel : Ein neues Kapitel in Deutschlands Bildungsforschung

    OpenAIRE

    Preis, Nina; Stecher, Ludwig

    2009-01-01

    Was macht eigentlich ein gutes Praktikum aus? Welche Rolle spielt ein Praktikum bei der späteren Berufswahl, und was lernen Jugendliche in einem Praktikum? Wie verhalten sich die Praktikumsanleiter? Wie nehmen es die Schülerinnen und Schüler wahr? Und wie gestaltet sich der Transfer zwischen Schule und Betrieb? Dies sind nur einige Fragen, mit denen sich die Gießener Erziehungswissenschaftler Prof. Dr. Ludwig Stecher und Dipl.-Päd. Nina Preis im Rahmen des Nationalen Bildungspanels (National ...

  8. Integration eines 3D-Skizziertools in den Produktentwicklungsprozess

    OpenAIRE

    Diehl, Holger;Lindemann, Udo

    2017-01-01

    Frühe Phasen der Produktentwicklung zeichnen sich durch einen verstärkten Einsatz von Skizzen aus. CAD Systeme bieten für die in dieser Phase benötigte schnelle und intuitive Modellierung von Lösungsideen noch immer ungenügende Voraussetzungen. Am Lehrstuhl für Produktentwicklung wurde daher ein Tool für das intuitive Erstellen dreidimensionaler Skizzen aufgebaut. Der gewählte Ansatz zielt in Analogie zu bleistiftbasierten Papierskizzen auf ein Minimum an Funktionen zur Erhaltung höchster Int...

  9. Interspinöse Implantate in der Wirbelsäulenchirurgie - eine Frage der Indikation: Ein Fallbericht

    Directory of Open Access Journals (Sweden)

    Decristoforo I

    2009-01-01

    Full Text Available Ein 77-jähriger Patient war wegen manifester neurogener Claudicatio spinalis bei bekannter lumbaler Spinalkanalstenose in 3 Segmenten an einer auswärtigen Institution mit perkutanen interspinösen Implantaten versorgt worden, wonach sich die klinische Symptomatik nicht änderte. Erst die mikrochirurgische Dekompression und die Entfernung der Platzhalter führten zu einer deutlichen Besserung der Beschwerden und Verlängerung der schmerzfreien Gehstrecke. Anhand dieses Falles wird die Verwendung von interspinösen Platzhaltern beleuchtet. In der bisherigen klinischen Anwendung fehlen noch die Langzeitergebnisse. Eine korrekte Indikationsstellung zur Intervention bei Spinalkanalstenose ist Voraussetzung für ein zufriedenstellendes postoperatives Ergebnis.

  10. Eficiencia de pseudomonas sp, rhodopseudomonas sp, micrococcus sp y bacillus sp empleados como cultivos individuales y en consorcio, en la degradación de petróleo diesel ii

    OpenAIRE

    Otiniano García, Nélida Milly Esther

    2010-01-01

    In order to evaluate the efficiency of Pseudomonas sp, Rhodopseudomonas sp, Micrococcus sp, Bacillus sp, and the consortium formed by these four microorganisms in the diesel II petroleum degradation, it was worked in 5 bioreactors of aerated and shaken tank of 1.5 litters of capacity, with speed agitation of 120 rpm, and air flow of 0.5 vvm; in which were placed; 940 mL of Minimum Broth of Davies pH 7.0; 50 mL of diesel II petroleum as source of carbon and 10 mL of a suspension of approx...

  11. The electronically excited states of LH2 complexes from Rhodopseudomonas acidophila strain 10050 studied by time-resolved spectroscopy and dynamic Monte Carlo simulations. II. Homo-arrays of LH2 complexes reconstituted into phospholipid model membranes.

    Science.gov (United States)

    Pflock, Tobias J; Oellerich, Silke; Krapf, Lisa; Southall, June; Cogdell, Richard J; Ullmann, G Matthias; Köhler, Jürgen

    2011-07-21

    We performed time-resolved spectroscopy on homoarrays of LH2 complexes from the photosynthetic purple bacterium Rhodopseudomonas acidophila. Variations of the fluorescence transients were monitored as a function of the excitation fluence and the repetition rate of the excitation. These parameters are directly related to the excitation density within the array and to the number of LH2 complexes that still carry a triplet state prior to the next excitation. Comparison of the experimental observations with results from dynamic Monte Carlo simulations for a model cluster of LH2 complexes yields qualitative agreement without the need for any free parameter and reveals the mutual relationship between energy transfer and annihilation processes.

  12. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available clase ... (GGDEF) [Rhodopseudomonas palustris CGA009] ... Length = 124 ... Query: 353 PDILWHETYACGEPTIDAQHRELFDLANVILGPEI...EMLEPARLSELVELLLTRVAEHFQY 412 ... PDILWHETYACGEPTIDAQHRELFDLANVILGPEI...EMLEPARLSELVELLLTRVAEHFQY Sbjct: 1 ... PDILWHETYACGEPTIDAQHRELFDLANVILGPEIEMLEPARLSELVELLLTRVAEHFQY 60 ... Query: 473 DRRF 476 ... DRRF Sbjct: 121 DRRF 124

  13. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

  14. Coxarthrosis - an update; Koxarthrose - ein Update

    Energy Technology Data Exchange (ETDEWEB)

    Imhof, H.; Noebauer-Huhmann, I.; Trattnig, S. [Medizinische Universitaet Wien, Klinik fuer Radiodiagnostik, Wien (Austria)

    2009-05-15

    klinischen Symptomatik gestellt. Die typischen konventionell-radiologischen sowie CT-Befunde sind: Gelenkspaltverschmaelerung, Osteophytenformation, subchondrale Demineralisation/Sklerose, subchondrale Zystenbildung, freie Gelenkkoerper, Gelenkfehlstellung, Gelenkdeformitaet. Durch die MR-Diagnostik lassen sich weitere Fruehsymptome bzw. Aktivitaetszeichen festhalten: Knorpeloedem, -riss, -defekt, subchondrales Knochenmarkoedem, synoviales Oedem und Gelenkerguss sowie Muskelatrophie. Derzeit wird die Bedeutung oft nur geringfuegiger Fehlformen (z. B. Impingement, Dysplasie), Fehlstellungen, Ligamentlockerungen etc. sowie Stoerungen in der Gefaessversorgung (z. B. Osteonekrose etc.) heftig diskutiert, die alle als moegliche Praearthrose eine hohe Wahrscheinlichkeit zur Arthroseentwicklung aufweisen. Dem gesamthaften Gelenkcontainment sowie der Genderproblematik wird heute ebenfalls richtigerweise hoehere Aufmerksamkeit gewidmet. In der Forschung wird mittels verschiedener MR-Verfahren (z. B. Hoechstfeld-MR mit H- und Na- Spektroskopie, T2*-Mapping etc.) der Knorpelstoffwechsel und seine Aenderungen bei Praearthrose untersucht (biochemisches Imaging). Zweifellos sind auf diesem Gebiet bereits in wenigen Jahren neue tief greifende Erkenntnisse zu erwarten. (orig.)

  15. Magnitude and direction of the change in dipole moment associated with excitation of the primary electron donor in Rhodopseudomonas sphaeroides reaction centers

    Energy Technology Data Exchange (ETDEWEB)

    Lockhart, D.J.; Boxer, S.G.

    1987-02-10

    The magnitude and direction of the change in dipole moment, ..delta mu.., associated with the Q/sub y/ transition of the dimeric primary electron donor (special pair or P870) in Rhodopseudomonas sphaeroides reaction centers have been measured by Stark spectroscopy at 20 /sup 0/C. The magnitude of ..delta mu.. is found to be f/sup -1/ (10.3 +/- 0.7) D, where f is a correction factor for the local dielectric properties of the protein matrix. With the spherical cavity approximation and an effective local dielectric constant of 2, f = 1.2, and absolute value of ..delta mu.. is 8.6 +/- 0.6 D. Absolute value of ..delta mu.. for the Q/sub y/ transition of the special pair is approximately a factor of 3.4 and 2 greater than for the monomeric bacteriochlorophylls and bacteriopheophytins, respectively, in the reaction center. The angle between ..delta mu.. and the transition dipole moment for excitation of the first singlet electron state of the special pair was found to be 24 +/- 2/sup 0/. The measured values are combined to suggest a physical model in which the lowest excited singlet state of the special pair has substantial charge-transfer character and where charge is separated between the two monomers comprising the dimeric special pair. This leads to the hypothesis that the first charge-separated state in bacterial photosynthesis is formed directly upon photoexcitation. These data provide stringent values for comparison with theoretical calculations of the electronic structure of the chromophores in the reaction center.

  16. Neue Generation, neue Medien und eine neue Bildung?

    NARCIS (Netherlands)

    Bastiaens, Theo; Schrader, Claudia

    2018-01-01

    Extract Neue Generation, neue Medien und eine neue Bildung? Theo Bastiaens & Claudia Schrader Abstract This chapter focuses on the question of what influence societal changes have on learners, their learning behavior and the curriculum. Fact is that there has been one major change with an

  17. Leitung und Kooperation in wissenschaftlichen Bibliotheken Berlins - eine empirische Untersuchung

    OpenAIRE

    Paul, Gerhard

    1998-01-01

    Die vorliegende Arbeit greift ein im bibliotheks- und IuK-wissenschaftlichen sowie im fachprofessionellen Diskurs bisher weitgehend vernachlässigtes, aber immer bedeutsameres Thema auf: das vertikale soziale Geschehen in der Arbeitsorganisation ?wissenschaftliche Bibliothek". Die Absicht der Untersuchung lag darin, einen Zusammenhang zwischen dem Interaktionsverhalten der Leitungspersonen einerseits und der Mobilisierung von Leistungs- und Innovationspotentialen bei den Mitarbeiterinnen und M...

  18. Osteoarthritis - one disease or many?; Arthrose - eine oder viele Erkrankungen

    Energy Technology Data Exchange (ETDEWEB)

    Watt, I. [Bristol Royal Infirmary, Bristol (United Kingdom)

    2000-12-01

    The classical features of osteoarthritis (OA) include osteophytosis, joint space narrowing, subchondral cyst formation, sclerosis, deformity and low-grade synovitis. OA has been tacitly assumed to be a homogeneous disorder and dismissed as 'degenerative'. This short article will seek to challenge this traditional view and suggest that at least two major processes emerge from detailed radiological studies in patients with OA. One comprises osteophytosis associated with hyaline cartilage thinning and perhaps joint instability. This may represent a normal response to joint instability, and be seen as a healing mechanism. The other, when subchondral sclerosis and bone attrition predominate, may reflect joint failure. (orig.) [German] Die radiologischen Basissymptome einer Arthrose sind Osteophytenbildung, Gelenkspaltverschmaelerung, subchondrale Zystenbildung, Sklerose, Gelenkdeformitaet und geringgradige Synovialitis. Stillschweigend wurde die Arthrose durch viele Jahre hindurch als eine einheitliche Erkrankung betrachtet und als degenerativ bezeichnet. In dem vorliegenden Manuskript wird diese traditionelle Betrachtungsweise in Frage gestellt. Detaillierte radiologische Studien am Patienten mit Arthrose zeigen, dass zumindestens 2 unterschiedliche Prozesse ursaechlich vorliegen. Der eine umfasst Osteophytenbildung mit Gelenkknorpelverschmaelerung und Gelenkinstabilitaet. Diese koennten eine normale Reaktion auf Gelenkinstabilitaeten sein und daher moeglicherweise einem Heilungsprozess entsprechen. Der andere Prozess ist mit subchondraler Sklerose und Knochenabbau verbunden und stellt ein Versagen der Gelenkfunktion dar. (orig.)

  19. Die Leben Einsteins eine Reise durch die Geschichte der Physik

    CERN Document Server

    Fiami

    2005-01-01

    Jeder kennt die Namen Einstein, Newton oder Galilei. aber was weiss man über sie? Hier ein Porträt Einsteins anhand von sechs Meilensteinen aus der Geschichte der Physik. Einstein tritt auf als Protagonist in verschiedenen Epochen und bei verschiedenen Entdeckungen, die die Welt verändert haben.

  20. Merkmals- und Prototypensemantik: Eine Einführung

    Directory of Open Access Journals (Sweden)

    Bärenfänger, Olaf

    2002-01-01

    Full Text Available Traditional componential semantics are faced with various problems in adequately describing the meaning of a word. Therefore, this contribution presents the prototype theory as a fruitful approach for the description and explanation of many phenomena in the field of lexical semantics. Starting out from a large body of empirical results, it is discussed how prototype theory conceives lexical categories and meaning or concepts respectively. Important properties of a category are fuzzy boundaries as well as that particular elements can be viewed as differently typical for a category. The degree to which an element belongs to a category is defined in terms of typical features, whereby the most central element is called "prototype" and possesses the greatest possible number of typical features. Unlike traditional componential semantics, family resemblance relations determine which elements belong to a particular category, i.e. not all elements have to share the same necessary features, but at least one typical one. Subsequent to the description of these theorems consequences for argumentation theory, lexicography and the formation of linguistic theories are discussed as well as critical aspects of the prototype theory. After an enumeration of some research desiderata a concluding chapter gives a short summary and names the most impressive achievements of this increasingly influential research paradigm. Angesichts der verschiedenen Schwierigkeiten traditioneller Merkmalssemantiken, die Bedeutung eines Wortes angemessen zu beschreiben, wird mit der Prototypentheorie im vorliegenden Beitrag eine Konzeption vorgestellt, die möglicherweise vielversprechende Lösungsansätze bereithält. Ausgehend von empirischen Befunden wird diskutiert, wie lexikalische Kategorien resp. Bedeutungen oder Begriffe von der Prototypentheorie konzipiert worden sind. Als wesentliche Kategorieneigenschaften spielen hierbei insbesondere unscharfe Kategoriengrenzen eine Rolle

  1. Kyphoplasty - Vertebroplasty. A critical assessment; Kyphoplastie - Vertebroplastie. Eine kritische Standortbestimmung

    Energy Technology Data Exchange (ETDEWEB)

    Kasperk, C. [Medizinische Universitaetsklinik Heidelberg, Sektion Osteologie, Heidelberg (Germany)

    2015-10-15

    Painful vertebral compression fractures. Analgesia. Osteoplastic procedures, such as kyphoplasty and vertebroplasty. Anamnestic and radiological associations of clinical complaints with the radiomorphological findings of vertebral compression fractures are required for an adequate consideration to assess whether an osteoplastic procedure should be carried out. A computed tomography (CT) scan allows a reliable judgement whether an osteoplastic procedure is technically feasible and promising to improve the local vertebral fracture-associated pain. Prospective controlled trials have demonstrated a satisfactory improvement of back pain associated with vertebral fractures and parameters of quality of life by osteoplastic interventions. No prospective, truly sham-controlled blind trials are currently available which demonstrate an advantage of osteoplastic interventions compared to standard pain treatment; however, the currently published prospective controlled trials show a satisfactory pain reduction by osteoplastic interventions, such as kyphoplasty and vertebroplasty. Painful vertebral fractures and progressive loss of vertebral height of compression fractures should be evaluated in an interdisciplinary team consisting of radiologists, spinal surgeons and internists to assess whether an osteoplastic procedure is technically feasible and promising to improve local pain and immobility associated with vertebral fractures. (orig.) [German] Schmerzhafte Wirbelkoerpersinterungsfraktur. Schmerztherapie. Osteoplastische Verfahren wie die Kyphoplastie und die Vertebroplastie. Anamnestische und bildgebende (moeglichst CT) Assoziation der klinischen Beschwerden (Hauptschmerzbereich) mit dem radiologischen Befund eines eingebrochenen Wirbelkoerpers. Das CT gestattet am zuverlaessigsten eine Beurteilung der technischen Durchfuehrbarkeit eines osteoplastischen Verfahrens bei einer Wirbelkoerpersinterungsfraktur. Kontrollierte prospektive Studien belegen die schmerzreduzierende

  2. Pleading for a rational energy policy; Fuer eine aufgeklaerte Energiepolitik

    Energy Technology Data Exchange (ETDEWEB)

    Tillessen, U. [Colenco Power Consulting AG, Baden (Switzerland)

    1999-09-01

    To the argument that the long half-life values of the most important products of fission represent an unacceptable burden for coming generations, the author retorts that this is an emotion-directed pseudo-argument. Anyone who ventures into deep geological strata, such as the final storage area Konrad, should also count in terms of geological periods. From this point of view, a million years - however difficult to imagine for the average human being - is not a very long time. Toxic chemical waste is accepted by society, even if the toxicity should remain for all time. The article is an extract from a lecture given by the author to the Franco-German Society for Science and Technology. (orig.) [German] Dem Argument, die langen Halbwertszeiten der wichtigsten Spaltprodukte beinhalte eine nicht zu verantwortende Belastung fuer die nachfolgenden Generationen, haelt Autor Tillessen entgegen, dass dies ein auf Emotionen abzielendes Scheinargument sei. Wer sich, wie zum Beispiel beim Endlager Konrad, in tiefe geologische Schichten begebe, duerfe auch in geologischen Zeitraeumen rechnen. Und da sei eine Million Jahre, so wenig vorstellbar das auch fuer den Durchschnitts-Menschen sei, eben keine allzulange Zeit. Chemische Giftabfaelle wuerden von der Gesellschaft akzeptiert, obwohl ihre Toxitaet ewig waehre. Der Beitrag des Autors ist ein Auszug aus einer Rede, die er vor der Deutsch-Franzoesischen Gesellschaft fuer Wissenschaft und Technik gehalten hat. Aus diesem Anlass hatte Tillessen vorgeschlagen, ein von einer Stiftung getragenes deutsch-franzoesisches Institut zu gruenden, dessen Aufgabe es sein soll, mit mehr Rationalitaet die von teutonischer Romantik dominierte Technikdiskussion zu versachlichen. (orig.)

  3. EIN2 mediates direct regulation of histone acetylation in the ethylene response.

    Science.gov (United States)

    Zhang, Fan; Wang, Likai; Qi, Bin; Zhao, Bo; Ko, Eun Esther; Riggan, Nathaniel D; Chin, Kevin; Qiao, Hong

    2017-09-19

    Ethylene gas is essential for developmental processes and stress responses in plants. Although the membrane-bound protein EIN2 is critical for ethylene signaling, the mechanism by which the ethylene signal is transduced remains largely unknown. Here we show the levels of H3K14Ac and H3K23Ac are correlated with the levels of EIN2 protein and demonstrate EIN2 C terminus (EIN2-C) is sufficient to rescue the levels of H3K14/23Ac of ein2 -5 at the target loci, using CRISPR/dCas9-EIN2-C. Chromatin immunoprecipitation followed by deep sequencing (ChIP-seq) and ChIP-reChIP-seq analyses revealed that EIN2-C associates with histone partially through an interaction with EIN2 nuclear-associated protein1 (ENAP1), which preferentially binds to the genome regions that are associated with actively expressed genes both with and without ethylene treatments. Specifically, in the presence of ethylene, ENAP1-binding regions are more accessible upon the interaction with EIN2, and more EIN3 proteins bind to the loci where ENAP1 is enriched for a quick response. Together, these results reveal EIN2-C is the key factor regulating H3K14Ac and H3K23Ac in response to ethylene and uncover a unique mechanism by which ENAP1 interacts with chromatin, potentially preserving the open chromatin regions in the absence of ethylene; in the presence of ethylene, EIN2 interacts with ENAP1, elevating the levels of H3K14Ac and H3K23Ac, promoting more EIN3 binding to the targets shared with ENAP1 and resulting in a rapid transcriptional regulation.

  4. Conformational heterogeneity of the bacteriopheophytin electron acceptor HA in reaction centers from Rhodopseudomonas viridis revealed by Fourier transform infrared spectroscopy and site-directed mutagenesis.

    Science.gov (United States)

    Breton, J; Bibikova, M; Oesterhelt, D; Nabedryk, E

    1999-08-31

    The light-induced Fourier transform infrared (FTIR) difference spectra corresponding to the photoreduction of either the HA bacteriopheophytin electron acceptor (HA-/HA spectrum) or the QA primary quinone (QA-/QA spectrum) in photosynthetic reaction centers (RCs) of Rhodopseudomonas viridis are reported. These spectra have been compared for wild-type (WT) RCs and for two site-directed mutants in which the proposed interactions between the carbonyls on ring V of HA and the RC protein have been altered. In the mutant EQ(L104), the putative hydrogen bond between the protein and the 9-keto C=O of HA should be affected by changing Glu L104 to a Gln. In the mutant WF(M250), the van der Waals interactions between Trp M250 and the 10a-ester C=O of HA should be modified. The characteristic effects of both mutations on the FTIR spectra support the proposed interactions and allow the IR modes of the 9-keto and 10a-ester C=O of HA and HA- to be assigned. Comparison of the HA-/HA and QA-/QA spectra leads us to conclude that the QA-/QA IR signals in the spectral range above 1700 cm-1 are largely dominated by contributions from the electrostatic response of the 10a-ester C=O mode of HA upon QA photoreduction. A heterogeneity in the conformation of the 10a-ester C=O mode of HA in WT RCs, leading to three distinct populations of HA, appears to be related to differences in the hydrogen-bonding interactions between the carbonyls of ring V of HA and the RC protein. The possibility that this structural heterogeneity is related to the observed multiexponential kinetics of electron transfer and the implications for primary processes are discussed. The effect of 1H/2H exchange on the QA-/QA spectra of the WT and mutant RCs shows that neither Glu L104 nor any other exchangeable carboxylic residue changes appreciably its protonation state upon QA reduction.

  5. Doppler-Ultraschall in der Schilddrüsenabklärung: Eine Übersicht

    Directory of Open Access Journals (Sweden)

    Radl I

    2012-01-01

    Full Text Available Die farbkodierte Dopplersonographie ermöglicht in der Schilddrüsendiagnostik die Quantifizierung der Gewebevaskularisation. Die Diagnose eines Morbus Basedow kann mithilfe der Dopplersonographie aufgrund der eindeutigen Gewebehypervaskularisation praktisch allein getroffen werden und gibt Auskunft über den Therapieerfolg. Entzündliche Veränderungen der Schilddrüse zeigen im Vergleich zum M. Basedow praktisch immer einen geringeren Vaskularisationsgrad. Auch Schilddrüsentumoren zeigen eine vermehrte Vaskularisation. Während Adenome eine perinodale Durchblutung aufweisen, zeigen Karzinome eine Zunahme der zentralen Vaskularisation. Die Dopplersonographie kann zwar eine große Hilfestellung in der Abklärung von Schilddrüsenknoten bieten, eine Differenzierung zwischen benignen und malignen Gewebeveränderungen ist jedoch nicht möglich. Daher ist die ultraschallgezielte Feinnadelpunktion unerlässlich in der präoperativen Abklärung von Schilddrüsenknoten.

  6. Untersuchung eines breitbandigen Koaxial-Hohlleiterübergangs für einen Schottky-Strahldiagnosedetektor

    CERN Document Server

    Ehret, M; Wendt, M

    In der vorliegenden Arbeit wurde ein Koaxial-Hohlleiterübergang im Mikrowellenbereich (4.8 GHz) untersucht und verbessert. Diese Kopplung ist eine der Schlüsselstellen des sogenannten „Schottky-Detektors“. Dieser Detektor befindet sich innerhalb des Teilchenbeschleunigers des Large Hadron Colliders am CERN. Während der Arbeit wurden verschiedene Untersuchungen am Detektor durchgeführt und anhand der ermittelten Ergebnisse eine veränderte Kopplerstruktur entwickelt. Diese Struktur wurde zuerst anhand von verschiedenen Modellen in einer elektromagnetischen Feldsimulation überprüft und mit Hilfe verschiedener Algorithmen verifiziert. Im nächsten Schritt wurde ein Testaufbau entwickelt, mit dem eine Überprüfung und eine abschließende Betrachtung der Ergebnisse möglich war. Es konnte gezeigt werden, dass mit der neu entwickelten Struktur die Kopplereigenschaften wesentlich verbessert und die Zielvorgaben sogar deutlich übertroffen wurden.

  7. A Tribal Story Written in Silica: Using Phytoliths to Research the Effects of Mining on Past Wild Rice (Zizania palustris) Abundance in Sandy Lake, Minnesota

    Science.gov (United States)

    Clarke, I. R.; Jones, M. A.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.

    2014-12-01

    Wild rice (Zizania palustris, manoomin) is an emergent aquatic plant that grows annually in the northern Great Lakes region of North America. This region is also rich in iron ore deposits and correspondingly has an extensive history of mining activities. Wild rice no longer grows in some areas where it was previously abundant. Sandy Lake, located in St. Louis County on federally protected lands that are ceded territory of the Fond du Lac Band of Lake Superior Chippewa in Minnesota and downstream of the nearby U.S. Steel Minntac mine, was selected as a test site. This lake has a history of ricing activities by the Ojibwe (Chippewa) People, for whom manoomin has cultural importance. Lake cores were taken on June 17, 2014 by LacCore and FDLRM staff and samples were obtained. This project used phytolith analysis to answer the question of past wild rice presence and abundance in Sandy Lake. Phytoliths are microscopic opal silica deposits produced in some plants. Zizania palustris produces phytolith morphotypes that are unequivocally diagnostic of this species in this region. Microscopic slides were prepared and analyzed for wild rice phytoliths. Concentration values ranged from 25 to 4379 phytoliths per cm3/year, and wild rice accumulation figures ranged from 7 to 789 phytoliths/cm2/year, the maximum values of which occurred in the 1920s and generally declined to the current lowest levels observed. Mining has likely impacted wild rice populations by causing increased sulfate levels and possibly contributing to higher lake levels.

  8. Allodaposuchus palustris sp. nov. from the upper cretaceous of Fumanya (South-Eastern Pyrenees, Iberian Peninsula: systematics, palaeoecology and palaeobiogeography of the enigmatic allodaposuchian crocodylians.

    Directory of Open Access Journals (Sweden)

    Alejandro Blanco

    Full Text Available The controversial European genus Allodaposuchus is currently composed of two species (A. precedens, A. subjuniperus and it has been traditionally considered a basal eusuchian clade of crocodylomorphs. In the present work, the new species A. palustris is erected on the base of cranial and postcranial remains from the lower Maastrichtian of the southern Pyrenees. Phylogenetic analyses here including both cranial and postcranial data support the hypothesis that Allodaposuchus is included within Crocodylia. The studied specimen suggests little change in postcranial skeleton along the evolutionary history of crocodylians, except for some bone elements such as the axis, the first caudal vertebra and the ilium. The specimen was found in an organic mudstone corresponding to a coastal wetland environment. Thus, A. palustris from Fumanya is the first Allodaposuchus reported in lacustrine-palustrine settings that expand the ecological range for this genus. The S-DIVA palaeobiogeographic reconstruction of ancestral area suggests that early members of Crocodylia rapidly widespread for the Northern Hemisphere landmasses no later than the Campanian, leading the apparition of endemic groups. In that way "Allodaposuchia" represents an endemic European clade probably originated in the Ibero-Armorican domain in the late Campanian and dispersed by the Southern European archipelago prior to the early Maastrichtian.

  9. Vermittlung eines soliden Grundwissens Conveying a Sound Base of Knowledge

    Directory of Open Access Journals (Sweden)

    Anja Wehler-Schöck

    2004-07-01

    Full Text Available Ellen Krause legt eine umfassende und zugängliche Einführung in die politikwissenschaftliche Geschlechterforschung vor. Sie beabsichtigt damit, eine von ihr konstatierte Lücke in der deutschsprachigen Literatur zu diesem Thema zu schließen. Darauf bedacht, wissenschaftliche Konzepte in Bezug zur Praxis zu stellen, beweist die Autorin viel didaktisches Geschick. Theoretische Ausführungen werden durch Übungen, Denkanstöße und praktische Tipps ergänzt.Ellen Krause presents a broad and accessible introduction to gender studies within the discipline of political science. She hereby intends to fill a gap in the literature on this topic in German-speaking countries. The author illustrates great didactical skill in her aim to relate scientific concepts to practice. Theoretical explanations are supplemented with exercises, impetuses for reflection and practical tips.

  10. Chirurgische Therapie der Stressharninkontinenz (SUI - Ein Überblick

    Directory of Open Access Journals (Sweden)

    Riss P

    2009-01-01

    Full Text Available Die Stressharninkontinenz der Frau hat ihre höchste Prävalenz um die Zeit der Menopause. Es gibt verschiedene Erklärungsmöglichkeiten für die Kontinenz bei der Frau: die anatomische Lage des Blasenhalses, die Druckübertragung auf die proximale Urethra, eine Degeneration des M. sphincter urethrae, die sogenannte Hängemattentheorie der Unterstützung des Blasenhalses, das Trampolinmodell von P. Petros und schließlich das Konzept der mittleren Urethra. Auf letzterem beruhen die Operationen, bei denen ein Prolene-Band spannungsfrei unter die mittlere Urethra gelegt wird (TVT und Modifikationen. Wegen der Einfachheit der Durchführung und der exzellenten Erfolgsraten haben diese Operationen die bewährte Kolposuspension nach Burch weitgehend verdrängt. Faszienschlingenoperationen sind speziellen Rezidivsituationen vorbehalten.

  11. Die Entwicklung von Kindern: eine Einführung

    OpenAIRE

    Siegler, Robert; DeLoache, Judy; Eisenberg, Nancy

    2005-01-01

    Das Kapitel behandelt zunächst die Gründe für die Untersuchung der Kindesentwicklung und ihre historischen Wurzeln. Es werden anschließend Leitfragen der Kindesentwicklung sowie Methoden der Untersuchung kindlicher Entwicklung erläutert. Eine Zusammenfassung stellt schließlich die Kernthesen der einzelnen Abschnitte in einer kompakten Übersicht dar.(DIPF/paul)

  12. Ein wellenbasiertes stochastisches Modell zur Vorhersage der Erdbebenlast

    OpenAIRE

    Bretschneider, Jörg

    2007-01-01

    Starke Erdbeben stellen weltweit ein hohes Risiko für urbane Zentren dar, dem unter anderem durch Methoden der aseismischen Bauwerksbemessung begegnet wird. Grundlage hierfür bilden Annahmen und Erfahrungswissen über die lokale seismische Bodenbeschleunigung, Grenzen sind hingegen durch die zusätzlichen Kosten gesetzt. Die Schadensbilanz der Starkbeben der letzten Jahre, auch in den Industrieländern, verdeutlicht die Notwendigkeit, die Konzepte und Methoden des erdbebensicheren Bauens weiter ...

  13. Analyse und Regelung eines nichtlinearen Bremssystems mit elektromechanischen Stellgliedern

    OpenAIRE

    Arnold, Armin

    2002-01-01

    Ein elektromechanisches Bremssystem bietet im Vergleich zu einer hydraulischen Bremsanlage prinzipbedingt Vorteile hinsichtlich Komfort, Sicherheit und Umwelt. Allerdings müssen aufgrund des unterschiedlichen Stellverhaltens angepasste Regelalgorithmen entwickelt werden. Dies geschieht durch einen modellgestützten Ansatz, der neben den Raddrehzahlen auch die gemessenen Zuspannkräfte als Eingangsgröße verwendet. Es wird gezeigt, dass trotz des langsameren Ansprechverhaltens mindestens die Brem...

  14. Ein Beitrag zur Blutzellmorphologie ausgewählter karnivorer Zootierarten

    OpenAIRE

    Güth, Henrike

    2004-01-01

    Henrike Güth Ein Beitrag zur Blutzellmorphologie ausgewählter karnivorer Zootierarten Zoo Leipzig Januar 2003 156 Seiten, 222 Abbildungen, 67 Tabellen, 1 Graphik, 151 Literaturangaben, Anhang mit 25 Abbildungen und 6 Tabellen Zur Beurteilung des Blutbildes ist es nötig, neben der quantitativen Betrachtung der Blutzellen auch ihre Morphologie in die Untersuchungen einzubeziehen. In der Praxis werden dazu häufig nach May-Grünwald-Giemsa-gefärbte Ausstriche verwendet. Referenzwerte zur physiolog...

  15. Evaluation eines Trainings in Narrativer Expositionstherapie in Kolumbien

    OpenAIRE

    Schart, Christian

    2014-01-01

    In dieser Studie wurde untersucht, ob durch ein zehntägiges Training in Kolumbien den teilnehmenden Psychologen und Psychologinnen die nötigen Kenntnisse und Fertigkeiten der Traumatherapie Narrative Expositionstherapie (NET) vermittelt werden können, damit diese die Therapie effektiv durchführen können.Insgesamt nahmen 29 Psychologinnen und Psychologen an dem Training teil, wobei 25 Personen anschließend als Therapeuten und Therapeutinnen und 4 Personen in der Leitung des Reintegrationsprogr...

  16. Systems for uninterrupted power supply; USV - ein starkes Stueck Sicherheit

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, D.; Soelter, W. [AEG SVS GmbH, Warstein-Belecke (Germany)

    1999-09-01

    The millennium bug is only one of the many potential hazards in information technology. Systems for uninterrupted power supply offer a solution. [German] Alle Welt spricht vom Jahr-2000-Problem (Y2K). Die Meinungen dazu reichen von Horror-Szenarien bis hin zum Ignorieren dieses Problems. Dabei steht fest: Das Jahr-2000-Problem ist nur eines unter vielen Gefahrenpotentialen fuer die Informationstechnik. Dabei lassen sich alle Stoerfaktoren, die aus der Energieversorgung resultieren mit einer USV beseitigen. USV sichern Geschaeftsablaeufe und Fertigungsprozesse. (orig.)

  17. Optimierung der Hupkraftverteilung eines airbagintegrierten Automobillenkrades mit Hilfe einer Parameterstudie

    OpenAIRE

    Pietsch, Karsten

    2011-01-01

    Die Hupkraftverteilung eines airbagintegrierten Automobillenkrades wird mit Hilfe einer Parameterstudie in MathCAD so optimiert, das an jeder Krafteinleitungsposition die Hupe mit einer geforderten Mindestkraft betätigt werden kann. Nach der Modellierung in MathCAD der zugehörigen Geometrie und der Dimensionierung der Federlagerung ist das zugehörige mechanische Ersatzmodell mit Hilfe einer Parameterstudie verändert worden, so dass die Hupkraftforderung erfüllt wird.

  18. When is cartilage repair successful?; Wann ist eine Knorpelreparatur erfolgreich

    Energy Technology Data Exchange (ETDEWEB)

    Raudner, M.; Roehrich, S.; Zalaudek, M.; Trattnig, S. [Medizinische Universitaet Wien, Exzellenzzentrum Hochfeld-MR, Universitaetsklinik fuer Radiologie und Nuklearmedizin, Wien (Austria); Schreiner, M.M. [Medizinische Universitaet Wien, Universitaetsklinik fuer Orthopaedie, Wien (Austria)

    2017-11-15

    Focal cartilage lesions are a cause of long-term disability and morbidity. After cartilage repair, it is crucial to evaluate long-term progression or failure in a reproducible, standardized manner. This article provides an overview of the different cartilage repair procedures and important characteristics to look for in cartilage repair imaging. Specifics and pitfalls are pointed out alongside general aspects. After successful cartilage repair, a complete, but not hypertrophic filling of the defect is the primary criterion of treatment success. The repair tissue should also be completely integrated to the surrounding native cartilage. After some months, the transplants signal should be isointense compared to native cartilage. Complications like osteophytes, subchondral defects, cysts, adhesion and chronic bone marrow edema or joint effusion are common and have to be observed via follow-up. Radiological evaluation and interpretation of postoperative changes should always take the repair method into account. (orig.) [German] Die Therapie fokaler Knorpelschaeden ist weiterhin eine klinische Herausforderung. Nach erfolgter Sanierung gilt es daher besonders, Erfolg und Misserfolg zu evaluieren und den Verlauf standardisiert und somit reproduzierbar zu beurteilen. Dieser Artikel bietet einen Ueberblick ueber gaengige Reparaturverfahren und deren Charakteristika in der Magnetresonanztomographie. Nach einer erfolgreichen Knorpelreparatur ist eine vollstaendige, aber nicht hypertrophe Fuellung des Knorpeldefekts das primaere Kriterium. Zum umgebenden Nativknorpel ist ausserdem eine durchgehende Integration des Transplantats vordergruendig. Im weiteren postoperativen Verlauf sollte das Transplantat ausserdem ein im Vergleich zu nativem Knorpel isointenses Signalverhalten zeigen. Haeufig beobachtete Komplikationen sind zentrale Osteophyten, subchondrale Defekte, Zysten, chronifizierte Knochenmarksoedeme, Gelenkserguesse oder Adhaesionen. Die radiologische Beurteilung dieser

  19. Solar heating for a village; Ein Dorf heizt solar

    Energy Technology Data Exchange (ETDEWEB)

    Roepcke, Ina

    2013-07-05

    In Buesingen (administrative district of Konstanz) a solar thermal system with 1091 sqm collector area is put into operation. Together with two wood chip boilers they supply more than 100 private and municipal buildings with regenerative heat. [German] In Buesingen im Landkreis Konstanz ist eine solarthermische Anlage mit 1091 qm Kollektorflaeche in Betrieb gegangen. Zusammen mit zwei Hackschnitzelkesseln versorgt sie ueber 100 private und kommunale Gebaeude mit regenerativer Waerme.

  20. Gute Nerven und eine gewisse Chaosfähigkeit

    Directory of Open Access Journals (Sweden)

    Sabine Bangert

    2006-03-01

    Full Text Available Die Hessische Landesregierung hat mit „JAMBA“ (Junge allein erziehende Mütter in der Berufsausbildung ein Modell entwickelt und erprobt, um allein erziehenden jungen Müttern ohne Berufsausbildung eine Lehre im dualen System zu ermöglichen. An dem Modellversuch haben hundert junge Frauen an zehn Standorten in Hessen teilgenommen. Ziel des Projekts war es, den Personenkreis der jungen allein erziehenden Mütter zu ermutigen und zu unterstützen, eine betriebliche Ausbildung zu absolvieren. Gleichzeitig sollten Betriebe darin bestärkt werden, allein erziehende Frauen auszubilden. Prof. Dr. Angela Paul-Kohlhoff und Dr. Uta Zybell u. a. haben dieses Modellprojekt über vier Jahre wissenschaftlich begleitet. Das zweibändige Werk präsentiert die Ergebnisse des Modellprojektes und die Konsequenzen für die praktische Politik. Es zeigt Wege auf, Benachteiligungen junger Mütter nicht nur zu beseitigen, sondern aus den Erfahrungen mit der Ausbildung junger Mütter generelle Reformoptionen für die berufliche Ausbildung in Deutschland zu begründen. Flexibilisierung und Individualisierung ohne Abstriche an der Qualität der beruflichen Ausbildung stehen damit – nicht nur für die in den vorliegenden Veröffentlichungen untersuchten Zielgruppe „junge allein erziehende Mütter“ – auf der Tagesordnung der Reformagenda.

  1. Schreiben hat auch eine Stimme. Eine explorative Untersuchung über die Beziehung zwischen lautem Sprechen und Schreiben.

    OpenAIRE

    Lohmeier-Weidner, Yvonne (B. A.)

    2017-01-01

    Die Aufgabe in dieser Arbeit ist die Untersuchung der Beziehung zwischen lautem Sprechen und Schreiben im Schreibprozess. Grundlage ist die Annahme, dass beides zusammengehört und das Verbalisieren von Gedanken zum Schreiben, ob im Dialog oder im Selbstgespräch, selbiges positiv unterstützt. Dazu werden drei Studentinnen der Universität Paderborn, die an einem Abschlussarbeitenworkshop des Kompetenzzentrums Schreiben teilnahmen, durch ein fokussiertes Interview befragt. Diese Interviews werde...

  2. Höhepunkte der Thyreologie: Eine historische Vignette

    Directory of Open Access Journals (Sweden)

    Weissel M

    2014-01-01

    Full Text Available Die vorliegende Übersicht gibt einen historischen Überblick über die Entwicklung des Verständnisses für Erkrankungen der Schilddrüse und die Möglichkeiten, diese zu behandeln. Erkenntnisse vom 3. Jahrtausend vor Christus bis ins 19. Jahrhundert ergeben, dass ein mit der Nahrung aufgenommener Stoff zur Vermeidung eines Kropfes notwendig ist, dass Kröpfe (die in gebirgigen Gegenden gehäuft vorkommen oft mit Kretinismus einhergehen und dass die Schilddrüse ein Organ ist, dessen 2 Lappen durch einen Isthmus verbunden sind. Kurz nach der Entdeckung des Halogens Jod (1811 erkennt man schon seine Bedeutung für die Behandlung und Vermeidung vom Strumawachstum. Sein Vorkommen in der Schilddrüse und im menschlichen Plasma wird eine Dekade später entdeckt. Die Klinik der Hyperthyreose wird bereits genau beschrieben, nur dauert es eine gewisse Zeit, bis man sie einer Überfunktion der Schilddrüse zuordnet. Die Klärung der Ätiologie der autoimmun bedingten Hyperthyreose erfolgte erst ab der Mitte des 20. Jahrhunderts. Therapeutisch war anfangs die Kropfexstirpation die einzige Möglichkeit. Wien und Bern waren die Zentren mit der weltweit besten Expertise. Zur Behandlung des nachfolgenden Myxödems wurden Extrakte von Schaf-Schilddrüsen verwendet. Radiojod wird seit 1946 routinemäßig zur Behandlung der Hyperthyreose und auch des Schilddrüsenkarzinoms eingesetzt. Seit 1948 stehen die Thyreostatika unverändert zur Therapie der Hyperthyreose zur Verfügung. Die verschiedenen Arten der Entzündung der Schilddrüse werden ab Ende des 19. und Beginn des 20. Jahrhunderts beschrieben. Die Pathogenese der chronischen Autoimmunthyroiditis wurde 1956 geklärt, wobei unter anderem auf das außergewöhnliche Schicksal des Erstbeschreibers H. Hashimoto eingegangen wird. Das Schilddrüsenhormon Thyroxin wurde zu Beginn des 20. Jahrhunderts entdeckt. Die Synthese gelang etwa 10 Jahre danach. Die Existenz von 3,5,3’-Triojodthyronin (T3 wurde Mitte der

  3. Action of sulfurous acid on pollen. [Hepatica triloba; Helleborus orientalis; Vinca minor; Viola tricolor; Primula officinalis; Lilium candidum; Petunia; Pisum; Helleborus viridus; Galanthus nivealis; Vinca major; Convallaria maialis; Narcissus poeticus; Caltha palustris; Cystisus laburnum; Orchis maculata; Bilbergia; Eranthus; Crocus

    Energy Technology Data Exchange (ETDEWEB)

    Sabachnikoff, V

    1912-01-23

    The following ornamental plants: Hepatica triloba, Helleborus orientalis, Vinca minor, Viola tricolor, Primula officinalis, Lilium candidum, Petunia, Pisum, Helleborus viridus, Galanthus nivealis, Vinca major, Convallaria maialis, Narcissus poeticus, Caltha palustris, Cystisus laburnum, Orchis maculata, Bilbergia, Eranthus, and Crocus were tested for seed production. Exposure to sulfuric acid ranged from three to forty-eight hours. Responses were noted for varying concentrations.

  4. Scheuchzeria palustris L

    Czech Academy of Sciences Publication Activity Database

    Šída, O.; Štěpánková, Jitka

    2015-01-01

    Roč. 50, č. 1 (2015), s. 100-101 ISSN 1211-5258 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : floristics * distribution * endangered species Subject RIV: EF - Botanics

  5. The electronically excited states of LH2 complexes from Rhodopseudomonas acidophila strain 10050 studied by time-resolved spectroscopy and dynamic Monte Carlo simulations. I. Isolated, non-interacting LH2 complexes.

    Science.gov (United States)

    Pflock, Tobias J; Oellerich, Silke; Southall, June; Cogdell, Richard J; Ullmann, G Matthias; Köhler, Jürgen

    2011-07-21

    We have employed time-resolved spectroscopy on the picosecond time scale in combination with dynamic Monte Carlo simulations to investigate the photophysical properties of light-harvesting 2 (LH2) complexes from the purple photosynthetic bacterium Rhodopseudomonas acidophila. The variations of the fluorescence transients were studied as a function of the excitation fluence, the repetition rate of the excitation and the sample preparation conditions. Here we present the results obtained on detergent solubilized LH2 complexes, i.e., avoiding intercomplex interactions, and show that a simple four-state model is sufficient to grasp the experimental observations quantitatively without the need for any free parameters. This approach allows us to obtain a quantitative measure for the singlet-triplet annihilation rate in isolated, noninteracting LH2 complexes.

  6. Überlegungen zu einer entrepreneur-orientierten Ausbildung an gewerblichen Fachschulen: eine Bestandsaufnahme mit Vorschlägen für eine Ergänzung des Curriculums

    OpenAIRE

    Hartmann, Falk

    2010-01-01

    In der Arbeit wird untersucht ob eine Ausbildung zum Entrepreneur, also zur Selbständigkeit möglich ist und es wird ein geeigneter curricularer Ansatz gesucht eine Entrepreneurship Education in die Ausbildung zum staatlich geprüften Techniker Maschinentechnik zu integriereren.

  7. How should communal gas supply be organized?; Wie muss eine kommunale Gasversorgung organisiert sein?

    Energy Technology Data Exchange (ETDEWEB)

    Wolters, T.

    2000-06-01

    Reliable gas supply requires a reliable and economical organisational and procedural structure. These aspects were discussed theoretically and with the aid of examples in a diploma thesis which received a DVGW award. [German] Eine sichere Gasversorgung verlangt auch nach einer planvollen und angemessenen Aufbau- und Ablauforganisation eines Unternehmens. In einer vom DVGW ausgezeichneten Diplomarbeit wurden diese Aspekte theoretisch und an Beispielen eroertert. (orig.)

  8. IFRS 8 OPERATING SEGMENTS: Eine Untersuchung der erstmaligen Anwendung in der Schweiz

    OpenAIRE

    Meyer, C; Weiss, S

    2010-01-01

    Seit dem 1. Januar 2009 sind kotierte IFRS-Anwender verpflichtet, eine Segmentberichterstattung nach IFRS 8 zu erstellen. Anhand einer Analyse der Geschäftsberichte 2009 der an der SIX Swiss Exchange kotierten Unternehmen soll ein Überblick über die erstmalige Anwendung von IFRS 8 "Operating Segments" in der Schweiz gewonnen werden.

  9. Emotional Branding in der Automobilindustrie: ein Schlüssel zu langfristigem Markenerfolg?

    OpenAIRE

    Nadler, Sabrina; Rennhak, Carsten

    2011-01-01

    In der Automobilindustrie vollzieht sich aktuell ein Wandel von der Technik- zur Kundenorientierung. Die Konsumenten sollen Produkte und Dienstleistungen nicht nur einfach nutzen, sondern eine emotionale Bindung zu ihnen aufbauen und sie im Idealfall sogar lieben. Seit Gobé (2001) werden entsprechende Markenführungsansätze mit dem Schlagwort „Emotional Branding“ bezeichnet.

  10. Endometrial Intraepithelial Neoplasia (EIN In An Endometrial Polyp

    Directory of Open Access Journals (Sweden)

    Devic Ana

    2015-12-01

    Full Text Available Endometrial intraepithelial neoplasia (EIN is a monoclonal neoplastic cell proliferation of the endometrium associated with a significantly increased risk of endometrioid endometrial adenocarcinoma. We herein present the case of a 58-year-old female patient who underwent a hysterectomy with bilateral salpingo-oophorectomy because of the existence of endometrial intraepithelial neoplasia in an endometrial polyp. The patient had irregular uterine bleeding, which lasted 10 days. An endometrial polyp was diagnosed by ultrasound examination. The polyp was located in the isthmus of the uterus, on the back wall, and measured 32 mm × 25 mm. The patient underwent fractional dilation and curettage, and the specimens were subjected to a histopathological examination. The histopathological findings were EIN, endometrioid type, a focus of which was found within the endometrial polyps, as well as the endometrial polyp and proliferative endometrium. The endocervical tissue was normal. Given the age of the patient and the histopathological findings, she underwent a total abdominal hysterectomy with bilateral salpingo-oophorectomy. The final histopathological findings were EIN, endometrioid type with a focus found within the endometrial polyp; endometrial polyp; simple hyperplasia; chronic inflammation of the uterine cervix; hyperkeratosis of the cervical squamous epithelium; and cervicitis chronica. There was also hydrosalpinx of the left fallopian tube, and cystic follicles in the left ovary. There was no significant morphological change in the right ovary or fallopian tube. The surgical and postoperative course were normal. The patient was sent home on the fifth postoperative day in good general condition. A check-up performed one month after surgery showed normal findings.

  11. Einfluss eines nanogefüllten Schutzlackes auf das Ermüdungsverhalten eines Glasionomerzementes in destilliertem Wasser und künstlichem Speichel

    OpenAIRE

    Knöllinger, Melissa

    2012-01-01

    Hintergrund und Ziele Glasionomerzemente (GIZ) sind in der Zahnmedizin seit Jahrzehnten ein bewährtes Füllungsmaterial. Die Sprödigkeit des Materials resultiert allerdings in mangelnder mechanischer Stabilität, welches die Indikationen bisher auf nicht lasttragende Bereiche im bleibenden Gebiss limitiert. Ein neuartiger, mit Nanopartikeln (kolloidales Siliziumdioxid)angereicherter, lichtpolymerisierbarer Schutzlack (G-Coat Plus), ergibt zusammen mit einem stopfbaren Glasionomerzement (Fuji IX...

  12. Entfremdung als Strukturmoment von Unterricht? Eine Fallstudie zur Arbeit eines Schülers an der Tafel aus der Sicht der pädagogischen Unterrichtsforschung

    OpenAIRE

    Twardella, Johannes

    2010-01-01

    "In den 70er Jahren des 20. Jahrhunderts beobachtete Jules Henry im Rahmen seiner ethnographischen Schulforschungen die Arbeit eines Schülers an der Tafel und interpretierte sie aus einer sozialpsychologischen Perspektive heraus als einen Prozess, in dem ein Schüler lernt, was "Entfremdung" ist. Ausgehend von dieser Deutung wird in dem vorliegenden Aufsatz der Frage nachgegangen, ob der Begriff der Entfremdung auch heute noch für die Erforschung von Unterricht fruchtbar gemacht werden kann. D...

  13. Odontologie im numismatischen Spiegel : Ein Beitrag zur Geschichte der Zahnheilkunde

    OpenAIRE

    Heckert, Gerold Rüdiger

    2006-01-01

    Obgleich Medaillen mit zahnheilkundlichen Motiven schon sehr lange vertreten sind, hat dies in der Literatur bisher wenig Beachtung gefunden. Eine eigenständige Veröffentlichung erschien 1988 herausgegeben von Ladendorf und Salaschek (Proskauer 1940), die sich aber nur mit der Reklame von Zahnärzten und für Zahnärzte auf Medaillen befasst. Dieser Publikation liegt die Zusammenstellung von Storer und der Katalog zur Sammlung Brettauer zu Grunde. In den USA führte der Gynäkologe Horatio...

  14. Polen: ein Jahr EU-Mitgliedschaft als Erfolgsstory

    OpenAIRE

    Wilkiewicz, Zbigniew

    2005-01-01

    Aus Anlass der einjährigen EU-Mitgliedschaft Polens zieht der Beitrag eine positive Bilanz für die Wirtschaft und das Wirtschaftswachstums des Landes und zitiert einen veröffentlichten Regierungsbericht der polnischen Regierung, dem zufolge der EU-Beitritt maßgeblich zur Festigung günstiger makroökonomischer und struktureller Tendenzen im Außenhandel, auf dem Arbeitsmarkt und in der Landwirtschaft beigetragen hat. Angesichts der sehr hohen Arbeitslosenrate, der gravierenden regionalen Asymme...

  15. Eine wasserdurchlässige Dampfbremse als Hygrodiode

    DEFF Research Database (Denmark)

    Sagelsdorff, Ralph; Rode, Carsten

    1997-01-01

    Hohe Feuchtigkeit unde freies Wasser in Baukonstruktionen könne zu Bauphysikalischen Problemen und Schäden führen. Vor allem während der Bauphase eingebrachchtes oder durch Risse eindringendes Wasser, das bei ungünstigen Konstruktionen nur schlecht austrocknet, wird in der Winterperiode durch Dif...... Diffusionsprozesse noch erhöht. Eine wasserdurchlässige Dampfbremse als Hygrodiode erlaubt die sichere kapillare Rückführung des Wassers zur Raumseite, wo es verdunsten kann....

  16. Justitia ist eine Frau Justice is a Woman

    Directory of Open Access Journals (Sweden)

    Susanne Benöhr-Laqueur

    2008-11-01

    Full Text Available Das reich bebilderte Buch ist der Begleitkatalog zu der Wanderausstellung „Füllhorn, Waage, Schwert – Justitia ist eine Frau“. In zwölf Kapiteln – entsprechend den „Räumen der Gerechtigkeit“ – wird der Frage nachgegangen, warum Justitia von der Frühgeschichte bis in die Gegenwart in weiblicher Gestalt abgebildet wird. Die Juristin Barbara Degen verfolgt das Ziel, den Beweis dafür zu erbringen, dass Frauen und insbesondere Mütter die Kernelemente der Gerechtigkeit verkörpern.This richly illustrated catalogue accompanies the traveling exhibition “Cornucopia, Scales, Sword—Justice is a Woman” (“Füllhorn, Waage, Schwert—Justitia ist eine Frau”. In twelve chapters, each corresponding to the “spaces of justice,” the book explores question as to why justice has been depicted as a woman from early history to today. The lawyer Barbara Degen intends to supply evidence supporting the claim that women, and mothers in particular, embody the core elements of justness.

  17. Landeskundeunterricht zum Nationalsozialismus. Ein Praxisbericht aus der Mongolei

    Directory of Open Access Journals (Sweden)

    Ralf Heimrath

    2015-03-01

    Full Text Available In einer Umfrage bei den fortgeschrittenen Studierenden an der Deutschen Abteilung der Nationaluniversität der Mo n- golei wurde festgestellt, dass der Name Hitler sehr bekannt und mit e iner positiven Konnotation verbunden ist. Dagegen gab es keine Kenntnisse über die Zeit des Nationalsozialismus in Deutschland. Mehrere weitere Beobachtungen lassen darüber hinaus in der Mongolei und in anderen Ländern eine bestimmte Hitler - Verehrung erken nen. Vor diesem Hintergrund wurde im Jahr 2012 an der Deutschen Abteilung der Nationaluniversität der Mongolei eine Unterricht s- sequenz zum Thema Nationalsozialismus in Deutschland durchgeführt. Die wichtigsten Themen sind dabei die Persönlichkeit des Dikt ators, der Werdegang der NSDAP während der Weimarer Republik und das Schicksal der jüdischen Bevölkerung in Deutschland vor und insbesondere nach der Machtergreifung Hitlers. Die Sequenz dient der Relativierung des Hitler - Bildes im Bewusstsein der Studiere nden und der Vermittlung von Kenntnissen zur Geschichte des 20. Jahrhunderts als Grundlage einer Entwicklung, die zu zwei deutschen Staaten und ihrer späteren Vereinigung führte. Die Sequenz ist auf vergleichbare Unterrichtssituationen in anderen Ländern übertragbar.

  18. Energy from biomass. Teaching material; Energie aus Biomasse. Ein Lehrmaterial

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-04-01

    The textbook discusses the available options for power and heat generation from biomass as well as the limits of biomass-based power supply. The main obstacle apart from the high cost is a lack of knowledge, which the book intends to remedy. It addresses students of agriculture, forestry, environmental engineering, heating systems engineering and apprentice chimney sweepers, but it will also be useful to all other interested readers. [German] Biomasse kann aufgrund seiner vielfaeltigen Erscheinungs- und Umwandlungsformen sowohl als Brennstoff zur Waerme- und Stromgewinnung oder als Treibstoff eingesetzt werden. Die energetische Nutzung von Biomasse birgt zudem nicht zu verachtende Vorteile. Zum einen wegen des Beitrags zum Klimaschutz aufgrund der CO{sub 2}-Neutralitaet oder einfach, weil Biomasse immer wieder nachwaechst und von fossilen Ressourcen unabhaengig macht. All den bisher erschlossenen Moeglichkeiten der energetischen Nutzung von Biomasse moechte dieses Lehrbuch Rechnung tragen. Es zeigt aber auch die Grenzen auf, die mit der Energieversorgung durch Bioenergie einhergehen. Hohe Kosten und ein erhebliches Informationsdefizit behinderten bisher eine verstaerkte Nutzung dieses Energietraeges. Letzterem soll dieses Lehrbuch entgegenwirken. Das vorliegende Lehrbuch wurde fuer die Aus- und Weiterbildung erstellt. Es richtet sich vor allem an angehende Land- und Forstwirte, Umwelttechniker, Heizungsbauer und Schornsteinfeger, ist aber auch fuer all diejenigen interessant, die das Thema ''Energie aus Biomasse'' verstehen und ueberblicken moechten. (orig.)

  19. Normative Professionalisierung freier Journalisten. Eine berufspädagogische Perspektive

    Directory of Open Access Journals (Sweden)

    Armin Himmelrath

    2017-02-01

    Full Text Available In Zeiten von Fake-News, «Lügenpresse»-Vorwürfen und Diskussionen darüber, wie qualitativ gute Medienarbeit aussehen kann und soll, steigt der Druck auf journalistische Akteure, sich mit berufsethischen Fragen zu befassen. Wer eine entsprechende berufsfachliche Ausbildung durchlaufen hat, ist mit solchen Themen zwangsläufig in Berührung gekommen. Doch die zunehmende Zahl von Freiberuflern ohne entsprechende Fachausbildung, verbunden mit dem immer leichteren Zugang zu digitalen journalistischen Produktionsmitteln und Veröffentlichungswegen, sorgt dafür, dass viele Journalisten über herkömmliche berufsethische Qualifikationsmassnahmen wie z. B. Kurse im Rahmen eines Volontariats oder Fachstudiums gar nicht mehr erreicht wurden bzw. werden. Es stellt sich daher die Frage, wie innerhalb dieser Gruppe von Medienakteuren in Zukunft berufsethische Werte vermittelt werden können und welche Bedingungen einen Prozess ethischer Reflexion unter freien Journalisten/-innen befördern. Erste Umfrageergebnisse innerhalb der Berufsgruppe legen nahe, dass vor allem Aktivitäten von Redaktionen und Verlagen im Sinne einer schärferen Normierung als adäquate Reaktion auf bestehende berufsethische Defizite gesehen werden. Nachhaltig Erfolg versprechender könnten jedoch Massnahmen sein, die auf die Eigenaktivität und intrinsische Motivation freier Journalisten/-innen setzen. Hier stellt sich die Frage der effektiven Lern- und Vermittlungswege. Sie sollten, dem digital geprägten Arbeitsumfeld der Zielgruppe angemessen, auf digitalen Lehr- und E-Learning-Konzepten beruhen.

  20. Der Einfluss des mikrovaskulären Systems auf das Überleben eines Hauttransplantats

    OpenAIRE

    Motsch, Benjamin

    2017-01-01

    Transplantierte Organe benötigen eine zuverlässige Versorgung über das Gefäßsystem. Daher richtet diese Studie ihr Augenmerk darauf, ob eine Hemmung von Thrombozyten, sowohl allein als auch in Kombination mit einem mTOR-Hemmer, einen positiven Effekt auf die Ausprägung der mikrovaskulären Struktur in Hauttransplantaten bei einem allogenen Mausmodell hat. Für die Hauttransplantation wurde die Haut von C57BL6 (H-2b) als Spendertiere auf CBA/J(H-2k) Mäuse übertragen. Auf diese Weise wurde eine v...

  1. Bibliothekarische Berufsethik in der Praxis – Ergebnisse eines Studienprojekts aus Deutschland und Großbritannien

    Directory of Open Access Journals (Sweden)

    Jens Boye

    2011-10-01

    Full Text Available Sowohl in Deutschland als auch in Großbritannien existieren seit einigen Jahren Grundsatzpapiere zur Berufsethik im Informations- und Bibliotheksbereich. Neben der bloßen Existenz derartiger Kodizes stellt sich die Frage, welche Relevanz diese Dokumente in der beruflichen Praxis haben. Dieser Frage wurde im Rahmen einer Team-Projektarbeit an der FH Köln nachgegangen. Mithilfe eines standardisierten Fragebogens wurden deutsche Bibliotheksleitungen zu der Thematik befragt. In Großbritannien wurde ein Interview mit Paul Sturges geführt, darüber hinaus erfolgte eine Analyse der Online-Angebote von CILIP, insbesondere des Information Ethics Blog.

  2. Detection and enumeration of methanotrophs in acidic Sphagnum peat by 16S rRNA fluorescence in situ hybridization, including the use of newly developed oligonucleotide probes for Methylocella palustris.

    Science.gov (United States)

    Dedysh, S N; Derakshani, M; Liesack, W

    2001-10-01

    Two 16S rRNA-targeted oligonucleotide probes, Mcell-1026 and Mcell-181, were developed for specific detection of the acidophilic methanotroph Methylocella palustris using fluorescence in situ hybridization (FISH). The fluorescence signal of probe Mcell-181 was enhanced by its combined application with the oligonucleotide helper probe H158. Mcell-1026 and Mcell-181, as well as 16S rRNA oligonucleotide probes with reported group specificity for either type I methanotrophs (probes M-84 and M-705) or the Methylosinus/Methylocystis group of type II methanotrophs (probes MA-221 and M-450), were used in FISH to determine the abundance of distinct methanotroph groups in a Sphagnum peat sample of pH 4.2. M. palustris was enumerated at greater than 10(6) cells per g of peat (wet weight), while the detectable population size of type I methanotrophs was three orders of magnitude below the population level of M. palustris. The cell counts with probe MA-221 suggested that only 10(4) type II methanotrophs per g of peat (wet weight) were present, while the use of probe M-450 revealed more than 10(6) type II methanotroph cells per g of the same samples. This discrepancy was due to the fact that probe M-450 targets almost all currently known strains of Methylosinus and Methylocystis, whereas probe MA-221, originally described as group specific, does not detect a large proportion of Methylocystis strains. The total number of methanotrophic bacteria detected by FISH was 3.0 (+/-0.2) x 10(6) cells per g (wet weight) of peat. This was about 0.8% of the total bacterial cell number. Thus, our study clearly suggests that M. palustris and a defined population of Methylocystis spp. were the predominant methanotrophs detectable by FISH in an acidic Sphagnum peat bog.

  3. Heating water. Specifications for feedwater; Heizungswasser. Eine Standortbestimmung

    Energy Technology Data Exchange (ETDEWEB)

    Hannemann, M. [Hannemann Wassertechnik (Germany)

    2004-08-01

    Water is indispensable for life and for engineering. It is so universal that we seem to have lost respect for it. In heating systems, it is recommended to know about its technical properties and to account for them by appropriate measures. (orig.) [German] Wasser ist fuer Leben und Technik unverzichtbar. Vielleicht ist es auf die enormen Vorkommen und die Selbstverstaendlichkeit der Nutzung zurueckzufuehren, dass wir ein Stueck Achtung vor diesem Gut verloren haben. Wer bei der technischen Verwendung als Waermetraeger in Heizungsanlagen die speziellen Eigenschaften und die Wechselwirkungen mit Werkstoffen missachtet, kann schnell in unruhiges Fahrwasser geraten, mithin bis zum Schiffbruch. Wer die Wechselwirkungen kennt, beachtet und mit speziellen Behandlungsverfahren gegensteuert, ist daher gut beraten. (orig.)

  4. Ein Integraler Gestalt-Ansatz fuer Therapie und Beratung

    Directory of Open Access Journals (Sweden)

    Martina Gremmler-Fuhr

    2005-06-01

    Full Text Available Zusammenfassung: In diesem Text stellen wir unseren Ansatz für Psychotherapie und Beratung auf dem Hintergrund des integralen Paradigmas dar. Wir erläutern zunächst kurz vier Anforderungen an ein integrales Konzept in diesem professionellen Bereich: Umgang mit Komplexität und Vielperspektivität, Berücksichtigung gerichteter, vieldimensionaler Entwicklung, Orientierungs- und Sinngebungsfunktion, Realisierung relationaler Qualitäten in der Arbeit. Nach einer Begriffsbestimmung von „Therapie“, „Beratung“ und „Bildung“ charakterisieren wir das seit vielen Jahren von uns entwickelte Konzept für den Integralen Gestalt-Ansatz unter den Fragen nach (1 den Intentionen und Aufgaben von Therapie und Beratung, (2 der Gestaltung der Kommunikation und Beziehung, (3 der Art der Problemdefinition und dem Umgang mit Diagnostik sowie (4 den Strategien und Methoden – alle unter Rückkopplung an die zuvor erläuterten Anforderungen an ein integrales Konzept. Abstract: In this text we present our approach to psychotherapy and counseling on the background of the integral paradigm. We shortly explain four major requirements for such an integral concept: handling complexity and multi-perspectivity, considering directed and multi-dimensional development, offering orientation and meaning, relational qualities. After defining the terms „psychotherapy“, „counselling“, and „education“ we present our concept for the Integral Gestalt Approach which we have developed and evaluated for many years by dealing with four questions: (1 the intentions and tasks of therapy and counselling, (2 the formation of communication and relationship, (3 the specific way of defining problems and using diagnostics, and (4 the strategies and methods – all related back to the major requirements of an integral concept.

  5. Der menschliche Alltag - ein unverzichtbarer Bestandteil eines wissenschaftlichen Menschenbildes [Everyday life - a vital component of every scientific model of man

    Directory of Open Access Journals (Sweden)

    Schmid-Tannwald, Ingolf

    2008-02-01

    Full Text Available [english] The inadequacy of the current model of reproduction in mammals and vertebrates and the "need for a new model of man" becomes evident as soon as the relations and interactions of heterosexual partners within their living conditions are concerned. In contrast to animals hu-mans constitute an everyday life by interpersonal (social actions. Here at first the biological processes are triggered bringing humans as unique interpersonal and biological realites into existence at the moment of fertilisation. This twofold reality may be integrated into a more comprehensive scientific model of man by means of general system theory and semiotics rep-resenting human life as a flow of signs through various sign systems.[german] Jeder Mensch ist das Ergebnis eines zwischenmenschlichen Handelns in der menschlichen Sozialwelt der dort in Gang gesetzten biologischen Prozesse. Letztere sind für den Menschen und andere Säuge- und Wirbeltieren prinzipiell gleicher maßen gültig und im gängigen naturwissenschaftlichen Fortpflanzungsmodell beschrieben. Aber das naturwissenschaftliche Modell kann dieses gewissermaßen zweifache Werden des Menschen nicht angemessen repräsentieren. Dies wäre nur dann der Fall, wenn die menschlichen Beziehungen in der Sozialwelt identisch oder zumindest sehr ähnlich wären, wie die Lebensumstände der nichtmenschlichen Säuge- und Wirbeltiere, in denen sie ihre Nachkommen hervorbringen. Dann würde sich der Unterschied zwischen dem Werden des Menschen und jenem der anderen Säuge- und Wirbeltiere auf die biologischen Fakten beschränken und diese wären mit dem Fortpflanzungsmodell hinreichend beschrieben. Die Voraussetzung gleicher Lebenswelten bei Mensch und Tier trifft aber nicht zu. Deshalb stellt das Fortpflanzungsmodell eine Verfremdung des Phänomens „Mensch“ dar, noch dazu eine folgenschwere, vor allem am Lebensanfang, da Modelle als Bilder unser Handeln im Alltag leiten, vor allem, wenn sie

  6. Methylocella palustris gen. nov., sp. nov., a new methane-oxidizing acidophilic bacterium from peat bogs, representing a novel subtype of serine-pathway methanotrophs.

    Science.gov (United States)

    Dedysh, S N; Liesack, W; Khmelenina, V N; Suzina, N E; Trotsenko, Y A; Semrau, J D; Bares, A M; Panikov, N S; Tiedje, J M

    2000-05-01

    A new genus, Methylocella, and a new species, Methylocella palustris, are proposed for three strains of methane-oxidizing bacteria isolated from acidic Sphagnum peat bogs. These bacteria are aerobic, Gram-negative, colourless, non-motile, straight and curved rods that utilize the serine pathway for carbon assimilation, multiply by normal cell division and contain intracellular poly-beta-hydroxybutyrate granules (one at each pole). These strains use methane and methanol as sole sources of carbon and energy and are moderately acidophilic organisms with growth between pH 4.5 and pH 7.0, the optimum being at pH 5.0-5.5. The temperature range for growth is 10-28 degrees C with the optimum at 15-20 degrees C. The intracytoplasmic membrane system is different from those of type I and II methanotrophs. Cells contain an extensive periplasmic space and a vesicular membrane system connected to the cytoplasmic membrane. The strains grew only on media with a low salt content (0.2-0.5 g l(-1)). All three strains were found to possess soluble methane monooxygenase and are able to fix atmospheric nitrogen via an oxygen-sensitive nitrogenase. No products were observed in a PCR with particulate methane monooxygenase-targeted primers; hybridization with a pmoA probe was also negative. The major phospholipid fatty acids are 18:1 acids. The G+C content of the DNA is 61.2 mol%. The three strains share identical 16S rRNA gene sequences and represent a novel lineage of methane-oxidizing bacteria within the alpha-subclass of the class Proteobacteria and are only moderately related to type II methanotrophs of the Methylocystis-Methylosinus group. The three strains are most closely related to the acidophilic heterotrophic bacterium Beijerinckia indica subsp. indica (96.5% 16S rDNA sequence similarity). Collectively, these strains comprise a new species and genus Methylocella palustris gen. nov., sp. nov.; strain KT (= ATCC 700799T) is the type strain.

  7. Safety audits/Verkehrssicherheitsaudits : ein vielsprechendes Instrument zur Förderung der Verkehrssicherheit ?

    NARCIS (Netherlands)

    Wegman, F.C.M. & Schagen, I.N.L.G. van

    1998-01-01

    Das Instrument `Verkehrssicherheitsaudit' (`Audits') hat zum Zweck die infrastrukturellen Bedingungen für Verkehrssicherheit bereits während der Entwurf- und Realisierungsphase der Verkehrsinfrastruktur einzubauen. Dieser Bericht gibt ein Übersicht der Tragweite des Audits. Ausserdem werden

  8. Die Digitalisierung des Wissens – oder: Haben Bibliotheken und wissenschaftliches Publizieren eine gemeinsame Zukunft?

    Directory of Open Access Journals (Sweden)

    Volker Oppmann

    2016-04-01

    Full Text Available Bereits heute kontrollieren einige wenige Konzerne weite Teile der öffentlichen Grundversorgung mit digitalen Inhalten. Dies stellt eine Bedrohung für eine demokratischeWissens- und Informationsgesellschaft dar. Wir laufen Gefahr, die Hoheit über unser wichtigstes Kulturgut zu verlieren und von jenen anhängig zu werden, welche die systemrelevanten Infrastrukturen betreiben. Ein Aufruf für eine gemeinsames Gegenmodell. A few corporations are gaining more and more control over large sections of the public supply of digital content, which poses a threat to every democratic knowledge and information society. We are in danger of losing control over our most important cultural asset – and becoming totally dependent from those infrastructures. A call for a common counter-model.

  9. Die App „Weltbrand 1914“ der SUB Hamburg – Ein Werkstattbericht

    Directory of Open Access Journals (Sweden)

    Markus Trapp

    2015-01-01

    Full Text Available Wie kommt eine wissenschaftliche Bibliothek  dazu, eine App entwickeln zu lassen, auf der 100 Jahre alte Zeitungsseiten der Hamburger Nachrichten gelesen werden können, in denen auf Volltextebene recherchiert werden kann und die einen Einblick in Fotos gibt, die zu Beginn des Ersten Weltkrieges veröffentlicht wurden? Wie ist die Vorgeschichte der Tablet-App für iOS und Android, wie ist die SUB Hamburg an diese Aufgabe herangegangen und wie hat sie das Projekt zusammen mit dem Hamburger Softwareunternehmen CCS realisiert? Auf diese Fragen gibt der folgende Werkstattbericht eine Antwort und liefert auch ein erstes persönliches Zwischenfazit von einem der Projektbeteiligten.

  10. Imaging and therapy of a chondroblastoma; Bildgebung und Therapie eines Chondroblastoms

    Energy Technology Data Exchange (ETDEWEB)

    Nickel, J.; Meyer, D.R.; Geufke, P.; Andresen, R. [Krankenhaus Guestrow, Akademisches Lehrkrankenhaus der Universitaet Rostock (Germany)

    2002-07-01

    ] Das Chondroblastom ist eine seltene lytische ossaere Laesion, welche typischerweise in den Epiphysen der langen Roehrenknochen zu finden ist. Wir praesentieren die differentialdiagnostische Bildgebung und die opterative Therapie kasuistisch an einem Chondroblastom der proximalen Tibiaepiphyse. In der traumatologischen Ambulanz stellte sich ein 16 jaehriger Patient mit unklarem, seit Monaten zunehmenden Kniegelenksschmerz vor. Ein akutes Trauma war nicht erinnerlich. Zur weiteren Abklaerung erfolgte eine konventionelle Roentgenaufnahme in zwei Ebenen, ein Duennschicht CT, ein multiplanares MRT vor und nach Gd-DTPA und eine 3-Phasen-Skelettszintigrafie. Die konventionelle Roentgendiagnostik zeigt eine glattbegrenzte, osteolytische, exzentrische Laesion mit Randsklerosierung, welche die Epiphysenfuge der proximalen Tibia nicht ueberschreitet. In der Duennschicht-CT findet sich eine exzentrische Osteolyse mit typischen, schmalen Sklerosierungssaum und zentralen Verkalkungen. In der hochaufloesenden MRT zeigen die T2 gewichteten Sequenzen eine lokal begrenzte, epiphysaere, lobulierte Laesion mit einem heterogenen z.T. angehobenen Signal, eine weitere Signalanhebung zeigt sich in den T1 gewichteten Sequenzen nach Gabe von Gd-DTPA. Perifokal findet sich ein epiphysaeres Oedem und diskrete Fluessigkeit im Kniebinnenraum. In der Skelettszintigrafie kommt es zu einer starken fokalen und diffusen Mehrbelegung der proximalen, lateralen Tibiaepiphyse. Nach Diagnosestellung wurde eine Kuerettage des Defektes durchgefuehrt und anschliessend nach histologischer Bestaetigung der Diagnose die komplettierende Kuerettage und Spongiosaplastik vorgenommen. Unter Beruecksichtigung der Tumorlokalisation und des Alters des Patienten laesst sich bereits mit der konventionellen Bildgebung eine praktisch sichere Diagnose stellen. Eine ergaenzende MRT oder CT kann zur endgueltigen Abklaerung hilfreich sein, eine 3-Phasen-Skelettszintigrafie ist ueberfluessig. Die Therapie der Wahl ist die

  11. Balanced scorecard - a novel management philosophy; Balanced scorecard - eine neue Management-Philosophie

    Energy Technology Data Exchange (ETDEWEB)

    Pendzialek, W.

    1999-09-20

    The article briefly explains the management philosophy elaborated by Kaplan and Norton, USA. (orig./CB) [German] Bei dem von Kaplan und Norton in den USA entwickelte Managementkonzept der Balanced Scorecard wird eine Uebergewichtung der finanziellen Ergebnisse verhindert. Es wird eine Ausgewogenheit zwischen langfristigen und kurzfristigen Zielen, monetaeren und nichtmonetaeren Kennzahlen, Spaet- und Fruehindikatoren sowie internen und externen Leistungsanforderungen angestrebt. Dies fuehrt zu einer vernetzten und multidimensionalen Betrachtungsweise. (orig./RHM)

  12. Kontrolle des Verwaltungsrates : eine Untersuchung der internen und externen Kontrollinstitutionen, -instrumente und -mechanismen

    OpenAIRE

    Reust, Dominik

    2014-01-01

    Eine wichtige Erkenntnis dieser Arbeit ist, dass eine effiziente und effektive Kontrolle des Verwaltungsrates nur über das Zusammenspiel der internen körperschaftlichen Kontrollinstitutionen und -instrumente mit den externen Kontrollinstitutionen und Kontrollmechanismen des Marktes erreicht wird. Die Vorschriften der VegüV betreffend transparente Entschädigungspolitik und unabhängige Stimmrechtsvertreter sowie die in der Aktienrechtsrevision angestrebte Stärkung der Informations-, Mitwirk...

  13. Ein Verfahren zur schnellen experimentellen Charakterisierung der Quietschneigung von Kfz-Scheibenbremsen

    OpenAIRE

    Gödecker, Holger

    2015-01-01

    Die Hauptaufgabe der bei dieser Arbeit im Vordergrund stehenden Kfz-Scheibenbremse ist das Verzögern des Fahrzeuges durch den auftretenden Reibeffekt. Dabei kann es zu ungewollten selbsterregten Schwingungen und damit zu störenden Geräuschentwicklungen kommen. Dieses bei der Entwicklung und Konstruktion von Bremsen vorherzusagen und zu vermeiden ist ein großes Thema in Industrie und Forschung. In dieser Arbeit wird ein Verfahren beschrieben, mit dem experimentell schnell, noch vor dem Auft...

  14. Entwicklung und Umsetzung eines XML-basierten elektronischen Arzneimittelinformationssystems (AIS) mit XML-Topic Maps

    OpenAIRE

    Bánffy-Jósika, Emmerich

    2006-01-01

    Die Arzneimittelliste im Klinikum der Justus-Liebig-Universiät Gießen wurde erstmals 1974 unter dem Namen Hausliste erstellt, und war aus damaliger Sicht eine wertvolle Arbeitserleichterung, allerdings boten die einfachen Textdokumente aus heutiger Sicht keine optimalen Suchmöglichkeiten. Das Ziel dieser Arbeit lag somit darin, die wertvollen Dokumentinhalte der alten Version der Hausliste optimal nutzbar zu machen, und damit ein modernes Arzneimittelinformationssystem zu etablieren. Dafür wu...

  15. Quantitative Datenanalyse: Arbeiten mit SPSS Statistics : Eine Einführung

    OpenAIRE

    Hoidn, Sabine

    2012-01-01

    Bei diesem Buch handelt es sich um eine verständliche Einführung in das Arbeiten mit dem quantitativen Datenanalyseprogramm SPSS Statistics. Die Studierenden setzen sich mit den Grundlagen zum Arbeiten mit SPSS Statistics auseinander, können selbständig eine SPSS Statistics-Datei erstellen, Daten einlesen, zusammenfügen und modifizieren, erfasste Daten managen und die gebräuchlichsten tabellarischen und grafischen Grundauswertungen sowie Analyseverfahren durchführen und interpretieren. Au...

  16. Lebenswelt Polizei. Ein ethnografischer Zugang zur Berufsidentität von Polizeibeamten

    OpenAIRE

    Behr, Rafael

    2002-01-01

    In meinem Beitrag stelle ich einige Besonderheiten und Probleme des Konzepts einer "ethnografischen Polizeiforschung" dar. Empirische Referenz ist eine ethnografische Untersuchung mehrerer Hessischer Polizeidienststellen im Jahr 1995. Die "teilnehmende Beobachtung des Gewaltmonopols" ist zwar nicht neu, nach wie vor aber in mehrfacher Hinsicht spannend, weil es sich um den Blick auf ein exklusives Gewaltverhältnis handelt, das zwar durch individuelle Akteure vollzogen wird, das aber strukture...

  17. Ein Entscheidungshilfesystem für die Planung dezentraler Regenwasserbewirtschaftungsmaßnahmen in Siedlungsgebieten Koreas

    OpenAIRE

    Kwon, Kyung-Ho

    2009-01-01

    Ein Entscheidungshilfesystem wurde auf der Basis eines Computerprogrammes für die Planung dezentraler Regenwasserbewirtschaftung(RWB) mit Hilfe der Programmiersprache Visual Basic entwickelt. Dieses Programm „RainCity“ besteht aus zwei Simulationspakete „RainCity-Balance“ und „RainCity-Combi“. Das Simulationspaket “RainCity-Balance” berücksichtigt die planerischen Handlungskomponenten Verdunstung, Nutzung und Versickerung auf der Grundlage von Tageswerten und Bemessungsregen für regional unte...

  18. "Achte auf Deine Gewohnheiten..." : eine institutionenethische Betrachtung aus Sicht der Evolutorischen Ökonomik

    OpenAIRE

    Beschorner, Thomas

    2000-01-01

    "Der Beitrag beabsichtigt, eine mögliche Neukonzeptualisierung der Wirtschafts- und Unternehmensethik zu skizzieren. Es wird ein theoretischer Zugang vorgestellt, der in der bisherigen Kontroverse zur Wirtschafts- und Unternehmensethik weitgehend unberücksichtigt blieb und einen vielversprechenden Ausgangspunkt für die derzeit anstehenden Fragen innerhalb der Diskussion bildet: Es geht um Elemente einer individualistisch fundierten Evolutorischen Ökonomik, die handlungstheoretische Überlegung...

  19. Ganzheitlich prozessorientierte Entscheidungsunterstützung am Beispiel der Automobillackierung : Ein Beitrag zum industriellen Stoffstrommanagement

    OpenAIRE

    Rosenau-Tornow, Dirk

    2005-01-01

    Im Rahmen der sich verknappenden Ressourcen, der Anforderungen durch die Umweltgesetzgebung sowie des Gedankens einer nachhaltigen Entwicklung wird es für Unternehmen zunehmend wichtiger, den Aufwand für die Herstellung von Gütern und Dienstleistungen effizienter zu gestalten. Dabei gewinnt eine ganzheitliche Sichtweise unternehmerischer Entscheidung im Sinne von Technik, Ökonomie und Ökologie an Bedeutung, die eine Entkopplung von Wirtschaftswachstum und Ressourcenverbrauch bewirkt. Für betr...

  20. Review: Eine Replik auf: Schmitt, Rudolf (2011. Review Essay: Rekonstruktive und andere Metaphernanalysen

    Directory of Open Access Journals (Sweden)

    Jan Kruse

    2012-03-01

    Full Text Available udolf SCHMITT ist unbestreitbar ein fundierter Experte im deutschsprachigen Raum im Hinblick auf eine umfassende und fokussierte Metaphernanalyse als ein spezifisches Verfahren der Analyse qualitativer Daten. Mit seiner in FQS erschienenen Rezension zu unserem Buch "Metaphernanalyse. Ein rekonstruktiver Ansatz" wird dies abermals deutlich. SCHMITT ordnet unser Verfahren zur rekonstruktiven Metaphernanalyse in andere sozialwissenschaftliche Metaphernanalysen ein und versucht auf dieser Grundlage, Vor- und Nachteile unseres metaphernanalytischen Zugangs hervorzuheben. Ausgehend von diesem Vergleichshorizont gelingt ihm die Besprechung eines grundlegenden Buches zur Einführung in die sozialwissenschaftliche Metaphernanalyse – welches unser Buch aber weder ist noch vorgibt zu sein. Wir begrüßen seine breit gefächerte Auswahl sozialwissenschaftlicher metaphernanalytischer Zugänge, glauben aber, dass die Zielsetzungen unseres Ansatzes (und unseres Buches in seinem Review-Essay zu sehr in den Hintergrund treten. Wir haben uns daher zu dieser Replik entschlossen, um die "sozialwissenschaftliche Metaphernanalyse" weiter in einem diskursiven Prozess zu halten. URN: http://nbn-resolving.de/urn:nbn:de:0114-fqs1202102

  1. Identitätskonstruktionen in narrativen Interviews. Ein Operationalisierungsvorschlag im Anschluss an die relationale Netzwerktheorie

    Directory of Open Access Journals (Sweden)

    Stefan Bernhard

    2014-07-01

    Full Text Available In dem Artikel wird eine Forschungsstrategie vorgeschlagen, die eine Integration von Studien zur situativen Identitätskonstruktion in small stories und autobiografischen Identitätskonstruktionen in narrativen Interviews (big stories erlaubt. Grundlage dafür ist eine Operationalisierung des Identitätsbegriffs im Anschluss an die neuere Netzwerktheorie um Harrison C. WHITE. Identitäten folgen aus relationalen Positionierungen, die lokal, typisiert, laufbahnbezogen oder personalisiert vollzogen werden können. Narrative Interviews zeichnen sich dadurch aus, dass in ihnen die lokal-interaktive Identitätskonstruktion der Biograf/innen wesentlich über die Entfaltung einer big story (d.h. einer personalen Identität geschieht. Anhand eines Textbeispiels wird gezeigt, dass sich solche autobiografischen Erzählungen aus einer Vielzahl von kleinen Storys zusammensetzen, in denen identitäre Positionierungen auf unterschiedlichen Identitätsebenen vorgenommen werden. Die Debatte um small stories und big stories einerseits und der Whitesche Theorieansatz andererseits können voneinander profitieren. Für das Identitätsmodell der relationalen Soziologie stellen autobiografische Interviews eine wichtige, bislang wenig genutzte Informationsquelle dar. Zugleich lässt sich im Anschluss an WHITEs Identitätstheorie begründen, warum eine umfassende Identitätsanalyse über das artifizielle Setting narrativer Interviews hinausgehen muss. URN: http://nbn-resolving.de/urn:nbn:de:0114-fqs140311

  2. Synthese von analogen Filtern auf einer rekonfigurierbaren Hardware-Architektur mittels eines Genetischen Algorithmus

    Directory of Open Access Journals (Sweden)

    S. Trendelenburg

    2008-05-01

    Full Text Available Rekonfigurierbare Analog-Arrays (FPAAs sind der Versuch, die Vorteile der aus der digitalen Welt bekannten FPGAs (Flexibilität, Entwurfsgeschwindigkeit auch für analoge Anwendungen verfügbar zu machen. Aufgrund der Vielfalt der analogen Schaltungstechnik ist die Abbildung von vorgegebenen Schaltungskonzepten auf eine FPAA-Architektur nicht immer einfach lösbar.

    Diese Arbeit stellt einen neuen Ansatz für die Synthese von Filtern auf einer FPAA-Architektur für zeitkontinuierliche Analogfilter mittels eines Genetischen Algorithmus (GA vor. Anhand eines Matlab-Modells des FPAA, das eine gute übereinstimmung mit Simulationen des FPAA auf Transistorebene aufweist, wurde gezeigt, dass eine große Vielzahl verschiedener Filterstrukturen auf dieser Architektur dargestellt werden kann. Daraufhin wurde ein Genetischer Algorithmus entwickelt, der es erlaubt, aus einer gegebenen Filterspezifikation Konfigurationsdatensätze zu synthetisieren, die den gewünschten Filter auf die FPAA-Architektur abbilden.

  3. Ein Lehrbuch über Psychiatrie und Psychotherapie – Geschlechtsunterschiede unter der Lupe?

    Directory of Open Access Journals (Sweden)

    Isabella Heuser

    2007-07-01

    Full Text Available Anke Rohde und Andreas Marneros haben sich ein hohes Ziel gesetzt: ein übersichtliches Lehrbuch für Psychiatrie und Psychotherapie, das erstmals eine systematische Zusammenstellung des Wissens über geschlechtsspezifische Aspekte von Symptomatologie, Epidemiologie, Diagnostik, Pharmakotherapie und Psychotherapie psychischer Störungen enthält. Bemerkenswert ist dabei zweierlei: Erstens werden bei der Betrachtung geschlechtsspezifischer Unterschiede im Sinne der Genderforschung Frauen und Männer berücksichtigt, zweitens wird ein vollständiger Überblick sowohl über die häufigen und bekannten psychischen Störungen als auch die äußerst seltenen psychiatrischen Erkrankungen der gesamten Altersspanne gegeben. Wenngleich die Qualität der einzelnen Beiträge deutlich zwischen sehr differenzierter und leider auch für ein Handbuch eindeutig zu oberflächlicher Betrachtung variiert, liegt in dem Band ein weitgehend informatives Nachschlagewerk vor, das einen ersten Überblick über die geschlechtsspezifische Psychiatrie gibt.

  4. Sulfide Generated by Sulfate Reduction is a Primary Controller of the Occurrence of Wild Rice (Zizania palustris) in Shallow Aquatic Ecosystems

    Science.gov (United States)

    Myrbo, A.; Swain, E. B.; Engstrom, D. R.; Coleman Wasik, J.; Brenner, J.; Dykhuizen Shore, M.; Peters, E. B.; Blaha, G.

    2017-11-01

    Field observations suggest that surface water sulfate concentrations control the distribution of wild rice, an aquatic grass (Zizania palustris). However, hydroponic studies show that sulfate is not toxic to wild rice at even unrealistically high concentrations. To determine how sulfate might directly or indirectly affect wild rice, potential wild rice habitat was characterized for 64 chemical and physical variables in over 100 sites spanning a relatively steep climatic and geological gradient in Minnesota. Habitat suitability was assessed by comparing the occurrence of wild rice with the field variables, through binary logistic regression. This analysis demonstrated that sulfide in sediment pore water, generated by the microbial reduction of sulfate that diffuses or advects into the sediment, is the primary control of wild rice occurrence. Water temperature and water transparency independently control the suitability of habitat for wild rice. In addition to generating phytotoxic sulfide, sulfate reduction also supports anaerobic decomposition of organic matter, releasing nutrients that can compound the harm of direct sulfide toxicity. These results are important because they show that increases in sulfate loading to surface water can have multiple negative consequences for ecosystems, even though sulfate itself is relatively benign.

  5. Kocuria palustris sp. nov. and Kocuria rhizophila sp. nov., isolated from the rhizoplane of the narrow-leaved cattail (Typha angustifolia).

    Science.gov (United States)

    Kovács, G; Burghardt, J; Pradella, S; Schumann, P; Stackebrandt, E; Màrialigeti, K

    1999-01-01

    Two Gram-positive, aerobic spherical actinobacteria were isolated from the rhizoplane of narrow-leaved cattail (Typha angustifolia) collected from a floating mat in the Soroksár tributary of the Danube river, Hungary. Sequence comparisons of the 16S rDNA indicated these isolates to be phylogenetic neighbours of members of the genus Kocuria, family Micrococcaceae, in which they represent two novel lineages. The phylogenetic distinctness of the two organisms TA68T and TAGA27T was supported by DNA-DNA similarity values of less than 55% between each other and with the type strains of Kocuria rosea, Kocuria kristinae and Kocuria varians. Chemotaxonomic properties supported the placement of the two isolates in the genus Kocuria. The diagnostic diamino acid of the cell-wall peptidoglycan is lysine, the interpeptide bridge is composed of three alanine residues. Predominant menaquinone was MK-7(H2). The fatty acid pattern represents the straight-chain saturated iso-anteiso type. Main fatty acid was anteiso-C15:0. The phospholipids are diphosphatidylglycerol, phosphatidylglycerol and an unknown component. The DNA base composition of strains TA68T and TAGA27T is 69.4 and 69.6 mol% G+C, respectively. Genotypic, morphological and physiological characteristics are used to describe two new species of Kocuria, for which we propose the names Kocuria palustris, type strain DSM 11925T and Kocuria rhizophila, type strain DSM 11926T.

  6. High-resolution bioactivity profiling combined with HPLC-HRMS-SPE-NMR: α-Glucosidase inhibitors and acetylated ellagic acid rhamnosides from Myrcia palustris DC. (Myrtaceae).

    Science.gov (United States)

    Wubshet, Sileshi G; Moresco, Henrique H; Tahtah, Yousof; Brighente, Inês M C; Staerk, Dan

    2015-08-01

    Type 2 diabetes (T2D) is an endocrine metabolic disease with a worldwide prevalence of more than 8%, and an expected increase close to 50% in the next 15-20years. T2D is associated with severe and life-threatening complications like retinopathy, neuropathy, nephropathy, and cardiovascular diseases, and therefore improved drug leads or functional foods containing α-glucosidase inhibitors are needed for management of blood glucose. In this study, leaves of Myrcia palustris were investigated by high-resolution α-glucosidase inhibition profiling combined with HPLC-HRMS-SPE-NMR. This led to identification of casuarinin, myricetin 3-O-β-d-(6″-galloyl)galactopyranoside, kaempferol 3-O-β-d-galactopyranoside, myricetin, and quercetin as α-glucosidase inhibitors. In addition, four acetylated ellagic acid rhamnosides, i.e., 4-O-(2″,4″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, 4-O-(2″,3″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, 4-O-(3″,4″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, and 4-O-(2″,3″,4″-O-triacetyl-α-l-rhamnopyranosyl)ellagic acid were identified. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. Model-based control and application of a thermomanagement engine cooling system; Modellbasierte Regelung und Applikation eines Thermomanagement-Motorkuehlsystems

    Energy Technology Data Exchange (ETDEWEB)

    Mann, K.; Zeitz, M. [Robert Bosch GmbH, Stuttgart (Germany); Schmitt, M.

    2002-07-01

    Efficient heat management is a central development goal today. So-called thermomanagement systems cool the engine as required, ensuring energy-efficient control of a given engine temperature. The contribution presents a model-based process guidance structure and an application concept which can be adapted to various thermomanagement systems, ensureing high control quality and low application expenditure. Application requirements are minimized by model-based generation of the greater part of the application data. [German] Im Bereich der Fahrzeugentwicklung wird derzeit intensiv an Konzepten fuer ein effizienteres Waermemanagement gearbeitet. Mit einem sogenannten Thermomanagement-System wird der Motor bedarfsgerecht gekuehlt. Hierfuer wird eine vorgegebene Motortemperatur moeglichst energieeffizient geregelt. In dem Beitrag werden eine modellbasierte Prozessfuehrungsstruktur und ein Applikationskonzept vorgestellt, die flexibel fuer verschiedene Thermomanagement-Systeme angepasst werden koennen und bei geringem Applikationsaufwand eine hohe Regelguete gewaehrleisten. Der Applikationsaufwand wird minimiert, indem ein Grossteil der Applikationsdaten modellbasiert generiert wird. (orig.)

  8. Bedarf an medizinischer Psychologie in der Zahnheilkunde:eine wissenschaftliche Untersuchung unter Zahnärzten und Zahnmedizinstudenten

    OpenAIRE

    Bastian, C. (Cordula)

    2006-01-01

    Die teilnehmenden Stichprobengruppen (52 Zahnärzte, 78 Studenten) wurden zu dem Thema "Bedarf an medizinischer Psychologie in der Zahnheilkunde" befragt, wobei eine Mehrheit von 89% aller Befragten eine psychologische Schulung eines Zahnarztes für wichtig erachtet. In Ermangelung einer ausreichenden psychologischen Vor- und Weiterbildung halten sich die befragten Zahnärzte und Studenten auch nicht für gut genug gerüstet, schwierige Situationen im Beruf adäquat zu meistern ("wenig bis durchsch...

  9. Ein größeres Stück vom Kuchen: Besteuerung der Gewinne von Google und Co.

    OpenAIRE

    Becker, Johannes; Englisch, Joachim

    2017-01-01

    Unternehmen der digitalen Wirtschaft wie Google, Facebook, Amazon usw. sind in Europa allgegenwärtig, zahlen aber nur wenig Steuern. Die Finanzminister einiger wichtiger EUMitgliedstaaten haben deshalb eine umsatzbasierte Ausgleichsteuer auf Internetunternehmen vorgeschlagen. Ein solches Steuerinstrument verletzt jedoch wesentliche Regeln des internationalen Steuerregimes. Eine Erweiterung des Betriebstättenbegriffs in Richtung einer 'digitalen Betriebstätte' könnte hingegen sinnvoll sein. Su...

  10. Nachlassverzeichnisse im Netz – Ein Projekt der Bayerischen Staatsbibliothek

    Directory of Open Access Journals (Sweden)

    Maximilian Schreiber

    2015-12-01

    Full Text Available Nachlässe rücken in der wissenschaftlichen Forschung immer mehr in den Fokus, wie etwa die stark gestiegenen Nutzerzahlen der Bayerischen Staatsbibliothek (BSB über die letzten Jahre hinweg deutlich zeigen. Umso wichtiger ist insbesondere für Bibliotheken mit umfangreichen und fachlich breit gestreuten Nachlassbeständen eine möglichst genaue Erschließung im Internet, um der wissenschaftlichen Forschung einen schnellen Zugriff auf diese unikalen Materialien zu ermöglichen. Bei der digitalen Bereitstellung und vernetzten Erschließung verfolgt die BSB mit ihren rund 1.100 Nachlässen eine doppelte Strategie. Einerseits wird versucht, ausgewählte Nachlässe im Verbundsystem Kalliope zu katalogisieren. Andererseits werden die Erschließungsdaten zu den bereits erschlossenen und den erst grob geordneten Nachlässen, die in Form von hand- oder maschinenschriftlichen Listen sowie als Wordlisten vorliegen, digitalisiert und über den Bibliothekskatalog online zur Verfügung gestellt, um den Nutzern die Möglichkeit zu geben, sich so über die vorhandenen Bestände zu informieren. Wie dieses Projekt genau durchgeführt wurde, ist Gegenstand des Artikels. Special collections and personal papers are becoming more and more important for academic research, as is shown clearly by the increasing usage numbers at the Bavarian State Library (BSB over the last couple of years. Especially for libraries with extensive and manifold collections of estates, it is important to present these unique materials in a well-indexed manner on the internet, in order to give the scientific community easy access. The Bavarian State Library, which keeps more than 1.100 estates of personal papers, pursues a double strategy: On the one hand, selected estates are fully cataloged in the database “Kalliope”. As this procedure is likely to take a long time, the library on the other hand has been digitizing older hand- or typewritten lists with information

  11. Ein kombinierter Operationsansatz zur Therapie der rektovaginalen Endometriose auf der Basis histologischer Befunde

    Directory of Open Access Journals (Sweden)

    Köhler C

    2008-01-01

    Full Text Available Einleitung: Eine Endometriose des Septum rectovaginale kann oberflächlich dem Darm aufliegen oder die Darmwand infiltrieren. Durch bildgebende Verfahren kann jedoch präoperativ eine Infiltration des Darms weder hinreichend bestätigt noch ausgeschlossen werden, was zu einem therapeutischen Dilemma führt, da nur die Darmwand eindeutig infiltrierende Endometrioseprozesse durch eine Darmresektion behandelt werden sollten. Wir möchten ein neues Operationsverfahren vorstellen, das eine intraoperative Differenzierung zwischen einer oberflächlichen und einer infiltrativen Darmendometriose erlaubt. Patienten und Methodik: 70 Patientinnen mit rektovaginaler Endometriose wurden nach einem neu entwickelten kombinierten vaginal-laparoskopisch-abdominalen Verfahren operiert. Diese Operationsmethode wird Schritt für Schritt vorgestellt. Die Entscheidung zur Darmresektion wurde dabei allein aufgrund der intraoperativen Befunde und nicht aufgrund der präoperativen bildgebenden Diagnostik getroffen. Alle Resektate wurden standardisiert histologisch aufgearbeitet. Ergebnisse: Ob eine Darmresektion notwendig war, ließ sich intraoperativ anhand der Präparation des rektovaginalen Septums entscheiden. Daher wurden nur bei Patientinnen mit gesichertem infiltrativem Darmbefall Darmresektionen unter Erhalt des Mesointestinums durchgeführt. Weder intraoperative noch postoperative Komplikationen wie Anastomoseninsuffizienzen oder Restharnmengen traten auf. Diskussion: Die vorgestellte Operationsmethode zur Therapie der rektovaginalen Endometriose erlaubt eine exakte Diagnosestellung und präzise Therapieentscheidung bei minimaler Morbidität. Die Resektion des Darmschlauches ohne Mesoresektion ist ausreichend, da sich die Endometrioseknoten – wie histologisch bewiesen wurde – nur im ventralen Darmbereich befinden. Durch die Mesoerhaltung werden die vegetativen Funktionen des kleinen Beckens nicht beeinträchtigt.

  12. Der Krieg als eine besondere Form des Konflikts

    Directory of Open Access Journals (Sweden)

    Sebastian Schneider

    2011-12-01

    Full Text Available Comme le montrent les débats politiques et scientifiques actuels, la notion de guerre ne décrit pas uniquement une condition, mais a des implications normatives larges. Dans les situations de guerre, l’interdiction générale de tuer est en partie levée ou limitée. Afin d’éviter toute instrumentalisation politique et arbitraire de la notion de guerre, il faut repenser les critères de distinction entre la notion de guerre et les autres formes de conflit. Cet article se propose d’évoquer les réflexions philosophiques ainsi que politiques sur le thème de la guerre et critique le manque de réflexion sur la distinction entre la notion de guerre et les autres formes de conflits.Wie sich an aktuellen politischen und wissenschaftlichen Debatten zeigen lässt, ist der Begriff des Krieges nicht nur eine reine Zustandsbeschreibung, sondern hat auch weitreichende normative Implikationen. Im Krieg ist das ansonsten generelle Tötungsverbot partiell aufgehoben oder eingeschränkt. Um den Begriff nicht einer willkürlichen politischen Instrumentalisierung zu übergeben, muss über Kriterien zur Abgrenzung von Krieg und anderen Formen des Konflikts nachgedacht werden. Der Artikel wirft einen Blick auf die Beschäftigung der Philosophie und Politikwissenschaft mit dem Thema Krieg und kritisiert die mangelnde Abgrenzung des Krieges zu anderen Konfliktformen.

  13. Salt-induced stabilization of EIN3/EIL1 confers salinity tolerance by deterring ROS accumulation in Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Jinying Peng

    2014-10-01

    Full Text Available Ethylene has been regarded as a stress hormone to regulate myriad stress responses. Salinity stress is one of the most serious abiotic stresses limiting plant growth and development. But how ethylene signaling is involved in plant response to salt stress is poorly understood. Here we showed that Arabidopsis plants pretreated with ethylene exhibited enhanced tolerance to salt stress. Gain- and loss-of-function studies demonstrated that EIN3 (ETHYLENE INSENSITIVE 3 and EIL1 (EIN3-LIKE 1, two ethylene-activated transcription factors, are necessary and sufficient for the enhanced salt tolerance. High salinity induced the accumulation of EIN3/EIL1 proteins by promoting the proteasomal degradation of two EIN3/EIL1-targeting F-box proteins, EBF1 and EBF2, in an EIN2-independent manner. Whole-genome transcriptome analysis identified a list of SIED (Salt-Induced and EIN3/EIL1-Dependent genes that participate in salt stress responses, including several genes encoding reactive oxygen species (ROS scavengers. We performed a genetic screen for ein3 eil1-like salt-hypersensitive mutants and identified 5 EIN3 direct target genes including a previously unknown gene, SIED1 (At5g22270, which encodes a 93-amino acid polypeptide involved in ROS dismissal. We also found that activation of EIN3 increased peroxidase (POD activity through the direct transcriptional regulation of PODs expression. Accordingly, ethylene pretreatment or EIN3 activation was able to preclude excess ROS accumulation and increased tolerance to salt stress. Taken together, our study provides new insights into the molecular action of ethylene signaling to enhance plant salt tolerance, and elucidates the transcriptional network of EIN3 in salt stress response.

  14. A DICOM based PACS for nuclear medicine; Ein DICOM-basiertes PACS fuer die Nuklearmedizin

    Energy Technology Data Exchange (ETDEWEB)

    Lassmann, M.; Reiners, C. [Wuerzburg Univ. (Germany). Klinik und Poliklinik fuer Nuklearmedizin

    2002-02-01

    The installation of a radiology information system (RIS) connected to a hospital information system (HIS) and a picture archiving and communications system (PACS) seems mandatory for a nuclear medicine department in order to guarantee a high patient throughput. With these systems a fast transmission of reports, images to the in- and out-patients' wards and private practitioners is realized. Therefore, since April 2000, at the department of nuclear medicine of the university of Wuerzburg a completely DICOM based PACS has been implemented in addition to the RIS. With this system a DICOM based workflow is realized throughout the department of nuclear medicine for reporting and archiving. The PACS is connected to six gamma-cameras, a PET scanner, a bone densitometry system and an ultrasound device. The volume of image data archived per month is 4 GByte. Patient demographics are provided to the modalities via DICOM-Worklist. With these PACS components a department specific archive purely based on DICOM can be realized. During the installation process problems occurred mainly because of the complex DICOM standard for nuclear medicine. Related to that is the problem that most of the software implementations still contain bugs or are not adapted to the needs of a nuclear medicine department (particularly for PET). A communication software for the distribution of nuclear medicine reports and images based on techniques used for the worldwide web is currently tested. (orig.) [German] Fuer eine nuklearmedizinische Klinik ist ein Klinikinformationssystem (KIS) gekoppelt mit einem Radiologieinformationssystem (RIS) sowie einem Bildarchivierungs- und Verteilungssystem (PACS) unabdingbar, um einen schnellen Patientendurchsatz sowie die zeitnahe Uebermittlung von Befunden inklusive nuklearmedizinischen Bildern an zuweisende Stationen, Ambulanzen und externe Zuweiser zu gewaehrleisten. Daher wurde im April 2000 an der Klinik und Poliklinik fuer Nuklearmedizin der Universitaet

  15. Akupunktur bei Sterilität und zum Schwangerschaftserhalt: Eine Übersicht mit Forschungsidee

    Directory of Open Access Journals (Sweden)

    Ots T

    2011-01-01

    Full Text Available Die Unterstützung der weiblichen Fertilität und der Schwangerschaft mittels Akupunktur hat während der vergangenen Dekade viele Anhänger gefunden. Dieser Artikel gibt eine Übersicht über die hierzu veröffentlichten wichtigsten Studien. Die Wirkung der Akupunktur wird als effektiv und effizient beschrieben. In einem zweiten Ansatz stellt der Autor eine vereinfachte Form der Akupunktur auf dem Boden der Segment-Anatomie vor. Dieser kuti-viszeralen, segmentalen Reizung der gynäkologischen Organe könnte innerhalb der gynäkologischen Praxis große Bedeutung zukommen, da sie leicht erlernbar (innerhalb eines Tages und einfach durchführbar ist. Die Zielvorstellung ist ein integratives Vorgehen in der Hand der Gynäkologen. Vorbereitend hierzu ist eine multizentrische randomisierte kontrollierte Studie notwendig, die diese beiden Ansätze innerhalb der Akupunktur als Komplement zum gynäkologischen Prozedere der IVF untersucht.

  16. Spontane Mobilisierung und der Wandel kollektiver Formationen im Internet. Eine Fallstudie zur PEGIDA-Bewegung

    Directory of Open Access Journals (Sweden)

    Sang-hui Nam

    2016-11-01

    Full Text Available Der vorliegende Beitrag beschäftigt sich mit der Frage, wie sich eine aus spontaner Mobilisierung entstandene soziale Bewegung als kollektive Formation im Internet entwickelt. Da spontane Bewegungen in aller Regel nur über eine schwache kollektive Identität verfügen, werden sie bislang überwiegend als Übergangsphänomen betrachtet. Viele Studien beschäftigten sich eher mit den Folgen spontaner Mobilisierung, insbesondere der Frage, wie daraus eine nachhaltige Bewegung entstehen kann. Die kollektive Formation selbst ist bis dato weitgehend eine Blackbox geblieben. In der vorliegenden Studie widme ich mich folgenden zentralen Forschungsfragen: 1. Wie werden kollektive Formationen aus spontanen ProtestteilnehmerInnen dargestellt und generiert? 2. Wie ändern sich diese im Verlauf der Mobilisierung? Im Mittelpunkt der empirischen Analyse stehen Online-Kommentare, die eine zunehmend wichtige Rolle für soziale Bewegungen und spontane Mobilisierungsprozesse spielen. Am Beispiel von PEGIDA wird die Konstruktion einer kollektiven Formation über Live-Kommentare zu Live-Übertragungen von PEGIDA-Demonstrationen sowie deren Wandel in drei Phasen untersucht. Im ersten Schritt werden die soziotechnischen Grundlagen kollektiven Handelns im Internet erläutert. Der zweite Schritt befasst sich mit der methodischen Vorgehensweise. Im dritten Schritt werden ausgewählte Textpassagen von Online-Kommentaren analysiert. Anschließend wird der Wandel kollektiver Formationen nachgezeichnet. URN: http://nbn-resolving.de/urn:nbn:de:0114-fqs170138

  17. Genome Assembly of the Fungus Cochliobolus miyabeanus, and Transcriptome Analysis during Early Stages of Infection on American Wildrice (Zizania palustris L..

    Directory of Open Access Journals (Sweden)

    Claudia V Castell-Miller

    Full Text Available The fungus Cochliobolus miyabeanus causes severe leaf spot disease on rice (Oryza sativa and two North American specialty crops, American wildrice (Zizania palustris and switchgrass (Panicum virgatum. Despite the importance of C. miyabeanus as a disease-causing agent in wildrice, little is known about either the mechanisms of pathogenicity or host defense responses. To start bridging these gaps, the genome of C. miyabeanus strain TG12bL2 was shotgun sequenced using Illumina technology. The genome assembly consists of 31.79 Mbp in 2,378 scaffolds with an N50 = 74,921. It contains 11,000 predicted genes of which 94.5% were annotated. Approximately 10% of total gene number is expected to be secreted. The C. miyabeanus genome is rich in carbohydrate active enzymes, and harbors 187 small secreted peptides (SSPs and some fungal effector homologs. Detoxification systems were represented by a variety of enzymes that could offer protection against plant defense compounds. The non-ribosomal peptide synthetases and polyketide synthases (PKS present were common to other Cochliobolus species. Additionally, the fungal transcriptome was analyzed at 48 hours after inoculation in planta. A total of 10,674 genes were found to be expressed, some of which are known to be involved in pathogenicity or response to host defenses including hydrophobins, cutinase, cell wall degrading enzymes, enzymes related to reactive oxygen species scavenging, PKS, detoxification systems, SSPs, and a known fungal effector. This work will facilitate future research on C. miyabeanus pathogen-associated molecular patterns and effectors, and in the identification of their corresponding wildrice defense mechanisms.

  18. Analyse der Literatur zu Klimawirkungen in Deutschland: ein Gesamtbild mit Lücken

    Science.gov (United States)

    Fleischhauer, Mark; Greiving, Stefan; Lindner, Christian; Lückenkötter, Johannes; Schauser, Inke

    Dieses Kapitel präsentiert Ergebnisse einer umfassenden Literaturauswertung zu relevanten Klimawirkungen für Deutschland, die im Rahmen des Projekts "Netzwerk Vulnerabilität" vorgenommen wurde. Es zeigt auf, dass ein aggregiertes Gesamtbild der Klimawirkungen für Deutschland als Grundlage für Folgenabschätzungen und Anpassungsplanungen noch nicht gezeichnet werden kann, da eine große Bandbreite an Ansätzen zur Bewertung von Vulnerabilitäten oder Klimawandelfolgen existiert und die gegenwärtig vorhandenen Klimawirkungs- und Vulnerabilitätsstudien von großer Heterogenität gekennzeichnet sind. Als erster Schritt wird deshalb eine Zusammenschau bereits vorhandener Ansätze geliefert.

  19. Special liquid nitrogen dewar for a superconducting levitation transport system; Spezialkryostat fuer ein supraleitendes Schwebetransportsystem

    Energy Technology Data Exchange (ETDEWEB)

    Schumann, B.; Binneberg, A. [ILK Dresden gGmbH, Dresden (Germany)

    2002-07-01

    Within a joint project supported by the Free State Saxony a novel bearing and transport system was developed. The prototype is based on the combination of the magnetic bearing technique using high temperature-superconductors with a non-contacting linear drive. This non-contracting 'lift' is free from friction and contaminations due to wear and therefore predestinated for applications in clean rooms, e.g. in the microelectronic technology. (orig.) [German] Im Rahmen eines Verbundprojektes, gefoerdert vom Freistaat Sachsen, wurde ein neuartiges Lager- und Transportsystem in Form einer Kombination der supraleitenden Magnetlagertechnik mit Hochtemperatursupraleitern und einem beruehrungslos arbeitenden Linearantriebssystem am Beispiel eines Demonstrators entwickelt. Der voellig beruehrungslos und damit reibungs- und abriebfrei funktionierende Lift ist fuer Anwendungen in Reinraeumen z.B. in der Mikroelektroniktechnologie praedestiniert. (orig.)

  20. ENZIAN-Klassifikation zur Diskussion gestellt: Eine neue differenzierte Klassifikation der tief infiltrierenden Endometriose

    Directory of Open Access Journals (Sweden)

    Tuttlies F

    2008-01-01

    Full Text Available Mit Einführung des ENZIAN-Scores wurde eine neue Klassifikation für die Erkrankung der Endometriose vorgestellt, die insbesondere die tief infiltrierende Endometriose mit der typischen retroperitonealen Manifestation berücksichtigt. In Anlehnung an onkologische Stadieneinteilungen wurde eine Einteilung in vier Schweregrade gewählt, die mit drei Raumachsen zur Lokalisation der Erkrankung erweitert wurden. Der ENZIAN-Score versteht sich als eine Ergänzung zu dem bekannten rAFS-System (revised American Fertility and Sterility Score, das sich lediglich auf die intraperitoneale Manifestation der Endometriose anwenden lässt. In vielen Fällen ist die rAFS-Klassifikation nur bedingt oder gar nicht geeignet, die Ausdehnung und den Schweregrad der Erkrankung darzustellen. Am Kollektiv von Patientinnen mit Darmendometriose wurde der ENZIAN- Score retrospektiv auf die klinische Wertigkeit hin untersucht und bewährte sich in der klinischen Anwendung.

  1. Auch eine Theorie der Moderne Another Theory of Modernity

    Directory of Open Access Journals (Sweden)

    Sabine Rohlf

    2002-11-01

    Full Text Available Barbara Hahn zeichnet die Wege schreibender Frauen durch 200 Jahre deutsch-jüdische Kulturgeschichte nach. Ausgehend von Paul Celans vieldeutiger Jüdin Pallas Athene, werden dabei stereotype Bilder der „Jüdin“, der „Intellektuellen“ und die scharfe Trennlinie zwischen humanistisch christlicher und jüdischer Tradition zur Diskussion gestellt. Mit Celans Figur schreibt sich gleichzeitig die theoretische Herausforderung in diese Studie ein, nach Ambivalenzen und Dialogen zu fragen, deren Voraussetzungen mit beispielloser Gewalt zerstört wurden. Gestützt auf Archivmaterial und veröffentlichte Texte der von ihr vorgestellten Frauen, spannt Hahn den Bogen von frühen Strategien der Assimilierung bis in die Jahre nach 1945. Das Buch ist keine Überblicksdarstellung, sondern präsentiert einzelne, einander auch überschneidende Konstellationen – intellektuelle Netzwerke, Briefwechsel, intertextuellen Transfer.Hahn traces the paths of women writers through two hundred years of German-Jewish cultural history. Using Celan’s plurivalent “Pallas Athene” as a starting point, Hahn discusses stereotypical images of “the Jew,” “the Intellectual,” and the sharp division between the humanistic Christian and the Jewish tradition. The character created by Celan functions as a theoretical challenge in this text, asking about feelings of ambivalence and dialogues which could not take place as their premises were destroyed with an unprecedented violence. Based on archival material and biographical texts about the women she uses, Hahn completes the circle between early strategies and assimilation until the post-WWII years. This book does not offer a general overview, but offers individual, overlapping constellations-intellectual networks, letters, and intertextual transfers.

  2. Development of a test station for the illustration of a hydraulic heating network; Entwicklung eines Pruefstandes zur Abbildung eines hydraulischen Heizungsnetzwerks

    Energy Technology Data Exchange (ETDEWEB)

    Kopmann, Nina; Adolph, Michael; Mueller, Dirk [RWTH Aachen Univ. E.ON Energy Research Center (Germany). Inst. for Energy Efficient Buildings and Indoor Climate

    2011-07-01

    As the parameters describing air currents in rooms will change to the opposite when the characteristic length is shortened, small-scale investigations of room air currents are not possible. For this reason, the E.ON Energy Research Center set up a ''Hardware-in-the-Loop'' (HiL) test stand which models a real hydraulic heating system of an apartment or a building. The test stand consists of several interconnected model rooms with typical heating units, and only the enclosing building volume is reduced. The model rooms all have a volume of 3-4 m{sup 3}. Depending on the heat emitted by the radiators, the boundary conditions of air supply (volume flow and temperature) and of the walls (wall surface tempeartures) are calculated using the simulation software Modelica and are emulated in the test stand. The measured heat emissions of the radiators are used as boundary conditions in the thermohydraulic simulations. The function of the HiL test stand was first tested in a single model room. Verification of the test stand concept took place via measurements of the velocity and temperature field in front of the radiator, which were compared with measurements in a thermal test stand with realistic room dimensions. [German] Da die Parameter zur Beschreibung von Raumluftstroemungen bei einer Verkleinerung der charakteristischen Laenge ein gegensaetzliches Verhalten aufweisen, koennen die Untersuchungen von Raumluftstroemungen nicht kleinskaliert werden. Deswegen wird am E.ON Energy Research Center ein ''Hardware-in-the-Loop'' (HiL) -Pruefstand entwickelt, welcher ein reales hydraulisches Heizungsnetz einer Wohnung oder eines Gebaeudes mit geringem Platzbedarf nachbildet. In den Pruefstand, welcher aus mehreren vernetzten Modellraeumen besteht, werden typische Heizkoerper eingebaut und nur das umschliessende Volumen wird verkleinert. Die Modellraeume haben jeweils ein Volumen von 3-4 m{sup 3}. Abhaengig von der Waermeabgabe der Heizkoerper

  3. Entwicklung eines Summenparameters für potenziell bioakkumulierbare Stoffe (PBS) im Abwasser

    OpenAIRE

    Stenz, Georg

    2001-01-01

    Es wurde ein Summenparameter für potenziell bioakkumulierbare Stoffe (PBS) im Abwasser entwickelt. Der Summenparameter soll als Instrumentarium zur Überwachung von Einleitungen, Emissionen und Verlusten an anreicherungsfähigen Stoffen eingesetzt werden, da die Bioakkumulation besonders für marine Ökosysteme ein Gefährdungskriterium darstellt. Stoffe werden nach dem „Technical Guidance Document (TGD)“ als potenziell bioakkumulierbar bertrachtet, wenn deren log POW-Wert größer als drei ist. Der...

  4. Vermögensmaximierung durch Stiftungen als Unternehmensträger? Eine Analyse der Steuerwirkungen

    OpenAIRE

    Franke, Günter; Herrmann, Markus

    1993-01-01

    Einige große deutsche Unternehmen werden von privaten gemeinnützigen Stiftungen getragen. Dies wirft die Frage auf, weshalb eine solche Lösung der üblichen Vorgehensweise, bei der natürliche Personen Gesellschafter eines Unternehmens sind, vorgezogen wird. In diesem Beitrag wird untersucht, ob und unter welchen Voraussetzungen der Hauptgesellschafter einer Kapitalgesellschaft das Vermögen seiner Erben erhöhen kann, indem er seine Gesellschaftsanteile einer gemeinnütziger Stiftung überträgt un...

  5. Therapie einer postoperativ entstandenen zystischen Raumforderung mit Picibanil (OK-432): Ein Fallbericht

    OpenAIRE

    Schlüter, A; Weller, P; Mattheis, S; Lang, S

    2014-01-01

    Einleitung: Picibanil (=OK432) ist ein Lysat bestehend aus Penicillin G und mit H2O2 attenuiertem Streptococcus pyogenes. In den letzten Jahrzehnten wurde Picibanil zur Therapie von Pleuraergüssen, Lymphangiomen, Chylusfisteln, medianen Halszysten und Ranulae eingesetzt. Es verursacht eine Immunreaktion mit aseptischer Entzündung. Dies führt zu einer Zerstörung des Endothels und konsekutiv zu einer Verklebung und Schrumpfung des Zystensacks.Falldarstellung: Wir berichten über einen 40-jähri...

  6. EINE UNTERSUCHUNG UBER DIE NUTZUNG DER WINDENERGIE IN DER WELT UND IN DER TURKEI

    Directory of Open Access Journals (Sweden)

    Aydoğan ÖZDAMAR

    2000-02-01

    Full Text Available In dieser Arbeit wurde die Nutzung der in Zukunft bei der Energieversorgung eine wichtige Rolle zuspielende Windenergie allgemein bewertet. Zu dem Zweck wurde zuerst Potential und geschichtliche Entwicklung der Windenergienutzung in der Welt und in der Türkei, Entstehung des Windes und Windmessungen betrachtet. Anschließend wurden Kritiken über die Unstetigkeit der Windenergie, der Deckung des Energiebedarfs eines Hauses vollständig von Windenergie und der Wirtschaftlichkeit des Windstroms behandelt und Antworten mit konkreten Beispielen auf diese Kritiken gegeben.

  7. Die Restaurierung eines Meisterwerkes live erleben. Stereomikroskopie hilft Kunstschätze zu erhalten

    DEFF Research Database (Denmark)

    Wadum, Jørgen

    2008-01-01

    können bis voraussichtlich Juni 2008 die konservierung, restaurierung und wissenschaftliche untersuchung eines der imposantesten gemälde von Jacob Jordaens (1593–1678) hautnah miterleben: das 2,80 × 4,67 m große „Der Zinsgroschen – Petrus findet die Münze im Maul des fischs oder Die fähre nach Antwerpen......“. Eine offene Werkstatt inmitten des Museums eröffnet spannende einblicke in das innerste des Meisterwerkes sowie in Techniken der konservierungs- und restaurierungsarbeit. Ziel des rund zehnmonatigen projektes ist es, neben der restaurierung, die Materialien, Techniken, Bedeutung...

  8. Eine praktische Anwendung von CMC-Flächen in der Bionik

    OpenAIRE

    Apeltauer, Christian

    2011-01-01

    Die vorliegende Arbeit beschäftigt sich mit den theoretischen Grundlagen für die Entwicklung von Oberflächen, die unter Wasser möglichst lange eine Luftschicht an sich halten können. Ein natürliches Vorbild für solche Oberflächen ist die Pflanze Salvinia molesta; technisch interessieren solche Oberflächen zur Verringerung des Wasserwiderstandes von Schiffen und als Schutz vor Besiedlung durch Wasserorganismen. Wichtigste Gleichung bei der Entwicklung solcher Oberflächen ist...

  9. Wirkungen eines Bifidojoghurts mit Laktulose und eines konventionellen Joghurts auf Darmphysiologie und bakterielle Metaboliten als Risikomodulatoren der Kolonkarzinogenese sowie Darmflora und Blutlipide bei gesunden Erwachsenen

    OpenAIRE

    Gerlach, Stefanie

    2007-01-01

    Hintergrund: Probiotische und synbiotische Milchprodukte zählen zu den "funktionellen Lebensmitteln", denen im Vergleich zu herkömmlichen Produkten ein gesundheitsfördernder Zusatznutzen zugeschrieben wird. Dabei wird diskutiert, ob die Gesundheit bereits gesunder Personen noch optimierbar ist, ob und in welcher Weise die Darmflora gezielt "günstig" modifiziert werden kann und/oder ob diese Manipulation zu messbaren gesundheitsfördernden Veränderungen metabolischer und systemischer Biomarker ...

  10. Jaguar und Wildschwein, eine Fabel für Menschen oder: Der Aufstieg des Jaguars zum Himmel, ein Karriereleitfaden für Wissenschaftler

    OpenAIRE

    Münzel, Mark

    2017-01-01

    Der sog. „Indianische Perspektivismus“ (Perspectivismo Ameríndio) stellt einen Versuch dar, europäische Philosophie, nicht zuletzt die Machtphantasien eines faschistoid verstandenen Nietzsche, südamerikanischen Schamanen anzulasten. Das erzähle ich in Form einer Tierparabel, die den Stil südamerikanischer indianischer Tierparabeln nachahmt, dabei aber den Schematismus des Strukturalismus und des Perspektivismus karikiert. The so-called „Amerindian Perspectivism“ (Perspectivi...

  11. MaxControl : ein objektorientiertes Werkzeug zur automatischen Erstellung von 3D-Computeranimationsfilmen und dessen Integration in eine professionelle 3D-Animationssoftware

    OpenAIRE

    Paul, Jan

    2008-01-01

    Durch die wachsende Computerleistung können 3D-Computeranimationen sehr komplexe Szenen mit ebenso komplexen zeitlichen Abläufen animiert darstellen. Jedoch ist neben der Erstellung einer komplexen Szene auch deren Animation entsprechend aufwendig, wenn keine Automatisierungen genutzt werden können. Das in dieser Arbeit entwickelte Werkzeug MaxControl ist ein System zur automatischen Animation von nicht-interaktiven 3D-Animationsfilmen. Dies wird durch die Simulation von Verhaltensweisen erre...

  12. Mechatronic Carlab - Eine System-Entwicklungsumgebung mit realen und virtuellen mechatronischen Fahrzeug-Komponenten

    OpenAIRE

    Bünte, Tilman

    2004-01-01

    Bei der Entwicklung mechatronischer Komponenten sind verschiedene Ingenieurdisziplinen beteiligt: Das Fachwissen auf dem Gebiet Mechanik, Elektronik und Informatik ist gefragt, wenn auf kleinem Raum die unterschiedlichsten Funktionen zu einem Produkt integriert werden. Beim DLR in Oberpfaffenhofen hat diese Technologie schon Tradition - ein großes Anwendungsfeld ist inzwischen die Fahrzeugtechnik

  13. [Reinhold Reith. Torsten Meyer (Hrsg.) Luxus und Konsum : eine historische Annäherung] / Raimo Pullat

    Index Scriptorium Estoniae

    Pullat, Raimo, 1935-

    2009-01-01

    Arvustus: Reith, Reinhold. Torsten Meyer (Hrsg.) Luxus und Konsum : eine historische Annäherung. Cottbuser Studien zur Geschichte von Technik, Arbeit und Umwelt. hrsg. von Günter Bayerl. Bd. 21. 2003. Collegium Johann Beckmann'i kolmanda teaduskonverentsi ettekannete kogumikust

  14. Mehrkörpersimulation eines ebenen Koppelgetriebes mittels Matlab / ADAMS -Co-Simulation

    OpenAIRE

    Gollee, Christian; Troll, Clemens

    2017-01-01

    Mit Hilfe der Matlab/ADAMS-Co-Simulation wird ein ebenes Koppelgetriebe (5- Gelenk) untersucht und anschließend die Wirkpaarung mit einem Stückgut betrachtet. Dabei werden verschiedene Modellierungsstufen angewendet und die Simulationsergebnisse Messergebnissen vom Versuchsstand gegenübergestellt. Daneben wird die grundlegende Herangehensweise beim Einsatz dieser Simulationswerkzeuge erläutert.

  15. Ustekinumab in der Therapie der Pustulosis palmoplantaris - Eine Fallserie mit neun Patienten.

    Science.gov (United States)

    Buder, Valeska; Herberger, Katharina; Jacobi, Arnd; Augustin, Matthias; Radtke, Marc Alexander

    2016-11-01

    Die Pustulosis palmoplantaris ist eine chronisch entzündliche Hauterkrankung, die mit bedeutenden Einschränkungen der Lebensqualität und der Belastbarkeit einhergeht. Aufgrund von Zulassungsbeschränkungen und einem häufig therapierefraktären Verlauf sind die Behandlungsmöglichkeiten limitiert. Nach zuvor frustranen Therapien erhielten 9 Patienten mit Pustulosis palmoplantaris nach Ausschluss einer latenten Tuberkulose Ustekinumab (45 mg Ustekinumab bei  100 kg KG) in Woche 0, 4, 12 und 24. Reguläre Visiten erfolgten nach 4 und 12 Wochen, im weiteren Verlauf alle 12 Wochen. Das Durchschnittsalter bei Therapiebeginn betrug 48 Jahre. Drei Patienten waren männlich. Bei n  =  4 Patienten (44,4 %) wurde eine Verbesserung um 75 % des Palmoplantar-Psoriasis-Area-Severity-Index (PPPASI) erreicht. Insgesamt verbesserte sich der PPPASI nach 24 Wochen durchschnittlich um 71,6 %. Eine komplette Abheilung zeigte sich bei n  =  2 Patienten nach 24 Wochen. Bis auf lokale Injektionsreaktionen und leichte Infekte wurden keine unerwünschten Wirkungen beobachtet. Die Fallserie ist ein weiterer Beleg für die Wirksamkeit und Verträglichkeit von Ustekinumab in der Therapie der Pustulosis palmoplantaris. Zur Beurteilung der Langzeitwirkung und -sicherheit sowie der Wirksamkeit einer intermittierenden Therapie sind kontrollierte Studiendaten sowie Beobachtungen im Rahmen von Patientenregistern notwendig. © 2016 Deutsche Dermatologische Gesellschaft (DDG). Published by John Wiley & Sons Ltd.

  16. Ein kurzer Überblick über die Geschichte der Fledermausforschung

    NARCIS (Netherlands)

    Eisentraut, M.

    1970-01-01

    Es ist das hohe Verdienst unserer Kollegen aus der CSSR, den Anstoss zu einem Zusammentreffen und einer engeren Zusammenarbeit der Chiropteren-Forscher aus aller Welt gegeben zu haben. Sie ergriffen, wie Sie wissen, die Initiative und luden 1968 zu der ersten internationalen Tagung in ihr Land ein.

  17. Steht uns eine gesellschaftliche Stigmatisierung der Nanotechnologie bevor? Lehren aus der Biotechnologiedebatte

    DEFF Research Database (Denmark)

    Scholderer, Joachim

    2008-01-01

    Ergebnisse zeigen, dass die Nanotechnologie zur Zeit noch ein weitgehend weisser Fleck in der öffentlichen Wahrnehmung ist. Von den ca. 45%, die mit dem Konzept Nanotechnologie überhaupt vertraut sind, werden Nano- und Biotechnologie nur bedingt als ähnlich wahrgenommen. Im dritten Abschnitt wird die...

  18. Was ist eine Frau? Sexualität, Begehren und Einschreiben

    Directory of Open Access Journals (Sweden)

    Alejandra Barron

    2016-07-01

    Full Text Available Da die menschliche Sexualität nicht natürlich ist, reichen anatomische oder biologische Argumente nicht, um sie aufzuklären. Freud entdeckte, dass der Geschlechtsunterschied durch den Signifikanten vermittelt wird, denn Triebe als solche ignorieren die Dichotomie Mann/Frau. Jacques Lacan greift diesen vernachlässigten Aspekt auf und hebt die Schicksale des Subjekts mit der Sprache durch seine Lehre als etwas Fundamentales hervor. In Anbetracht der Prämisse, dass «die Neurose wie eine Frage strukturiert» sei, drücken die komplexen symptomatischen Manifestationen der Hysterika ihren Versuch aus, sich in einen Diskurs einzuschreiben, der von der Unmöglichkeit, eine kategoriale Antwort auf das Rätsel der Weiblichkeit zu geben, geprägt ist. Deren Frage lautet also: Was ist eine Frau? Ein Signifikant ergibt nur Sinn in Verbindung zu einem anderen Signifikanten und daher werden wir alle den durch den Signifikanten vermittelten Sachen gegenüber unabänderlich entfremdet. Aus dieser Sichtweise heraus möchte ich mich mit der Frage der Heterosexualität auseinandersetzen.

  19. [Jean-Daniel Strub. Der gerechte Friede. Spannungsfelder eines friedensethnischen Leibegriffs.] / Andreas Pawlas

    Index Scriptorium Estoniae

    Pawlas, Andreas

    2012-01-01

    Arvustus: Strub, Jean-Daniel. Der gerechte Friede. Spannungsfelder eines friedensethnischen Leibegriffs. (Forum Systematik. beiträge zur Dogmatik, Ethik und ökumenischen Theologie, hg von Johannes Brosseder, Johannes Fischer und Joachim Track, Band 36), Verlag W. Kohlhammer, Stuttgart 2010

  20. Aufbau eines "Fracture-Liaison"-Dienstes (FLD in der Steiermark: Erste Erfahrungen

    Directory of Open Access Journals (Sweden)

    Sampl E

    2011-01-01

    Full Text Available Die Osteoporose und die damit assoziierten Frakturen stellen ein globales Gesundheitsproblem dar. Trotz zahlreicher präventiver Möglichkeiten, die uns heute zur Verfügung stehen, sind weiterhin große Defizite in der Diagnostik und Therapie der Osteoporose vorhanden. Die meisten Patienten werden nach einer Fragilitätsfraktur nicht weiter osteologisch abgeklärt. Im Oktober 2009 begann in der Steiermark die Implementierung des „Fracture-Liaison“- Dienstes (FLD an 4 unfallchirurgischen Abteilungen. Ziel dieses Projekts ist es, möglichst alle Patienten ab dem 50. Lebensjahr, welche aufgrund einer „Low-trauma“-Fraktur stationär behandelt werden, zu erfassen, weitere diagnostische und therapeutische Schritte einzuleiten und somit auch das Risiko für Folgefrakturen zu reduzieren. In den ersten 6 Monaten wurden 404 Patienten erfasst. Nur 15 % hatten zum Zeitpunkt der Fraktur eine osteoprotektive Therapie, obwohl 52 % bereits zumindest eine prävalente osteoporotische Fraktur aufwiesen. Lediglich 59 Patienten (15 % hatten einen normalen 25- Hydroxyvitamin-D-Serumspiegel von 30 ng/mL, wobei 37 Patienten (62 % davon vorsubstituiert waren. Diese ersten Auswertungen zeigen die eklatante Unterversorgung in diesem Patientenkollektiv, welche in Kombination mit der pandemisch vorliegenden Vitamin-D-Defizienz die hohe Dringlichkeit eines interdisziplinären Managements über die chirurgische Versorgung hinaus unterstreicht.

  1. Potenziale eines ‚Dispositive Turn‘ in der Medienpädagogik

    Directory of Open Access Journals (Sweden)

    Patrick Bettinger

    2016-09-01

    Full Text Available Rezension zu: Caborn Wengler, Joannah, Britta Hoffarth, und Łukasz Kumięga, Hrsg. 2013. Verortungen des Dispositiv-Begriffs. Analytische Einsätze zu Raum, Bildung, Politik. Wiesbaden: Springer Fachmedien Wiesbaden. doi:10.1007/978-3-531-94260-5.

  2. Plain film emergency radiology of child abuse: a strategy; Die akute Roentgendiagnostik der Kindesmisshandlung: Eine Strategie

    Energy Technology Data Exchange (ETDEWEB)

    Oestreich, A.E. [Children`s Hospital Medical Center, Cincinnati OH (United States). Dept. of Radiology

    1998-04-01

    A strategy is proposed for the dedicated interpretation of possible radiographic plain film signs that are suspicious for indicating child abuse. For each sign, the features `PRO` raise the question of abuse, while radiographic or clinical findings `CON` suggest an alternate explanation. Birth trauma, oesteogenesis imperfecta, rescue trauma, and metastatic neuroblastoma are among the many entities cited. A triad of situations may lead a radiologist to look systematically for changes from abuse; a triad of resolutions may result from the search. Periosteal reaction is the major factor in dating of fractures; physiologic periosteal reaction of infancy and periosteal reaction from previous fracture must be considered when so dating fractures. (orig.) [Deutsch] Es wird eine Strategie fuer die genaue Interpretation roentgenologischer Befunde, die auf eine Kindesmisshandlung hindeuten koennen, vorgeschlagen. Fuer jeden Befund werfen die unter `PRO` aufgefuehrten Merkmale die Frage nach einer Kindesmisshandlung auf, waehrend radiologische und klinische Befunde unter `CON` andere Erklaerungen nahelegen. Geburtstrauma, Osteogenesis imperfecta, Rettungstrauma und metastasierendes Neuroblastom sind unter den vielen zitierten Differentialdiagnosen. Drei moegliche Situationen koennen den Radiologen dazu veranlassen, systematisch nach Zeichen einer Kindesmisshandlung zu suchen, 3 moegliche Loesungen koennen aus dieser Suche hervorgehen. Eine Periostreaktion ist ein Kardinalbefund zur Datierung von Frakturen. Physiologische Periostreaktionen im fruehen Kindesalter und Periostreaktionen durch fruehere Frakturen muessen bei einer solchen Datierung von Frakturen mitbedacht werden. (orig.)

  3. Two-stage supercharging of a passenger car diesel engine; Zweistufige Aufladung eines Pkw-Dieselmotors

    Energy Technology Data Exchange (ETDEWEB)

    Wittmer, A.; Albrecht, P.; Becker, B.; Vogt, G.; Fischer, R. [Erphi Elektronik GmbH, Holzkirchen (Germany)

    2004-07-01

    Two-stage supercharging of internal combustion engines with specific capacities beyond 70 kW/l opens up new options for smaller charge volumes. A low-pressure and a high-pressure supercharger are connected in series, with by-passes. The control strategy is described in this contribution using a model of exhaust counterpressure. The potential of a two-stage supercharged diesel engine with CR injection was proved in two engines and in dynamic driving tests. The new concept offers optimum chances for downsizing provided that the driving performance is not affected. (orig.) [German] Die zweistufige Aufladung von Verbrennungsmotoren eroeffnet mit spezifischen Leistungen jenseits von 70 kW/l weitere Moeglichkeiten der Hubraumverkleinerung. Dabei werden ein Niederdruck- und ein Hochdrucklader mit Umgehungsleitungen in Reihe geschaltet. Die erforderliche Regelungsstrategie zum kontrollierten Uebergang von einer Stufe auf die naechste erfolgt in dem hier vorliegenden Beitrag anhand eines Modells fuer den Abgasgegendruck. Hierbei wird das Regelorgan so angesteuert, dass sich der gewuenschte Druck vor den Turbinen einstellt. An zwei Motoren konnten stationaere Ergebnisse das Leistungspotential eines zweistufig aufgeladenen Dieselmotors mit 'Common Rail' Einspritzung nachgewiesen werden. Die dynamischen Fahrversuche belegen eindrucksvoll den schnellen Ladedruckaufbau auch aus tiefen Drehzahlbereichen bei gleichzeitig gutem Uebergangsverhalten von der Hochdruck- auf die Niederdruckstufe. Damit bietet der zweistufig aufgeladene Dieselmotor mit dem hier dargestellten Regelungsverfahren optimale Voraussetzungen fuer 'Downsizing' unter der Randbedingung, dass moeglichst keine Einbussen bei den Fahrleistungen hinzunehmen sind. (orig.)

  4. Environmental pollution: Measurable quantity or a problem of general risk acceptance?; Die stoffliche Belastung der Umwelt. Eine Systemgroesse oder eine Frage der allgemeinen Risikoakzeptanz?

    Energy Technology Data Exchange (ETDEWEB)

    Ballschmiter, K.

    2001-08-01

    Having different disciplines give different meanings to one same word is not unusual; using the word 'risk' in an environmental context has its specific importance. The classical definitions of 'risk' as the possibility of an adverse incident have been projected in the environmental and human health study areas. Risk-acceptance and risk-preference are general factors of the everyday life and even find a role in economics. However, their use as parameters in the field of environmental hazards should be avoided, or at least be defined as to their meaning. The environment is a complex system of mass fluxes and interdependencies that can be observed and described but not regulated in its global dimension. Technology assessment has here a specific task in defining precaution as the prevention of hazards as well as the 'repair in advance' of potential environmental risks of global dimensions. The globe as a whole and many of its parts cannot be subjected to 'end of the pipe' repair strategies. (orig.) [German] Das Phaenomen der unterschiedlichen Fuellung eines Begriffs in unterschiedlichen Disziplinen ist nicht neu; es wird aber besonders deutlich bei der Verwendung des Begriffes Risiko, wenn es um reale oder nur als moeglich angesehene Gefaehrdungen im Umweltbereich geht. Es werden die klassischen Definitionen eines Risikos, d.h. des moeglichen Eintritts eines Schadensereignisses, in ihrer Anwendung auf moegliche Schadensereignisse fuer Umwelt und Gesundheit gegenueber gestellt. Es wird die These vertreten, dass spezifische Formen der Risikoakzeptanz und Risikopraeferenz sehr wohl Faktoren der persoenlichen Lebensgestaltung sein koennen und auch in wirtschaftlichen Unternehmungen definierbare Groessen sind, dass sie aber fuer vom Menschen angestossene Veraenderungen in der Umwelt und hier insbesondere im Bereich der stofflichen Vorgaenge in den globalen Dimensionen nicht eingebracht werden koennen oder wenigstens eine sehr eigene

  5. Epiploic appendagitis of caecum: a diagnostic dilemma [Appendicitis epiploica des Blinddarms: ein diagnostisches Dilemma

    Directory of Open Access Journals (Sweden)

    Rashid, Arshad

    2012-10-01

    Full Text Available [english] Epiploic appendagitis is a rare cause of acute abdomen. Depending on the site of occurrence, it can mimic any cause of acute abdomen or disease of the colon and caecal appendix; making its preoperative diagnosis very difficult. We present here a case of a 7-year-old boy misdiagnosed preoperatively as acute appendicitis and later on, upon surgical exploration, found to have caecal appendagitis. The affected epiploic appendage was removed and the patient had an uneventful recovery. We also review the relevant literature and discuss the measures to overcome this diagnostic dilemma. General surgeons should be aware of this self-limiting disease and consider it as a differential diagnosis of acute abdomen.[german] Appendicitis epiploica oder epiploische Appendagitis ist eine seltene Ursache des akuten Abdomens. Je nach Ort des Auftretens kann sie jede Ursache für akuten Unterleibsschmerz oder Erkrankungen des Dickdarms und Appendix vermiformis imitieren, was ihre präoperative Diagnose sehr schwierig macht. Wir präsentieren hier den Fall eines alten Jungen, bei dem präoperativ akute Blinddarmentzündung diagnostiziert wurde. Beim chirurgischen Eingriff stellte sich dann eine Appendicitis epiploica des Blinddarms als Befund heraus. Der betroffene Appendix epiploica wurde entfernt und der Patient erholte sich ohne besondere Vorkommnisse. Wir geben auch eine Übersicht über die relevante Literatur und diskutieren die Maßnahmen, um dieses diagnostische Dilemma zu überwinden. Allgemeine Chirurgen sollten sich dieser selbstlimitierenden Krankheit bewusst sein und sie als eine Differentialdiagnose bei akutem Abdomen in Betracht ziehen.

  6. Untersuchungen zur Anwendbarkeit eines integrierten Nachweissystems für Penicillin-Rückstände in Kuhmilch und Ziegenmilch

    OpenAIRE

    Kress, Claudia

    2010-01-01

    In der vorliegenden Arbeit wurde die Anwendbarkeit eines integrierten Nachweissystems für Penicillin-Rückstände in Kuhmilch und Ziegenmilch überprüft. Der zweite Schwerpunkt dieser Arbeit lag auf der Hemmstoffbelastung von Ziegenmilch, d.h. es sollte ein Überblick über die Belastung der in Hessen produzierten Ziegenmilch mit Penicillin-Rückständen gewonnen werden. Die „Kernmethode“ des integrierten Nachweissystems für Penicillin-Rückstände in Kuhmilch und Ziegenmilch ist ein...

  7. Entwicklung der Reglementierung von 10 MEM-Berufen im Kontext von Bildungsreformen und dem Wandel in der Arbeitswelt: Eine Kurzstudie im Auftrag von LIBS: Eine Kurzstudie im Auftrag von LIBS Industrielle Berufslehren Schweiz, Baden

    OpenAIRE

    Egg, Maria Esther; Renold, Ursula

    2015-01-01

    Im Auftrag der LIBS Industrielle Berufslehren Schweiz, hat die KOF die Entwicklung von 10 MEM1-Berufsbildern seit dem ersten Berufsbildungsgesetz dargestellt und diese eingebettet in eine kurze Zusammenfassung der wichtigsten Etappenschritte des Schweizer Berufsbildungssystems.

  8. Review: Holger Stoecker: Afrikawissenschaften in Berlin von 1919 bis 1945. Zur Geschichte und Topographie eines wissenschaftlichen Netzwerkes (2008 Buchbesprechung: Holger Stoecker: Afrikawissenschaften in Berlin von 1919 bis 1945. Zur Geschichte und Topographie eines wissenschaftlichen Netzwerkes

    Directory of Open Access Journals (Sweden)

    Katrin Bromber

    2009-05-01

    Full Text Available Review of the monograph: Holger Stoecker: Afrikawissenschaften in Berlin von 1919 bis 1945. Zur Geschichte und Topographie eines wissenschaftlichen Netzwerkes, Stuttgart: Franz Steiner Verlag 2008, ISBN 978-3-515-09161-9, 359 pages. Besprechung der Monographie: Holger Stoecker: Afrikawissenschaften in Berlin von 1919 bis 1945. Zur Geschichte und Topographie eines wissenschaftlichen Netzwerkes, Stuttgart: Franz Steiner Verlag 2008, ISBN 978-3-515-09161-9, 359 Seiten.

  9. Review: Findeisen, Genia: Frauen in Indonesien: Geschlechtergleichheit durch Demokratisierung? Eine Analyse des Demokratisierungsprozesses aus Frauenperspektive (2008 Buchbesprechung: Findeisen, Genia: Frauen in Indonesien: Geschlechtergleichheit durch Demokratisierung? Eine Analyse des Demokratisierungsprozesses aus Frauenperspektive (2008

    Directory of Open Access Journals (Sweden)

    Carola von der Dick

    2009-04-01

    Full Text Available Review of the monograph: Findeisen, Genia: Frauen in Indonesien: Geschlechtergleichheit durch Demokratisierung? Eine Analyse des Demokratisierungsprozesses aus Frauenperspektive Wettenberg: Johannes Herrmann J&J Verlag, 2008, ISBN 978-3-937983-11-0, 434 pages Besprechung der Monographie: Findeisen, Genia: Frauen in Indonesien: Geschlechtergleichheit durch Demokratisierung? Eine Analyse des Demokratisierungsprozesses aus Frauenperspektive Wettenberg: Johannes Herrmann J&J Verlag, 2008, ISBN 978-3-937983-11-0, 434 Seiten

  10. Hat das humane Wachtumshormon (hGH eine Relevanz in der Kontrolle der penilen Erektion?

    Directory of Open Access Journals (Sweden)

    Ückert St

    2003-01-01

    Full Text Available Allgemeines: Schon seit langem wird die Frage einer Beteiligung des Hypophysenhormons Human Growth Hormone (Wachstumshormon, hGH, GH an der Kontrolle der sexuellen Maturation und der Reproduktionsfunktion des Menschen diskutiert. Die Symptome eines GH-Defizits beim Mann sind u. a. allgemeine Antriebslosigkeit, Oligo- oder Azoospermie, eine Verminderung der Libido sowie eine Beeinträchtigung der normalen Erektionsfähigkeit. Es wird vermutet, daß die biologischen Effekte des GH eine durch das Somatomedin Insulin-like Growth Factor 1 (IGF-1 vermittelte Stimulation der Produktion von Stickoxid (NO durch die endotheliale und neuronale Form des Enzyms NO-Synthase einschließen. So konnte gezeigt werden, daß physiologische Konzentrationen von GH den adrenergen Tonus isolierter Streifenpräparate humaner Schwellkörpermuskulatur antagonisieren und den Gewebegehalt des Second Messengers cGMP erhöhen. Im Rahmen dieser Studie haben wir in einem Kollektiv gesunder Männer und in einer Gruppe von Patienten mit erektiler Dysfunktion (ED die systemischen und cavernösen Serumkonzentrationen von GH während verschiedener peniler Funktionszustände, d. h. verschiedener Stadien der sexuellen Erregung, untersucht. Methoden: 35 gesunden männlichen Probanden und 45 Patienten mit einer ED organogener oder psychogener Genese wurden während der penilen Flakzidität, Tumeszenz, Rigidität - dieses Stadium wurde nur von den Gesunden erreicht - und Detumeszenz zeitgleich Blutproben aus einer Cubitalvene und dem Corpus cavernosum penis entnommen. Tumeszenz und Rigidität wurden durch visuelle und taktile Stimulation ausgelöst. Die Quantifizierung von GH in Aliquots der Serumfraktionen erfolgte mit immunradiometrischen Methoden (IRMA. Ergebnisse: In der Gruppe der gesunden Männer stieg die mittlere systemische und cavernöse Serumkonzentration von GH während der Tumeszenz an, während in den Phasen der Rigidität und Detumeszenz eine Abnahme registriert wurde

  11. [Sven Jüngerkes. Deutsche Besatzungsverwaltung in Lettland 1941-1945. Eine Kommunikations- und Kulturgeschichte nationalsozialistischer Organisationen] / Toomas Hiio

    Index Scriptorium Estoniae

    Hiio, Toomas, 1965-

    2012-01-01

    Arvustus: Jüngerkes, Sven.Deutsche Besatzungsverwaltung in Lettland 1941-1945. Eine Kommunikations- und Kulturgeschichte nationalsozialistischer Organisationen (Historische Kulturwissenschaft, 15). (Konstanz: UVK Verlagsgesellschaft mbH, 2010)

  12. [Anja Wilhelmi. Lebensweltlen von Frauen der deutschen Oberschicht im Baltikum (1800-1939). Eine Untersuchung anhand von Autobiographien] / Alexander Ewig

    Index Scriptorium Estoniae

    Ewig, Alexander, 1980-

    2011-01-01

    Arvustus: Wilhelmi, Anja. Lebenswelten von Frauen der deutschen Oberschicht im Baltikum (1800-1939). Eine Untersuchung anhand von Autobiographien. (Veröffentlichungen des Nordost-Instituts, 10.) (Wiesbaden : HArrassowitz 2008)

  13. Vom Gewohnheitstier zur reflektierten Nutzung – Ein Diskussionsanstoß über Betriebssysteme und Programmnutzung nachzudenken

    Directory of Open Access Journals (Sweden)

    Christian Berger

    2010-06-01

    Full Text Available Das Nutzungsverhalten bei digitalen Medien entspringt mehr der Gewohnheit als dem vorhandenen Angebot. Ein kleiner Einblick in die Philosophie und Möglichkeiten der Nutzung von Freier Software.

  14. Wirksamkeit und Verträglichkeit von Mepartricin (Iperplasin® bei benigner Prostatahyperplasie: Ergebnisse eine Anwendungsbeobachtung

    Directory of Open Access Journals (Sweden)

    Madersbacher H

    2000-01-01

    Full Text Available Ziel der Studie: Das Ziel dieser Anwendungsbeobachtung war es, Wirksamkeit und Verträglichkeit von Mepartricin-Filmtabletten (Iperplasin® bei der Behandlung von Patienten mit benigner Prostatahyperplasie (BPH bzw. Prostatavergrößerung (BPE zu untersuchen. Patienten und Methoden: Im Rahmen einer österreichweiten Anwendungsbeobachtung wurden Patienten mit unterer Harntraktsymptomatik (LUTS, verursacht durch eine BPH/BPE, untersucht. Die wichtigsten Einschlußkriterien waren eine reduzierte maximale Harnflußrate (Qmax von 6-15 ml/sec und ein Restharn 100 ml. Als Studienmedikation erhielten die Patienten 3 x 1 Tbl. Iperplasin®. Ein, drei und sechs Monate nach Studienbeginn wurden die Patienten nachkontrolliert. Die wichtigsten Zielparameter waren eine Verbesserung des Internationalen Prostata Symptomen Scores (IPSS, der Lebensqualitätsfrage des IPSS (IPSS-Ql sowie des Qmax. Ein Einfluß auf die Sexualität wurde anhand des GRISS-Scores erhoben. Ergebnisse: Insgesamt wurden 130 Patienten (67,4 ± 8,4 Jahre; Durchschnitt ± Standardabweichung in diese Studie aufgenommen. Der IPSS sank von 16,4 ± 5,0 zu Studienbeginn auf 9,4 ± 6,0 (-41 %; p 0,0001 nach 6 Monaten Therapie, der IPSS-Ql von 3,3 ± 0,8 auf 2,0 ± 1,1 (-39 %; p 0,0001. Im gleichen Zeitraum stieg der Qmax von 11,3 ± 6,0 auf 12,5 ± 6,4 ml/sec (+11 %; p 0,0001, der Restharn sank von 49 ± 36 ml auf 33 ± 35 ml (-33 %; p 0,0001. Insgesamt war die Therapie mit Iperplasin® gut verträglich, bei 10 % traten im Rahmen der Studie unerwünschte Ereignisse oder interkurrente Erkrankungen auf, bei zwei Patienten mußte eine TURP durchgeführt werden. Der GRISS-Score blieb über den gesamten Studienzeitraum konstant. Schlußfolgerung: Diese Anwendungsbeobachtung belegt die Sicherheit von Iperplasin® bei Patienten mit LUTS und BPH/BPE, vor allem kommt zu keiner Beeinträchtigung der Vita sexualis. Obwohl eine signifikante Verbesserung von subjektiven und objektiven Parametern in dieser

  15. A new verification method for vehicle electronics; Ein neues Testverfahren zur Verifikation der Fahrzeugelektrik/-elektronik

    Energy Technology Data Exchange (ETDEWEB)

    Sigwart, A.; Bockemuehl, P. [Ford-Werke AG, Koeln (Germany)

    2001-07-01

    A reliable and durable design of electronic and electrical components of a vehicle is without an adequate verification method inconceivable. Until now the supplier were responsible to verify their components on test benches. Later in the development process the durability is being tested on the proving ground or on hot/cold climate trips. This has been found as not robust enough to deliver high quality to our customer. Due to complex relation between the subsystems and various failure modes a new verification method has been developed. To overcome quality issues a project has been initiated to combine road load conditions, full environmental conditions with driverless actuation. Central part of the project is a small handling robot positioned in the car instead of the driver simulating the customer behaviors by actuating all electrical switches, while the vehicle is in an environmental test chamber (temperature, humidity and sunload) and on a 4-poster road simulator. With an automated procedure the road loads and environmental conditions are combined with the actuation of all electrical components. With this method more complex tasks can be realized. It is now possible to simulate real world customer usage within a short time frame. (orig.) [German] Ein ausfallsicheres Design elektrischer / elektronischer Komponenten im Fahrzeug kann ohne einen Versuch mit kundenrelevanten Parametern nicht realisiert werden. Bisher wurden diese Komponenten beim Lieferanten als Einzelteil und spaeter im Entwicklungsprozess dann im Fahrzeug waehrend der Dauerlauferprobung getestet. Aufgrund der komplexen Zusammenhaenge aller Teilsysteme und der Vielfalt von Versagensarten wurde bei Ford ein neues Testverfahren, ein sog. Key Life Test, entwickelt. Key Life Tests konzentrieren sich auf die wichtigsten Beanspruchungen, die fuer den Funktionsverlust und/oder die im realen Einsatz auftretenden Ausfallarten verantwortlich sind. Die Basis hierfuer bildet ein klimatisierter Testroboter, der

  16. Der Einfluß der Ablauforganisation auf die Effizienz von Entscheidungen: Eine empirische Untersuchung am Beispiel von Bilanzanalysen

    OpenAIRE

    Gemünden, Hans Georg

    1987-01-01

    Der vorliegende Beitrag widmet sich einem in der Organisationstheorie stark vernachlässigten Problem: der Ablauforganisation von Entscheidungen. Am Beispiel von Bilanzanalysen wird empirisch geprüft, in welcher Weise eine Gliederung des Prozesses nach Verrichtungen oder Objekten die Qualität der Analyse beeinflußt. Hierzu wird ein validiertes Konzept zur Messung der Qualität von Bilanzanalysen entwickelt. Es wird gezeigt, wie man mittels prozeßbegleitender experimenteller Organisationsforschu...

  17. Narrative Expositionstherapie (NET) für Menschen nach Gewalt und Flucht : Ein Einblick in das Verfahren

    OpenAIRE

    Schauer, Maggie; Elbert, Thomas; Neuner, Frank

    2017-01-01

    Die Narrative Expositionstherapie (NET) ist ein effizientes Kernelement der Behandlung von Kindern und Erwachsenen, die unter den Folgen von Mehrfach- und Komplextraumatisierung nach Gewalt und Flucht leiden. Die chronologische Erarbeitung einer Narration, der individuellen Lebensgeschichte in der NET ermöglicht Traumaüberlebenden eine Gesamtschau ihres Lebens und so die Integration der Lebenserfahrungen in den biografischen Zusammenhang. Sie aktiviert Ressourcen und erlaubt korrigierende Bez...

  18. Möglichkeiten und Grenzen der Nutzerintegration in der Produktentwicklung:Eine Systematik zur Anpassung von Methoden zur Nutzerintegration

    OpenAIRE

    Reinicke, Tamara

    2004-01-01

    Die Entwicklung nutzerfreundlicher Produkte wird heutzutage oft gefordert. Dabei werden vor allem ergonomische Aspekte in den Vordergrund gerückt. Doch wie kann man, abgesehen von den präzisen ergonomischen Richtlinien und Regeln ein Produkt an die Bedürfnisse der Nutzer anpassen? Wie sehen die Bedürfnisse der Nutzer aus? Durch die in dieser Arbeit vorgestellt Nutzerintegrationsmethodik, wird ein Weg aufgezeigt, auf systematische Weise nutzerfreundliche Produkte zu entwickeln. Die wichtigste ...

  19. Bewertung des Aufbaus einer Ladeinfrastruktur für eine Redox-Flow-Batteriebasierte Elektromobilität

    OpenAIRE

    Funke, Simon Árpád; Wietschel, Martin

    2012-01-01

    Eine Erreichung ambitionierter internationaler Klimaziele ist bei wachsendem Mobiliätsbedarf ohne Elektromobilität nicht möglich. Elektromobilität in Verbindung mit regenerativen Energien wird als wichtiger Baustein zur Reduktion der Treibhausgasemissionen angesehen. Gleichzeitig ist die Verbreitung von Elektrofahrzeugen gering, da diese gegenüber Verbrennungsfahrzeugen mit Einschränkungen verbunden sind. Neben den Anschaffungsausgaben stehen lange Ladezeiten und eine beschränkte Reichweite d...

  20. Ein LED-Band basiertes, integratives Interaktionskonzept für unterschiedliche Fahrerassistenz- und Automationsfunktionen – Realisierung und Evaluationsergebnisse

    OpenAIRE

    Dziennus, Marc; Kelsch, Johann; Schieben, Anna

    2016-01-01

    Ein zentrales Element moderner Fahrzeuge besteht in einer optimalen Unterstützung des Fahrers bei Ausführung der Fahraufgabe, der frühzeitigen Kommunikation kritischer Situationen oder dem Eingriff in die Fahrzeugführung in Notfallsituation sowie der Bereitstellung von unterschiedlich starker Unterstützung durch eine Fahrzeugautomation. Hierfür müssen unterschiedlichste Assistenz- und Automatisierungsfunktionen, die jeweils einen spezifischen Teilbereich abdecken (Spurverlassenswarnung, Toter...

  1. Die Wirkung von Work-Life Balance Initiativen auf das Mitarbeitercommitment: Eine empirische Untersuchung in der Unternehmensberatungsbranche

    OpenAIRE

    Kaiser, Stephan; Ringlstetter, Max; Reindl, Cornelia U.; Stolz, Martin Lothar

    2010-01-01

    Der vorliegende Beitrag untersucht die Wirkung von unternehmerischen Work-Life Balance Initiativen für die emotionale Bindung der Mitarbeiter zum Unternehmen, d. h. das organisationale Commitment von Mitarbeitern im Kontext der Unternehmensberatung. Dazu wurde eine Untersuchung mit insgesamt 275 Unternehmensberaterinnen und -beratern durchgeführt. Die Datenanalyse erfolgte anhand eines PLSStrukturgleichungsmodells (Partial-Least-Squares-Ansatz). Die Ergebnisse weisen darauf hin, dass auch in ...

  2. Biomechanisch-kinemetrische Bewegungsanalyse und Ansätze zur Bewegungssteuerung für ein Training im Wellenreiten

    OpenAIRE

    Matschkur, Tina

    2008-01-01

    Neben der biomechanisch-kinemetrischen Bewegungsanalyse einzelner ausgewählter Techniken im Wellenreiten beschäftigt sich diese Dissertation auch ansatzweise im Rahmen einer elektromyographischen Fallstudie mit der muskulären Koordination bei der Bewegungsausführung im Surfen, um daraus Schlussfolgerungen für das Training im Wellenreiten treffen zu können. Ein geschichtlicher und wissenschaftlicher Überblick über das Wellenreiten leitet das Thema ein und macht somit auf die besondere Ausgangs...

  3. Zur Aktualität der Etikettierungsperspektive als Ideologiekritik. Ein Beitrag zur Debatte um kritische Polizeiforschung

    Directory of Open Access Journals (Sweden)

    Helga Cremer-Schäfer

    2014-10-01

    Full Text Available Zu kritischer Institutionenforschung gehört, über die Herrschaftsfunktionen von gesellschaftlichen Institutionen, ihrer Organisationen (Apparate/Instanzen und die von ihnen verwalteten und angewendeten Kategorisierungen aufzuklären. Mit der Anwendung des Etiketts ,Verbrechen‘ beteiligt sich die Polizei als eine Instanz an der Institution ,Verbrechen und Strafe‘, das heißt an legitimierter sozialer Ausschließung (Zuarbeit zu Bestrafung, Inszenierung von Bedrohungsszenarien, Verwaltung der Paria-Bevölkerung. Zu kritischer Polizeiforschung gehört daher auch ein Dauer-Monitoring polizeilich betriebener ,Kriminalisierung‘ von Konflikten, Lebensweisen, Ärgernissen und Lebenskatastrophen. Einen theoretischen Rahmen bieten Etikettierungstheorien und Ideologiekritik. Positiv gewendet: Im Verbund mit kritischer Alltags- und Kulturforschung kann kritische Polizeiforschung zudem für die intellektuelle Verstehbarkeit kriminalisierter Konflikte und Lebensweisen sorgen und damit für die Wiederaneignung von Konflikten.

  4. Generation und Familie – über die Ambivalenz eines multistrukturellen Verhältnisses

    Directory of Open Access Journals (Sweden)

    Vera Bollmann

    2008-07-01

    Full Text Available Der Sammelband Generationen und Familien, welcher dem Soziologen Kurt Lüscher zum 70. Geburtstag gewidmet ist, stellt eine kritische Gegenwartsdiagnose des aktuellen Theorie- und Forschungsstandes zu diesem Thema dar. Schon in ihrem Vorwort machen die beiden Herausgeber auf die Diversität und den Facettenreichtum des Familien- und Generationenkonzeptes in modernen Gesellschaften aufmerksam: familiale Generationenbeziehungen werden in ganz unterschiedlicher Weise gelebt, und je nach theoretischer Lesart ergeben sich vielfältige Deutungsmuster. Die Beiträge nähern sich der Verflechtung von Familie, Generation und Gesellschaft sowohl in theoretischer als auch in empirischer Hinsicht. Inhaltlich reihen sie sich in drei übergeordnete Themenblöcke ein: „Generationen, Generationenverhältnisse und Generationenbeziehungen“, „Familie, Alltag und Identität“ und „Soziologie, Recht und Politik”.

  5. Faszinierende Physik ein bebilderter Streifzug vom Universum bis in die Welt der Elementarteilchen

    CERN Document Server

    Bahr, Benjamin; Riebe, Kristin

    2013-01-01

    Von den Rätseln der Quantenwelt bis zum Polarlicht - von Schwarzen Löchern bis zum GPS-System -von Teilchenbeschleunigern, dem Higgs und der Supersymmetrie bis zum Foucaultschen Pendel – dieses Buch bietet einen packenden Streifzug durch die spannendsten und aktuellsten Themen der modernen Physik! Auf jeweils einer Doppelseite wird dem Leser dabei mit vielen Bildern ein kompakter und klar verständlicher Einstieg in jeweils ein Thema und den Stand der Forschung geboten – und so insgesamt etwa 140 verschiedene Themen beleuchtet und jedes treffend erläutert. Dabei liegt die besondere Stärke des Buches in der klaren Sprache und den Erklärungen, die nahezu ganz ohne Formeln auskommen – begleitet von atemberaubenden und weltweit eingeholten Bildern renommierter Forscher und Institute, die uns die Schönheit unserer Welt vor Augen führen.

  6. Ein umfassendes Standardwerk der Väterforschung A Comprehensive Standard Work on Fatherhood Studies

    Directory of Open Access Journals (Sweden)

    Martin Textor

    2004-11-01

    Full Text Available In dem umfangreichen Band wird in 23 Kapiteln ein detaillierter Überblick über die deutschsprachige Väterforschung geboten, wobei selbstverständlich die in anderen Ländern gesammelten Erkenntnisse berücksichtigt werden. Alle relevanten Wissenschaftsdisziplinen sind mit Beiträgen vertreten. Die einzelnen Aufsätze sind entweder eher theoretisch ausgerichtet, enthalten Literaturübersichten oder stellen empirische Untersuchungen vor. Der Sammelband präsentiert somit eine Gesamtschau des Forschungsstandes.In its 23 chapters, this extensive volume offers a detailed overview of German-language fatherhood research, whereby findings collected in other countries are, of course, recognized. All relevant academic disciplines are represented with contributions. The individual essays are either theoretically oriented, contain surveys of literature, or present empirical examinations. The collection thus presents a consummate digest of the current state of research.

  7. Einführung in die hochschul-lehre ein didaktik-coach

    CERN Document Server

    Boss-Ostendorf, Andreas

    2010-01-01

    Mit diesem Coach in Buchform bekommen Hochschullehrende Unterstützung bei der Entfaltung ihrer eigenen Lehrkompetenz. In vier Schritten vermitteln die Autoren zentrale didaktische Fähigkeiten. Auf der Grundlage einer Lehre, die sich am Lernen der Studierenden orientiert, hilft der Didaktik-Coach dabei, elementare Fertigkeiten auszubilden: die eigene Kontaktfähigkeit weiter zu entfalten, ein von der Gehirnforschung gestütztes Lernverständnis zu entwickeln, sich mit Hilfe gruppenanalytischer Erkenntnisse sicher in Seminaren zu bewegen und schließlich eine Methodenkompetenz zu erwerben, die deshalb effizient ist, weil sie sich an den Bedürfnissen der Lerngruppe orientiert. Die Autoren sind ausgewiesene Fachleute für Coaching und Beratung im Hochschulbereich. Methoden für die professionelle Lehre an Hochschulen: So macht die Lehre Freude!

  8. Simulator to evaluate and optimise driver assistance systems; Ein Simulator zur Bewertung und Optimierung von Fahrerassistenzsystemen

    Energy Technology Data Exchange (ETDEWEB)

    Locher, J. [Hella KG Hueck and Co., Paderborn (Germany); Kleinkes, M. [Hella KG Hueck and Co., Lippstadt (Germany)

    2003-07-01

    For a short time now, the L-LAB (Light-LABoratory), a joint research facility of Hella KG and the University of Paderborn, has had a simulator available which allows the evaluation of driver assistance systems and the optimisation of man-machine interfaces. It is an interactive night driver simulator, which can be used to visualise any type of headlamp beam pattern true to the original. A Smart is used as the input medium; image projection is via a 3-channel high-performance beamer projection system onto large screens. Alongside synthetic roads, there is also a digitalised course available, approx. 10 km long, the original of which is actually used by Hella as a proving ground. Road safety indicators can be recorded directly and indirectly. For example, obstacles which suddenly appear force drivers to apply the brakes. The stopping distance required can be interpreted as a direct indicator for safety. In addition, an eye tracking system is used to record the eye movements of the test subjects, which allows additional road safety indicators to be derived. Comparative investigations between the digitalised proving ground and reality allow validation of the simulator. This year, a comprehensive study will be made to optimise the man-machine interface in connection with infrared vision systems in vehicles. The advantages of simulation are not only in the economical implementation possibilities and control of the variables, but also the fact that properties of driver assistance systems can be evaluated which are not even technically possible yet in reality. The use of the simulator developed here is not limited to tests connected with the visibility of obstacles, however. Rather, it allows the investigation and evaluation of a large range of potential driver assistance systems. (orig.) [German] Dem L-LAB (Light-LABoratory), einer gemeinsamen Forschungseinrichtung der Universitaet Paderborn und der Firma Hella KG in Lippstadt, steht seit kurzer Zeit ein Simulator zur

  9. Never let me go : ein Drehbuch nach dem gleichnamigen Roman von Kazuo Ishiguro

    OpenAIRE

    Wendel, Johann

    2011-01-01

    By their very existence, adaptations remind us there is no such thing as an autonomous text or an original genius transcending history, either public or private. They also affirm, however, that this is not to be lamented. - Linda Hutcheon, A Theory of Adaptation (2006) 1 Einführung Adaptionen - ob sie auf einer Literaturvorlage, einem Zeitungsbericht oder einem historischen Ereignis basieren - sind in der heutigen Filmindustrie eher die Regel als die Ausnahme: so waren laut eine...

  10. Ein Schlüsselproblem zum Verständnis des 2. Thessalonicherbriefs

    African Journals Online (AJOL)

    25. Sept. 2015 ... Die wichtigste Arbeit, die sich mit diesem umstrittenen und mysteriösen Begriff beschäftigt, und dabei auch eine ausführliche. Auslegungsgeschichte .... bislang wissenschaftlich vermessen worden ist. Denn damit lassen ... insofern bereits das κύριος in der Formulierung ἡ ἡμέρα τοῦ κυρίου (z.B. Apg 2:20; ...

  11. Die Sprache der Mode - Eine linguistische Betrachtung lexikalischer und stilistischer Besonderheiten in der Sprache der Modewelt

    OpenAIRE

    Suchert, Anne

    2015-01-01

    Diese wissenschaftliche Arbeit beschäftigt sich mit der Eigentümlichkeit der geschriebenen Modesprache. Da die Modesprache offensichtliche sprachliche Auffälligkeiten sowie einen überaus kreativen und erfrischend humorvollen Umgang mit Sprache aufweist, sollte sie unter wissenschaftlichen Aspekten betrachtet werden. Mode ist eine Institution mit der sich die Soziologie seit jeher ausführlich beschäftigt. Somit stellt sie auch einen interessanten Untersuchungsgegenstand für die Soziolinguisti...

  12. Identifikationsanalyse : Zur Einführung eines neuen Verstehensansatzes in Psychiatrie, Psychotherapie, Literatur- und Sprachwissenschaft

    OpenAIRE

    Herthneck, Kai-Uwe

    2009-01-01

    Hintergrund: Das primäre Problem der Interpretation kommunikativer Akte wie etwa „Symptom-Geschehen“ - zutreffende Bedeutungs-Attribution - ist spätestens seit I. Kant ein schwieriger Aspekt nicht nur der Arzt-Patient-Beziehung. Im vergangenen Jahrhundert findet sich die diesbezügliche Debatte hauptsächlich im Widerstreit verschiedener Schulrichtungen (Psychoanalyse vs. empirische Kognitionswissenschaften, Hermeneutik vs. Konstruktivismus usw.), deren Ausläufer bis in die Gegenwart reichen. S...

  13. Ein MapReduce-basiertes Programmiermodell für selbstwartbare Aggregatsichten

    OpenAIRE

    Schildgen, Johannes

    2014-01-01

    Hadoop ist ein beliebtes Framework für verteilte Berechnungen über große Datenmengen (Big Data) mittels MapReduce. Hadoop zu verwenden ist einfach: Der Entwickler definiert die Eingabedatenquelle und implementiert die beiden Methoden Map und Reduce. Über die verteilte Berechnung und Fehlerbehandlung muss er sich dabei keine Gedanken machen, das erledigt das Hadoop-Framework. Allerdings kann die Analyse von Big Data sehr lange dauern und da sich die Eingabedaten jede Sekunde...

  14. Stars als Human Brands im Sport: Ein State of the Art

    DEFF Research Database (Denmark)

    Hofmann, Julian

    2014-01-01

    Für die Entstehung von Stars als Human Brands werden in der Literatur zwei gegenläufige Erklärungen vertreten. Hiernach führt entweder höhere Popularität (vgl. Adler 1985, 2006) oder höheres Talent bzw. Können (vgl. Rosen, 1981) zur Herausbildung von Human Brands bzw. Stars. Eine empirische Verif...

  15. Entwicklung und Applikation eines instationären Reifenmodells zur Fahrdynamiksimulation von Ackerschleppern

    OpenAIRE

    Ferhadbegovic, Bojan

    2009-01-01

    Die Fahrgeschwindigkeit moderner Ackerschlepper nimmt in den letzten Jahren stetig zu. Mittlerweile sind 50 km/h für Standardschlepper in Deutschland üblich. Um diese Geschwindigkeiten sicher erreichen zu können, werden die Ackerschlepper mit einer hydropneumatischen Vorderachsfederung ausgestattet. Eine Hinterachsfederung für Standardschlepper hat sich bisher aus Kostengründen nicht durchgesetzt. Die steigenden Transportanteile und das Bestreben nach weiteren Produktivitätserhöhungen erzeuge...

  16. Ein Lehr- und Studienbuch der interkulturellen Pädagogik A Textbook of Inter-Cultural Pedagogy

    OpenAIRE

    Kerstin Schenkel

    2003-01-01

    Renate Nestvogel gibt anhand von Auszügen ausgewählter biographischer Romane und Erzählungen einen Einblick in Aspekte weibliche verschiedener Kulturen und Gesellschaften. Den Texten vorangestellt ist u. a. ein Forschungsüberblick zu Sozialisationskonzepten, zur weiblichen Sozialisation und den Geschlechterverhältnissen sowie zur Kindheit und Jugend. Die Texte werden thematisch nach unterschiedlichen Themen wie Lebensräumen, Kinderarbeit, Phantasie, Geschlechtersozialisation, Körpersozialisat...

  17. CEACAM3: ein neuartiger phagozytischer Rezeptor der angeborenen Immunantwort zur Erkennung human-spezifischer Pathogene

    OpenAIRE

    Schmitter, Tim

    2006-01-01

    Eine Infektion durch das ausschließlich human-spezifische Pathogen Neisseria gonorrhoeae manifestiert sich bei einer symptomatischen Kolonisierung in der sog. Gonorrhö, einer venerischen Erkrankung, die durch akute Inflammation des befallenen Gewebes und durch die massive Infiltration von Granulozyten charakterisiert ist. Die Gonokokken können im Verlauf einer symptomatischen Infektion über ihre OpaCEA-Adhäsine mit CEACAM Proteinen unterschiedlicher Wirtszellen interagieren. In der vorliegend...

  18. Darstellung und Anwendung eines Bewertungsmodells im Rahmen des Controllings unter Beachtung der IAS/IFRS

    OpenAIRE

    Volkmann, Sebastian

    2005-01-01

    Die zunehmende Etablierung des Shareholder Value-Gedankens in Europa, die Rechnungslegung nach IAS/IFRS in Kombination mit der Forderung nach Konvergenz des internen sowie des externen Rechnungswesens erfordern die vertiefte Kapitalmarktorientierung von Unternehmen. Entsprechend werden in dieser Arbeit Ansätze diskutiert, die wertorientierte Unternehmensführung mit Hilfe eines Bewertungsmodells zu unterstützen, um Implementierungslücken auf Ebene des Konzern- oder Geschäftsbereichscontrolling...

  19. EMMPRIN (CD 147): Ein Schlüsselprotein in der Tumorprogression des Harnblasenkarzinoms

    OpenAIRE

    Kurzrock, Andreas Robert

    2013-01-01

    In dieser Studie wurden Expression und Funktion des multifunktionalen Proteins EMMPRIN (CD 147) im Urothelkarzinom (UCa) charakterisiert. EMMPRIN Expression wurde an primärem Tumorgewebe und in UCa Zelllinien nachgewiesen. Es wurden Modelle für die Inhibition der EMMPRIN Expression in vitro etabliert und gezeigt, dass EMMPRIN Einfluss auf Zellzyklus, Apoptose und das Migrationsverhalten hat. EMMPRIN stellt ein potentielles Zielmolekül in der Prognose und Therapie des UCa dar. The present s...

  20. Potentiale und Barrieren der Nutzung des Mobile Payment aus Kundensicht: eine empirische Untersuchung

    OpenAIRE

    Haarstick, Felix

    2016-01-01

    Während sich das Zahlungsverfahren Mobile Payment seit einigen Jahren international mehr und mehr etabliert, fristet es entgegen jährlich wiederkehrender Erfolgsprognosen in Deutschland immer noch ein Nischendasein. Die vorliegende Untersuchung entstand im Rahmen einer Bachelorarbeit des Studiengangs der Betriebswirtschaftslehre an der Hochschule Hannover und beschäftigt sich mit den Potentialen und Barrieren der Nutzung des Mobile Payment aus Kundensicht, mit dem Ziel, die wesentlichen Fakto...

  1. EU-Verordnung zu "Konfliktmineralien": Ein Schritt zu höherer Rechenschaftspflicht im Rohstoffsektor?

    OpenAIRE

    Küblböck, Karin; Grohs, Hannes

    2017-01-01

    "No blood in my cell phone" - Anfang der 2000er-Jahre zeigten Kampagnen von Nichtregierungsorganisationen (NGOs) Verbindungen zwischen Rohstoffen in Elektronikprodukten und der Finanzierung des Krieges in der Demokratischen Republik Kongo (DRC) auf. In diesem Zusammenhang rückte auch die Verantwortung von Unternehmen für die Gestaltung ihrer Lieferkette verstärkt ins öffentliche Bewusstsein. 2017 tritt nun eine EU-Verordnung in Kraft, die verhindern soll, dass Unternehmen durch ihre Rohstoffb...

  2. „Die kriminelle Frau“ – ein „Anwendungsfall“ für die Anomietheorie?

    OpenAIRE

    Gabriele Schmölzer

    2008-01-01

    Die von der Verfasserin vorgenommene Bearbeitung der Anomietheorie des Soziologen Robert K. Merton zielt darauf ab, „relevante Unterschiede zwischen Frauen und Männern zu finden, die den unterschiedlichen Anteil der Geschlechter bei der registrierten Kriminalität erklären können“ (S. 223). Dies gelingt insofern, als sie strukturelle Variablen herausarbeiten kann, die per se die Wahrscheinlichkeit von strafbarem Verhalten erhöhen. Das Geschlecht spielt dabei (nur) insofern eine Rolle, als der ...

  3. Eine Analyse des Zusammenhangs zwischen dem Konsum von Alkopops und dem Problemverhalten von Jugendlichen

    OpenAIRE

    Metzner, Cornelia Beate Isabel

    2007-01-01

    Zielsetzung: In dieser Arbeit wird untersucht, ob bei Jugendlichen ein Zusammenhang zwischen dem Konsum von Alkopops einerseits und dem sonstigen Alkoholtrinkverhalten, dem Konsum von Zigaretten und illegalen Drogen sowie weiteren Risikoverhaltensweisen andererseits besteht, ferner ob sich Unterschiede im Verhalten von Jungen und Mädchen ergeben. Theoretischer und empirischer Hintergrund: �Alkopops�, d. h. Mischgetränke diverser Hersteller aus Likör bzw. Schnaps und Limonade sowie wein- ...

  4. Blended Learning in der Musiklehrerbildung. Erfahrungen und Perspektiven am Beispiel eines Praxisprojekts

    OpenAIRE

    Lutz, Julia

    2015-01-01

    In der Lehrerbildung zu Beginn des 21. Jahrhunderts wird einem hohen Bezug zum Berufsfeld Schule, phasenübergreifender Zusammenarbeit und lebenslangem Lernen zunehmend Bedeutung geschenkt. Mehr und mehr kommt in Veröffentlichungen und auf den Internetseiten von Lehrerbildungszentren deutscher Universitäten ein umfassendes Verständnis von Lehrerbildung zum Ausdruck, das alle Phasen der Aus- und Fortbildung von Lehrkräften einschließt: Studium, Vorbereitungsdienst („Referendariat“) und Fortbild...

  5. LED-Band basiertes Interaktionskonzept für ein integratives Fahrerassistenzsystem

    OpenAIRE

    Dziennus, Marc; Kelsch, Johann

    2015-01-01

    Ein Zweck moderner Fahrerassistenzsysteme besteht in einer optimalen Unterstützung des Fah-rers bei Ausführung der Fahraufgabe, der frühzeitigen Kommunikation kritischer Situationen oder dem Eingriff in die Fahrzeugführung in Notfallsituation. Hierfür müssen unterschied-lichste Assistenzfunktionen, die jeweils einen spezifischen Teilbereich abdecken (Spurverlas-senswarnung, Toter Winkel Assistent etc.), zeitgleich und parallel arbeiten. Problematisch wird hierbei die oft unterschiedlich gesta...

  6. Ein Frankfurter Sicherheitsregime. Neoliberale Sicherheitsproduktion in der ,Hauptstadt des Verbrechensʼ

    Directory of Open Access Journals (Sweden)

    Anna Kern

    2014-10-01

    Full Text Available Während sich staatliche Sicherheitspolitik fortwährend verändert, scheint die Kritik an ihr verhältnismäßig unflexibel. Vielmehr wird der ständige Prozess der Ausdifferenzierung und Transformation der staatlichen Sicherheitsapparate von ihren Kritiker_innen seit Jahrzehnten so vehement mit Warnungen vor der Herausbildung eines totalitären Überwachungsstaates begleitet, dass diese zunehmend zu Unkenrufen verkommen. Mit dem Begriff des Sicherheitsregimes wird im Folgenden gegen einen Alarmismus argumentiert, der sich in Hinweisen auf die ständige Eskalation von Sicherheitspolitiken und eine damit einhergehende Beschneidung der Freiheit von Bürger_innen, Prekarisierten, Exkludierten oder sozialen Bewegungen erschöpft. Denn eine Kritik, die bei Skandalisierungen verbleibt, ist einerseits blind für qualitative Veränderungen. Andererseits schreibt sie selbst tradierte Herrschaftsverhältnisse fest, indem sie Vergangenes romantisiert und so an der Erzählung von der grundsätzlichen Alternativlosigkeit einer herrschaftsförmig organisierten Gesellschaft mitwirkt.Dagegen wird eine materialistische Analyseperspektive eingenommen, die die Transformationen von Politiken der Sicherheit im Kontext der historischen Entwicklung der kapitalistischen Produktionsweise begreift. Anhand von Fallbeispielen zum Polizieren der Felder häusliche Gewalt und gewaltaffine Fußballfans in Frankfurt am Main wird die neoliberale Konzeption des umfassenden Zusammenwirkens öffentlicher, privatwirtschaftlicher und zivilgesellschaftlicher Akteure empirisch skizziert und das sich ausdifferenzierende Akteursfeld in diesem Bereich dargestellt. So können auch soziale Konfliktlinien identifiziert werden, die über die herkömmliche Gegenüberstellung von Freiheit und Sicherheit hinausweisen.

  7. Erstellung einer Checkliste zur Beurteilung des Arbeitsplatzes eines Physiotherapeuten nach ergonomischen Gesichtspunkten

    OpenAIRE

    Gauermann, Christoph

    2013-01-01

    Einleitung: Arbeitsbedingte Erkrankungen des Muskel-Skelett-Systems sind unter Physiotherapeuten sehr häufig. Die präventive Forschung hat diese Berufsgruppe bisher kaum untersucht. In diesem Zusammenhang stellt die Veränderung des Arbeitsumfeldes einen vielversprechenden Ansatz für die Verhinderung arbeitsbedingter Erkrankungen dar. Das Ziel dieser Arbeit ist die Erstellung einer Checkliste zur Bewertung des Arbeitsplatzes eines Physiotherapeuten zu erstellen. Material und Methoden: ...

  8. Osseointegration bei dentalen Implantaten : eine Literaturübersicht und -auswertung

    OpenAIRE

    Bras da Silva, Manuel A.

    2003-01-01

    Die Osseointegration in der dentalen Implantologie wurde anhand einer Literaturübersicht dargestellt und ausgewertet. Die Literaturübersicht beinhaltet Verlaufsstudien, in vitro und in vivo Studien, die ultrastrukturelle, biomechanische und biochemische Untersuchungen und deren Resultate aufzeigen. Im 1. Kapitel wurden die Kriterien zur Beurteilung des Implantaterfolges dargestellt. Es lässt sich feststellen, dass nicht nur ein Implantatverlust als Misserfolg zu bewerten ist, sondern auch kli...

  9. Das migrationspolitische Feld der Schweiz: eine politikwissenschaftliche Analyse der Vernehmlassung zum Arbenzbericht

    OpenAIRE

    Mahnig, Hans

    2007-01-01

    Der Bericht, vom Bundesamt für Flüchtlinge (BFF) in Auftrag gegeben, stellt eine politikwissenschaftliche Analyse der Vernehmlassung zum Bericht Arbenz vom Mai 1995 dar, welche parallel zur Auswertung durch das BFF selbst unternommen wurde. Er hat zum Ziel, die zentralen Konflikt- und Konsensfelder in der gegenwärtigen migrationspolitischen Auseinandersetzung der Schweiz herauszuarbeiten. Die wichtigsten Resultate der Analyse sind die folgenden: Die Internationale Flüchtlingspolitik und die A...

  10. Loyalty Profiling - Erfolgsdimensionen und Modellansätze eines effizienten und effektiven Customer Relationship Management

    OpenAIRE

    Lafleur, Martin J.

    2009-01-01

    Loyalty Profiling bezeichnet einen Managementansatz, der die Komplexität und wesentliche Effekte der Kundenbindung in Abhängigkeit von persönlichen Merkmalen quantitativ modelliert. Darin enthaltene Profilabgleiche von Bindungspotenzialen vs. Maßnahmenwirkungen (Effektivität) sowie Erträgen aus geändertem Kundenverhalten vs. Kosten der Maßnahmen (Effizienz) werden durch Anwendungsbeispiele für die Automobilindustrie und eine computergestützte Umsetzung veranschaulicht.

  11. "making moves": Eine empirische Untersuchung zur Zweierbeziehung von Jugend und Sport im neuen Jahrtausend

    OpenAIRE

    Boszczyk, Christian

    2010-01-01

    Nach den Hochrechnungen des Marktforschungsinstituts "iconkids & youth" gaben in 2006 deutsche Teenager in der Alterskategorie von 13 – 19 Jahren insgesamt rund 468 Millionen Euro für Sportartikel aus. Diese imposante Zahl alleine ist Grund genug für einen Absolventen eines Studiums der Wirtschaftswissenschaften, sich mit der Zweierbeziehung "Jugend und Sport" auseinanderzusetzen. Betrachtet man den Jugendmarkt in Deutschland unter ökonomischen Gesichtspunkten, so entpuppt sich diese junge Kä...

  12. Ein Nachkömmling Tristans : Warum hat Theodor Storm in seiner Novelle „Späte Rosen" Gottfried von Straßburgs „Tristan und Isolde" erwähnt?

    OpenAIRE

    田淵, 昌太

    2010-01-01

    Man hat bisher Theodor Storms Novelle „Späte Rosen" für ein Werk gehalten, das ein friedliches Familienleben beziehungweise das tägliche Zusammenleben eines Ehepaars schildert. Zum Beispiel hat Beate Charlotte Göhler in ihrer umfangreichen Storm-Biografie geschrieben, dass Theodor Storm mit diesem Werk seiner Frau Constanze eine Liebeserklärung machte („Ein Leben für die Graue Stadt" S.198). Wenn man diese Novelle nur oberflächlich liest, ist es eine mögliche Folge, dass man „Späte Rosen"...

  13. Fermats letzter Satz die abenteuerliche Geschichte eines mathematischen Rätsels

    CERN Document Server

    Singh, Simon

    2000-01-01

    Der Satz des Pythagoras: a²+b²=c² steht im Zentrum des Rätsels, um das es hier geht. Diese »Urformel« gilt immer und überall, aber nur in der Zweier-Potenz, mit keiner anderen ganzen Zahl. In den Notizen des französischen Mathematikers Pierre Fermat, der im 17. Jahrhundert lebte, gibt es einen Hinweis, dass er den Beweis für dieses Phänomen gefunden hat. Doch der Beweis selbst ist verschollen. 350 Jahre lang versuchten nun die Mathematiker der nachfolgenden Generationen, diesen Beweis zu führen. Keinem wollte es gelingen, manche trieb das Problem sogar in den Selbstmord. Schließlich wurde ein Preis für die Lösung des Rätsels ausgesetzt. Nun gelang dem britischen Mathematiker Andrew Wiles 1995 der Durchbruch. Simon Singh wiederum gelang es, diese auf den ersten Blick abgelegene Geschichte so zu erzählen, dass niemand und auch kein Mathematikhasser sich ihrer Faszination entziehen kann: Ein Glanzlicht des modernen Wissenschaftsjournalismus! »Dieses Buch ist ein Wunder.

  14. Uta Fenske: Mannsbilder. Eine geschlechterhistorische Betrachtung von Hollywoodfilmen 1946–1960. Bielefeld: transcript Verlag 2008.

    Directory of Open Access Journals (Sweden)

    Asokan Nirmalarajah

    2009-11-01

    Full Text Available Uta Fenske’s dissertation examines concepts of masculinity in classic 1950s Hollywood films. The historian thus looks back to an era of US history in which sociocultural upheavals led to a disturbance of traditional images of masculinity and to a discourse of crisis of the modern man. Fenske’s examination, informed by cultural studies, distinguishes itself in two different ways. Firstly, through the unorthodox choice of its object of inquiry the study expands the corpus of historical sources. Secondly, through recourse to a variety of genres it can show that the Hollywood films of the 1950s offer a greater richness of answers to the crisis than heretofore assumed.Uta Fenske beschäftigt sich in ihrer Dissertation mit den Männlichkeitsentwürfen des klassischen Hollywoodfilms der 1950er Jahre. Die Historikerin blickt damit zurück in eine Ära US-amerikanischer Geschichte, in der soziokulturelle Umbrüche zu einer Erschütterung tradierter Männlichkeitsbilder, zu einem Krisendiskurs über den modernen Mann führten. Fenskes kulturwissenschaftliche Studie kann sich dabei aus zweierlei Sicht profilieren. Zum einen erweitert sie mit der unorthodoxen Wahl ihres Untersuchungsgegenstandes das geschichtswissenschaftliche Quellenkorpus. Zum anderen kann sie durch ihren Rekurs auf eine Vielzahl von Genres zeigen, dass die Hollywoodfilme der 1950er eine größere Fülle an Antworten auf die Krise anbieten als gemeinhin angenommen.

  15. Overview of the Factors Music Making in Tamhidat by Ein al-Ghozat Hamedani

    Directory of Open Access Journals (Sweden)

    Fatemeh Modarresi

    2013-11-01

    Full Text Available Abstract Figures of speech in addition to their aesthetic functions have different effects on words. Internal music is one of the  effects of figures of speech  which can play an important role in beautifying the word and its effect on the audience. The internal music comes with the use of verbal figures of speech. Figures that make words related by similarity or uniformity of vowels and consonants and create sensible  alliteration. Categories of palilogy, alliteration, parallelism, pun and riming prose are among the figures of speech  that play a major role in creating internal  music of the poem. In this study, with a descriptive-analytical approach, we discuss the roll of music making factors in  Tamhidat as an example of prose poem. The language of Ein ol-Ghozat in Tamhidat is preachy and didactical and in an addressing mode. Despite the intensity and sharpness of his speech, he speaks simple language with his audience. However, his words are in some cases melodious that influences audience and increases its penetration in the listener. The music of his words is natural so the listener can feel it with his spirit and takes its effect. Well syntagmatic arrangement of words is one of his language features that is based on music and phonemes' melody. This music gives words importance and predominance and makes Tamhida's  prose a kind of prose poem. Applying some of the subtle and tiny musical elements such as parallelism (paronomasia /pun makes the music of book more effective and catching. In other words, harmony of sounds and synchronization through which prose becomes rhythmic and melodious is one of the aesthetic aspects of the mystical prose of Ein ol-Ghozat that arises from his word's music and special intonation, so as human nature accepts it and enjoys reading. This word music is found in the form of alliteration, pun, repetition, and meter in important parts of his speech that sometimes becomes close to prosodic meter. In Ein ol

  16. Overview of the Factors Music Making in Tamhidat by Ein al-Ghozat Hamedani

    Directory of Open Access Journals (Sweden)

    Fatemeh Modarresi

    2013-10-01

    Full Text Available Abstract Figures of speech in addition to their aesthetic functions have different effects on words. Internal music is one of the  effects of figures of speech  which can play an important role in beautifying the word and its effect on the audience. The internal music comes with the use of verbal figures of speech. Figures that make words related by similarity or uniformity of vowels and consonants and create sensible  alliteration. Categories of palilogy, alliteration, parallelism, pun and riming prose are among the figures of speech  that play a major role in creating internal  music of the poem. In this study, with a descriptive-analytical approach, we discuss the roll of music making factors in  Tamhidat as an example of prose poem. The language of Ein ol-Ghozat in Tamhidat is preachy and didactical and in an addressing mode. Despite the intensity and sharpness of his speech, he speaks simple language with his audience. However, his words are in some cases melodious that influences audience and increases its penetration in the listener. The music of his words is natural so the listener can feel it with his spirit and takes its effect. Well syntagmatic arrangement of words is one of his language features that is based on music and phonemes' melody. This music gives words importance and predominance and makes Tamhida's  prose a kind of prose poem. Applying some of the subtle and tiny musical elements such as parallelism (paronomasia /pun makes the music of book more effective and catching. In other words, harmony of sounds and synchronization through which prose becomes rhythmic and melodious is one of the aesthetic aspects of the mystical prose of Ein ol-Ghozat that arises from his word's music and special intonation, so as human nature accepts it and enjoys reading. This word music is found in the form of alliteration, pun, repetition, and meter in important parts of his speech that sometimes becomes close to

  17. Ein "global orientiertes Geschichtsbewusstsein" als zukünftige Herausforderung der Geschichtsdidaktik?

    Directory of Open Access Journals (Sweden)

    Susanne Popp

    2002-07-01

    Full Text Available Für den Geschichtsunterricht, der in seinem Kerncurriculum nationalhistorisch ausgerichtet ist, stellt die Globalisierung eine große Herausforderung dar. Der Beitrag untersucht die Frage, ob und in welcher Weise die aktuelle deutsche Geschichtsdidaktik sich mit dem Thema der "Globalisierung" auseinandersetzt, und stellt die Schwierigkeiten für eine ernsthafte Annäherung an dieses Thema dar. Denn, so wird gezeigt, der Weg zu einer angemessenen geschichtsdidaktischen Antwort auf die Herausforderungen der Globalisierung kann nicht auf dem Weg zusätzlicher Inhalte gefunden werden, sondern erfordert eine konzeptionelle Herangehensweise. Deshalb skizziert der Beitrag in knapper Form neue historische Ansätze einer "globally conceptualized world history" und leitet daraus erste geschichtsdidaktische Überlegungen ab. Des weiteren werden Geschichtscurricula aus anderen Ländern, die sich mit "world history" befassen, dargestellt, diskutiert und auf Anregungen für die geschichtsdidaktische Diskussion befragt. Sie können die keine fertigen Lösungen bieten, doch Wahrnehmung der Probleme schärfen und Impulse für die geschichtsdidaktische Diskussion geben.

  18. A techno-typological analysis of fan (tabular scrapers from Ein Zippori, Israel

    Directory of Open Access Journals (Sweden)

    Katia Zutovski

    2016-09-01

    Full Text Available Fan (or tabular scrapers are a diagnostic  tool type in Chalcolithic Ghassulian and Early Bronze Age lithic assemblages from  the southern Levant. To date, only small numbers of fan scrapers have been reported from the Late Pottery Neolithic Wadi Rabah culture. In this paper we present a techno-typological analysis of a fair sample of fan scrapers and fan scrapers spalls from Wadi Rabah and Early Bronze Age layers at Ein Zippori, Lower Galilee, Israel. Techno-typological similarities and differences of Wadi Rabah, Chalcolithic Ghassulian and Early Bronze Age fan scrapers from Ein Zippori and other sites in the region are presented, trends of change along time are noted, and an updated definition is proposed. Our results indicate that fan scrapers are highly efficient tools for accurate and prolonged animal butchering and hide working. The main advantage of fan scrapers is their mostly flat, thin morphology and large size that permits the creation of several relatively long working edges, various retouched angles (from sharp to abrupt, extensive resharpening, and a comfortable grasp. While fan scrapers were products of a local trajectory in Late Pottery Neolithic Wadi Rabah lithic industries at Ein Zippori, a standardized, off-site manufacturing of fan scrapers is evident during the Early Bronze Age.

  19. Symptomatic endometriosis of the colon - a case report; Symptomatische Dickdarmendometriose - eine Falldarstellung

    Energy Technology Data Exchange (ETDEWEB)

    Leutloff, U.C. [Abt. Radiodiagnostik, Radiologische Universitaetsklinik Heidelberg (Germany); Roeren, T. [Abt. Radiodiagnostik, Radiologische Universitaetsklinik Heidelberg (Germany); Feldmann, K. [Abt. Gynaekologische Endokrinologie und Fertilitaetsstoerungen, Universitaets-Frauenklinik Heidelberg (Germany); Sillem, M. [Abt. Gynaekologische Endokrinologie und Fertilitaetsstoerungen, Universitaets-Frauenklinik Heidelberg (Germany); Rabe, T. [Abt. Gynaekologische Endokrinologie und Fertilitaetsstoerungen, Universitaets-Frauenklinik Heidelberg (Germany); Kauffmann, G. [Abt. Radiodiagnostik, Radiologische Universitaetsklinik Heidelberg (Germany)

    1996-05-01

    The intestinal endometriosis in need of treatment is a rare case in the surgical department. Preoperative diagnosis is very difficult and in any case must be based on histologic findings; endoscopy-guided biopsy very frequently yields negative results. Dual-contrast scanning of the colon still is a major examination method, but the findings make it difficult to rule out malignomas. Cyclic, recurrent abdominal complaints reported in the case history strongly indicate the possibility of endometriosis. Typing can be done in general only after surgery. The article reports the clinical and diagnostic parameters of a symptomatic endometriosis of the colon. (orig.) [Deutsch] Die behandlungsbeduerftige Darmendometriose ist eine seltene Erkrankung im chirurgischen Krankengut. Eine praeoperative Diagnose ist meist schwierig und ohne Histologie nicht zu erreichen; die endoskopisch gesteuerte Biopsie ist haeufig negativ. Eine grosse Rolle spielt nach wie vor die Kolonuntersuchung im Doppelkontrast, wobei die Abgrenzung zu einem Malignom schwierig ist. Einen wichtigen Hinweis liefern in der Anamnese zyklisch wiederkehrende abdominelle Beschwerden. Die Artdiagnose gelingt in der Regel erst operativ. Wir beschreiben die klinischen und diagnostischen Parameter einer symptomatischen Dickdarmendometriose. (orig.)

  20. Die Osteonekrose des Fußes: Eine Übersicht

    Directory of Open Access Journals (Sweden)

    Schenk S

    2007-01-01

    Full Text Available Die Osteonekrose (ON am Fuß ist eine heterogene Gruppe von Krankheitsbildern, die sich deutlich hinsichtlich Klinik, Verlauf, Prädilektionsalter und Prognose unterscheiden. Ebenso sind die Ursachen für diese Erkrankungen vielfältig: Neben idiopathischen finden sich auch posttraumatische und postoperative Formen. Seltene Ursachen sind Kollagenosen, Stoffwechselerkrankungen wie Diabetes mellitus und Kortikoidtherapie. ON finden sich gehäuft nach Nierentransplantationen. Je nach Ursache tritt eine ON gehäuft in typischer Lokalisation auf. Idiopathische Formen findet man am Os naviculare pedis – Morbus Köhler 1 (MK1, an den Metatarsaleköpfchen – Morbus Köhler 2, "Freiberg’s disease" (MK2, an den Sesambeinen und an der Apophyse des Calcaneus. Operationsbedingte Fälle sind gehäuft am Metatarsaleköpfchen 1 nach Versorgung eines Hallux valgus lokalisiert, posttraumatische Nekrosen am Talus. In diesem Artikel werden die idiopathischen Formen hinsichtlich Klinik und Therapie näher beleuchtet. Bezüglich der Therapie gibt es konservative und operative Ansätze. Die wissenschaftlichen Daten zur Behandlung von idiopathischen Nekrosen sind spärlich, die Behandlungsstrategien jedoch einheitlich und allgemein anerkannt.

  1. Development of an integrated system for a SOFC for combined heat and power generation; Entwicklung eines integrierten Systems fuer eine SOFC mit Kraft-Waerme-Stoffkopplung

    Energy Technology Data Exchange (ETDEWEB)

    Stichtenoth, J.; Meyer-Pittroff, R.

    2002-06-01

    The feasibility of CO2 removal from the exhaust of a 250 kW{sub e} SOFC module, with recirculation of the liquefied CO2 is discussed for the example of a German brewery (Bayerische Staatsbrauerei Weihenstephan). An electric efficiency of 50% can be achieved provided that the liquefied CO2 is utilized to substitute CO2 liquefaction in another point of the process. The high-temperature waste heat of the 250 kW SOFC is fed into the brewer's copper via feedwater preheating. [German] In dieser Studie werden die Moeglichkeiten einer technischen Rueckgewinnung von CO{sub 2} aus dem Abgasstrom eines SOFC-Moduls mit 250 kW elektrischer Leistung und Rueckfuehrung des verfluessigten CO{sub 2} in den Wertschoepfungsprozess am Beispiel der Bayerischen Staatsbrauerei Weihenstephan untersucht. Unter der Voraussetzung, dass dieses verfluessigte CO{sub 2} als Produkt Verwendung findet und die CO{sub 2}-Verfluessigung an anderer Stelle substituiert, kann der von der SOFC gelieferte Energiebeitrag zur CO{sub 2}-Verfluessigung dem Gesamtsystem gutgeschrieben werden, so dass der elektrische Wirkungsgrad bei 50% bleibt. Die Hochtemperaturabwaerme der 250 kW-SOFC wird ueber eine Speisewasservorwaermung in den Dampfkessel der Brauerei eingekoppelt.

  2. Plädoyer für eine Re-Lektüre feministischer Texte vor der ‚Butlermania‘

    Directory of Open Access Journals (Sweden)

    Susanne Maurer

    2008-11-01

    Full Text Available Eine wesentliche Botschaft der Textsammlung von Christiane Schmerl lautet, dass es eine mehr als unglückliche Verkürzung sei, feministischen Texten vor Judith Butlers Gender Trouble vorzuhalten, sie würden ‚Geschlecht‘ einfach nur ‚reifizieren‘. Damit – so eine Quintessenz – schneiden sich heutige Kritiken von ihrer eigenen Geschichte ab. Die Lektüre des Bandes von Christiane Schmerl zeigt, dass manche aktuellen Texte hinter ein bereits erreichtes Niveau feministischer Reflexion(smöglichkeiten oftmals zurückfallen.

  3. Development of a ceramic heat exchanger for a combined cycle plant with pressurized coal dust combustion. Final report; Entwicklung eines keramischen Waermeaustauschers fuer eine Kombianlage mit Kohlenstaubdruckfeuerung. Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Leithner, R.; Ehlers, C.

    2001-12-01

    dazu notwendige Gasreinheit vor der Gasturbine ist bislang bei Temperaturen ueber 1000 C nicht erreichbar. Als ein Ansatz wird versucht, die notwendige Abscheidung von Asche und Alkaliverbindungen oberhalb der Aschefliesstemperatur durchzufuehren. Problematisch hierbei sind v.a. der verbleibende Asche- und Alkaliengehalt im Rauchgas und Korrosionsschaeden an den Feuerfestmaterialien. Zielsetzung der Untersuchung: Eine alternative Schaltung sollte untersucht werden, in der die Gasreinigung nach Stand der Technik unterhalb des Ascheerweichungspunktes erfolgt. Dazu ist eine Abkuehlung und anschliessende Wiederaufheizung des Rauchgases in einem Hochtemperatur-Waermeaustauscher erforderlich. Methode: Eine keramischer Rohrbuendel-Waermeaustauscher im Modellmassstab wurde konstruiert und in einer drucklosen Versuchsanlage zusammen mit einer Heissgasentstaubung unter realen Bedingungen betrieben. Ergebnis: Der Waermeaustauscher erwies sich in Konstruktion und Werkstoffwahl als geeignet. Wegen Undichtigkeiten konnten die angestrebten hohen Temperaturen nicht ganz erreicht werden. Bei hohen Temperaturen verstopfte versinternde Asche die Rohreingaenge. Erste Vorversuchen zur Reinigung der Rohr im Betrieb erbrachten positive Ergebnisse. Die Abscheidung der Asche durch Zyklon und keramische Filterkerzen gelang problemlos. Schlussfolgerung: Bei Vermeidung bzw. Verbesserung von undichten Verbindungen liessen sich hoehere Temperaturen erreichen. Gelingt die Reinigung der Rohreingaenge im Betrieb bei hohen Temperaturen, steht ein Verfahren zur Verfuegung, mit dem die fuer den Prozess noetige Gasreinheit erreicht wird. (orig.)

  4. Electromobility and electromagnetic compatibility of a BMS module; Elektromobilitaet und Elektromagnetische Vertraeglichkeit eines BMS-Moduls

    Energy Technology Data Exchange (ETDEWEB)

    Palme, Robert [Fachhochschule Nordhausen (Germany); Graebner, Frank; Kallemyer, Christian; Schmidt, Gunther; Hungsberg, Axel [Hoermann IMG GmbH, Nordhausen (Germany)

    2012-11-01

    In the years to come, electromobility will have an increasingly important role, also for economic reasons. So far, electric vehicles and e-vehicle concepts were hampered by technical problems, e.g. high proneness to disturbances and high EMC effects. EMP compatibility and the development of a BMS system for electric HV power stores are key issues. Increasing concentration of electronic and microprocessor systems in the environment increasingly causes interferences, disturbances and malfunctions. As a rule, efforts are made to make the equipment radiation-resistant by appropriate circuiting and layout design, but this is often insufficient and shielding casings are required. There are also legal aspects even though standardisation is still in its early stages. The draft EU Directive ECE R 10 (Draft 2010) is under discussion, which proposes to consider the effect of line impedance and voltage ratios of a battery charging station. In the publication, the grid-bound EMP of a BMS/accumulator package is modelled, measured, and simulated in an e-vehicle simulator. [German] Auch wirtschaftlich wird in den naechsten Jahren die Elektromobilitaet eine immer staerkere Rolle einnehmen. Bisherige Elektrofahrzeuge und E-Fahrzeugkonzepte weisen auf Grund der Neuartigkeit viele technischen Probleme und ''technische Kinderkrankenheiten'' auf. Eines dieser Probleme ist die hohe Stoeranfaelligkeit und grosse Stoeraussendung von leitungsgebundenen EMV Effekten und gestrahlten EMV Stoerungen. Ein spezielles Hauptproblem im Elektromobil ist der Stoersichere Aufbau (EMV) und die Realisierung eines BMS Systems fuer elektrische Hochvolt Energiespeicher. Die Konzentration der Elektronik und Mikroprozessortechnik in unserer Umgebung fuehrt immer haeufiger zur gegenseitigen Stoerung, was zu einer Beeinflussung dieser Systeme bis hin zum Funktionsausfall fuehren kann. Primaer wird versucht, durch entsprechendes Schaltungs- und Layoutdesign die Geraete abstrahl- und

  5. ORA59 and EIN3 interaction couples jasmonate-ethylene synergistic action to antagonistic salicylic acid regulation of PDF expression.

    Science.gov (United States)

    He, Xiang; Jiang, Jishan; Wang, Chang-Quan; Dehesh, Katayoon

    2017-04-01

    Hormonal crosstalk is central for tailoring plant responses to the nature of challenges encountered. The role of antagonism between the two major defense hormones, salicylic acid (SA) and jasmonic acid (JA), and modulation of this interplay by ethylene (ET) in favor of JA signaling pathway in plant stress responses is well recognized, but the underlying mechanism is not fully understood. Here, we show the opposing function of two transcription factors, ethylene insensitive3 (EIN3) and EIN3-Like1 (EIL1), in SA-mediated suppression and JA-mediated activation of PLANT DEFENSIN1.2 (PDF1.2). This functional duality is mediated via their effect on protein, not transcript levels of the PDF1.2 transcriptional activator octadecanoid-responsive Arabidopsis59 (ORA59). Specifically, JA induces ORA59 protein levels independently of EIN3/EIL1, whereas SA reduces the protein levels dependently of EIN3/EIL1. Co-infiltration assays revealed nuclear co-localization of ORA59 and EIN3, and split-luciferase together with yeast-two-hybrid assays established their physical interaction. The functional ramification of the physical interaction is EIN3-dependent degradation of ORA59 by the 26S proteasome. These findings allude to SA-responsive reduction of ORA59 levels mediated by EIN3 binding to and targeting of ORA59 for degradation, thus nominating ORA59 pool as a coordination node for the antagonistic function of ET/JA and SA. © 2017 Institute of Botany, Chinese Academy of Sciences.

  6. The production phase model as a tool for analysing and structuring the database of an operation management system; Das Phasenmodell der Produktion als ein Werkzeug fuer Analyse und Strukturierung der Datenbasis eines Betriebsmanagementsystems

    Energy Technology Data Exchange (ETDEWEB)

    Rauprich, G.; Polke, B.

    1997-12-31

    This paper presents a process analysis which was carried out with the aid of a phase model for the purpose of supporting the start-up phase of an operation management system. Beside providing a functional structure for the database this process analysis permits a functional and consistent representation of the process at as crude or detailed a level as desired. In this way the phase model supplies a functional model of the process which serves the purposes of both the process control and the operation control level. Once the phase model has been created it largely only depends on the question being asked which level of detail and what properties of the relevant process elements and material and energy flows are used. [Deutsch] Eine mit Hilfe des Phasenmodells durchgefuehrte Prozessanalyse unterstuetzt die Einfuehrungsphase eines Betriebsmanagementsystems. Sie gibt eine funktionale Struktur der Datenbank vor und erlaubt darueberhinaus auf der Ebene des Betriebsmanagementsystems eine funktionale, konsistente, beliebig grobe oder feine detaillierte Darstellung des Prozesses. Die Phasenmodellierung liefert damit sowohl fuer die Prozessleitebene als auch fuer die Betriebsleitebene ein ganzheitliches, funktionales Modell des Prozesses. Wenn das Phasenmodell erst einmal erstellt ist, ist es im wesentlichen nur abhaengig von der Fragestellung, welche Detaillierungsebenen mit welchen Eigenschaften der relevanten Prozesselemente und Material-/Energiestroeme verwendet werden. (orig./RHM)

  7. Rechtsgeschichte – Geschichte der Evolution eines sozialen Systems

    Directory of Open Access Journals (Sweden)

    Marie Theres Fögen

    2002-01-01

    mische Rechtsgeschichten. Über Ursprung und Evolution eines sozialen Systems, Göttingen 2002. Gould, S. J., Illusion Fortschritt, Frankfurt am Main 1999. Gould, S. J., "Punctuated equilibrium in fact and theory" in Journal of social and biological structures 12 (1989 117-136. Harvey, D.L., Reed, M.H., "The Evolution of Dissipative Social Systems" in Journal of Social and Evolutionary Systems 17 (1994 371-411. Luhmann, N., "Geschichte als Prozeß und die Theorie sozio-kultureller Evolution" in Theorie der Geschichte. Beiträge zur Historik, Band.2: Historische Prozesse, edited by K.-G.Faber and Chr. Meier, Munich 1978, 413-440. Luhmann, N., "Evolution und Geschichte" in Soziologische Aufklärung 2, by the same author, Opladen 1982, 150-169. Luhmann, N., Soziale Systeme, Frankfurt am Main 1984. Luhmann, Niklas, Das Recht der Gesellschaft, Frankfurt am Main 1993; esp.chap. 6 and the chapter on evolution in Luhmann, N., Die Religion der Gesellschaft, 200, Die Politik der Gesellschaft, 2000; Die Gesellschaft der Gesellschaft, 1997. Mainzer, K. (ed., Komplexe Systeme und Nichtlineare Dynamik in Natur und Gesellschaft, Berlin, Heidelberg 1999. Mohr, H.-U., "Systemtheorie und Literaturwissenschaft" in Domänen der Literaturwissenschaft. edited by H.Jaumann, J.Klein et al., Tübingen 2001, 145-162. Plumpe, G., "Programme moderner Literatur. Eine systemtheoretische Skizze" in Domänen der Literaturwissenschaft [see Mohr], 131-143. Stichweh, R., Reyer, H.-U., Uszkoreit, Memorandum zu einem Institut für Evolutionswissenschaft, edited by Programmbeirat der Werner Reimers Konferenzen, Bad Homburg, February 1999. Stichweh, R., "Selbstorganisation und die Entstehung nationaler Rechtssysteme (17.-19.Jahrhundert" in RJ 9 (1990, 254-270. Teubner, G., Recht als autopoietisches System, Frankfurt am Main 1989. Teubner, Gunther, "Eigensinnige Produktionsregimes: Zur Ko-evolution von Wirtschaft und Recht in den varieties of capitalism" in Soziale Systeme 5, 1999, 7-26. Voigt, Rüdiger (ed., Evolution des

  8. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  9. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  10. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  11. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  12. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

  13. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  14. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...

  15. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...

  16. Carbon dioxide digital subtraction angiography using a new gas management system; Digitale Subtraktionsangiographie mit Kohlendioxid unter Verwendung eines neuen Gasdosiersystems

    Energy Technology Data Exchange (ETDEWEB)

    Schmitz-Rode, T.; Alzen, G.; Guenther, R.W. [Klinik fuer Radiologische Diagnostik, Universitaetsklinikum der RWTH Aachen (Germany)

    1997-07-01

    Purpose: The clinical evaluation of digital subtraction angiography with carbon dioxide using a newly developed low-tech CO{sub 2}-dosage- and injection system. Method and patients: The hand-held system (CO{sub 2} angio set) consists of a dosage chamber in connection with a special stopcock to apportion the gas. By optimising injection volume and pressure steady gas flow characteristics are approximated. A safety design prevents unintentional gas injection volume and pressure steady gas flow characteristics are approximated. A safety design prevents unintentional gas injection. CO{sub 2} arteriographies were performed on 185 patients. Main indications were renal insufficiency and a history of adverse reactions to iodinated contrast media. In patients with femoral connula access, catheterless reflux angiography was performed. Results: The injection system provided complete and coherent visualisation of the abdominal aorta, visceral, pelvic, and lower limb arteries via catheter (71 cases) or via femoral cannula using reflux technique (114 cases). Stenoses, occlusions, and collaterals were assessable. Employing the gas reflux over the aortic bifurcation bilateral run-off studies up to the calf trifurcation were performed via unilateral femoral cannula. Use of a dedicated stacking software improved image quality of distal femoral, popliteal and calf arteries. Conclusion: The CO{sub 2} management system allows adequate imaging of the arteries below the diaphragm. Ease and safety of use and low costs are advantageous. (orig.) [Deutsch] Ziel: Die klinische Erprobung der digitalen Subtraktionsangiographie mit Kohlendioxid unter Verwendung eines neuentwickelten, einfachen Gasdosier- und Injektionssystems. Methode und Patienten: Eine Dosierkammer mit einstellbarem Volumen in Verbindung mit einem Spezial-Hahn (CO{sub 2}-Angio-Set) portioniert das Gas. Durch Optimierung von Injektionsvolumen und -druck wurde eine konstante Ausstroemcharakteristik angenaehert. Das System wurde

  17. Design of a modular cogeneration plant to supply residential buildings; Dimensionierung eines Blockheizkraftwerkes zur Versorgung einer Wohnsiedlung

    Energy Technology Data Exchange (ETDEWEB)

    Marquardt, R.

    2000-03-01

    Excel tables are presented for fast integral calculation of all energetic and monetary parameters required for calculating the economic efficiency of a cogeneration plant. The Excel programming is more detailed than the method of calculation specified in VDI 2067 in that it also provides potential energy savings,carbon dioxide reduction and exergetic calculations. Influencing parameters like technical data, energy consumption data, fuel properties, and the cost structure of electricity and heat supply can be freely chosen so as to enable maximum parameter variation and an analysis of their influence on the result. [German] Mit der vorliegenden Arbeit wurde ein Instrument in Form von Excel-Tabellen erstellt, das eine schnelle integrale Berechnung aller energetischen und monetaeren Ergebnisgroessen ermoeglicht, die beim Einsatz eines BHKW zur Versorgung einer Bedarfsstruktur im Vergleich zu einer konventionellen getrennten Energiebereitstellung von Interesse sind. Die Excel-Programmierung geht dabei ueber die Abbildung des in der VDI 2067 beschriebenen Berechnungsverfahrens hinaus und liefert neben der Berechnung der Waermebereitstellungskosten auch die Ermittlung von Energieeinspar-, CO{sub 2}-Minderungspotentialen sowie eine exergetische Betrachtung der Ergebnisse. Alle auf das Ergebnis einwirkende Parameter wie technische Anlagendaten, Energiebedarfswerte, Brennstoffeigenschaften, Kostenstruktur der Elektrizitaets- und Waermeversorgung u.a. sind prinzipiell frei waehlbar. So wurde sichergestellt, dass eine Variation verschiedener Parameter moeglich ist und deren Einfluss auf das Ergebnis analysiert werden kann. (orig.)

  18. Medienpädagogik unter der differenztheoretischen Lupe. Eine Identitätssuche zwischen Disziplin und Profession

    Directory of Open Access Journals (Sweden)

    Franziska Linke

    2017-09-01

    Full Text Available Der Beitrag diskutiert die dem Themenheft zugrundeliegende Fragestellung nach der Konstitution der Medienpädagogik aus einer systemtheoretischen Perspektive. Dabei wird im Anschluss an Stichweh (2013 Ansatz der funktionalen Differenzierung ein Untersuchungsrahmen aufgezeigt, der es ermöglicht, die Medienpädagogik sowohl aus wissenschaftssoziologischer als auch professionssoziologischer Perspektive zu betrachten. Gerade die zentrale Rolle der (digitalen Medien für Lern- und Bildungsprozesse sowie für den Arbeitsmarkt (u. a. KMK 2016 verlangt eine stetige Reflexion professioneller Handlungssysteme der Medienpädagogik, die nicht losgelöst von der Frage nach dem Selbstverständnis der Medienpädagogik als Wissenschaftsdisziplin gelingen kann (u. a. Hugger 2001. Divergierende theoretische Positionierungen der Akteurinnen und Akteure sowie verschiedene Zielvorstellungen zur Medienpädagogik selbst und zu dem, was sie praktisch leisten kann, erschweren ein solches Vorhaben. Die Autorinnen des Beitrags begeben sich daher, unter Berücksichtigung der Differenzierung zwischen Disziplin und Profession, auf die Suche nach möglichen Antworten. Vorgeschlagen wird eine erweiterte Betrachtungsweise, welche die Medienpädagogik als wissenschaftliche Produktionsgemeinschaft beschreibt und dadurch Potenziale eröffnet theoretische und empirische Erkenntnisse von Akteurinnen und Akteuren unterschiedlicher wissenschaftlicher Disziplinen mit Medienzusammenhang zu berücksichtigen. Ferner wird dargelegt, dass ein solcher Beschreibungsansatz neue Forschungsperspektiven auf die professionstheoretische Einordnung praktischer Handlungssysteme der Medienpädagogik eröffnen kann.

  19. Plädoyer wider eine (medien-pädagogische Universalpragmatik. Für die "Medienperformanz"

    Directory of Open Access Journals (Sweden)

    Christine Trültzsch-Wijnen

    2016-12-01

    Full Text Available Ausgehend von Dieter Baackes Medienkompetenzbegriff und den Diskussionen zur media literacy referiert die Autorin die (linguistische und sprachphilosophische Herkunft des Kompetenzdiskurses bei Saussure, Chomsky, Searle und Habermas, um zu erläutern, wie noch die Unterscheidung von Medienkritik, Medienkunde, Mediennutzung und Mediengestaltung in den aktuellen Diskussionen von einer Schärfung der Unterscheidung von Kompetenz und Performanz profitieren kann. Insbesondere die Diskussionen zum "Medialen Habitus" sind dabei eine Referenz, um medienpädagogische Fragen nach der sozialen Ungleichheit in den Mittelpunkt zu rücken. Dabei wird betont, dass ein geschärfter Blick auf die Performanz nach wie vor ein Desiderat der medienpädagogischen Forschung darstellt. Insgesamt stellt der Beitrag ein Plädoyer für eine sozial gerechte Medienpädagogik dar. Starting from Dieter Baackes media literacy concept and the actual discussions on media literacy the author analyses the (linguistic and philosophical origins of competence discourse referring Saussure, Chomsky, Searle and Habermas to explain how even the distinction of media criticism, media studies, media usage and media design in the current discussions can benefit of a sharpening of the distinction between competence and performance. In particular, the discussions about "Media Habitus" are a reference to focus on questions of social inequality. It is emphasized that a keen eye on "performance" still represents a desideratum of research in media education. Overall, the article presents a plea for social justice in media education.

  20. Das Passepartout und der Zwischenraum zwischen den Sternen: Thomas Ruff – Ein Ausstellungsrundgang um ein Projekt der Annäherung!

    Directory of Open Access Journals (Sweden)

    Jürgen Stöhr

    2013-07-01

    Full Text Available Bildbetrachtung und insbesondere die Anschauung von Kunstwerken bedürfen einer näher zu bestimmenden «visuellen Kompetenz». Je nach methodologischer Ausrichtung wird diese Kompetenz eher als bildexternes historisch-kontextuelles Fachwissen oder eher bildimmanent als Fähigkeit zum «Lesen» oder zur «ästhetischen Erfahrung» von Einzelwerken angesetzt. Der vorliegende Beitrag untersucht spielerisch die Dynamiken einer visuellen Kompetenz, die zwischen diesen beiden Polen ausgehandelt wird. Als Beispiel wurde eine Bildserie des Düsseldorfer Fotokünstlers Thomas Ruff ausgewählt. Hierbei handelt es sich um im weitesten Sinne «postmoderne» Kunst-Fotografie, die insofern die Fragen nach der Kompetenz im Umgang mit fotografischer Bildlichkeit explizit aufwirft, als Ruffs Arbeiten ihre Rezeption vermutlich selbst thematisieren und innerbildlich zu reflektieren scheinen.

  1. Effects of a railway line project on a colony of grey herons; Auswirkungen eines linienhaften Vorhabens (Eisenbahnstrecke) auf eine Graureiherkolonie (Bayern)

    Energy Technology Data Exchange (ETDEWEB)

    Krause, P. [Inst. fuer Oekologie, Umweltvertraeglichkeit, Landschaftsplanung und Landesentwicklung, Westheim (Germany). igi Niedermeyer Inst.

    1997-12-01

    As part of the efforts made to collect ecological evidence in connection with the Nantenbach Bend project to link the Wuerzburg-Aschaffenburg-Frankfurt line with the new Wuerzburg-Hanover line the colony was observed at regular intervals after completion of the construction work with the intention of quantifying any effects on the population of grey herons. The counts that were carried out indicate that the number of breeding pairs halved in the period from 1990 to 1995 (49 pairs in 1995). On completion of the construction work the pairs once again increased in number, to 56 in 1996 and 52 in 1997. The conclusion that can be drawn from this is that the effects of construction work on the environment in the immediate vicinity were the main cause of negative developments in a bird population and that such measures have more extensive effects than has been assumed in the past. (orig.) [Deutsch] Im Rahmen der oekologischen Beweissicherung zum Vorhaben der Nantenbacher Kurve, die die Anbindung der Eisenbahnstrecke Wuerzburg-Aschaffenburg-Frankfurt am Main an die Neubaustrecke Wuerzburg-Hannover ermoeglicht, wurde die Graureiherkolonie in regelmaessigen Zeitabstaenden nach Fertigstellung der Baumassnahme untersucht. Die Bestandsaufnahmen sollen dazu dienen moegliche Auswirkungen auf die Graureiherpopulation zu quantifizieren. Aufgrund der Bestandszaehlungen wurde vom Jahr 1990 bis 1995 eine Halbierung der Brutpaare (49 Bp. in 1995) in der Kolonie festgestellt. Nach Beendigung der Bautaetigkeiten nahmen die Brutpaare von 56 Bp. in 1996 und 52 Bp. in 1997 wieder zu. Dies laesst darauf schliessen, dass baubedingte Auswirkungen im unmittelbaren Umfeld die hauptsaechliche Ursache fuer die negative Entwicklung eines Bestandes darstellen und einen groesseren Wirkungsgrad haben, als dieser bisher immer angenommen wurde. (orig.)

  2. Internationalisierung des Lehramts – eine Quadratur des Kreises? Zu Chancen und Grenzen eines grenzüberschreitenden Paradigmas der Lehrerbildung am Beispiel des Masterstudiengangs MEEF / LINT (Lehramt International Nizza-Regensburg

    Directory of Open Access Journals (Sweden)

    Jochen Mecke

    2016-03-01

    Full Text Available Die Internationalisierung ist nicht das Problem, sie ist die Lösung: In einer europäischen Gesellschaft, in der die Dynamik einer neuen Vielfalt derzeit eine der wenigen Konstanten darstellt, die nationenübergreifend Bestand hat und keine Grenzen kennt, brauchen wir eine Lehrerbildung, die strukturell und konzeptionell so gesamteuropäisch angelegt ist wie ihre Herausforderungen. Wir brauchen trotz und wegen verschiedener bildungspolitischer Unterschiede und Hürden neue Ansätze der Kooperation und Vernetzung, deren Chancen und Herausforderungen in der Folge exemplarisch am binationalen Master of Education MEEF / LINT (Lehramt International Deutsch-Französisch skizziert werden sollen.

  3. Advanced waste water cleaning with the aid of an algae biofilm; Weitergehende Abwasserreinigung mit Hilfe eines Algenbiofilms

    Energy Technology Data Exchange (ETDEWEB)

    Schumacher, G.; Patzold, V.; Ike, A.; Sekoulov, I. [Technische Univ. Hamburg-Harburg, Hamburg (Germany). Arbeitsbereich Abwasserwirtschaft

    1999-07-01

    These first investigations have led to results indicating that advanced waste water cleaning with the aid of algae biofilm as a downstream process stage is feasible. The concentration of phosphorus in waste water could be reduced to less than 1 mg per litre. Ammonium, which is toxic to fish, was nitrified, and the overall nitrogen concentration could be cut down. The concentration of bacteria was reduced by means of a close-to-nature process to less than the limiting values set by the European Union directive governing the quality of bathing waters. (orig.) [German] Die Ergebnisse dieser ersten Untersuchungen zeigen, dass eine weitergehende Abwasserreinigung mit Hilfe eines Algenbiofilms als nachgeschaltete Verfahrensstufe moeglich ist. Die Phosphorkonzentration im Abwasser konnte auf unter 1 mg/l reduziert werden. Fischgiftiges Ammonium wurde nitrifiziert und die Gesamtstickstoffkonzentration konnte gesenkt werden. Die Bakterienkonzentration konnte mit Hilfe eines naturnahen Verfahrens bis unter die Grenzwerte der EU-Richtlinie ueber die Qualitaet der Badegewaesser reduziert werden. (orig.)

  4. Quantenmechanik verstehen eine Einführung in den Welle-Teilchen-Dualismus für Lehrer und Studierende

    CERN Document Server

    Pietschmann, Herbert

    2003-01-01

    Der bekannte Autor H. Pietschmann wendet sich mit diesem Buch an Physiklehrer an höheren Schulen und an Physikstudenten im Anschluß an deren Grundausbildung. Quantenmechanik entzieht sich der Anschaulichkeit, wie wir sie von der klassischen Physik her kennen, aber - und das ist das Kernthema des Buchs - man kann sie sehr wohl verstehen. H. Pietschmann gelingt es, dies mit einfachen Mitteln zu erreichen, und damit gibt er Lehrerinnen und Lehrern eine Unterrichtshilfe und Studenten eine Einführung in die anspruchsvollen Hochschultexte an die Hand. Die mathematische Behandlung spielt keine zentrale Rolle, vielmehr wird versucht, der Interpretation und dem Denken in quantenmechanischen Kategorien breiten Raum zu geben. Behandelt werden z.B. die Quantenhypothese unter Einbeziehung der Geschichte dieses Konzepts, die Schrödingertheorie, die Interpretation der Wellenfunktion und der Messprozess, die Ein- und Mehrelektronenatome sowie Fragen der Zeitabhängigkeit.

  5. Review: Christian Thiel (2011. Das "bessere" Geld: Eine ethnographische Studie über Regionalwährungen

    Directory of Open Access Journals (Sweden)

    Rolf F.H. Schröder

    2012-07-01

    Full Text Available Seit einigen Jahren zirkulieren in verschiedenen Teilen Deutschlands Regionalwährungen. Die Initiatoren dieser Projekte sehen in diesen Ergänzungen zum etablierten Euro einen wesentlichen Beitrag zur Lösung der sozialen und ökologischen Herausforderungen unserer Zeit. Die Dissertationsschrift von Christian THIEL offeriert einen Blick hinter die Kulissen und fragt in ihrer systematischen Analyse nach den Triebfedern dieser sozialen Bewegung sowie ihren Erfolgschancen. Der Autor hat sein Forschungsprogramm vor dem Hintergrund eines sich wandelnden Grundverständnisses zum Thema Geld entwickelt. Dabei stützt er sich vor allem auf die theoretischen Reflexionen von Viviana ZELIZER. Mittels teilhabender Beobachtung, Interviews sowie der Auswertung von Materialien entwickelt er ein detailliertes Bild von den Regionalwährungen. Die Darstellung dieser Bewegung auf der Bundesebene wird ergänzt durch eine Fallstudie zum Chiemgauer, der bedeutendsten Einrichtung dieser Art. URN: http://nbn-resolving.de/urn:nbn:de:0114-fqs1203158

  6. Rezension zu: Uta Fenske: Mannsbilder. Eine geschlechterhistorische Betrachtung von Hollywoodfilmen 1946–1960. Bielefeld: transcript Verlag 2008.

    Directory of Open Access Journals (Sweden)

    Asokan Nirmalarajah

    2009-10-01

    Full Text Available Uta Fenske beschäftigt sich in ihrer Dissertation mit den Männlichkeitsentwürfen des klassischen Hollywoodfilms der 1950er Jahre. Die Historikerin blickt damit zurück in eine Ära US-amerikanischer Geschichte, in der soziokulturelle Umbrüche zu einer Erschütterung tradierter Männlichkeitsbilder, zu einem Krisendiskurs über den modernen Mann führten. Fenskes kulturwissenschaftliche Studie kann sich dabei aus zweierlei Sicht profilieren. Zum einen erweitert sie mit der unorthodoxen Wahl ihres Untersuchungsgegenstandes das geschichtswissenschaftliche Quellenkorpus. Zum anderen kann sie durch ihren Rekurs auf eine Vielzahl von Genres zeigen, dass die Hollywoodfilme der 1950er eine größere Fülle an Antworten auf die Krise anbieten als gemeinhin angenommen.

  7. Herausforderungen beim Aufbau und bei der Pflege einer Bilddatenbank – ein Anwendungsbeispiel aus dem Digitalen Forschungsarchiv Byzanz (DiFAB

    Directory of Open Access Journals (Sweden)

    Nina Rannharter

    2017-09-01

    Full Text Available Mit Metadaten versehene, digital archivierte Bilder sind aufgrund ihrer hohen Komplexität eine ständige Herausforderung für den Aufbau von Metadatenstrukturen und für das Beibehalten von adäquaten Metadatenstandards in Bilddatenbanken. Besonders bei Bildern über eine materielle Kultur zeichnet sich diese Komplexität in den diversen Ebenen ab. Zur Verdeutlichung dieser Problematik dient ein einzelnes Monument mit seiner fotographischen Dokumentation als geisteswissenschaftliches Anwendungsbeispiel aus dem Digitalen Forschungsarchiv Byzanz (DiFAB der Universität Wien. Unter der grundsätzlichen Berücksichtigung der künftigen Anforderungen und der einfachen Navigation von Metadaten beinhaltet dieser Beitrag u. a. die Herausforderungen mit den diversen analogen und digitalen Formen der Dokumentation, der historischen Geographie, der kulturspezifischen Terminologie sowie mit der kunsthistorischen Bedeutung einer exakten und unscharfen Datierung für Forschungsarchive.

  8. Inductive charging of electric cars. A techno-economic assessment; Induktives Laden von Elektromobilen. Eine techno-oekonomische Bewertung

    Energy Technology Data Exchange (ETDEWEB)

    Schraven, Sebastian; Kley, Fabian; Wietschel, Martin [Fraunhofer-Institut fuer System- und Innovationsforschung (ISI), Karlsruhe (Germany). Competence Center Energy Politik und Energie Systeme

    2010-07-01

    Most concepts for charging of electric vehicles are based on cables that must be plugged in and out. In case of frequent charging or short-term charging, however, this may be impractical, and an inductive (cableless) solution would be preferable. The contribution attempts to analyze if inductive power transmission is technically feasible in electric vehicles, and in what areas it will be economically attractive to users. To begin with, the two charging technologies are presented and compared. This is followed by a cost assessment. It is found that the inductive technology involves significant additional cost, so it cannot be expected to spread quickly. In certain conditions, however, it may be applicable as a niche technology in certain commercial applications, e.g. taxis. (orig.) [German] In den bisher diskutierten Konzepten zur Ladung von Elektrofahrzeugen ist die kabelgebundene (konduktive) Ladung vorherrschend, bei der der Nutzer das Kabel zur Ladung ein- bzw. wieder ausstecken muss. Haeufige Ladevorgaenge und insbesondere Kurzladungen lassen jedoch dieses Ein- und Ausstecken neben der reduzierten Reichweite des Elektrofahrzeugs unpraktisch in der Nutzung erscheinen. Demgegenueber bietet die induktive (kabellose) Energieuebertragung das Laden ohne erforderlichen Nutzereingriff. Der vorliegende Artikel versucht die Fragen zu beantworten, ob ein Einsatz der induktiven Energieuebertragung bereits technisch zur Ladung von Elektrofahrzeugen realisierbar ist, und in welchen Bereichen diese eine wirtschaftlich attraktive Loesung fuer den Nutzer darstellt. Dazu werden zunaechst die Ladetechnologien vor- und technisch gegenuebergestellt. Auf Basis einer Kostenbetrachtung ist auch ein oekonomischer Vergleich der beiden Ladetechnologien moeglich. Es zeigt sich, dass aus wirtschaftlicher Sicht aufgrund signifikanter Mehrkosten vorlaeufig kein weitverbreiteter Einsatz der induktiven Technik zu erwarten ist. Unter bestimmten Voraussetzungen ergibt sich aber ein begrenztes

  9. Ein „Untergrund-Kodex“ in der deutschen multilingualen Gesellschaft: Kanak Sprak

    Directory of Open Access Journals (Sweden)

    Elcio Loureiro Cornelsen

    2017-04-01

    Full Text Available Unser Beitrag fokussiert auf ein sprachliches Phänomen in der gegenwärtigen Gesellschaft in Deutschland, das auch im kulturellen Bereich Folgen hat: die sogenannte „Kanak Sprak“. In ihrer Beziehung zur deutschen Sprache wäre die Kanak Sprak, also die Sprache des Kanaken, ein Ethnolekt, wie Martin Schramm sie in einem Artikel Verhunztes Deutsch oder Sprachkultur? aus dem Jahr 2011 definiert. Nach der Meinung des Journalisten und türkisch-deutschen Schriftstellers Feridun Zaimoğlu wäre Kanake übrigens „ein Etikett, das nach mehr als 30 Jahren Immigrationsgeschichte von Türken nicht nur Schimpfwort ist, sondern auch ein Name, den ‚Gastarbeiterkinder’ der zweiten und vor allem der dritten Generation mit stolzem Trotz führen“ (2007: 9. In diesem Sinne zielt unsere Studie darauf ab, diesen „Untergrund-Kodex“ (2007: 13, wie Feridun Zaimoğlu ihn bezeichnet, in den folgenden Werken von Zaimoğlu zu untersuchen: Kanak Sprak – 24 Mißtöne vom Rande der Gesellschaft (Erstauflage 1995; 2007 und Kopf und Kragen – Kanak-Kultur-Kompendium (Erstauflage 2001; 2006. Schließlich soll darauf hingewiesen werden, dass solche Werke als „Konternarrative der Nation“ (Bhabha 1990: 149 interpretiert werden können. Our contribution focuses on a linguistic phenomenon in contemporary society in Germany, which has as well consequences in the cultural field: the so-called kanak sprak. In their relationship with the German language reflects the kanak sprak, the language of the kanaks, an “ethnolect”, as Martin Schramm would define it. According to the journalist and Turkish-German author/writer Feridun Zaimoğlu would kanake be defined as “a label that not only is a dirty word for more than 30 years history of immigration of Turks, but also a name that the children of the Gastarbeiter of especially the second and the third generation lead with proud defiance” (2007: 9. In this sense, our study aims to analyze this “underground Code

  10. Ein schlankes Datenmodell für E-Books: die providerneutrale Aufnahme

    Directory of Open Access Journals (Sweden)

    Manfred Müller

    2015-12-01

    Full Text Available Der Artikel zeigt verschiedene Lösungsansätze, wie je nach Prinzipien der Verbund-Datenhaltung eine providerneutrale E-Book-Beschreibung modelliert sein kann. Die skizzierten Datenmodelle bieten einen Ausblick, welche Chancen in der frühzeitigen Adaption des providerneutralen Datenmodells beim Übergang zu den Datenstrukturen in den Cloud-basierten Erschließungsumgebungen bestehen. The article demonstrates current approaches to provider-neutral ebook records in German unioncatalogs and gives a perspective on how to transfer the outlined data models into cloud-based catalog systems.

  11. Ein PKI-basiertes Protokoll für sichere und praktikable Onlinewahlen

    Directory of Open Access Journals (Sweden)

    Lucie Langer

    2010-04-01

    Full Text Available Wir stellen ein Protokoll für Onlinewahlen vor, welches auf dem Schema von Ohkubo et al. [13] basiert. Besonders an diesem Protokoll ist, dass der Auszähler nicht vertrauenswürdig sein muss. Der geheime Schlüssel des Auszählers wird am Ende der Wahl veröffentlicht und ermöglicht so die universelle Verifizierbarkeit der Stimmauszählung. Wir diskutieren die Sicherheit des Protokolls angesichts der allgemein anerkannten Sicherheitsanforderungen für elektronische Wahlschemata.

  12. Digitales Peer-Tutoring - Explorative Analyse eines Peer-Video-Tutoring auf YouTube

    OpenAIRE

    Lebedynska, Viktoriya

    2016-01-01

    Als eine der erfolgreichsten und empirisch gut erforschten Methoden ist das Peer-Tutoring in den pädagogischen Kreisen äußerst beliebt. Neue organisatorische Anforderungen an Schule, wie die Einführung von G8 und die steigende Erwerbstätigkeit beider Elternteile, sowie neue didaktische Anforderungen, wie etwa Inklusion, eröffnen neue Möglichkeiten und Potentiale für den Einsatz des Peer-Tutoring. Die vorliegende Arbeit hat die Bearbeitung zweier Schwerpunkte zum Ziel. Zunächst wird das kla...

  13. Message of the rainforests. A jungle in Vienna; Botschaft der Regenwaelder. Ein Dschungel in Wien

    Energy Technology Data Exchange (ETDEWEB)

    Doeller, M.

    2003-07-01

    A 'rainforest house' is the latest project of the Vienna Zoo, Tiergarten Schoenbrunn. The contribution presents details of the technical facilities of the envisaged building. [German] Durch die in den letzten zehn Jahren erfolgte Modernisierung der Anlagen besitzt der Wiener Tiergarten Schoenbrunn heute internationalen Vorzeigecharakter. Treibende Kraft hinter dieser Entwicklung ist ohne Zweifel Direktor Dr. Helmut Pechlaner. Wie das juengste Projekt ''Regenwaldhaus'' zeigt, stehen dem anerkannten Zoo-Experten in der baulichen Umsetzung seiner Visionen jedoch nicht minder engagierte Planer zur Seite. Allein das gesamte Haustechnikkonzept ist eine ausgetueftelte Zusammenstellung aus verschiedensten Sonderloesungen sowie Systemeigenentwicklungen. (orig.)

  14. Ein Vorschlag zur Wahl der Zuchtwerte bei der Anwendung dermarkergestützten Selektion

    DEFF Research Database (Denmark)

    Thomsen, Hauke

    2009-01-01

    Im Rahmen dieser Simulationsstudie wurde ein Enkelinnendesign mit 10 Großvätern erstellt, um die Einflüsse unterschiedlicher Eingabevariablen in der markergestützten Selektion zu untersuchen. Dabei wurden genotypische und phänotypische Daten für die Großväter, Großmütter und 500 Söhne simuliert. ......,89), so dass empfohlen wird diese Eingabevariable in der markergestützten Zuchtwertschätzung zu verwenden...

  15. Consulting: a new area of business for energy supply utilities; Consulting - ein neues Geschaeftsfeld fuer Energieversorgungsunternehmen

    Energy Technology Data Exchange (ETDEWEB)

    Busse, H.; Oswald, H. [MVV-Energie AG im Internationalen Gasconsulting, Duggendorf (Germany)

    2000-03-01

    The radical changes in national and international markets in recent years will have a long-term effect on the future development of industry and of energy supply utilities. The dynamics and complexity of these processes are producing new challenges. These are leading to a departure from rigid structures in the supply enterprises, towards functional, process-oriented organizational structures. In addition, a whole series of new business activities is arising. One of these new strategic areas of business is consulting. In Germany, a range of regional and municipal supply utilities now offer consulting services for third parties on an intensified basis around the world. Since about 1990, larger municipal technical service organizations and regional energy supply utilities have been working on numerous projects both within Germany and abroad. It has become apparent that it is necessary to take a long breath (one to four years) from the time of obtaining the sale until the award of contract, particularly in the case of foreign projects. In addition to the demand for technical know-how, BOT (Build, Operate, Transfer) projects and assistance with financing and matters regarding structure, setting-up and organization of possible new projects are of particular interest. (orig.) [German] Die umfassenden Veraenderungen der nationalen und internationalen Maerkte in den letzten Jahren wirken nachhaltig auf die zukuenftige Entwicklung der Industrie und der Energieversorgungsunternehmen. Aus der Dynamik und Komplexitaet der Prozesse resultieren neue Herausforderungen. Diese fuehren zur Abkehr von starren Strukturen in den Versorgungsunternehmen hin zu funktionalen am Prozess orientierten Organisationsstrukturen. Zusaetzlich leiten sich daraus eine Reihe neuer Geschaeftsfelder ab. Eines dieser neuen strategischen Geschaeftsfelder ist Consulting. In Deutschland bieten verschiedene regional und kommunal taetige Versorgungsunternehmen verstaerkt Beratungsleistung fuer Dritte weltweit

  16. Low temperature drying. A case study; Niedertemperatur-Trocknung. Eine Fallstudie

    Energy Technology Data Exchange (ETDEWEB)

    Arauzo, Ivan; Permuy, Diana [STC Sistemas de Transferencia de Calor, S.A., Castellon (Spain)

    2012-07-01

    Incorporating waste treatment processes in systems in which residual energy can be utilized is one of the best residue management alternatives. With an LHV of between 2000 and 4500 kcal/kg, efficiently dried sewage sludge can be used as standard fuel, thereby reducing primary energy consumption and the CO{sub 2} quota. (orig.) [German] Abfallbehandlungsverfahren in Anlagen zur Restenergierueckgewinnung sind eine der besten Reststoffentsorgungsoptionen. Effizient getrockneter Klaerschlamm mit einem unteren Heizwert (Hu) von 2000-4500 kcal/kg kann als Standardbrennstoff eingesetzt werden und zur Verminderung von Primaerenergieverbraeuchen und CO{sub 2}-Emissionen beitragen.

  17. Beeinflussung des Angebots im Lebensmitteleinzelhandel durch Konsumenteninformationen: Eine Anwendung auf Basis der Theory of Planned Behavior

    OpenAIRE

    Mecking, Rebecca-Ariane

    2015-01-01

    Von Informationen, die Konsumenten z. B. über Kundenkarten dem Lebensmitteleinzelhandel (LEH) mitteilen, können auch sie selber profitieren, indem das Angebot besser an ihre Bedürfnisse angepasst wird. Basierend auf der Theory of Planned Behavior untersucht diese Arbeit, welche Faktoren entscheidend dafür sind, ob ein Konsument dem LEH zum Zwecke der Einflussnahme Informationen mitteilen möchte. Wichtig sind das Bewusstsein um diese Chance und ihre positiven Folgen. Sorgen um die Privatsphäre...

  18. „Die kriminelle Frau“ – ein „Anwendungsfall“ für die Anomietheorie?

    Directory of Open Access Journals (Sweden)

    Gabriele Schmölzer

    2008-07-01

    Full Text Available Die von der Verfasserin vorgenommene Bearbeitung der Anomietheorie des Soziologen Robert K. Merton zielt darauf ab, „relevante Unterschiede zwischen Frauen und Männern zu finden, die den unterschiedlichen Anteil der Geschlechter bei der registrierten Kriminalität erklären können“ (S. 223. Dies gelingt insofern, als sie strukturelle Variablen herausarbeiten kann, die per se die Wahrscheinlichkeit von strafbarem Verhalten erhöhen. Das Geschlecht spielt dabei (nur insofern eine Rolle, als der Frauenanteil in der besonders kriminalitätsgefährdeten Personengruppe geringer ist.

  19. Cryotherapy of the brain - a new methodical basic approach; Kryotherapie am Hirn - ein neuer methodischer Ansatz

    Energy Technology Data Exchange (ETDEWEB)

    Gruender, W. [Inst. fuer Medizinische Physik und Biophysik, Univ. Leipzig (Germany); Goldammer, A.; Vitzthum, H.E. [Klinik und Poliklinik fuer Neurochirurgie, Univ. Leipzig (Germany); Schober, R. [Selbstaendige Abt. fuer Neuropathologie am Inst. fuer Pathologie, Univ. Leipzig (Germany)

    2003-07-01

    Cryodestruction of tissue is influenced by cooling and thawing rates, absolute tissue temperature, number of freeze-thaw cycles, and type of tissue. However, under clinical conditions a MRT visualization of the temperature distribution during cryo-procedures is not possible. Thus, the extent of necrotic areas within the cryo-influenced regions are not precisely predictable. This limitation is particularly relevant for the application of cryoablation in the brain. The present paper proposes the concept of a local, cryo-induced ischemic necrosis. The basic concept is that the MRT-observable and surgically well-manageable frozen region is ischemic. This cryo-induced ischemia causes a necrosis. The extent of the necrotic region is exclusively determined by the ischemia tolerance of the tissue. The effectiveness of this method is demonstrated on sheep brain in vivo. Compared to the freeze-thaw method, histological examinations show a sharper demarcation between regions of necrosis and healthy tissue. In conclusion, the method of MR-controlled local, cryo-induced ischemia enables an exact definition of the region of necrosis in the brain. (orig.) [German] Die Kryodestruktion von Gewebe ist abhaengig von den Abkuehl- und Taugeschwindigkeiten, von der absoluten Gewebetemperatur, der Anzahl der Gefrier-Tau-Zyklen sowie vom Gewebetyp. Da es unter klinischen Bedingungen nicht moeglich ist, waehrend einer kryochirurgischen Intervention die Temperaturverteilung im Gewebe unter MRT-Kontrolle zu verfolgen, ist der Grad der Gewebedestruktion innerhalb des kaeltebeeinflussten Gebiets nicht sicher voraussagbar. Dies jedoch ist speziell fuer die Anwendung im Hirn wesentlich. In der vorliegenden Arbeit wird das Konzept der lokalen, kaelteinduzierten ischaemischen Nekrose vorgestellt: Dabei erfolgt eine Abkuehlung des intrazerebralen Zielbereichs bis zum Einfrieren des Gewebes. Es resultiert eine im MRT-Bild als signalfreie Zone sichtbare und damit intraoperativ gut zu steuernde

  20. Gas distribution systems. A constant in the energy transition; Gasnetze. Eine Konstante im Energiewandel

    Energy Technology Data Exchange (ETDEWEB)

    Bahke, Ralph [ONTRAS - VNG Gastransport GmbH, Leipzig (Germany)

    2013-06-15

    In the course of the energy transition the gas network infrastructure and the supply of renewable gases provide a valuable potential to be exploited. However the given the regulatory framework are blocking the necessary reorientation and thus hinder the achievement of politically set climate protection targets. [German] Im Zuge der Energiewende bieten die Gasnetzinfrastruktur und die Einspeisung regenerativer Gase ein wertvolles Potenzial, das es zu nutzen gilt. Die gegebenen regulatorischen Rahmenbedingungen blockieren jedoch die dafuer noetige Umorientierung und behindern damit die Erreichung der politisch gesetzten Klimaschutzziele.

  1. RANK/RANK-Ligand/OPG: Ein neuer Therapieansatz in der Osteoporosebehandlung

    Directory of Open Access Journals (Sweden)

    Preisinger E

    2007-01-01

    Full Text Available Die Erforschung der Kopplungsmechanismen zur Osteoklastogenese, Knochenresorption und Remodellierung eröffnete neue mögliche Therapieansätze in der Behandlung der Osteoporose. Eine Schlüsselrolle beim Knochenabbau spielt der RANK- ("receptor activator of nuclear factor (NF- κB"- Ligand (RANKL. Durch die Bindung von RANKL an den Rezeptor RANK wird die Knochenresorption eingeleitet. OPG (Osteoprotegerin sowie der für den klinischen Gebrauch entwickelte humane monoklonale Antikörper (IgG2 Denosumab blockieren die Bindung von RANK-Ligand an RANK und verhindern den Knochenabbau.

  2. Die HECT-Ligase Hul5, eine neue Komponente der ER-assoziierten Proteindegradation

    OpenAIRE

    Kohlmann, Sonja

    2007-01-01

    Die meisten sekretorischen Proteine der eukaryontischen Zellen erreichen durch das endoplasmatische Retikulum (ER) den sekretorischen Signalweg. Sie gelangen vom Zytoplasma durch einen Kanal in der ER-Membran in das ER, wo sie ihre native Konformation erhalten. Das ER enthält ein strenges Qualitätskontrollsystem, welches fehlgefaltete Proteine erkennt, im ER zurückhält und letztendlich der ER-assoziierten Degradation (ERAD) zuführt. Die ER-Qualitätskontrolle und die ER-assoziierte Degradation...

  3. Genome-wide analysis suggests high level of microsynteny and purifying selection affect the evolution of EIN3/EIL family in Rosaceae.

    Science.gov (United States)

    Cao, Yunpeng; Han, Yahui; Meng, Dandan; Li, Dahui; Jin, Qing; Lin, Yi; Cai, Yongping

    2017-01-01

    The ethylene-insensitive3/ethylene-insensitive3-like ( EIN3/EIL ) proteins are a type of nuclear-localized protein with DNA-binding activity in plants. Although the EIN3/EIL gene family has been studied in several plant species, little is known about comprehensive study of the EIN3/EIL gene family in Rosaceae. In this study, ten, five, four, and five EIN3/EIL genes were identified in the genomes of pear ( Pyrus bretschneideri ), mei ( Prunus mume ), peach ( Prunus persica ) and strawberry ( Fragaria vesca ), respectively. Twenty-eight chromosomal segments of EIL/EIN3 gene family were found in four Rosaceae species, and these segments could form seven orthologous or paralogous groups based on interspecies or intraspecies gene colinearity (microsynteny) analysis. Moreover, the highly conserved regions of microsynteny were found in four Rosaceae species. Subsequently it was found that both whole genome duplication and tandem duplication events significantly contributed to the EIL/EIN3 gene family expansion. Gene expression analysis of the EIL/EIN3 genes in the pear revealed subfunctionalization for several PbEIL genes derived from whole genome duplication. It is noteworthy that according to environmental selection pressure analysis, the strong purifying selection should dominate the maintenance of the EIL/EIN3 gene family in four Rosaceae species. These results provided useful information on Rosaceae EIL/EIN3 genes, as well as insights into the evolution of this gene family in four Rosaceae species. Furthermore, high level of microsynteny in the four Rosaceae plants suggested that a large-scale genome duplication event in the EIL/EIN3 gene family was predated to speciation.

  4. Genome-wide analysis suggests high level of microsynteny and purifying selection affect the evolution of EIN3/EIL family in Rosaceae

    Directory of Open Access Journals (Sweden)

    Yunpeng Cao

    2017-05-01

    Full Text Available The ethylene-insensitive3/ethylene-insensitive3-like (EIN3/EIL proteins are a type of nuclear-localized protein with DNA-binding activity in plants. Although the EIN3/EIL gene family has been studied in several plant species, little is known about comprehensive study of the EIN3/EIL gene family in Rosaceae. In this study, ten, five, four, and five EIN3/EIL genes were identified in the genomes of pear (Pyrus bretschneideri, mei (Prunus mume, peach (Prunus persica and strawberry (Fragaria vesca, respectively. Twenty-eight chromosomal segments of EIL/EIN3 gene family were found in four Rosaceae species, and these segments could form seven orthologous or paralogous groups based on interspecies or intraspecies gene colinearity (microsynteny analysis. Moreover, the highly conserved regions of microsynteny were found in four Rosaceae species. Subsequently it was found that both whole genome duplication and tandem duplication events significantly contributed to the EIL/EIN3 gene family expansion. Gene expression analysis of the EIL/EIN3 genes in the pear revealed subfunctionalization for several PbEIL genes derived from whole genome duplication. It is noteworthy that according to environmental selection pressure analysis, the strong purifying selection should dominate the maintenance of the EIL/EIN3 gene family in four Rosaceae species. These results provided useful information on Rosaceae EIL/EIN3 genes, as well as insights into the evolution of this gene family in four Rosaceae species. Furthermore, high level of microsynteny in the four Rosaceae plants suggested that a large-scale genome duplication event in the EIL/EIN3 gene family was predated to speciation.

  5. Dewatering and drying - prerequisites for a safe sewage sludge disposal; Entwaesserung und Trocknung - Voraussetzung fuer eine sichere Klaerschlammentsorgung

    Energy Technology Data Exchange (ETDEWEB)

    Wiesmann, J. [Stadtentwaesserung Zuerich (Switzerland)

    1997-12-31

    Today, besides the agricultural utilization of liquid and drained sludge and the composting, there are the following different disposal ways which come into consideration: - sludge combustion in an independent plant or with garbage together; - utilization as a combustible both in cement and asphalt industry as well as in thermal power stations; - additives in commercial fertilizer or direct utilization as a dry fertilizer in agriculture (phosphorus fertilizer). All these ways demand a sludge product, with a dry content of 55 up to approximately 90 percent. During specification of an as flexible as possible plant in the waste water treatment plant Zurich-Werdhoelzli therefore, was demanded a double stage drying, for the production of both products, one with about 55 percent of dry matter (for combustion without supplementary combustibles) and one of these with 85-95 percent of dry matter. An indirect thin film contact extrusion gear was chosen in order to hold the odour and dust problems as small as possible, a high drying degree, in order to allow the desired corrected piling up and a better handling. This in turn should bring a further flexibility for trading of the sewage sludge product what has again favorable influence on the costs. (orig./SR) [Deutsch] Zur Zeit kommen neben der landwirtschaftlichen Verwertung von fluessigem und entwaessertem Schlamm sowie dem Kompostieren folgende Entsorgungswege in Frage: - Schlammverbrennung in einer eigenstaendigen Anlage oder zusammen mit Muell; - Einsatz als Brennstoff sowohl in der Zement- und Asphaltindustrie wie auch in thermischen Kraftwerken; - Zuschlagstoff in Handelsduenger oder direkter Einsatz als Trockenduenger (Phosphorduenger) in der Landwirtschaft. Alle diese Wege verlangen ein Schlammprodukt, das einen Trockengehalt von 55 resp. rund 90 Prozent aufweisen muss. Bei der Spezifikation einer moeglichst flexiblen Anlage in der Klaeranlage Zuerich-Werdhoelzli wurde deshalb eine zweistufige Trocknung verlangt, die

  6. Einsatzmöglichkeiten eines saponinreichen Extrakts aus Quillaja saponaria Molina zur Formulierung und Stabilisierung von funktionellen Lebensmittelinhaltsstoffen

    OpenAIRE

    Tippel, Janine

    2017-01-01

    Emulgatoren werden in der Lebensmittelindustrie häufig zur Herstellung disperser Trägersysteme verwendet, welche eine Solubilisierung und Erhöhung der Stabilität von lipophilen Lebensmittelinhaltsstoffen ermöglichen. Für flüssige Lebensmittelsysteme können mizellare Systeme und Emulsionen eingesetzt werden. Eine Sprühtrocknung ermöglicht hier die Umwandlung flüssiger Formulierungen in feste Pulver, welche den Transport und die Einbringung in das Endprodukt vereinfachen. Zudem können durch Ver...

  7. External therapy with radioactive urine: a pitfall during sceletal scintigraphy; Heisse Eigenurintherapie: ein ueberraschender Befund bei der Skelettszintigraphie

    Energy Technology Data Exchange (ETDEWEB)

    Scheidhauer, K.; Urbannek, V. [Klinik und Poliklinik fuer Nuklearmedizin, Univ. Koeln (Germany)

    1997-12-01

    A 41-year old male patient suffering from psoriasis arthropathica underwent a two-phase bone scan for activity of joint affections. Extensive diffuse skin contamination of the extremities in the delayed images was due to the use of the patient`s own radioactive urine as an embrocation for psoriasis exanthema. (orig.) [Deutsch] Bei einem 41jaehrigen Patienten mit Psoriasisarthropathie fiel in der Skelettszintigraphie in den Aufnahmen der Mineralisationsphase eine flaechige Aktivitaetsbelegung der Beine auf. Als Ursache stellte sich das zwischenzeitliche Einreiben der Extremitaeten durch den Patienten mit dem radioaktiven Eigenurin wegen eines Exantherms heraus. (orig.)

  8. Realisierung eines verzerrungsarmen Open-Loop Klasse-D Audio-Verstärkers mit SB-ZePoC

    Directory of Open Access Journals (Sweden)

    O. Schnick

    2007-06-01

    Full Text Available In den letzten Jahren hat die Entwicklung von Klasse-D Verstärkern für Audio-Anwendungen ein vermehrtes Interesse auf sich gezogen. Eine Motivation hierfür liegt in der mit dieser Technik extrem hohen erzielbaren Effizienz von über 90%. Die Signale, die Klasse-D Verstärker steuern, sind binär. Immer mehr Audio-Signale werden entweder digital gespeichert (CD, DVD, MP3 oder digital übermittelt (Internet, DRM, DAB, DVB-T, DVB-S, GMS, UMTS, weshalb eine direkte Umsetzung dieser Daten in ein binäres Steuersignal ohne vorherige konventionelle D/A-Wandlung erstrebenswert erscheint.

    Die klassischen Pulsweitenmodulationsverfahren führen zu Aliasing-Komponenten im Audio-Basisband. Diese Verzerrungen können nur durch eine sehr hohe Schaltfrequenz auf ein akzeptables Maß reduziert werden. Durch das von der Forschungsgruppe um Prof. Mathis vorgestellte SB-ZePoC Verfahren (Zero Position Coding with Separated Baseband wird diese Art der Signalverzerrung durch Generierung eines separierten Basisbands verhindert. Deshalb können auch niedrige Schaltfrequenzen gewählt werden. Dadurch werden nicht nur die Schaltverluste, sondern auch Timing-Verzerrungen verringert, die durch die nichtideale Schaltendstufe verursacht werden. Diese tragen einen großen Anteil zu den gesamten Verzerrungen eines Klasse-D Verstärkers bei. Mit dem SB-ZePoC Verfahren lassen sich verzerrungsarme Open-Loop Klasse-D Audio-Verstärker realisieren, die ohne aufwändige Gegenkopplungsschleifen auskommen.

    Class-D amplifiers are suiteble for amplification of audio signals. One argument is their high efficiency of 90% and more. Today most of the audio signals are stored or transmitted in digital form. A digitally controlled Class-D amplifier can be directly driven with coded (modulated data. No separate D/A conversion is needed. Classical modulation schemes like Pulse-Width-Modulation (PWM cause aliasing. So a very high switching rate is required to minimize the

  9. Wie das Neue in eine Brandenburgische Hochschulbibliothek kommt und nicht versiegen mag – Ein persönlicher Rückblick

    Directory of Open Access Journals (Sweden)

    Frank Seeliger

    2015-11-01

    Full Text Available Das Mantra der Kundenorientierung, Serviceentwicklung und die Verpflichtung zur Effektivität wie Effizienz bei der Bewältigung aller Geschäftsgänge sind mittlerweile Allgemeinplätze. Es verpflichtet Informationseinrichtungen, den aktuellen Entwicklungen und der Zeit auf den Fersen zu bleiben. Was bedeutet dies auf der alltäglich pragmatischen Ebene für eine überschaubare Fachhochschulbibliothek? Eine, die mit wenigen Ressourcen ausgestattet als Showcase, repräsentativer Raum, Boutique sich gut „verkaufen“ muss, um en vogue oder einfach nur relevant und interessant für Stakeholder, Nutzer sowie Mitarbeiter zu bleiben? Auf dem Campus der berlinnahen Informationseinrichtung wird seit dem Neubezug einer denkmalgeschützten Verladehalle 2007 versucht, dem gewinnenden Charme und anmutigen Ambiente des Porticus auch eine herausragende Rolle als Innovations-Hub für die Hochschule und Bibliotheken im Allgmeinen über gelebte neue Ideen abzugewinnen. Sie betreffen sowohl technische Lösungen in Bezug auf RFID, Visualisierung, Automatisierung und Software, aber auch Formate für Veranstaltungen und Weiterbildung. Was ist aber hierfür nötig, um das Neue, gekauft oder selbst gezimmert, immer wieder einfliessen zu lassen und sich mit dem Profil der tatkräftigen und kreativen Avantgarde zu identifizieren? Der Beitrag wird versuchen, das Umfeld dafür zu beleuchten, um Innovationen als selbstverständliche Erwartungshaltung reifen zu lassen. Der deskriptive Ansatz soll nach keineswegs vollständiger Reflexion eigener Bemühungen prima facie Anregung geben dazu, wie im öffentlichen Dienst und ohne direkte Tuchfühlung zu „schwarzen Zahlen“ eine Firmenkultur Einzug halten kann, die bei entsprechender Erwartungshaltung das Unvorhersehbare für sich höher einschätzt als das Vertraute. Es ist ein Plädoyer für das offene System, ein Hoch auf Veränderung und Neues, ohne damit in eine willkürliche Vielfalt zu geraten. Warum kann das

  10. In Situ Dark Adaptation Enhances the Efficiency of DNA Extraction from Mature Pin Oak (Quercus palustris Leaves, Facilitating the Identification of Partial Sequences of the 18S rRNA and Isoprene Synthase (IspS Genes

    Directory of Open Access Journals (Sweden)

    Csengele E. Barta

    2017-10-01

    Full Text Available Mature oak (Quercus spp. leaves, although abundantly available during the plants’ developmental cycle, are rarely exploited as viable sources of genomic DNA. These leaves are rich in metabolites difficult to remove during standard DNA purification, interfering with downstream molecular genetics applications. The current work assessed whether in situ dark adaptation, to deplete sugar reserves and inhibit secondary metabolite synthesis could compensate for the difficulties encountered when isolating DNA from mature leaves rich in secondary metabolites. We optimized a rapid, commercial kit based method to extract genomic DNA from dark- and light-adapted leaves. We demonstrated that in situ dark adaptation increases the yield and quality of genomic DNA obtained from mature oak leaves, yielding templates of sufficiently high quality for direct downstream applications, such as PCR amplification and gene identification. The quality of templates isolated from dark-adapted pin oak leaves particularly improved the amplification of larger fragments in our experiments. From DNA extracts prepared with our optimized method, we identified for the first time partial segments of the genes encoding 18S rRNA and isoprene synthase (IspS from pin oak (Quercus palustris, whose full genome has not yet been sequenced.

  11. Lehre - Lab - Research. Eine Mediathek im Spannungsfeld zwischen Lehre und Forschung

    Directory of Open Access Journals (Sweden)

    Tabea Lurk

    2017-12-01

    Full Text Available Der Beitrag stellt den Laborcharakter der Mediathek der Hochschule für Gestaltung und Kunst FHNW Basel (HGK vor und verdeutlicht anhand vom „integrierten Katalog“, wie der Einfluss der fortschreitenden Digitalisierung, die spezifischen lokalen und institutionellen Rahmenbedingungen sowie die wissenschaftspolitischen Anforderungen der künstlerischen und der Designforschung zur Profilbildung der Mediathek beitragen. Eine effiziente Kleinststruktur intern und eine grosse Offenheit für externe Anregungen und Kooperationen ermöglichen jene flexiblen und experimentellen Strukturen, die neben dem Normalbetrieb als Verbunds- und Fernleihbibliothek den spezifischen Charakter der Mediathek auszeichnen. The text presents the laboratory character of the Mediathek of the Academy of Design and Art FHNW Basel (HGK and shows on the basis of the “integrated catalogue” how the ongoing digitization, the specific local and institutional framework and the academic policies, including artistic and design research, influence the profile of the Mediathek. An efficient internal microstructure and a great openness for external stimuli and collaborations enable flexible and experimental structures, which, in addition to the daily business as NEBIS Network library, characterize the typical nature of the Mediathek.

  12. Ein statistisches Modell zum Einfluß der thermischen Bewegung auf NMR-Festkörperspektren

    Science.gov (United States)

    Ploss, W.; Freude, D.; Pfeifer, H.; Schmiedel, H.

    Es wird ein statistisches Modell zum Einfluß der thermischen Bewegung auf die NMR-Linienform vorgestellt, das die Verschmälerung von Festkörper-Spektren bei wachsender Temperatur beschreibt. Das Modell geht von der Annahme aus, daß nach einer Ortsveränderung eines Kerns infolge thermischer Bewegung jede beliebige Kernresonanzfrequenz mit der durch das Festkörperspektrum vorgegebenen Wahrscheinlichkeit angenommen werden kann. Am Beispiel der Festkörper-Gaußlinie wird der Unterschied zu dem bekannten Modell von ANDERSON und WEISS verdeutlicht.Translated AbstractA Statistical Model for the Influence of Thermal Motion on N. M. R. Spectra in SolidsA theory is proposed which allows to describe the narrowing of n. m. r.-line width in the presence of thermal motions of the spins. The model is based on the assumption, that the local resonance frequency of a given spin immediately after the jump is distributed according to the n. m. r.-line shape of the rigid lattice. The difference to the well-known ANDERSON-WEISS-model of spectral narrowing is demonstrated for a gaussian line shape.

  13. Narrative Kompetenz: Anforderungen an ein Verfahren der Sprach-standsfeststellung im Elementarbereich

    Directory of Open Access Journals (Sweden)

    Natalia Kapica

    2014-10-01

    Full Text Available Im vorliegenden Beitrag wird der Frage nachgegangen, welche Merkmale ein Verfahren zur Feststellung des Sprachstandes im Bereich Erzählkompetenz vereinen sollte, um nutzbare Informationen für die Planung an-schließender Fördermaßnahmen zu liefern. Dabei wird von der spracherwerbstheoretisch hergeleiteten Annahme ausgegangen, dass Förderangebote entwicklungssensitiv angelegt sein sollten, also von der erwartbaren Erwerbsprogression und dem jeweiligen Sprachstand des Kindes ausgehen sollten. Mit dieser diagnostischen Zielsetzung vor Augen werden anhand der Kategorien „entwicklungspsychologische/schulische Relevanz“, „profilanalytische Auswertung“ sowie „Authentizität der Sprachdaten“ Anforderungen an ein förderdiagnostisches Verfahren formuliert und exemplarisch auf Erkenntnisse der Spracherwerbsforschung zurückbezogen. The present article addresses the question of which characteristics a language proficiency assessment of children ́s narrative competence should possess to allow for its results to be used for planning subsequent assistance measures.The underlying assumption states that language acquisition processes follow their own inherent developmental pathway. Language promotion programmes should therefore be responsive to the children's development and be based on the respective proficiency level and the learning progress that may be expected. In view of this objective, the article specifies requirements on „interventional diagnostics” and correlates these with insights from languageacquisition research.

  14. Einstellung und Wissen von Lehramtsstudierenden zur Evolution - ein Vergleich zwischen Deutschland und der Türkei

    Science.gov (United States)

    Graf, Dittmar; Soran, Haluk

    Es wird eine Untersuchung vorgestellt, in der Wissen und Überzeugungen von Lehramtsstudierenden aller Fächer zum Thema Evolution an zwei Universitäten in Deutschland und der Türkei erhoben worden sind. Die Befragung wurde in Dortmund und in Ankara durchgeführt. Es stellte sich heraus, dass ausgeprägte Defizite im Verständnis der Evolutionsmechanismen herrschen. Viele Studierende, insbesondere aus der Türkei, sind nicht von der Faktizität der Evolution überzeugt. Dies gilt sowohl für Studierende mit Fach Biologie als auch für Studierende mit anderen Fächern. Näher untersucht worden sind die Faktoren, die die Überzeugungen zur Evolution beeinflussen können, was ja in Anbetracht der hohen Ablehnungsrate der Evolution von besonderem Interesse ist. Das Vertrauen in die Wissenschaft spielt hierbei eine besondere Rolle: Wer der Wissenschaft vertraut, ist auch eher von der Evolution überzeugt, als diejenigen, die skeptisch gegenüber der Wissenschaft sind.

  15. Editorial: Neue Fernsehserien und ihr Potenzial für eine kritische Medienpädagogik

    Directory of Open Access Journals (Sweden)

    Elena Pilipets

    2016-07-01

    Full Text Available Die Auseinandersetzung mit Fernsehserien spielt eine wichtige Rolle im Leben vieler Menschen weltweit: Die Serien wiederholen und entwickeln sich, sind Teil der Medienroutine, begleiten uns im Alltag. Was sie erzählen, entsteht daher nicht unerwartet oder zufällig, sondern verweist auf eine langfristige Ausprägung populärkultureller Ausdrucksformen, die kognitiv und ästhetisch sowie anwendungsorientiert ist (Eichner et al. 2013. Nichtsdestotrotz hatten die populären Serien schon immer ‹unvorhersehbare Folgen›. Vor allem Fernsehserien, die angesichts enormer Veränderungen in verschiedenen Bereichen der kulturindustriellen Medienunterhaltung seit den 1980er- und vor allem den 1990er- Jahren als anspruchsvolle und experimentelle erzählerische Formen wiederentdeckt wurden, scheinen sich permanent aufs Neue zu erfinden. Episode für Episode, Staffel für Staffel, irgendwo im Dazwischen von «coming next…» und «previously on» (Meteling et al. 2010 entfalten sich komplexe mediale Erfahrungswelten, indem sie dem performativen Imperativ popkultureller Überbietung zufolge an der kontinuierlichen Erweiterung ihrer narrativen und medialen Möglichkeiten arbeiten (Jahn-Sudmann/Kelleter 2012. Diese prozessorientierte Fähigkeit der Fernsehserie, aus der eigenen Transformation zu lernen, wird im Rahmen dieses Themenheftes hinsichtlich folgender (medien-pädagogischer Aspekte diskutiert:

  16. Lernen von der Medienkunst: Handlungsstrategien der Netzwerk-Kultur - eine medienkulturgeschichtliche Perspektive

    Directory of Open Access Journals (Sweden)

    Shusha Niederberger

    2014-06-01

    Full Text Available Der Begriff der Medienkunst wird mit fortschreitender Medialisierung der Welt immer problematischer. Die Digitalisierung hat alle künstlerischen Medien (ob technische oder nicht als Medien sichtbar gemacht und deren Verhältnis untereinander grundlegend verändert. Rosalind Krauss bezeichnet dieses neue Verhältnis als "post-medium condition" (Krauss 2000. Wenn wir also von der Medienkunst etwas über Medien lernen wollen, was für eine Medienpädagogik nutzbar ist, müssen wir die Entgrenzung des Medialen berücksichtigen. Diese macht die Abgrenzung von Medienkunst von anderen Künsten sehr schwierig, da eine solche künstlerische Praxis weder an formalen, inhaltlichen oder materiellen Eigenschaften festgemacht werden kann. Ich schlage in diesem Text vor, die Medienkunst in ihren methodischen Strategien zu betrachten. Ihre Referenzen in der Kunstgeschichte sind dabei die Konzeptkunst und die Institutionskritik, als kulturgeschichtlichen Hintergrund komme ich auf die Kybernetik zurück. Im vorliegenden Essay möchte ich versuchen, Anschlussmöglichkeiten einer kritischen Medienpädagogik an die aus der Kybernetik entstandene gegenwärtige Netzwerkkultur zu formulieren. Netzwerkkultur bezeichnet dabei nicht die spezifischen Technologien des Internets wie das Social Web, sondern die aus dem Geiste der Kybernetik entstandenen Formen vernetzter Handlungsmöglichkeiten, zu denen unter anderen auch das Social Web gehören.

  17. Underground storage with floating cover. An overview; Erdbeckenspeicher mit schwimmender Abdeckung. Eine Uebersicht

    Energy Technology Data Exchange (ETDEWEB)

    Heller, A.; Maureschat, G.; Duer, K. [Technical Univ. of Denmark, Lyngby (Denmark). Dept. of Buildings and Energy

    1998-12-31

    A number of underground stores have been developed in recent years in Denmark. The development has been subsidised with funds of `Development program renewable energy` launched by the Danish Ministry for Environment and Energy. First experience reports on underground storage show that more emphasis must be put on the development of storage sealing and cover construction. Hence research works currently focuses on the investigation of liner material and further development of floating cover constructions. The target is the development of underground storage using solar energy for heating that can compete with conventional heating systems technically and economically. (orig.) [Deutsch] In Daenemark hat man in den letzten Jahren eine Reihe von Erdbeckenspeichern entwickelt. Die Entwicklung wird mit Mitteln aus dem `Entwicklungsprogramm Erneuerbare Energie` vom daenischen Umwelt- und Energieministerium finanziell gefoerdert. Die ersten Erfahrungen mit Erdbeckenspeichern haben gezeigt, dass ein verstaerkter Einsatz bei der Entwicklung von Abdichtungen des Speichers und von Deckelkonstruktionen gefordert ist. Deshalb wird in Daenemark aktuell mit der Untersuchung von Linermaterialien und der Weiterentwicklung von schwimmenden Deckelkonstruktionen gearbeitet. Das Ziel dieser Arbeit ist es, Erdbeckenspeicher zu entwickeln, die die Ausnutzung von Sonnenenergie zur Waermeversorgung im Vergleich mit herkoemmlicher Waermeversorgung sowohl technisch als auch oekonomisch konkurrenzfaehig macht. (orig.)

  18. Twenty years of environmental education in Germany - a stocktaking; 20 Jahre Umweltbildung in Deutschland. Eine Bilanz

    Energy Technology Data Exchange (ETDEWEB)

    Lob, R.E. [Essen Univ. (Gesamthochschule) (Germany). Zentralstelle fuer Umwelterziehung

    1997-12-31

    The book is a precise documentation of the development of environmental edcuation as an educational task in the Federal Republic of Germany. It covers a large range: from Stockholm over Tiflis and Moscow to Rio and Toronto under the catchword ``national and international conferences``, and from eco-pedagogy over environmental consciousness to environmental activities in the chapter ``fundamentals and concepts``. Inventories and analyses of activities at schools are given, curricula and textbooks are examined, and developments in the subjects biology and geography are assessed. The book deals with nature and forest pedagogy, environmental games and projects, LUCAS - the environmental education learning programme at schools of commerce, and the European environmental academy at Borken, Westphalia. After an overview on central research and sponsoring institutions, conclusions are drawn and an outlook is given. (orig.) [Deutsch] Das Buch ist eine praezise Dokumentation der Entwicklung der `Bildungsaufgabe Umwelterziehung` in der Bundesrepublik Deutschland. Der Bogen wird weit gespannt: Von Stockholm ueber Tiflis und Moskau nach Rio und Toronto beim Stichwort `nationale und internationale Konferenzen`, von der Oekopaedagogik ueber das Umweltbewusstsein bis hin zum Umwelthandeln im Kapitel `Grundlagen und Begriffe`. Es folgen Bestandsaufnahmen und Analysen der Schulpraxis, Untersuchungen von Lehrplaenen und Schulbuechern sowie eine Begutachtung der Entwicklungen in den Faechern Biologie und Geographie. Der Autor thematisiert Natur- und Waldpaedagogik, Umweltspiele oder Projekte, LUKAS - das Lernprogramm Umweltbildung an kaufmaennischen Schulen und die `Europaeische Umweltakademie` im westfaelischen Borken. Der Bestandsaufnahme ueber zentrale Forschungs- und Foerdereinrichtungen folgen abschliessend Bilanz und Ausblick. (orig.)

  19. Arbitration in environmental matters. An interdisciplinary introduction; Studienbrief Umweltmediation. Eine interdisziplinaere Einfuehrung

    Energy Technology Data Exchange (ETDEWEB)

    Claus, F; Fietkau, H J; Fuchs, G [and others

    2000-07-01

    This textbook provides a comprehensive and systematic introduction to the process of arbitration in environmental matters, both for self-studies and for participants in the seminars on which it is based. The interdisciplinary readership is reflected in the interdisciplinary group of authors. The publication can be used as a training programme. [German] Mit Vorliegen dieses Studienbriefs wird erstmals eine Moeglichkeit geboten, sich umfassend und systematisch, im Eigenstudium oder im Rahmen des dazugehoerigen Seminarprogramms, mit dem Verfahren der Umweltmediation vertraut zu machen. Der Vielfalt der angesprochenen Zielgruppen (Politik, Verwaltung, Wirtschaft, Rechtswesen usw.) wurde in der interdisziplinaeren Zusammensetzung des Autorenkreises Rechnung getragen. Das Layout wurde so gestaltet, dass es die inhaltliche Orientierung erleichert. Zusaetzlich kann der Studienbrief auch als Bauelement fuer eine umfassendere Wissensaneignung dienen: Erstens ist es moeglich, sich ueber das oben genannte Ausbildungsprogramm fuer Praktiker zum Mediator fortzubilden. Zweitens besteht die Chance, das erworbene Wissen durch einen Lehrgang zur Agenda-Moderation des Wissenschaftsladen Bonn e.V. um weitere konsens- und handlungsorientierte Verfahren zu erweitern. Informationen koennen ueber den Foerderverein Umweltmediation e.V., Matthias-Gruenewald-Str. 1-3, 53175 Bonn, Tel. 0228/3 72 99 27, eingeholt werden. (orig.)

  20. Hybride textuelle Strukturen und hybride textuelle Einheiten. Ein Beitrag zur Theorie der Wörterbuchform

    Directory of Open Access Journals (Sweden)

    Herbert Ernst Wiegand

    2011-10-01

    Full Text Available

    ZUSAMMENFASSUNG: In diesem Beitrag wird die Bildung, Darstellung und Leistung von hybriden textuellen Strukturen, die akzessive Einträge aufweisen, am Beispiel von Wörterbuchartikeln behandelt sowie erklärt, welche Eigenschaften hybride textuelle Einheiten haben. Ein Wörterbuchartikel eines Printwörterbuchs weist immer dann neben einer hierarchischen reinen eine hierarchische hybride Textkonstituentenstruktur auf, wenn in ihm mindestens ein funktionaler Angabezusatz auftritt, z.B. ein oben oder unten erweiternder oder ein binnenerweiternder. Da funktionale Angabezusätze Textsegmente mit Angabefunktion aber ohne Textkonstituentenstatus sind, werden sie durch nichtfunktionale Segmentation ermittelt, so dass neben funktionalen auch nichtfunktionale Textsegmente gegeben sind, die dann bei der Strukturbildung in die Trägermengen eingehen, so dass die Trägermengen aller hybriden hierarchischen Strukturen elementenheterogen, während die Trägermengen aller hierarchischen reinen Strukturen elementenhomogen sind. In den Strukturgraphen für hierarchische hybride Artikelstrukturen sind dann die Knoten für diejenigen Textsegmente, die den Hybridstatus der Strukturen bewirken, entweder durch Pfeilkanten für die textarchitektonischen oberhalb/unterhalb-Relationen mit den Knoten für die Textkonstituenten verbunden, so dass die Strukturgraphen architektonisch angereichert sind, oder durch besonders markierte Kanten, die die Knoten für die nichtfunktionalen Textsegmente und die für die binnenerweiternden funktionalen Angabezusätze mit den Knoten für die Textkonstituenten verbinden. Zu jedem Typ von hierarchischer reiner Artikelstruktur gehören mehrere Typen von hybriden Artikelstrukturen; entsprechendes gilt für hierarchische reine Angabestrukturen. Nur eine Auswahl aus den Typologien der hybriden Artikel- und Angabestrukturen wird behandelt sowie eine kleine Auswahl von hybriden textuellen Einheiten, die kriteriale Eigenschaften von zwei

  1. Investigation of a matrix converter for contactless power transmission systems; Untersuchung eines Matrixumrichters fuer kontaktlose Energieuebertragungssysteme

    Energy Technology Data Exchange (ETDEWEB)

    Ecklebe, Andreas

    2009-05-22

    Arbeit beschaeftigt sich mit einem drei- zu zweiphasigen Matrixumrichter zur Speisung von kontaktlosen Energieuebertragungssystemen. Aufbauend auf einer Darlegung relevanter Untersuchungen zur Thematik werden zunaechst moegliche Resonanzanordnungen fuer kontaktlose Energieuebertragungssysteme untersucht. Die Betrachtung wichtiger elektrischer Parameter zeigt neben den Unterschieden der einzelnen Anordnungen auch, dass fuer eine auf den speisenden Umrichter fokussierte Untersuchung eine einfache Modellierung der drei untersuchten Resonanzanordnungen mit Hilfe eines Reihenschwingkreises moeglich ist. Als Konsequenz ergibt sich die Schlussfolgerung, dass sich die erzielten Ergebnisse auch fuer den Matrixumrichter mit anderen serienresonanten Lasten anwenden lassen. Der zweite Teil der Arbeit ist der Untersuchung des Matrixumrichters gewidmet. Basierend auf einer theoretischen Beschreibung wird die Kombination von hochfrequenten Steuerverfahren - wie z.B. der Blocktaktung - und niederfrequenten Pulsmustern zur Stellung des Oberschwingungsgehalts der Netzstroeme vorgestellt. Die Aehnlichkeit des Umrichters zu einem konventionellen Wechselrichter in H-Brueckenschaltung ermoeglicht anschliessend eine Betrachtung der Kommutierung und die Ableitung notwendiger Schaltzustaende. Diese sind dadurch gekennzeichnet, dass zu jedem Zeitpunkt genau eine bidirektionale Verbindung vom Eingangssystem zu jeder Ausgangsphase besteht. Die Funktionsweise der Kommutierung wie auch des gesamten Umrichters wird in einem ersten Schritt simulativ belegt. Dabei wird auch das dynamische Schaltverhalten der Leistungshalbleiter beruecksichtigt. Anschliessend werden an einem Laboraufbau aufgenommene Messergebnisse vorgestellt und mit den theoretischen Ergebnissen verglichen. Der Laboraufbau besteht aus dem Leistungsteil des Matrixumrichters mit Eingangsfiltern und modularen Gate-Treibern, einem DSP/FPGA-Steuerungssystem und einem kontaktlosen Energieuebertragungssystem mit sekundaerseitigem Gleichrichter

  2. Development of an aerobic/anaerobic process for in-situ-rehabilitation of a mostly with mineral oil contaminated location. Final report; Entwicklung eines aeroben/anaeroben Verfahrens zur `In situ-Sanierung` eines vorwiegend mineraloelkontaminierten Altlaststandortes. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Auerbach, C; Winsel, E; Wartenberg, G

    1994-12-31

    - A location contaminated with mineral oil was tested for the possibility of a bioremediation; - the microbiological tests showed, that there is both an aerobiotic and an optional anaerobic autochthonous pollutants degrading microflora but only the activation of the aerobiotic germs was possible by both suitable nutrients and test conditions; - in degrading tests with a high concentration of pollutants a degradation was possible by addition of different nutrients. Within a week a degradation of about 70% was shown. In areas of lower concentration the possible degradation was smaller. - An in-situ-rehabilitation by a hydraulic supply of the soil microorganisms was not possible because of the anisotropic conditions at the location in a depth of 5-10 m; - an in-situ-rehabilitation with both soil air aspiration and aeration, for the supply of the soil microorganisms too, is even possible at anisotropic soil conditions; - now there is knowledge about both a variable filtration and tubing for an optimal adaptation for the bioremediation to the damage; - apparatus were developped for in-situ-rehabilitation for small and medium locations, useable for biological processes too; - there is a wide utilization of the aeration apparatus is because of the careful environmental use. (orig.) [Deutsch] - Ein Mineraloel-kontaminierter Altlaststandort wurde im Hinblick auf eine moegliche biologische Sanierung untersucht. - Die mikrobiologischen Untersuchungen ergaben, dass eine aerobe und fakultativ anaerobe autochthone schadstoffabbauende Mikroflora vorhanden ist, aber nur der aeroben Keime durch geeignete Naehrstoffe und Versuchsbedingungen aktivierbar waren. - In Abbauuntersuchungen durch Zusatz unterschiedlicher Naehrsalze konnte bei hoher Schadstoffkonzentration schon nach 1 Woche ein Abbau > 70% erreicht werden. In niederen Konzentrationsbereichen war die Schadstoffabbaupotenz wesentlich geringer. - Die anisotropen Verhaeltnisse am Standort in 5-10m Tiefe liessen eine In

  3. Von Systemkritik zur Anpassung : Wie ein Buch in der Übersetzung die Farbe wechselt / Marianne Vogel

    Index Scriptorium Estoniae

    Vogel, Marianne

    2002-01-01

    Arvustus: Vetemaa, Enn. Die Nixen von Estland : ein Bestimmungsbuch / frei nach E. Vetemaa ; bearbeitet und illustriert von Kat Menschik ; nach dem russischen Übersetzungsmanuskript ins Deutsche übertragen von Günter Jäniche. Frankfurt/M : Eichborn Verlag, 2002.

  4. Die schwache Adjektivflexion im Dänischen und Deutschen. Eine Fingerübung in diachronischer Typologie

    DEFF Research Database (Denmark)

    Haberland, Hartmut; Heltoft, Lars

    2008-01-01

    als Ganze als [±definit] markiert – wobei die Adjektive gelegentlich an dieser Markierung mitwirken, gelegentlich aber auch nicht. Die schwache Flexion ist der reine Nominalgruppenkitt. Ein Vergleich mit anderen germanischen Sprachen und früheren Sprachstufen zeigt, dass Deutsch und Dänisch...

  5. [Heinz von zur Mühlen. Das Bürgertum Fordert Blut. Ein Bolschewistiches Flugblatt von 1918] / Paul Kaegbein

    Index Scriptorium Estoniae

    Kaegbein, Paul

    2007-01-01

    Arvustus: Heinz von zur Mühlen. Das Bürgertum Fordert Blut. Ein Bolschewistiches Flugblatt von 1918. In : Ostseeprovinzen, baltische Staaten und das Nationale. Münster : LIT, 2005, lk. 403-414. 1918. aastast pärit lendlehest, mille käekirja järgi otsustades on kirjutanud Viktor Kingissepp

  6. Hepatische Cytochrom-Wechselwirkungen von pharmakologischen Substanzen - Eine Literaturrecherche für den Zeitraum 2000 - 2008

    OpenAIRE

    Dippl, Hubert

    2011-01-01

    Hepatische CYP-P-450-Enzyme sind an der Metabolisierung der meisten pharmakologischen Substanzen beteiligt. Im Rahmen dieser Arbeit wurde eine Literaturrecherche durchgeführt, die die in Medline publizierten Arbeiten im Zeitraum 2000-2008 zum Arzneimittelmetabo-lismus von hepatischen Cytochrom-Enzymen berücksichtigt.

  7. Zur Entwicklung eines interaktiven Verfahrens der Sprachstandsermittlung bei mehrsprachig aufwachsenden Kindern – von der Idee zu ersten Umsetzungsschritten

    Directory of Open Access Journals (Sweden)

    Jörg Roche et al.

    2016-10-01

    Full Text Available Dieser Beitrag skizziert ein Konzept zur Sprachstandsermittlung, das aufbauend auf Ergebnissen der gebrauchsbasierten Spracherwerbsforschung die sprachlichen Fähigkeiten von Vorschulkindern in quasi-natürlichen Gesprächssituationen misst. Den Maßstab bilden dabei die altersgemäßen Deutschkompetenzen monolingualer und bilingualer Kinder im Vorschulalter. Mit dem neuen Verfahren soll eine akkurate Bewertung der kommunikativen Kompetenzen der Kinder am Übergang zur Schule erfolgen, die eine systematische Benachteiligung mehrsprachig aufwachsender Kinder aufgrund von Vergleichen mit zielsprachlichen Erwachsenennormen vermeidet. Das neuartige Erhebungsverfahren wird dabei in Form einer digitalen Spielumgebung (App entwickelt, die eine Umsetzung der Prinzipien des handlungsorientierten Sprachenlernens erlaubt. This paper presents the implementation of a new concept of first and second language assessment for pre-school children between four and six years. The concept is theoretically grounded in usage-based linguistics. It assesses language in authentic communicative settings in a game based app. The settings provide the children with incentives to engage in communication. As a result, the assessment tool does not evaluate formal aspects of language. Instead it relies on functional categories for evaluation. Norms for evaluations are derived from longitudinal corpus studies of authentic child language production. The goal of the new approach is to generate an accurate and fair assessments of the children’s communicative capacities. Pilot studies indicate that children with L2 German appear to be more advanced than shown by traditional form-based assessment methods.

  8. Einsatz eines "Audience Response Systems" in der Hochschullehre - Fragekategorien, didaktische Strukturierungen und Praxisreflexionen zur Partizipation im Hörsaal

    Directory of Open Access Journals (Sweden)

    Ahmet Camuka

    2014-06-01

    Full Text Available Im Hörsaal viele Studierende aktivieren? Hierfür kommt ein elektronisches Feedbacksystem auf der Grundlage von "Bring your own device" (BYOD zum Einsatz. Der Beitrag stellt Partizipationsformen anhand exemplarischer Fragekategorien vor und diskutiert diese aufgrund von Aussagen aus einer evaluativen Gruppendiskussion.

  9. Ein Elefant vergißt nicht - Erweiterte Funktionen in PostgreSQL am Beispiel der CSN Datenbank

    OpenAIRE

    Schreiber, Daniel

    2004-01-01

    PostgreSQL ist eine Open Source Datenbank, die in den letzten Jahren sehr populär geworden ist. Das Chemnitzer Studentennetz benutzt seit 1999 PostgreSQL zur Verwaltung seines Netzes. Der Vortrag zeigt erweiterte Funktionen von PostgreSQL wie Views, Rules, Stored Procedures und Trigger sowie deren Verwendung in der CSN Datenbank.

  10. Clinical course of a partially thrombosed, symptomatic aneurysm of the basilar artery tip with partial recanalization subsequent to coiling; Verlaufsbeschreibung eines teilthrombosierten symptomatischen Basilariskopfaneurysmas mit teilweiser Rekanalisierung nach Coiling

    Energy Technology Data Exchange (ETDEWEB)

    Moeller, V. [Universitaet des Saarlandes, Abteilung fuer Neuroradiologie, Homburg (Germany); Klinikum Saarbruecken, Institut fuer bildgebende Diagnostik und Interventionen, Saarbruecken (Germany); Axmann, C.; Reith, W. [Universitaet des Saarlandes, Abteilung fuer Neuroradiologie, Homburg (Germany)

    2006-05-15

    A 72-year-old patient was referred to the neuroradiological department for diagnostic angiography. She was suffering from vertigo and double vision. Magnetic resonance imaging performed elsewhere had demonstrated a giant aneurysm of the basilar artery tip 2 cm in diameter. Angiography revealed a large aneurysm with a broad neck that was partially thrombosed, which precluded closure by coiling. Neurosurgical management by clipping also appeared to be unsuitable because of the proximity to the cerebrum. The decision was reached to proceed expectantly by closely monitoring the clinical course. When the aneurysm increased in size in the ensuing weeks, coiling was performed successfully. Angiographic follow-up showed reperfusion of the aneurysm neck and closure was again achieved by repeat coiling. Reperfusion is not a rare complication following coiling and often necessitates renewed intervention. (orig.) [German] Eine 72-jaehrige Patientin wurde in der neuroradiologischen Abteilung zur diagnostischen Angiographie vorgestellt. Sie litt unter Schwindel und Doppelbildern. Eine auswaertige MR-Untersuchung des Gehirns zeigte ein Riesenaneurysma des Basilariskopfes mit einem Durchmesser von 2 cm. Die Angiographie zeigte ein grosses Aneurysma mit breitem Hals, das teilweise thrombosiert war. Dies liess einen Verschluss durch Coiling nicht zu. Eine neurochirurgische Behandlung durch Klippung erschien wegen der Naehe zum Mittelhirn ebenfalls ungeeignet. Man einigte sich auf ein abwartendes Vorgehen durch eine engmaschige Verlaufsbeobachtung. Als das Aneurysma in den folgenden Wochen eine Groessenzunahme zeigte, wurde erfolgreich ein Coiling durchgefuehrt. Eine angiographische Verlaufskontrolle zeigte eine Reperfusion des Aneurysmahalses. Erneut konnte ein Verschluss durch Coiling erzielt werden. Eine Reperfusion ist keine seltene Komplikation nach Coiling, die oft eine erneute Intervention erfordert. (orig.)

  11. Transobturatorielle Schlingensysteme (Monarc(R, Serasis TO(R: Ein erster Erfahrungsbericht von 150 Fällen

    Directory of Open Access Journals (Sweden)

    Fischer A

    2005-01-01

    Full Text Available Fragestellung: Überkorrektur mit ihren Begleiterscheinungen Obstruktion und Drangsymptomatik, retropubisches Hämatom und Blasenperforation sind die Hauptkomplikationen der mitturethralen spannungsfreien Bänder und kommen selbst nach fast 2000 Anwendungen immer wieder einmal vor. Zum Teil ist dies abhängig von Voroperationen, der Indikationsstellung, zum Teil auch von der Bandspannung, möglicherweise aber auch vom Weg des Bandes um die Urethra. Die Anwendung eines transobturatoriellen Systems soll nun zeigen, wo die Unterschiede bei dieser unterschiedlichen Technik und Bandverlauf liegen. Methode: 100 transobturatorielle Schlingen vom Typ Monarc(R (AMS, Berlin und 50 transobturatorielle Schlingen Serasis TO(R (Serag-Wiessner, Naila wurden in der Zeit von Anfang Februar bis Mitte Mai 2003 in unserer Klinik eingelegt. Perinealsonographie und Urodynamik inkl. Pad-Test sowie eine körperliche Untersuchung und ein Patientinnenfragebogen zur QoL wurden bei allen Frauen präoperativ und in der Folge nach 6 Wochen, 3 und 6 Monaten postoperativ durchgeführt. Ein Valsalva Leak Point Pressure wurde prä- und postoperativ nach 6 Monaten ermittelt. Der Eingriff erfolgt in Kurznarkose. Ergebnisse: Bei beiden Systemen zeigte sich eine durchschnittliche OP-Zeit von 8–10 Minuten und eine fehlende Hämatombildung sowie eine Blasenläsion bei der Monarc-Anwendung. Sonst trat bei beiden Systemen keine intraoperative Komplikation bei einem durchschnittlichen Blutverlust von ca. 20 ml auf. Perioperativ zeigte sich bei 12 % der mit Monarc behandelten Patienten eine Bakteriurie in den ersten 48 Stunden postoperativ, bei den Serasis-Patientinnen in 4 % der Fälle. Drei Monarc-Bänder und ein Serasis-Band mußten im Zusammenhang mit Drang durchtrennt werden. Fehlende postoperative Wundschmerzen und bis dato praktisch keine Zeichen einer Überkorrektur oder pathologischen Restharnbildung lassen den Unterschied zu den etablierten Inkontinenzoperationen deutlich

  12. Anonyme Kindesabgabe – ein passgenaues Angebot für hilfesuchende Frauen oder der Preis für ein kollektives gutes Gewissen?

    Directory of Open Access Journals (Sweden)

    Monika Bradna

    2014-07-01

    Full Text Available Das erste Angebot zur anonymen Kindesabgabe in Deutschland wurde 1999 initiiert. Mit der Zielsetzung, Kindstötung und Aussetzung zu verhindern sowie Schwangere und Mütter in problematischen Lebenssituationen zu unterstützen, wurden in den Folgejahren weitere Babyklappen und Möglichkeiten der anonymen Geburt bzw. der anonymen Übergabe geschaffen. Zugleich regen sich seit ihrer Einführung ethische und rechtliche Bedenken.  In einer bundesweiten Studie untersuchte das Deutsche Jugendinstitut, wie sich die Angebote der anonymen Kindesabgabe entwickelt haben und von wem bzw. wie sie in Anspruch genommen werden. Die Studie zeigt, dass sich die gegenwärtige Praxis in einer rechtlichen Grauzone bewegt und Routinen manifestiert, die weder rechtmäßig noch fachlich stets angemessen sind. Zu den wesentlichen Befunden gehört, dass die Zielgruppen, die bei der Einrichtung der Angebote im Fokus standen, nicht erreicht werden. Nicht die Zugehörigkeit zu einer bestimmten sozialen Gruppe ist für die Nutzung von Angeboten anonymer Geburt ausschlaggebend, sondern vielmehr eine Häufung von Belastungen und Problemen schwangerer Frauen.  Der vorliegende Beitrag befasst sich mit einer auf Anonymität verengten Problemlösungspraxis und fokussiert die Konsequenzen für betroffene Frauen.  Dem gegenübergestellt werden die Argumentationsmuster, die die anonyme Kindesabgabe rechtfertigen. Sie werden hinsichtlich ihrer gesellschaftlichen Bedeutung für Frauen in (sozialen Notlagen kritisch hinterfragt.

  13. Positive Effekte eines Kuraufenthaltes auf menopausale Beschwerden // Positive Effects of Health Cure on Menopausal Complaints

    Directory of Open Access Journals (Sweden)

    Foisner W

    2016-01-01

    Full Text Available 100 patients in menopause were recruited in an open duo-centre study during a health cure for musculoskeletal system to investigate if health cure is able to achieve additive effects on menopausal afflictions. Patients were differentiated in pre-, periand postmenopausal stadium due to their hormonal state (TSH, estradiol, LH, FSH. Survey dates were admission, discharge, 3, 6, 9, 12 months. MRS (Menopause Rating Scale and HADS-D (Hospital Anxiety and Depression Scale – German version were used as main outcome parameters.brThe analysis revealed that beside the total score also the subscale of both questionnaires improved during the cure. This “success of cure” lasted over a period of 6 months. Afterwards the values approached to the initial situation. Indeed all subscales stayed beyond baseline during the whole study.brThe results of the present investigation may be concluded as a temporary improvement of discomforts, life quality and psyche of peri- and postmenopausal women due to inpatient health cure. p bKurzfassung/b: Während eines Kurheilverfahrens zu Beschwerden des Stütz- und Bewegungsapparates wurden in einer offenen Duo-Center-Studie 100 Patientinnen in der Menopause rekrutiert, um zu untersuchen, ob der Kuraufenthalt additive Effekte auf menopausale Beschwerden besitzt. Anhand eines Hormonstatus (TSH, Estradiol, LH, FSH wurden die Patientinnen in die Menopause-Stadien prä-, peri- und postmenopausal eingeteilt. Erhebungszeitpunkte: Aufnahme, Entlassung, 3, 6, 9 und 12 Monate. Die „Menopause Rating Scale“ (MRS und die „Hospital Anxiety and Depression Scale – deutsche Version“ (HADS-D wurden als Haupt-Outcomeparameter herangezogen.brDie Auswertung ergab, dass sich neben dem Gesamtscore auch die Teilskalen der beiden Fragebögen während des Kuraufenthaltes verbesserten. Dieser „Kurerfolg“ hielt über einen Zeitraum von 6 Monaten an, danach näherten sich die Werte wieder der Ausgangssituation. Alle Teilscores blieben über dem

  14. EIN3-like gene expression during fruit ripening of Cavendish banana (Musa acuminata cv. Grande naine).

    Science.gov (United States)

    Mbéguié-A-Mbéguié, Didier; Hubert, Olivier; Fils-Lycaon, Bernard; Chillet, Marc; Baurens, Franc-Christophe

    2008-06-01

    Ethylene signal transduction initiates with ethylene binding at receptor proteins and terminates in a transcription cascade involving the EIN3/EIL transcription factors. Here, we have isolated four cDNAs homologs of the Arabidopsis EIN3/EIN3-like gene, MA-EILs (Musa acuminata ethylene insensitive 3-like) from banana fruit. Sequence comparison with other banana EIL gene already registered in the database led us to conclude that, at this day, at least five different genes namely MA-EIL1, MA-EIL2/AB266318, MA-EIL3/AB266319, MA-EIL4/AB266320 and AB266321 exist in banana. Phylogenetic analyses included all banana EIL genes within a same cluster consisting of rice OsEILs, a monocotyledonous plant as banana. However, MA-EIL1, MA-EIL2/AB266318, MA-EIL4/AB266320 and AB266321 on one side, and MA-EIL3/AB266319 on the other side, belong to two distant subclusters. MA-EIL mRNAs were detected in all examined banana tissues but at lower level in peel than in pulp. According to tissues, MA-EIL genes were differentially regulated by ripening and ethylene in mature green fruit and wounding in old and young leaves. MA-EIL2/AB266318 was the unique ripening- and ethylene-induced gene; MA-EIL1, MA-EIL4/Ab266320 and AB266321 genes were downregulated, while MA-EIL3/AB266319 presented an unusual pattern of expression. Interestingly, a marked change was observed mainly in MA-EIL1 and MA-EIL3/Ab266319 mRNA accumulation concomitantly with changes in ethylene responsiveness of fruit. Upon wounding, the main effect was observed in MA-EIL4/AB266320 and AB266321 mRNA levels, which presented a markedly increase in both young and old leaves, respectively. Data presented in this study suggest the importance of a transcriptionally step control in the regulation of EIL genes during banana fruit ripening.

  15. Some thoughts on risk acceptance and nuclear power; Risikoakzeptanz und Kernenergie - eine Betrachtung

    Energy Technology Data Exchange (ETDEWEB)

    Brejora, S.

    2001-04-01

    Risks are assessed very differently in our modern society. While a number of everyday risks, some of which are hardly perceptible while others are quite spectacular, are accepted to a considerable extent, many other risks, often minor ones, are overemphasized and rejected. Risk assessment in the minds of people is a function of a number of subjective, emotional factors with decisive psychological components which lead to irrational assessment especially of a number of manmade risks, including nuclear power. Factors to be mentioned in the assessment of the risks of nuclear power, among others, are the imaginary phenomenon of radioactivity and nuclear fission; the growing intrusion of technology into our living environment; the need to fall back upon expert knowledge; and the intuitive, wrong correlation of technical expense for safety with the perceived risk. As is seen, opinions are formed not solely on the basis of rational findings, but are influenced by many factors, some of which cannot be reproduced in a rational way. This makes it imperative to include in the debate about risks of technology, specifically the discussion about the use of nuclear power, the psychological aspect in order to arrive at a reasonable way for society to handle technology. (orig.) [German] Risiken in unserer modernen Gesellschaft werden sehr unterschiedlich bewertet. Waehrend eine Reihe alltaeglicher, wenig auffaelliger Risiken, aber auch spektakulaere Risiken in erheblichem Masse akzeptiert werden, werden andere, vielfach sehr kleine Risiken mit einer Ueberbewertung abgelehnt. Die eigentliche Risikobewertung des Menschen unterliegt einer Reihe subjektiver, emotionaler Faktoren mit massgeblichen psychologischen Komponenten, die insbesondere fuer eine Reihe zivilisatorischer Risiken, so auch die der Kernenergie, zu einer irrationalen Risikobeurteilung fuehren. Fuer die Beurteilung der Risiken der Kernenergie sind unter anderem als Faktoren zu nennen: das imaginaere Phaenomen von

  16. Berliner Geowissenschaftlerinnen an der Friedrich-Wilhelms-Universität von 1906 bis 1945, eine Fallstudie

    Directory of Open Access Journals (Sweden)

    B. A. R. Mohr

    2003-01-01

    Full Text Available In dieser Untersuchung werden beispielhaft die Lebenswege und Karrieren von Berliner Geowissenschaftlerinnen im Zeitraum von 1906 bis 1945 nachgezeichnet und analysiert. Ähnlich wie an anderen deutschen bzw. westlichen Universitäten, aber im Gegensatz zu Russland, begann die Tätigkeit von Frauen in den Geowissenschaften spät, und das Fach wurde auch relativ selten gewählt, hauptsächlich wegen der zu geringen Berufschancen. Aber die besondere Situation in Berlin mit mehreren sich ergänzenden Institutionen und dem daraus resultierenden breiten Spektrum an geowissenschaftlichen Disziplinen, sowie ausgezeichneten Professoren, ließ dennoch Raum für eine Ausbildung in diesem Bereich und erlaubte, wenn auch in bescheidenem Maße, eine gewisse Karrieremöglichkeit. Während der hier untersuchten 40 Jahre haben weniger als 20 Frauen in den Geowissenschaften und benachbarten Gebieten promoviert. Mehrere dieser Frauen blieben in dem von ihnen gewählten Fach weiterhin aktiv und wurden erfolgreich. Zwei Frauen gelang eine akademische Karriere — eine als Universitätsprofessorin, die auch Schülerinnen hatte. Andere arbeiteten an staatlichen Institutionen, wie z. B. dem Geologischen Landesamt. Wenige Frauen blieben nach ihrer Verheiratung beruflich aktiv, wenn auch nicht offiziell angestellt, sondern als Ehefrauen. Andere arbeiteten als "Ersatz" für die im Kriege stehenden Männer. Einige waren aus persönlichen und politischen Gründen, insbesondere während der NS-Zeit, gezwungen, die Geowissenschaften zu verlassen, konnten aber teilweise auf anderen Gebieten erfolgreich arbeiten. This paper documents the lives and careers of women geoscientists at the Berlin Friedrich-Wilhelms-University from 1906 through 1945. Traditionally, in Germany, women had difficulties to be accepted in geosciences (except for geography/geology teachers, because of strong links between geology and mining, a field dominated clearly by men. In western European countries

  17. ZWEI 'JAHRHUNDERTHOCHWASSER' IN ELF JAHREN - EIN VERGLEICH DER HOCHWASSEREREIGNISSE VON 2002 UND 2013 (IN DEUTSCHLAND

    Directory of Open Access Journals (Sweden)

    ANJA KLEINEBRAHN

    2014-05-01

    Full Text Available Zwei 'jahrhunderthochwasser' in elf jahren - ein vergleich der hochwasserereignisse von 2002 und 2013 (in Deutschland. Worldwide floods are among the most frequent and most momentous natural disasters. They occur in unpredictable intervals and dimensions and always bring particularly devastating or catastrophic impacts, if they get into contact with people or its uses. Within eleven years only Germany was affected of two so-called 'century-floods'. The expiry of extreme high water can be influenced by technical measures only up to a certain degree. It is therefore necessary to have a high protection from the effects of floods and to keep the impact as low as possible. Both being prepared as well as possible and being capable of acting for the case of emergency are corequisite. Flood protection is a longsome and s steadily continuing process. In dealing with the consequences of floods both political measures and the commitment and solidarity of the citizens were in demand.

  18. Stationary battery storage of energy transition a central component; Stationaere Batteriespeicher der Energiewende eine zentrale Komponente

    Energy Technology Data Exchange (ETDEWEB)

    Vetter, Matthias; Lux, Stephan [Fraunhofer-Institut fuer Solare Energiesysteme ISE, Freiburg (Germany)

    2017-01-15

    In a regenerative energy system with strong fluctuations in electricity production, the importance of short-term storage is increasing - on the one hand, in order to optimal need-oriented use of the energy supply, on the other hand, at any time to ensure a high network quality. The present overview of stationary battery storage shows how important it will be especially in the area of larger storage facilities with direct link to regenerative power plants, as a district storage or in the industry. [German] In einem regenerativen Energiesystem mit starken Fluktuationen der Stromproduktion nimmt die Bedeutung der Kurzzeitspeicherung zu - einerseits, um das Energieangebot bedarfsgerecht optimal zu nutzen, andererseits, um zu jedem Zeitpunkt eine hohe Netzqualitaet zu gewaehrleisten. Der vorliegende Ueberblick ueber stationaere Batteriespeicher zeigt, wie wichtig vor allem der Bereich groesserer Speicher in direkter Koppelung mit regenerativen Kraftwerken, als Quartiersspeicher oder im Gewerbe sein wird.

  19. Climate protection policy and new jobs - a contradiction in itself?; Klimaschutz und neue Arbeitsplaetze - ein Gegensatz?

    Energy Technology Data Exchange (ETDEWEB)

    Scheelhaase, J. [Prognos AG, Koeln (Germany)

    2002-04-01

    The article summarizes the results of an expert opinion submitted by the Prognos AG to the German Federal Environmental Agency. The expert opinion was to examine in various scenarios whether implementation of additional, ambitious climate protection policies and programmes may indeed have an adverse effect on the employment situation in Germany. The experts found that under certain framework conditions, positive synergy effects will develop. (orig./CB) [German] Ob zusaetzliche klimaschuetzende Massnahmen tatsaechlich zu Lasten der Beschaeftigung gehen wuerden, ist Gegenstand eines Gutachtens der Prognos AG, Koeln, das im Auftrag des Umweltbundesamtes erarbeitet wurde. Der Artikel fasst die wesentlichen Ergebnisse des Gutachtens zusammen, das u.a. positive Synergieeffekte zwischen oekologischen und beschaeftigungspolitischen Zielen darlegt. (orig./CB)

  20. Competition in the European electricity market - really a chance?; Wettbewerb im europaeischen Strommarkt - wirklich eine Chance?

    Energy Technology Data Exchange (ETDEWEB)

    Holzer, J [Bayernwerk AG, Muenchen (Germany)

    1993-12-31

    This report throws a critical look at the targets and guidelines aimed at by the EC Commission in order to change the present regulative frame of electricity supply. Particularly the difference between the German, French and British situation is shown. In the opinion of German electric utilities the principle of closed supply areas has to be sticked to. Finally the necessity is emphasized to use energy policy to solve quickly some problems in order to improve the standing of German electric utilities. (UA) [Deutsch] Der Vortrag beinhaltet eine kritische Auseinandersetzung mit den von der EG-Kommision verfolgten Zielen und Richtlinien zur Aenderung des bisherigen Ordnungsrahmens in der Elektrizitaetsversorgung. Insbesondere werden die Unterschiede im Vergleich zwischen deutschen, franzoesischen und englischen Verhaeltnissen herausgestellt. Nach Ausicht der deutschen EVUs muss das Prinzip der geschlossenen Versorgungsgebiete erhalten bleiben. Abschliessend wird die Forderung unterstrichen, die Loesung einiger Probleme durch die Energiepolitik voranzutreiben, um die Position der deutschen Elektrizitaetsversorgung zu verbessern. (UA)

  1. Environmental offences in 1995. An evaluation of statistics; Umweltdelikte 1995. Eine Auswertung der Statistiken

    Energy Technology Data Exchange (ETDEWEB)

    Goertz, M.; Werner, J.; Sanchez de la Cerda, J.; Schwertfeger, C.; Winkler, K.

    1997-06-01

    This publication deals with the execution of environmental criminal law. On the basis of police and judicial statistics it is pointed out how often an environmental criminal offence was at least suspected by the police or law courts, how they reacted to their suspicion, which individual environmental criminal offences were committed particularly frequently, and what segment of the population the typical perpetrator belonged to. (orig./SR) [Deutsch] Mit der vorliegenden Schrift soll ein Blick auf den Vollzug des Umweltstrafrechts geworfen werden. Auf der Basis der Polizei- und Gerichtsstatistiken wird dargelegt, wie oft bei diesen Stellen mindestens der Verdacht einer Umweltstraftat bestand, wie auf diesen Verdacht reagiert wurde, welche einzelnen Umweltstraftaten besonders haeufig registriert wurden und aus welchem Personenkreis der tpische Taeter stammt. (orig./SR)

  2. A dam against the Yangtse floods; Ein Bollwerk gegen die Fluten des Jangtse

    Energy Technology Data Exchange (ETDEWEB)

    Sauer, H.D.

    1998-02-01

    China`s history has always been landmarked by fights against flooded rivers. Ever since the earliest dynasties, China`s leaders have attempted to control the devastating effects of floods. The new government carries out an unequalled programme of dam construction to control the forces of nature. The most gigantic of these is the ``Three Canyons Project`` on the Yangtse river. (orig.) [Deutsch] Chinas Geschichte ist gepraegt vom Kampf mit dem Wasser. Seit den fruehesten Dynastien haben die Herrscher im Reich der Mitte versucht, den verheerenden Ueberschwemmungen Einhalt zu gebieten. Mit einem weltweit beispiellosen Programm von Dammbauten versucht die Regierung nun, gegen die Naturgewalten die Oberhand zu gewinnen. Ein Vorhaben stellt dabei alle anderen in den Schatten: Das `Drei-Schluchten-Projekt` am Jangtse. (orig.)

  3. Lizenzierungsservice Vergriffene Werke (VW-LiS – ein neuer Dienst der Deutschen Nationalbibliothek

    Directory of Open Access Journals (Sweden)

    Reinhard Altenhöner

    2015-12-01

    Full Text Available Vor allem die bestehende urheberrechtliche Situation verhindert die Digitalisierung von Beständen des 20. Jahrhunderts. Basierend auf einem EU-Memorandum hat der deutsche Gesetzgeber durch eine Neuregelung für die Materialart Buch eine Möglichkeit geschaffen: Nach dem Erwerb einer entsprechenden Lizenz bewegt sich die digitalisierende Einrichtung bei der öffentlichen Bereitstellung digitalisierter Bücher in einem rechtssicheren Raum. In Kooperation mit dem Deutschen Bibliotheksverband (dbv, der VG Wort und VG Bild-Kunst sowie dem Deutschen Patent- und Markenamt (DPMA hat die Deutsche Nationalbibliothek (DNB bis Juli 2015 einen Dienst entwickelt, der die Ermittlung vergriffener Bücher sowie ihre Lizenzierung im Rahmen der gesetzlichen Vorgabe wesentlich erleichtert. Dieser Dienst wird hier vorgestellt und eingeordnet. The existing copyright situation prevents the digitization of collections of the 20th century. Based on a European memorandum, the German legislature has created a new way for books: After the acquisition of the appropriate licence, the digitization becomes possible; the public provision of digitized books takes place in a legally safeguarded manner. In cooperation with the German Library Association (dbv, the copyright collecting agencies Wort and VG Bild-Kunst and the DPMA, the German National Library (DNB has until July 2015 developed a service which significantly facilitates the identification of out-of-commerce-books as well as their licensing under the new regulation. The new service will be presented and explained.

  4. Ein Versuch, Naturverhältnisse aus feministischer Sicht zu interpretieren

    Directory of Open Access Journals (Sweden)

    Helga Purgand

    2002-07-01

    Full Text Available Mit dem vorliegenden Sammelband Geschlechterverhältnisse – Naturverhältnisse wird nach dem innovativen Beitrag der feministischen Debatte für umweltsoziologisches Denken gefragt und nach Überschneidungen, Grenzen und Zwischenräumen zwischen „Geschlecht“ und „Natur“ gesucht. In ihm wird der lobenswerte Versuch unternommen, einen Zusammenhang zwischen Geschlechter- und Naturverhältnissen herzustellen „die in der Umweltsoziologie bislang stark vernachlässigte feministische Diskussion und Geschlechterforschung einzubeziehen und als genderbezogene Perspektive zu etablieren“. (S. 9 Das Buch enthält Beiträge von 15 Autorinnen, die unterschiedliche Natur- und Geschlechtsverhältnisse facettenreich, überwiegend kreativ und theoretisch anspruchsvoll betrachten. Das Buch enthält Zugänge aus der allgemeinen Soziologie, den Sprach- und Kulturwissenschaften, aus politik- und naturwissenschaftlichen Zusammenhängen. Den ausdrücklich formulierten Anspruch, von multi- zu einer inter-disziplinären Durchdringung zu gelangen, erfüllt es nur in Ansätzen (besonders mit der Einleitung und den theoretischen Problemexplikationen. Das zustande gekommene „Nach-, Zusammen- und Querdenken“ über Begriffe, Theorien und neuere Forschungsansätze (von Foucault über Butler bis zu Donna Haraway belegt die Notwendigkeit, die naturwissenschaftlichen Annahmen „immanent zu dekonstruieren“. Sehr aufschlussreich sind in diesem Zusammenhang die Beiträge von Irmgard Schultz, Elvira Scheich, aber auch von Mary Mellor und besonders von Paula-Irene Villa, die interessante und kreative Gedanken zur Klärung des Verhältnisses von Natur, Kultur und Geschlecht anbieten. Deutlich wurde, dass weiterhin ein kontroverses Ringen um angemessene konzeptionelle Fassungen von Geschlechts- und Naturverhältnissen und die Integration von Gender als zentraler analytischer Querschnitts-Kategorie nötig sind. Insgesamt ist dem Buch ist eine schnelle Verbreitung und

  5. Energy efficiency. A textbook and handbook; Energieeffizienz. Ein Lehr- und Handbuch

    Energy Technology Data Exchange (ETDEWEB)

    Pehnt, Martin (ed.) [IFEU Institut fuer Energie- und Umweltforschung Heidelberg GmbH, Heidelberg (Germany)

    2010-07-01

    Apart from renewable energies, energy efficiency and energy conservation are the fundament for an economically optimized energy strategy. Energy efficiency involves different ranges: the energy and heating market for households and trades, the traffic sector and industrial production. Along the value creation chain energy efficiency signifies an effective conversion of raw materials, a use of by-products, a reduction of consumption and a modification of the behaviour. This text book offers a comprehensive overview of all ranges of energy efficiency. It interdisciplinary it gives an engineering understanding of the technologies for the reader and connects this with economic, sociological, energy political and ecological fundamentals. The manual is not only suitable for the teachings in relevant courses of studies (e.g. energy, environmental or process engineering, architecture, industrial engineering, geography and political economy, physics), but also offers a clear, intimate insight of the topic energy efficiency to specialists of neighbouring disciplines. [German] Energieeffizienz und Energieeinsparungen sind - neben erneuerbaren Energien - die Basis fuer eine volkswirtschaftlich optimierte Energiestrategie. Energieeffizienz betrifft unterschiedliche Bereiche: den Strom- und Waermemarkt fuer Haushalte und Gewerbe, den Verkehrssektor und die industrielle Produktion. Energieeffizienz entlang der Wertschoepfungskette bedeutet, Rohstoffe wirksam umzuwandeln, Nebenprodukte zu nutzen, Verbrauch zu reduzieren und Verhalten zu aendern. Dieses Lehrbuch bietet einen umfassenden Ueberblick ueber alle Bereiche der Energieeffizienz. Interdisziplinaer vermittelt es dem Leser ein ingenieurtechnisches Verstaendnis der Technologien und verknuepft dieses mit oekonomischen, sozialwissenschaftlichen, energiepolitischen und oekologischen Grundlagen. Das Handbuch ist nicht nur fuer die Lehre in einschlaegigen Studiengaengen (z. B. Energie-, Umwelt- oder Verfahrenstechnik, Architektur

  6. Die polnischen Bücher (Bücherbestände in den Bibliotheken Roms. Eine Auswahl

    Directory of Open Access Journals (Sweden)

    Ligia ALeksandra Henczel-Wróblewska

    2017-11-01

    Full Text Available Die italienisch-polnischen Beziehungen haben eine lange Geschichte hinter sich. Seit dem Mittelalter, in dem die polnischen Scholaren ihre Ausbildung an den italienischen Universitäten genießen konnten, dominierte darin der wissenschaftliche und bildende Charakter. In den folgenden Jahrhunderten wurde der gegenseitige Kontakt um die künstlerische Ebene erweitert, zumal die polnischen Künstler nach Italien reisten, um bei den besten Meistern ihre Fertigkeiten zu vervollkommnen. Seit dem Ende des 18. bis zur Mitte des 19. Jahrhunderts kam zu den bereits bestehenden, tradierten italienischpolnischen Beziehungen im Bereich der Wissenschaft und Kultur der militärische und der sozialpolitische Aspekt hinzu, und mit der Zeit auch der wirtschaftliche. Auf dem italienischen Boden beteiligten sich die Polen zunächst an den Unabhängigkeitskämpfen, die mit der Vereinigung Italiens (die Risorgimento-Zeit endeten, und nachher an den Waffeninterventionen während der zwei Weltkriege. Seit der Mitte des 20. Jahrhunderts kehrte man zum früheren beiderseitigen Kontakt auf verschiedenen Ebenen zurück.In jeder dieser Zeitspannen wurde die polnische Anwesenheit in Italien in den schriftlichen, ikonografischen, künstlerischen Quellen belegt. Die meisten davon bewährten sich in den Archiven und Bibliotheken Roms, dem Zentrum der europäischen Wissenschaft, Kultur und Christenheit. Erst im 20. Jahrhundert, seit der Entstehung der ersten wissenschaftlichen polnischen Institutionen in Rom und dank der breiten Zusammenarbeit war es möglich, die Polonica, die sich in den römischen Bibliotheken, Archiven, Kulturinstitutionen und Privatbeständen befinden, offiziell zu registrieren, bearbeiten und ordnen. Die schriftlichen Denkmäler aus den vergangenen Jahrhunderten weisen auf eine breite gegenseitige Beziehung sowohl im Bereich des sacrum als auch des profanum hin. Dieses gemeinsame historische Gedächtniserbe zeugt von einer langen Zugehörigkeit Polens zur

  7. Hybridization and control of a mobile direct methanol fuel cell system; Hybridisierung und Regelung eines mobilen Direktmethanol-Brennstoffzellen-Systems

    Energy Technology Data Exchange (ETDEWEB)

    Wilhelm, Joerg Christoph

    2010-07-01

    for the dimensioning of the fuel cell as well as of the energy storage unit. Variation of parameters results in a minimum required fuel cell power of 1.3 kW as well as a minimum energy density of 66 Wh/l or a minimum power density of 355 W/l for the energy storage unit, respectively. The high energy density required and the fact that the energy storage unit must always be operated at a partial state of charge leads to faster aging, particularly of lead-acid batteries, so that a lithium battery is eventually chosen as an energy storage unit. (orig.) [German] Direktmethanol-Brennstoffzellen (DMFCs) zeichnen sich dadurch aus, dass sie die chemische Energie des fluessig zugefuehrten Brennstoffs Methanol direkt in elektrische Energie umwandeln. Methanol hat eine hohe Energiedichte und laesst sich vergleichsweise einfach speichern. Aufgrund dieser Vorteile eignen sich Direktmethanol-Brennstoffzellen- Systeme z. B. als Batterieersatz fuer den Bereich leichte Traktion in der kW-Klasse. Da das Nachtanken im Vergleich zum Laden einer Batterie viel schneller realisierbar ist, folgt hieraus ein nahezu unterbrechungsfreier Betrieb. Das Ziel der vorliegenden Arbeit ist es daher ein Direktmethanol-Brennstoffzellen-System fuer den Bereich leichte Traktion zu entwickeln. Die systemtechnische Entwicklung und Charakterisierung eines mobilen Direktmethanol-Brennstoffzellen-Systems erfolgt zuerst allgemein und anschliessend angewandt auf das Beispiel Horizontalkommissionierer aus der Klasse der Flurfoerderfahrzeuge. Hierfuer soll sowohl ein Hybridisierungs- als auch ein Regelungskonzept entwickelt werden. Die gewaehlte Vorgehensweise gliedert sich in die Charakterisierung der Anwendung, die theoretische Konzeptentwicklung und eine abschliessende Systemanalyse mithilfe von Untersuchungen am Teststand und Simulationen. Aus der Charakterisierung folgt der charakteristische Fahrzyklus der Anwendung. Die Eckdaten, wie maximale Peakleistungen beim Beschleunigen und Bremsen sowie die

  8. A 400-year phytolith-based reconstruction of wild rice (Zizania palustris) abundance from Mud Lake core sediments, Fond du Lac Band of Lake Superior Chippewa Reservation, Minnesota, USA.

    Science.gov (United States)

    Munoz, R.; Caylor, E.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.

    2014-12-01

    Wild rice (Zizania palustris L.) is an aquatic grass with spiritual and subsistence significance to Native people of the Great Lakes region of North America. Mud Lake (Mashkiigwaagamaag), located on the Fond du Lac Band of Lake Superior Chippewa Reservation in Carlton County, Minnesota, USA, once supported an extensive population of wild rice (manoomin). However, early 20th century attempts to ditch and drain surrounding wetlands for landuse intensification severely altered the natural hydrological system that supports wild rice. Fond du Lac Resource Management (FDLRM) technicians are currently working to increase the wild rice population in Mud Lake. As part of these efforts, this phytolith study was undertaken to better understand how wild rice abundance has fluctuated over the past 400 years, with particular emphasis on the 19th and 20th centuries. Phytoliths are microscopic opal silica plant remains that are incorporated into soils and lake sediments after the plant-parts that contain them decay. Wild rice produces phytolith morphotypes that are unequivocally diagnostic. Mud Lake core MNMN-MUD11-1C-1P-1 (46°43'38.39"N, 92°42'2.45"W) was piston cored by LacCore (National Lacustrine Core Facility) and FDLRM technicians on 24 May 2011. Initial core descriptions, multi-sensor core logging, phytolith sampling and phytolith extractions were completed during the summer of 2014 at LacCore. Wild rice phytolith identification and quantification was conducted on twelve samples using brightfield microscopy at 400x magnification. Wild rice phytolith concentration values ranged from 68 to 2,300 phytoliths/cm3. Wild rice accumulation rates ranged from 9 to 383 phytoliths/ cm2/yr, peaking in 1952 AD. Wild rice abundance in Mud Lake appears to be influenced by a complex set of variables that include anthropogenic disturbance, climatic events and aquatic plant community succession.

  9. Development of a Novel Escherichia coli–Kocuria Shuttle Vector Using the Cryptic pKPAL3 Plasmid from K. palustris IPUFS-1 and Its Utilization in Producing Enantiopure (S-Styrene Oxide

    Directory of Open Access Journals (Sweden)

    Hiroshi Toda

    2017-11-01

    Full Text Available The novel cryptic pKPAL3 plasmid was isolated from the Gram-positive microorganism Kocuria palustris IPUFS-1 and characterized in detail. pKPAL3 is a circular plasmid that is 4,443 bp in length. Open reading frame (ORF and homology search analyses indicated that pKPAL3 possesses four ORFs; however, there were no replication protein coding genes predicted in the plasmid. Instead, there were two nucleotide sequence regions that showed significant identities with untranslated regions of K. rhizophila DC2201 (NBRC 103217 genomic sequences, and these sequences were essential for autonomous replication of pKPAL3 in Kocuria cells. Based on these findings, we constructed the novel Escherichia coli–Kocuria shuttle vectors pKITE301 (kanamycin resistant and pKITE303 (thiostrepton resistant from pKPAL3. The copy numbers of the constructed shuttle vectors were estimated to be 20 per cell, and they exhibited low segregation stability in Kocuria transformant cells in the absence of antibiotics. Moreover, constructed vectors showed compatibility with the other K. rhizophila shuttle vector pKITE103. We successfully expressed multiple heterologous genes, including the styrene monooxygenase gene from Rhodococcus sp. ST-10 (rhsmo and alcohol dehydrogenase gene from Leifsonia sp. S749 (lsadh, in K. rhizophila DC2201 using the pKITE301P and pKITE103P vectors under the control of the glyceraldehyde 3-phosphate dehydrogenase (gapdh promotor. The RhSMO–LSADH co-expressing K. rhizophila was used as a biocatalyst in an organic solvent–water biphasic reaction system to efficiently convert styrene into (S-styrene oxide with 99% ee in the presence of 2-propanol as a hydrogen donor. The product concentration of the reaction in the organic solvent reached 235 mM after 30 h under optimum conditions. Thus, we demonstrated that this novel shuttle vector is useful for developing biocatalysts based on organic solvent-tolerant Kocuria cells.

  10. [Baltisches Welterlebnis. Die kulturgeschichtliche Bedeutung von Alexander, Eduard und Hermann Graf Keyserling. Beiträge eines internationalen Symposium in Tartu vom 19. bis 21. September 2003

    Index Scriptorium Estoniae

    Garleff, Michael, 1940-

    2011-01-01

    Baltisches Welterlebnis. Die kulturgeschichtliche Bedeutung von Alexander, Eduard und Hermann Graf Keyserling. Beiträge eines internationalen Symposium in Tartu vom 19. bis 21. September 2003. Heidelberg : Universitätsverlag Winter, 2007

  11. A contribution to the modelling of steam reformers for natural gas fuelled fuel cell heating systems; Ein Beitrag zur Modellierung von Dampfreformern fuer erdgasbetriebene Brennstoffzellenheizgeraete

    Energy Technology Data Exchange (ETDEWEB)

    Nietzsche, Joerg

    2010-10-29

    The author attempted to verify the assumptions and simplifications of common mathematical models of small-scale steam reformers. The emphasis was on the derivation of important model parameters on the basis of easily identifiable catalyst, fluid and reactor characteristics. An easily validated 2D model of a reformer tube is then used for a wide sensitivity analysis and a comparative investigation of various reactor types. [German] Die Motivation dieser Arbeit liegt in der Ueberpruefung der bislang in mathematischen Modellen von kleintechnischen Dampfreformern getroffenen Annahmen und Vereinfachungen, mit speziellem Augenmerk auf die Aufklaerung der Herkunft wichtiger Modellparameter anhand von leicht bestimmbaren Katalysator-, Fluid- und Reaktoreigenschaften. Ein leicht zu validierendes, zweidimensionales Modell eines Reformerrohres soll im Anschluss fuer eine breit angelegte Sensitivitaetsanalyse und eine vergleichende Untersuchung verschiedener Reaktortypen dienen.

  12. Anforderungen an ein System zur Evaluierung potentieller Langzeitschäden durch den Einsatz gentechnischer Methoden in der Nahrungsmittelherstellung und -verarbeitung

    OpenAIRE

    Katzek, Jens

    2000-01-01

    Der Einsatz der gentechnischer Methoden bei der Synthese und Veränderung von Lebensmittelbestandteilen unterliegt strengen gesetzlichen Regeln, die eine umfangreiche Risikoabschätzung vor dem Inverkehrbringen gewährleisten sollen. Erfahrungen aus anderen Technikbereichen – insbesondere der Pharmazie – zeigen jedoch, daß Risikoabschätzungen vor dem Inverkehrbringen eines Produktes nicht in der Lage sind, alle möglichen Rahmenbedingungen für die Evaluierung des Gefährdungspotentials bereits im ...

  13. Entwurf eines Soll-Prozessmodells für die Verwaltung von Herbarbelegen im Botanischen Garten/Botanischen Museum in Berlin-Dahlem

    OpenAIRE

    Krause, Manfred

    2009-01-01

    Das Forschungspapier entwirft ein Soll-Prozessmuster für die Verwaltung von Herbarbelegen im Botanischen Garten/ Botanischen Museum in Berlin-Dahlem im Rahmen des Forschungsvorhabens "Herbar Digital". Ausgangspunkt für die Erstellung des Soll- Modells sind die bereits dokumentierten Geschäftsprozesse. Die bestehenden Prozesse werden an die Ausbaustufe 1 von Herbar Digital angepasst, um die Kosten für die Digitalisierung eines Herbarbeleges zu senken. Als Grundlage für die Optimierung der Gesc...

  14. Cold. A fairytale from Orient: Burj al Arab, the new landmark of Dubai; Kaelte. Ein Maerchen aus tausend + einer Nacht: Burj al Arab, das neue Wahrzeichen Dubais

    Energy Technology Data Exchange (ETDEWEB)

    Eleftheriadis, G.

    2002-10-25

    The air conditioning for this hotel plays an important role. To protect coolant water lines safely from dew water and hold down energy losses as low as possible, an elastomere insulating material has been selected. (orig/GL) [German] Der Klimatisierung des Hotels kam im unwirtlichen Wuestenklima natuerlich eine besondere Bedeutung zu. Um die Kuehlwasserleitungen der Klimaanlage sicher vor Tauwasser zu schuetzen und die Energieverluste so gering wie moeglich zu halten, wurde ein elastomerer Daemmstoff gewaehlt. (orig.)

  15. Evaluierung der Zielsetzungen des vereinsbezogenen Praktikums für Sportlehramtsstudierende auf der Grundlage vereinsinterner und vereinsexterner Rahmenbedingungen : eine empirische Studie an den bayerischen Sportinstituten

    OpenAIRE

    Reim, Dominik

    2005-01-01

    Durch Kultusministerium und BLSV wurde 1997 ein Vereinspraktikum ins Leben gerufen mit dem Ziel, bei Studierenden bereits in der Ausbildungsphase eine Sensibilisierung für die Zusammenarbeit zwischen Schule und Verein zu erreichen und gleichzeitig die berufliche Eignung durch Erprobung der sportpädagogischen Begabung zu testen. Zu überprüfen galt es, ob Studierende durch das Praktikum in die Lage versetzt werden, diese beiden angestrebten Zielsetzungen zu erfüllen. Dazu war es in einem ersten...

  16. Mesenteric lymphadenopathy in patient with Yersinia enterocolitica infection. A differential diagnosis to abdominal lymphoma; Mesenteriale Lymphadenopathie bei Infektion mit Yersinia enterocolitica. Eine Differentialdiagnose zum abdominalen Lymphom

    Energy Technology Data Exchange (ETDEWEB)

    Trommer, G.; Koesling, S. [Leipzig Univ. (Germany). Klinik und Poliklinik fuer Diagnostische Radiologie; Bewer, A. [Leipzig Univ. (Germany). Klinik fuer Allgemein-, Thorax- und onkologische Chirurgie

    1998-01-01

    We report a case of previously undiagnosed Yersinia enterocolitica infection in a 46-year old woman. She consulted her physician because of continual weight loss and physical lassitude. A leucocytosis was found. Sonography revealed an excessive enlargement of abdominal lymph nodes. A malignant lymphoma was suspected and the patient underwent a staging by CT. There the disease was limited on mesenteric and retroperitoneal lymph nodes. Bone marrow biopsy and CT-guided lymph node biopsy did not confirm a systemic lymphatic disease. The patient did not undergo a special therapy. After six months, CT showed a clear regression of enlarged lymph nodes. Finally, a previous Yersinia enterocolitica infection of immunotype 03 could be proved serologically. At this time, the patient had no complaints. Diagnostic and differential diagnosis of benign abdominal lymph node enlargement are discussed based on literature. (orig.) [Deutsch] Berichtet wird der Fall einer klinisch inapperenten Yersinia-enterocolitica-Infektion bei einer 46jaehrigen Patientin, die aufgrund stetigen Gewichtsverlustes und koerperlicher Abgeschlagenheit den Hausarzt konsultierte. Dieser diagnostizierte eine Leukozytose. Die daraufhin durchgefuehrte Sonographie ergab eine massive abdominale Lymphknotenvergroesserung. Unter dem Verdacht eines malignen Lymphoms erfolgte eine computertomographische Ausbreitungsdiagnostik, die die Erkrankung auf mesenteriale und retroperitoneale Lymphknoten beschraenkt zeigte. Knochenmarkbiopsie und CT-gestuetzte Lymphknotenpunktion ergaben keinen Hinweis auf eine lymphatische Systemerkrankung. Ohne Therapie zeigte eine CT-Kontrolle nach 6 Monaten eine deutliche Regredienz der Lymphknotenschwellung. Bei der Erregersuche konnte serologisch eine zurueckliegende Infektion mit Yersinia enterocolitica, Serotyp 03, nachgewiesen werden. Zu diesem Zeitpunkt war die Patientin beschwerdefrei. Anhand der Literatur werden Diagnostik und Differentialdiagnose benigner abdominaler

  17. Optimisation of a bioindicator monitoring network using geostatic methods and a geographic information system; Optimierung eines Bioindikator-Messnetzes mit Hilfe geostatischer Methoden und eines Geographischen Informationssystems

    Energy Technology Data Exchange (ETDEWEB)

    Forster, E.M.

    1994-04-01

    Since 1981 the Bavarian State Authority for Environment Protection has used mosses (hypnum cupressiforme) as bioindicators for determining atmospheric background pollution. Covering all of Bavaria the monitoring network comprises more than 370 sampling sites spaced 8 km apart in urban regions and otherwise 16 km. The extremely labour-intensive and costly operation of the network led to the idea to thin it in such a way that the loss of information on regional background pollution would be kept as small as possible and remain within acceptable bounds. The geostatic methods used for this purpose permit an areal estimation of pollution load giving due consideration to local values as well as a calculation of the forecast error. The present report is divided into two sections: The first deals with the determination of spatial dependences, while the second concens the selection of sampling sites. (orig./KW) [Deutsch] Seit 1981 werden Moose (Hypnum cupressiforme) als Bioindikatoren zur Ermittlung der atmosphaerischen Hintergrundbelastung vom Bayerischen Landesamt fuer Umweltschutz eingesetzt. Das landesweite Messnetz umfasst mehr als 370 Probenahmestandorte, die 16 km bzw. in Verdichtungsregionen 8 km von einander entfernt liegen. Der erhebliche personelle und finanzielle Aufwand fuehrte zu der Ueberlegung das Messnetz mit moeglichst geringem, noch aktzeptablen Informationsverlust bezueglich der grossraeumigen Hintergrundbelastung zu reduzieren. Hierbei kamen geostatistische Methoden zum Einsatz, da sie eine flaechenhafte Schaetzung der Immissionsbelastung unter Beruecksichtigung der Umgebungswerte ermoeglichen. Zudem kann der Schaetzfehler berechnet werden. Die vorliegende Arbeit gliedert sich daher in zwei Bereiche: Einerseits das Feststellen raeumlicher Abhaengigkeiten und andererseits die Auswahl der Probenahmestandorte. (orig./KW)

  18. Thermodynamic analysis of a fuel-cell-system for automotive transportation; Thermodynamische Analyse eines Brennstoffzellensystems zum Antrieb von Kraftfahrzeugen

    Energy Technology Data Exchange (ETDEWEB)

    Berger, Oliver

    2009-09-28

    inclination angle profile of the Grossglockner mountain is followed on the test stand with a speed of 55 km/h without overheating of the cooling system. After optimization of the cooler design and positioning, the new vehicle was able to meet the specifications while the first of the two vehicles only achieved 35 km/h without overheating of the cooling system. Finally, a theoretical investigation identified the measures that should be taken to achieve sufficient cooling in countries with hot climates, e.g. the USA. It was found that it would be sufficient to raise the coolant temperature from 90 C to about 110 C to ensure good performance in these climate zones. (orig.) [German] Ziel der vorliegenden Arbeit ist die thermodynamische Analyse und Optimierung eines Brennstoffzellensystems zum Antrieb von Kraftfahrzeugen. Der Fokus ist im Wesentlichen auf die Kuehlung des Brennstoffzellenstapelmoduls gelegt, wobei aufgrund der Vielzahl an Schnittstellen zwischen der Kuehlung und den anderen Teilsystemen (Wasserstoff- und Luftversorgung) auch eine ganzheitlichere Betrachtung erforderlich ist. Ausgangspunkt der Untersuchungen ist ein bestehendes Brennstoffzellenfahrzeug, anhand dessen in einem ersten Schritt experimentelle Untersuchungen auf Systempruefstaenden und im Klimawindkanal durchgefuehrt werden. Die gewonnenen Messdaten dienen zum einen der Darstellung des Ist-Zustands und zur Ermittlung des Grenzbereichs der Waermeabfuhr an die Umgebung ueber das Brennstoffzellen-Kuehlsystem. Zum anderen werden sie zur Validierung eines dynamischen Kuehlsystemsimulationsmodells herangezogen. Mittels dieses Simulationsmodells werden anschliessend im Rahmen von Sensitivitaetsanalysen die wesentlichen Einflussfaktoren zur Steigerung der Waermeabfuhr an die Umgebung ermittelt. Die daraufhin durchgefuehrten Optimierungen betreffen die Verschaltung der Systemkomponenten sowie deren Auslegung und Platzierung im Fahrzeugvorderwagen. Auf Basis dieser und weiterer Erkenntnisse wird ein weiteres

  19. Analysis of an accident involving a battery of hydrogen flasks; Analyse eines Unfalls mit einer Flaschenbatterieanlage fuer Wasserstoff

    Energy Technology Data Exchange (ETDEWEB)

    Lietze, D. [Bundesanstalt fuer Materialforschung und -pruefung (BAM), Berlin (Germany)

    2000-09-01

    When a hydrogen storage flask battery was used again after an outage period, a small section of the high-pressure collecting main burst. Luckily, the leaking hydrogen did not ignite and there were no fires or explosions causing secondary damage. The cause of failure was identified on the basis of extensive knowledge on pipeline loads shortly after detonative reactions. [German] Nach einer laengeren Pause kam es bei der Inbetriebnahme einer Wasserstoff-Flaschenbatterieanlage zum Bersten eines kleinen Teilstuecks der Hochdrucksammelleitung. Gluecklicherweise gab es keine Zuendung des an dieser Bruchstelle ausstroemenden Wasserstoffs und damit auch keine weiteren Sekundaerschaeden durch einen Brand bzw. durch eine Raumexplosion. Aufgrund der bei umfangreichen Untersuchungen ueber die Beanspruchung von Rohrleitungen bei detonativ verlaufenden Reaktionen gemachten Erfahrungen konnte die Ursache fuer diesen Schadensfall ermittelt werden. (orig.)

  20. Quality of energy consultancy services - Requirements, criteria for evaluation, and a case report; Energieberatungsqualitaet - Anforderungen, Messung und ein Fallbeispiel

    Energy Technology Data Exchange (ETDEWEB)

    Hausser, K.

    1999-07-01

    The article initially pictures an optimized model of energy consultancy and continues with explaining an instrument available for quality assessment of services in general, (SERVQUAL), presenting approaches for modifying this tool so as to make it applicable to evaluating the quality of energy consultancy activities. Finally, the capabilities of the modified tool are discussed referring to a case study in an electric utility, the Neckarwerke Stuttgart. (orig./CB) [German] Energieberatung durch Energieversorgungsunternehmen wird in Deutschland fast flaechendeckend angeboten. Im Beitrag wird zuerst aufgezeigt, welche Anforderungen eine optimale Energieberatung erfuellen muss. Danach wird ein Instrument vorgestellt, das die Qualitaet von Dienstleistungen im allgemeinen misst und im Rahmen der o.g. Arbeit so weiterentwickelt wurde, dass es von nun an auch als Instrument zur Messung der Qualitaet von Energieberatung im Besonderen dienen kann: SERVQUAL (von SERVice QUALity). Zuletzt werden die Ergebnisse praesentiert, die in der o.g. Untersuchung unter Anwendung von SERVQUAL bei den Neckarwerken Stuttgart erzielt wurden. (orig./RHM)

  1. Ein Mythos wird besichtigt. Le deuxième sexe von Simone de Beauvoir unter dem Mikroskop der Genderforschung

    Directory of Open Access Journals (Sweden)

    Lieselotte Steinbrügge

    2005-11-01

    Full Text Available Aus Anlass des 50jährigen Jubiläums der Erstausgabe von Das andere Geschlecht haben namhafte Wissenschaftlerinnen aus den Gebieten Philosophie, Biologie, Soziologie, Psychoanalyse, Geschichte und Literatur das fast tausendseitige Standardwerk des Feminismus einer akribischen Lektüre unterzogen und dabei versucht, jene Fragen zu rekonstruieren, auf die das Werk bei seinem Erscheinen im Jahr 1949 eine Antwort gab. Die zeitlos scheinende Formel von der Konstruiertheit weiblicher Identität sollte wieder in ihren ursprünglichen Entstehungszusammenhang gestellt, die Autorin aus der mythischen Ferne in die kritische Nähe gerückt werden. Diese kritischen Lektüren sind insgesamt gut dokumentiert und erlauben meines Wissens zum ersten Mal einen Einblick in die Beauvoirsche Werkstatt. Ein weiterer – ebenfalls von Ingrid Galster herausgegebener – Band dokumentiert die Reaktionen, die unmittelbar nach Erscheinen von Le deuxième sexe in der französischen Presse erschienen sind.

  2. Pionierinnenarbeit für eine bessere Rechtsstellung der Frau Pioneer Work for Improved Legal Rights of Women

    Directory of Open Access Journals (Sweden)

    Ulrike Aichhorn

    2008-11-01

    Full Text Available Tanja-Carina Riedel hat mit ihrer veröffentlichten Dissertation Gleiches Recht für Frau und Mann ein Werk vorgelegt, das Rechtsgeschichte und Geschlechterforschung verbindet, indem es die Entstehung des Bürgerlichen Gesetzbuches (BGB aus dem Blickwinkel der bürgerlichen Frauenbewegung betrachtet. Durch die beeindruckende Darstellung der oft nur schwer zugänglichen Quellen wird eine Seite des BGB erschlossen, die kaum bekannt ist.In the publication of her dissertation Equal Rights for Woman and Man (Gleiches Recht für Frau und Mann, Tanja-Carina Riedel combines legal history with gender research by examining the origins of the German Civil Code (Bürgerliches Gesetzbuch or BGB from the perspective of the middle-class women’s movement. Her impressive presentation of the sources, which are often hard to approach, gives us access to a side of the BGB that is almost unknown.

  3. Investigation of the influence of airfoil geometry on its wake; Untersuchung zum Einfluss der Geometrie eines Fluegels auf seinen Nachlauf

    Energy Technology Data Exchange (ETDEWEB)

    Schell, I.

    2001-07-01

    Strong turbulent flow along the wings in the wake of starting or landing aircraft are a danger to the aircraft next in line and limit the starting and landing frequency. The degree of turbulence depends mostly on aircraft weight but the aerodynamic design clearly has an effect. The author investigated the influence of airfoil geometry, both experimentally and numerically. [German] Im Nachlauf von startenden und landenden Flugzeugen bilden sich starke Fluegelrandwirbel aus, die ein grosses Gefahrenpotential fuer nachfolgende Flugzeuge darstellen und somit die maximal moeglichen Start- bzw. Landefrequenzen an Flughaefen begrenzen. Die Staerke der Wirbel ist hauptsaechlich vom Gewicht der Flugzeuge abhaengig, jedoch hat auch die aerodynamische Auslegung der Flugzeuge einen deutlichen Einfluss. In der vorliegenden Arbeit wird der Einfluss der Fluegelgeometrie eines Flugzeugs auf seinen Nachlauf experimentell sowie numerisch untersucht. (orig.)

  4. Optimal management of the power distribution network. A novel network information system; Optimale Verwaltung des Versorgungsnetzes. Ein neues Netzinformationssystem

    Energy Technology Data Exchange (ETDEWEB)

    Kiesel, U. [HEW AG, Hamburg (Germany); Korri, P. [Tekla Qyj, Eschborn (Germany). Energieversorgung

    2000-12-01

    In June 200, the German electric utility Hamburgische Electricitaets-Werke AG (HEW) has bought and installed a high-performance, PC-based information system for all purposes of distribution network management tasks for their medium and low-voltage grids. The standard software Xpower of the Finnish software house Tekla Oyj has been streamlined with the requirements of the utility and is described with respect to the applications on site. (orig./CB) [German] Mit der Einfuehrung eines Netzinformationssystems (NIS) steht der Hamburgischen Electricitaets-Werke AG (HEW) seit Juni 2000 ein leistungsstarkes PC-basiertes Informationssystem zur Verfuegung, das langfristig die Projektierung und die Betriebsfuehrung der Mittel- und Niederspannungsnetze unterstuetzt und dokumentiert. Die Standardsoftware Xpower des finnischen Spezialisten Tekla Oyj wurde an die Anforderungen der HEW angepasst. (orig./CB)

  5. Interkulturelle kommunikative Kompetenz – ein Versuch der Operationalisierung aus dem Fach Deutsch an der dänischen Lehrerausbildung

    DEFF Research Database (Denmark)

    Bjerre, Kirsten; Daryai-Hansen, Petra

    2017-01-01

    Mit diesem Artikel versuchen wir, den Begriff 'interkulturelle kommunikative Kompetenz‘ theoretisch zu entwickeln. Wir gehen zunächst der Frage nach, warum im Fach Deutsch als Fremdsprache mit interkultureller kommunikativer Kompetenz gearbeitet werden sollte und welche Herausforderungen sich...... hierbei stellen. Im Anschluss präsentieren wir unser Modell der interkulturellen kommunikativen Kompetenz, das wir für das Fach Deutsch ain der dänischen Lehrerausbildung auf der Grundlage eines Modells von Michael Byram aus dem Jahre 1997 entwickelt haben. Byrams Modell der interkulturellen...... zunächst die Begriffe ‚Kompetenz‘, ‚Kultur‘, ‚kommunikative Kompetenz‘ und ‚interkulturelle Kompetenz‘. Wir konkretisieren die Dimensionen des Modells im Anschluss anhand eines Unterrichtsbeispiels für das Fach Deutsch an der dänischen Einheitsschule („Folkeskole“). Abschließend skizzieren wir, wie unser...

  6. Qualifizierungsbedarfe, -ansätze und -strategien im Secondhand Sektor. Ein Europäischer Good-Practice-Bericht

    OpenAIRE

    Arold, Heike; Koring, Claudia; Windelband, Lars

    2008-01-01

    Vor dem Hintergrund eines sich ändernden Konsumverhaltens sowie des Wandels in der Umweltpolitik ist zukünftig mit einem Wachstum des Secondhand Sektors zu rechnen. Um die Qualität sowie die Professionalisierung innerhalb der im Sektor operierenden Unternehmen zu stärken, bedarf es der Entwicklung einer europaweit einheitlichen und sektorspezifischen Qualifizierung, die an den realen Arbeitsprozessen und Anforderungen ausgerichtet ist. Der vorliegende Good-Practice-Bericht zeigt neben einer a...

  7. Review: Thomas Brüsemeister (2000). Qualitative Forschung. Ein Überblick [Qualitative Research: An Overview

    OpenAIRE

    Martin Spetsmann-Kunkel

    2002-01-01

    Thomas BRÜSEMEISTER's book Qualitative Forschung. Ein Überblick [Qualitative Research: An Overview] presents five different methods of social research: case study, narrative interview, grounded theory, ethnomethododical conversation analysis, and objective hermeneutics. These methods are so described as to make them clear and understandable for university entrants and lay people in the area of qualitative social research. URN: urn:nbn:de:0114-fqs020252

  8. Langzeitevaluation eines psychologischen Trainings für adipöse Kinder und ihre Eltern (TAKE)

    OpenAIRE

    Roth, Binia; Munsch, Simone; Meyer, Andrea H.

    2011-01-01

    Verhaltenstherapeutische Eltern-Kind-Programme haben bisher die besten Effekte bei der Behandlung kindlicher Adipositas gezeigt. Mit TAKE (Training adipöser Kinder und ihrer Eltern) stellen wir eine psychologiebasierte Behandlung vor, die nicht nur Bewegung, Ernährung und Essverhalten als Elemente einschließt, sondern auch psychische Faktoren wie Selbstwertgefühl, Körperbild, soziale Kompetenzen und Hänseleien sowohl mit den Eltern als auch mit den Kindern behandelt. Aktuell liegen die Langze...

  9. Thompson revisited. Ein empirisch fundiertes Modell zur Qualität von „Quality-TV“ aus Nutzersicht

    Directory of Open Access Journals (Sweden)

    Michael Harnischmacher

    2015-07-01

    Full Text Available Was bedeutet das Attribut „Quality-TV“ eigentlich für das Publikum? Nach welchen Kriterien beurteilen Zuschauerinnen und Zuschauer, ob eine Serie Qualitätsfernsehen ist oder nicht? Im Bereich der rezipientenorientierten Qualitätsforschung bezüglich Fernsehserien sind bislang fast ausschließlich qualitativ erhobene Modelle bedeutsam, am bekanntesten sicherlich die bereits 1996 von Robert J. Thompson vorgeschlagenen 12 Kriterien. Die vorliegende Untersuchung widmet sich nun der Frage, ob diese Qualitätskriterien tatsächlich die „richtigen“ sind. Sind sie für die Zuschauer/innen von Serien bedeutsam für die Einschätzung, ob ein Programm „Quality-TV“ ist oder nicht? Bislang fehlt eine empirische Fundierung der einzelnen Merkmale. Ebenso ungeklärt ist bislang, ob es eine Rangfolge dieser Merkmale gibt. Welche sind bedeutsamer, welche weniger wichtig für die Wahrnehmung einer Serie als Qualitätsprodukt? Die Studie hat Thompsons Vorschlag (unter Bezugnahme auf weitere Studien zum Thema (z.B. Cardwell 2007; Feuer 2007; Dreher 2010; Blanchett 2011; Kumpf 2011 operationalisiert und in einer standardisierten Befragung der Nutzer von 13 Onlineforen zu Qualitätsserien (n=1382 getestet. Auf Basis dieser Befragung kann statistisch nachgewiesen werden, welche Merkmale von den Zuschauer/innen als besonders wichtig angesehen werden und wie diese zu Qualitätsfaktoren zusammengefasst werden können, die das Phänomen „Quality-TV“ aus Zuschauersicht tatsächlich beschreiben können.

  10. Ethnographische Feldforschung in der Mathematik – oder – Ist eine Soziologie der Mathematik möglich?

    Directory of Open Access Journals (Sweden)

    Mechthild Koreuber

    2001-07-01

    Full Text Available Die wissenschaftliche Disziplin Mathematik ist mit dem Nimbus des Objektiven und Entpersonalisierten versehen und scheint einer soziologischen Analyse nicht zugängig. Bettina Heintz fragt ausgehend von einer konstruktivistischen Wissenschaftssoziologie nach Gründen der epistemischen Besonderheit der Mathematik. Durch eine Verschiebung des Fokus vom Wissen auf das Handeln der Mathematiker und Mathematikerinnen gelingt es ihr, neue Einsichten in den Prozeß der Entstehung mathematischen Wissens zu gewinnen.

  11. Einsatzmöglichkeiten eines Verriegelungsnagelsystems für die Katze inklusive der Bestimmung der Durchleuchtungszeiten bei der Implantation

    OpenAIRE

    Fiedler, Angelika Marion

    2016-01-01

    Im prospektiven Studienteil wurden Anwendbarkeit, Operationszeiten, Durchleuchtungseinsatz, Heilungsverlauf und Komplikationen bei der Versorgung von 25 Humerus-, Femur- und Tibiafrakturen der Katze mit dem MarMed Verriegelungsnagel(VN)-System untersucht. Die Röntgenbeurteilung fand durch 2 Beurteiler unabhängig voneinander statt. Zwischen den Beurteilern und den Wiederholungen der Knochenmessungen bestand eine sehr gute Übereinstimmung. Für Achsenabweichungen, Implantatsitz und Heilungsphase...

  12. Analysis of the flow in the exit of propfans; Analyse der raeumlichen Stroemung im Austritt eines Propfans

    Energy Technology Data Exchange (ETDEWEB)

    Maass, M [Deutsche Forschungsanstalt fuer Luft- und Raumfahrt e.V. (DLR), Koeln (Germany). Inst. fuer Antriebstechnik

    1997-12-31

    In this work the first rotor of a counterrotating shrouded propfan has been investigated to enable an overview of the complex rotor exit flow, basing on unsteady measurements. For this purpose the accuracy of the high speed probe technique has been improved. In combination with the 3D-Laser-2-Fokus system measurements were carried out in order to show the turbulent behaviour of the rotor exit flow. Though the turbulence models are presently not sufficiently developed, comparisons with results of numerical flow simulations support to interpret some wake details. A further focal point of this work is to determine the local losses for quantifying the isentropic efficiency and the pressure loss distribution. These investigations on the compressor`s exit flow can be used as a base for code validation and as design data for the next stage. (orig.). 95 figs., 2 tabs., 60 refs. [Deutsch] In dieser Arbeit wurde der erste Rotor eines gegenlaeufigen ummantelten Propfans experimentell untersucht. Damit soll ein Einblick in die komplexe Verdichtungsaustrittsstroemung ermoeglicht werden, basierend auf instationaeren Messungen im Nachlaufbereich. Hierzu wurde die Messgenauigkeit der instationaeren Totaldruckmesstechnik verbessert und zusammen mit dem 3D-Laser-2-Fokus-System im Verdichteraustritt angewendet. Mit diesen Messungen wird das turbulente Verhalten der Nachlaufstroemung aufgezeigt. Vergleiche mit Ergebnissen aus Rechnungen helfen trotz der derzeit noch nicht weit genug entwickelten Turbulenzmodelle, Stroemungsphaenomene im Nachlauf zu erklaeren. Ein weiterer Schwerpunkt der Arbeit liegt in der Bestimmung der lokalen Verlustleistung, um den lokalen Wirkungsgrad und damit die lokalen Verluste im Verdichteraustritt quantifizieren zu koennen. Diese Untersuchungen im Verdichteraustritt koennen als Datenbasis fuer Codevalidierung dienen und fuer die Auslegung als Eintrittsgroessen eines nachgeschalteten zweiten Rotors verwendet werden. (orig.)

  13. "Rund um die Monti Berici" - Von Villa zu Villa : ein Fahrradtourismuskonzept für die Region Veneto

    OpenAIRE

    Müller, Evelyn

    2002-01-01

    Das Konzeptgebiet, die venezianische Ebene in der Region Veneto, bietet ideale Bedingungen für die Entwicklung von Fahrrad- und Bildungstourismus. Es ist flach und landschaftlich reizvoll. Zudem besitzt die Region ein reiches kulturelles Erbe mit vielfältiger Tradition, vornehmlich die venezianische Villa. Die Villen liegen verstreut in der Landschaft auf der ehemaligen "Terraferma". Sie haben das Gesicht der Kulturlandschaft geprägt. Sie waren die Zentralen, von wo aus enorme Meliorationsarb...

  14. German PV-producers - an overview. Look back in humility; Photovoltaik Fabriken in Deutschland- eine Uebersicht. Blick zurueck in Demut

    Energy Technology Data Exchange (ETDEWEB)

    Iken, J.

    2001-03-01

    Three years are a long period of time in a growing field of industry like photovoltaic power generation. In January 1998, Sonne Wind and Waerme published the first list of German PV producers. The update is presented here. [German] Drei Jahre sind in einer Wachstumsbranche wie der Photovoltaik eine lange Zeit. Im Januar 1998 veroeffentlichte Sonne Wind and Waerme einen Ueberblick ueber die deutschen Photovoltaik-Fabriken. Hoechste Zeit also, die Uebersicht auf den neuesten Stand zu bringen. (orig.)

  15. Evidenzbasierte Diagnostik phonologischer Störungen - Entwicklung und Evaluation eines Sprachanalyseverfahrens auf der Basis nichtlinearer phonologischer Theorien

    OpenAIRE

    Ullrich, Angela

    2011-01-01

    Forderungen nach einer Qualitätssicherung in der sprachtherapeutischen Diagnostik werden durch die fortlaufende Umstrukturierung des deutschen Gesundheitswesens und der Adaption des Konzepts der evidenzbasierten Praxis zunehmend dringlicher (Schmacke, 2000; Beushausen 2009). Als grundlegende Voraussetzung für eine qualitätssichernde Diagnostik müssen Therapeuten Verfahren zur Verfügung stehen, deren zugrunde liegende Theorien der besten wissenschaftlichen Evidenz zur Beantwortung der jeweilig...

  16. Heterogenität im Bildungsprozess und pädagogische Professionalität – Skizze eines Forschungsprogramms

    Directory of Open Access Journals (Sweden)

    Josef Strasser

    2011-06-01

    Full Text Available Heterogenität der Schülerschaft, wie sie sich im Zuge eines zunehmenden binnengesellschaftlichen Pluralismus von Kulturen ergibt, stellt das professionelle Handeln von Lehrern vor neue Herausforderungen. Der mangelnde Bildungserfolg, der mit verschiedenen Dimensionen von Heterogenität einhergeht, ist ein Indikator für bestehende Probleme im Umgang mit Heterogenität. Trotz des zunehmenden Interesses am Thema fehlt es aber an einer breiten und systematisch gewonnenen Wissensbasis zur professionellen Auseinandersetzung mit Heterogenität. Unklar ist, wie pädagogische Professionalisierung besser an neue, mit wachsender Heterogenität einhergehende Anforderungen des Schulalltags angepasst werden kann. Hierzu bedarf es eines umfassenden Forschungsprogramms. In dem Beitrag wird der Rahmen für ein derartiges Programm abgesteckt, indem der Blick 1 auf vorliegende Erkenntnisse zum Zusammenhang zwischen Heterogenität und Bildungserfolg, 2 auf unterschiedliche Konzepte zum Umgang mit Heterogenität und 3 auf die Vermittlung geforderter Kompetenzen in der Lehrerbildung gerichtet wird. Die hierbei konstatierten Defizite führen zur systematischen Verortung von anzugehenden Forschungsbereichen.Student diversity, resulting from an increasing pluralism of cultures within society, is a major challenge for teachers’ professional action. The fact that problems in school achievement are associated with different dimensions of diversity hints to existing problems in dealing with diversity. Although student diversity is increasingly focused in educational discourses, a broad and systematically gained knowledge base is still lacking. It remains unclear, how the professional training and development of teachers can be adjusted to the demands of increasing diversity within schools. A comprehensive research program is needed to overcome this deficit. The paper delineates the frame for such a program by looking at 1 existing research on the relation between

  17. Klimaanpassung in Land- und Forstwirtschaft: Ergebnisse eines Workshops der Ressortforschungsinstitute FLI, JKI und Thünen-Institut

    OpenAIRE

    Schimmelpfennig, Sonja; Heidecke, Claudia; Beer, Holger; Bittner, Florian; Klages, Susanne; Krengel, Sandra; Lange, Stefan

    2018-01-01

    Das Working Paper stellt die Ergebnisse einer Umfrage und eines Workshops zusammen, die von Wissenschaftlern und Wissenschaftlerinnen der Ressortforschungsinstitute Thünen-Institut, Julius Kühn-Institut (JKI) und Friedrich-Loeffler-Institut (FLI) im Herbst 2016 zusammengetragen und diskutiert worden sind. Ziel des Workshops und der Umfrage war, den Stand des Wissens zu Klimaanpassungsthemen in der Ressortforschung des BMEL und die zukünftigen Herausforderungen einer Anpassung an den Klimawand...

  18. Erstellung eines multimedialen Lernprogramms über die Grundlagen der EKG-Aufzeichnung und Auswertung bei Hund und Katze

    OpenAIRE

    Weigel-Ossiander, Fiona Sarah

    2016-01-01

    Mit EKG Basics wurde ein detailliertes multimediales Lernprogramm über die Grundlagen der Elektrokardiographie bei Hund und Katze erstellt unter besonderer Berücksichtigung von didaktischen und ergonomischen Gesichtspunkten. Da vielen Veterinärmedizinerinnen/Veterinärmedizinern das Erlernen, Verstehen und Interpretieren der Elektrokardiographie schwer fällt, war das Ziel der vorliegenden Arbeit, sowohl Studierenden der Tiermedizin als auch interessierten Tierärztinnen/Tierärzten die Thema...

  19. Der Ausbau des Hochrheins zur Schifffahrtsstraße - Die Geschichte eines gescheiterten Großprojekts

    OpenAIRE

    Steiner, Rudolf

    2006-01-01

    Die vorliegende Arbeit befasst sich mit Genese, Verfall und Scheitern eines der ehrgeizigsten technischen Großprojekte des 20. Jahrhunderts im süddeutschen Raum – dem Ausbau des Rheinabschnitts zwischen Basel und dem Bodensee zu einer schiffbaren Wasserstraße. Hatte es bereits seit dem Mittelalter mehrere erfolglose Versuche gegeben, die zahlreichen natürlichen Hindernisse auf dem Hochrhein, wie die genannte Strecke bezeichnet wird, zum Zwecke einer durchgängigen Schifffahrt bis zum Bodensee ...

  20. Effects of aerodynamic properties on thermomanagement in a motor vehicle; Die Auswirkung aerodynamischer Eigenschaften auf das Thermomanagement eines Kraftfahrzeuges

    Energy Technology Data Exchange (ETDEWEB)

    Dietz, S. [Audi AG, Ingolstadt (Germany)

    1999-07-01

    The effects of aerodynamics on thermomanagement are overproportionally important especially in high-performance or low-consumption vehicles. Thermomanagement includes air flow through the vehicle in the context of cooling and aerodynamics. The contribution presents some examples. To make use of the potential for consumption reduction, aerodynamic experiments and thermomanagement should be integrated already in the very first design stages. New aerodynamic simulation techniques as well as virtual simulation methods will be employed here. [German] Die Verknuepfung von Aerodynamik und Thermomanagement wird vor allem bei Fahrzeugkonzepten mit hoher Leistung oder Fahrzeugen mit geringem Verbrauch ueberproportional wichtig. Ein Teilbereich des Thermomanagement betrifft den mit der Kuehlung und der Aerodynamik verknuepften Bereich der Fahrzeugdurchstroemung. Exemplarisch werden im Beitrag einige Beispiele dieser Verknuepfung dargestellt. Zunaechst der Einfluss der Durchstroemung zur Umstroemung, mit einer Aufgliederung der durch die Durchstroemung verursachten Luftwiderstandseinfluesse. Ausgehend von aktuellen Widerstandsanteilen der Kuehlluft im Cw-Wert, wird zusammen mit der Betrachtung des Waermestromes und einem Simulationsmodell fuer ein Kuehlsystem der minimale Anteil der Kuehlluft im Widerstand ermittelt. Das Verbrauchspotential durch die Optimierung der Verluste in der Durchstroemung und die Optimierung der aerodynamischen Form liegt bei einem Anteil von ca. 50% des Kuehlluftanteiles im Cw-Wert. Umgerechnet auf den Verbrauch (ohne die Aggregate anzupassen) ergibt sich damit fuer den MVEGII-Zyklus ein Potential von ca. 1% Verbrauchseinsparung. Abgeleitetes Ziel muss es deshalb sein, fruehe Entwicklungsphasen begleitend mit Versuchen, die eine realistische Durchstroemung und Aussenumstroemung des Fahrzeuges ermoeglichen, zu entwickeln. Neue Simulationstechniken seitens der Aerodynamik mit Messungen an Fahrzeugen mit drehenden Raedern und bewegtem Unterboden sowie

  1. Auswirkungen eines Intensivtherapie-Programms für verhaltensgestörte Geistigbehinderte auf ihre Bezugspersonen im Heim

    OpenAIRE

    Elbing, Ulrich; Rohmann, Ulrich H.

    1994-01-01

    Die vorliegende Studie dokumentiert die Auswirkungen eines Intensivtherapie-Programms für Geistigbehinderte mit schweren Verhaltensstörungen oder autistischen Verhaltensweisen auf ihre in das Programm mit einbezogenen Betreuer hinsichtlich ihrer fachlichen Kompetenz, ihrer Interaktionsqualität mit den Klienten, ihrer Teamkultur und ihrer Arbeitszufriedenheit. In einem quasiexperimentellen Design schätzten sich die Betreuer vor und nach dem Intensivtherapie-Programm mit einer Ratingskala im Hi...

  2. Evaluation eines Intensivtherapie-Programms zur Behandlung schwerer Verhaltensstörungen bei geistig Behinderten mit autistischen oder psychotischen Verhaltensweisen

    OpenAIRE

    Elbing, Ulrich; Rohmann, Ulrich H.

    1993-01-01

    Die vorliegende Studie dokumentiert den Verlauf schwerer Verhaltensstörungen und erwünschten Zielverhaltens bei Geistigbehinderten mit z. T. autistischen oder psychotischen Verhaltensweisen, die vor, während und nach der Durchführung eines Intensivtherapie Programms in einem Heim fur Geistig- und Mehrfachbehinderte beobachtet wurden. Der Artikel faßt sieben Einzelfallstudien zusammen, die als Längsschnitt-Beobachtungen das Verhalten zwischen 18 und 33 Wochen überwiegend in multiple baseline d...

  3. Alltagsvorstellungen über den Treibhauseffekt und die globale Erwärmung verändern - eine Voraussetzung für Bildung für nachhaltige Entwicklung

    OpenAIRE

    Reinfried, Sibylle; Rottermann, Benno; Aeschbacher, Urs; Huber, Erich

    2010-01-01

    Das korrekte Verstehen des Treibhauseffektes ist eine wichtige Voraussetzung, um politische Maßnahmen zur Reduktion des Treibhausgases CO2 zu unterstützen. Fehlerhafte Alltagsvorstellungen über den Treibhauseffekt und die globale Erwärmung sind jedoch weit verbreitet und schwer zu verändern. Um eine beständige Veränderung der Alltagsvorstellungen zu induzieren, wurde eine instruktionspsychologisch optimierte Lernumgebung zum Treibhauseffekt entwickelt. Ihre Wirksamkeit wurde in einer Interven...

  4. The EU electricity production structure requires a differentiated energy policy; Die Stromerzeugungsstruktur der EU erfordert eine differenzierte Energiepolitik

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2016-04-15

    For the electricity production of the EU there are differentiated structures which are based on different natural conditions, political decisions and investments of past decades. It has long been struggled committed to the ''one and correct'' energy policy. But precisely because of the differences in the individual countries, a unified energy and climate policy for the EU is not the right way. Diversity is a strength, which quite the EU Commission considered. Increased understanding of the specifics in other countries should just apply the German politics and the public that all too often judges from their own perspective. [German] Bei der Stromerzeugung in der EU bestehen differenzierte Strukturen, die auf unterschiedlichen natuerlichen Gegebenheiten, politischen Entscheidungen und Investitionen vergangener Jahrzehnte beruhen. Seit langem wird engagiert um die ''eine und richtige'' Energiepolitik gerungen. Doch gerade wegen der Unterschiede in den einzelnen Laendern kann eine vereinheitlichte Energie- und Klimapolitik fuer die EU nicht der richtige Weg sein. Vielfalt ist eine Staerke, was die EU-Kommission durchaus beruecksichtigt. Mehr Verstaendnis fuer die Spezifika in anderen Laendern sollte daher gerade die deutsche Politik und Oeffentlichkeit aufbringen, die allzu oft aus eigener Perspektive heraus urteilt.

  5. Leptomeningeosis leucaemica in connection with acute lymphatic leukemia. A case report; Leptomeningeosis leucaemica bei akuter lymphatischer Leukaemie. Ein Fallbericht

    Energy Technology Data Exchange (ETDEWEB)

    Fellner, F.; Dobritz, M.; Cavallaro, A.; Schmitt, R.; Bautz, W. [Universitaet Erlangen-Nuernberg (Germany). Institut fuer Diagnostische Radiologie; Roesler, W. [Universitaet Erlangen-Nuernberg (Germany). Medizinische Klinik III; Keilholz, L. [Universitaet Erlangen-Nuernberg (Germany). Klinik fuer Strahlentherapie

    1998-03-01

    MRI is significantly better than CT for detection of leptomeningeosis leucaemica, due to better imaging of the anatomy and the diversity of the tomographic images. Based on the MRI information in the case reported, the decision was for radiotherapy of the cranium: Linear accelerator-based irradiation of the neurocranium up to and inclusive of C2, with 6 MeV photons via laterally opposing fields. The single dose was 1.50 Gy, and 16.50 Gy at the reference point at the time of a control examination. The radiotherapy was accompanied at the same time by a further intrathecal cytostasis. The treatment rapidly achieved improvement of the clinical findings, and the follow-up MRI correspondingly revealed almost complete remission of the leptomeningeal foci. (orig./CB) [Deutsch] Die MRT ist im Nachweis der Leptomeningeosis leucaemica der CT deutlich ueberlegen, bedingt durch die bessere Darstellung der anatomischen Strukturen und der Moeglichkeit der Bildakquisition in verschiedenen Ebenen. Aufgrund des MR-tomographischen Befundes wurde im vorliegenden Fall eine Radiatio des Craniums durchgefuehrt: Bestrahlung des Neurocraniums bis einschliesslich C2 am Linearbeschleuniger mit 6 MeV Photonen ueber seitlich opponierende Gegenfelder. Einzeldosis war 1,50 Gy, zum Zeitpunkt der Kontrolluntersuchung im Referenzpunkt bis 16,50 Gy. Zusaetzlich wurde gleichzeitig eine weitere intrathekale Zytostase durchgefuehrt. Waehrend der Therapie kam es rasch zu einer deutlichen Verbesserung des klinischen Befundes. Die MRT-Kontrolluntersuchung zeigte dementsprechend eine fast vollstaendige Remission der leptomeningealen Herde. (orig.)

  6. Modelling and simulation of an absorption cycle with a blow pump; Modellierung und Simulation eines Absorptionskreislaufes mit einer Blasenpumpe

    Energy Technology Data Exchange (ETDEWEB)

    Buecherl, Markus

    2011-07-01

    Diffusion-absorption refrigerators are commonly operated with ammonia and water. If a ionic liquid with negligible vapour pressure is substituted for water, the rectifier will be unnecessary. In the context of a diploma thesis, a diffusion-absorption refrigerator with a blower pump and ammonia and a ionic liquid as working fluid was modelled and simulated. For this, three models were selected from the relevant literature and compared. Changes in COP as a result of varied operating parameters were investigated as well. It was shown that it is possible, in principle, to operate a diffusion-absorption refrigerator with a ionic liquid. [German] Diffusions-Absorptions-Kaeltemaschinen werden in der Regel mit dem Arbeitsstoffpaar Ammoniak-Wasser betrieben. Ersetzt man das Absorptionsmittel Wasser gegen eine ionische Fluessigkeit, die nur einen vernachlaessigbaren Dampfdruck besitzt, kann man den Rektifikator einsparen. Im Rahmen einer Diplomarbeit wurde eine Diffusions-Absorptions-Kaeltemaschine mit einer Blasenpumpe und dem Arbeitsstoffpaar Ammoniak-Ionische Fluessigkeit modelliert und simuliert. Hierfuer wurden drei Modelle aus der Literatur ausgewaehlt. Diese Modelle wurden untereinander verglichen. Ausserdem wurde die Veraenderung des COP bei der Variation der Betriebsparameter fuer diese Berechnungsmodelle untersucht. Es konnte gezeigt werden, dass es prinzipiell moeglich ist, eine Diffusions-Absorptions-Kaeltemaschine mit ionischer Fluessigkeit zu betreiben.

  7. SINTAP: draft of a unified European failure assessment procedure. An introduction; SINTAP: Entwurf einer vereinheitlichten europaeischen Fehlerbewertungsprozedur. Eine Einfuehrung

    Energy Technology Data Exchange (ETDEWEB)

    Zerbst, U.; Kocak, M. [GKSS-Forschungszentrum Geesthacht GmbH (Germany). Inst. fuer Werkstofforschung; Wiesner, C. [The Welding Institute (TWI), Cambridge (United Kingdom). Structural Integrity Dept.; Hodulak, L. [Fraunhofer-Institut fuer Werkstoffmechanik (IWM), Freiburg im Breisgau (Germany)

    1999-07-01

    Fracture mechanics based flaw assessment concepts are increasingly used in industrial regulations and standards. A considerable number of different guidelines and procedures are available which are partly based on each other but also exhibit significant differences. At this background, the EU sponsored SINTAP, an interdisciplinary Brite Euram project. SINTAP stands for 'Structural Integrity Assessment Procedures for European Industry'. From 1996 to 1999 seventeen organisations from nine European countries participated in the project the aim of which was to unify the available procedures. The present report is an introduction into the content, the structure and the scientific background of the procedure which was generated within SINTAP. (orig.) [German] Bruchmechanische Bewertungskonzepte werden international in zunehmendem Masse Bestandteil industrieller Regelwerke und Fachbereichsstandards. Bereits heute existiert eine Vielzahl derartiger Vorschriften und Rechnerprogramme, die teilweise aufeinander aufbauen, teilweise aber auch signifikante Unterschiede aufweisen. Vor diesem Hintergrund wurde durch die EU von 1996 bis 1999 SINTAP, ein interdisziplinaeres Brite-Euram-Projekt gefoerdert, dessen Ziel in einer Vereinheitlichung der vorhandenen Ansaetze bestand, und an dem siebzehn Institutionen aus neun europaeischen Laendern beteiligt waren. SINTAP steht fuer 'Structural Integrity Assessment Procedures for European Industry'. Der vorliegende Bericht ist eine Einfuehrung in Inhalt, Struktur und wissenschaftlichen Hintergrund der im Ergebnis des Projektes entstandenen SINTAP-Prozedur. (orig.)

  8. Ein realer Lernort mit digitalem Mehrwert. Die Bibliothek der Universität Konstanz nach der Sanierung

    Directory of Open Access Journals (Sweden)

    Oliver Kohl-Frey

    2014-12-01

    Full Text Available Die Sanierung der Bibliothek der Universität Konstanz erforderte eine Überprüfung des bibliothekarischen Konzepts aus den sechziger Jahren, das in einem Gebäude der siebziger Jahre umgesetzt wurde. Insgesamt betrachtet bewährt sich das Konzept der Konstanzer Bibliothek bis heute, und es werden lediglich Anpassungen an die Bedürfnisse des 21. Jahrhunderts nötig. Durch aktive Pflege des gedruckten Bestands inklusive Aussonderung konnte Raum für die notwendige Ausweitung der Funktionen als Lernort und als sozialer Ort geschaffen werden. Das neu konzipierte Hybrid Bookshelf erlaubt eine neuartige Präsentation des digitalen Bestands am Ort Bibliothek. Durch die so angepasste Konzeption kann eine signifikante Aufwertung des realen Lernorts samt digitalem Mehrwert erreicht werden. The redevelopment process of the University of Konstanz Library required a proof of the sixties library concept that was realized within a seventies building. Generally the concept has proved itself; small adaptions have to be realized for the needs of the 21.century. The libraries functions as learning space and as social space are strengthened. Through the newly developed Hybrid Bookshelf the digital collection will be visible within the library space. That leads to a significant appreciation of the real learning space and a digital additional value.

  9. Problems of method of technology assessment. A methodological analysis; Methodenprobleme des Technology Assessment; Eine methodologische Analyse

    Energy Technology Data Exchange (ETDEWEB)

    Zimmermann, V

    1993-03-01

    theoretische begruendete Aussagen zu methodischen Aspekten des TA waren. Es konnte festgestellt werden, dass theoretische Grundprobleme des TA insbesondere auf dem Gebiet der Komplexitaetsbewaeltigung liegen. Dies schlaegt sich auch in der Problemkonstituierung nieder, die elementarer und zentraler Ansatz des TA ist. Wissenschaftlich fundierte Problemkonstituierung und entsprechende Modellkonstruktion beduerfen interdisziplinaerer wissenschaftlicher Arbeit. Die Interdisziplinaritaet in TA-Forschungsprozessen vollzieht sich auf der Ebene virtueller Netze, wobei virtuelle Netze durch teamfaehige Individuen konstituiert werden. Die dabei entstehenden Netzstrukturen haben eine gegenstaendlich-organisatorische und eine ideelle Basis. Die gegenstaendlich-organisatorische Basis realisiert sich primaer durch die Teamzusammensetzung sowie durch die externen Einbindungen der Teammitglieder. Die ideele Grundlage virtueller Netze wird durch das Denken der Teammitglieder repraesentiert, das im einzelnen jeweils auf metadisziplinaerem Niveau angesiedelt werden muss. Das theoretische `Gerippe` des Wissenssystems des TA, das durch prozess- und wissensbasierte Koppelungsstrukturen repraesentiert wird, ist in Verbindung mit der Kenntnis von Problemtypen, Analysefeldern und Verfahren zur Komplexitaetsbewaeltigung generierbar und zugleich aufarbeitbar. In diesem Prozess ist diszipliaeres Wissen eine notwendige, jedoch keine hinreichende Voraussetzung. Metatheoretisches und metadisziplinaeres Wissen sowie die entsprechend aufbereitete Komplexitaet der Abbilder sind die Grundlage fuer die notwendige methodische Bewusstheit, die TA als Forschungsprozess gestaltbar werden laesst. (orig./HP)

  10. Interkulturelles Lernen während eines kurzzeitigen, studienbegleitenden Fremdsprachenprogramms. Erfahrungen australischer Studierender in Deutschland

    Directory of Open Access Journals (Sweden)

    Rosalind Blood

    2016-04-01

    Full Text Available Studienaufenthalte im Ausland werden im Zuge der Internationalisierung des Hochschulsystems von vielen australischen Universitäten gefördert. In dieser Studie werden die Wahrnehmungen von Austauschstudierenden untersucht, die sie während ihres kurzzeitigen Studienaufenthalts über die deutsche Sprache sowie über Umgangsformen, Sitten und Gebräuche im Gastland machen. Ziel der Studie ist eine Identifizierung von Faktoren, die interkulturelles Lernen erleichtern und deshalb von TutorInnen und Lehrenden bei der Vorbereitung auf ein Auslandsstudium berücksichtigt werden sollten. Zu diesem Zweck wurden mit zehn Studierenden, die an einem sechswöchigen Austauschprogramm in Stuttgart teilgenommen hatten, semi-strukturierte Interviews durchgeführt. Die Daten wurden mit der Methode der qualitativen Inhaltsanalyse untersucht, wobei deduktiv nach dem Modell der Entwicklung interkultureller Sensibilität von Bennett (1986 vorgegangen wurde. Die Ergebnisse unserer Studie weisen darauf hin, dass die Studierenden nur unzureichend in der Lage waren, interkulturelle Situationen zu reflektieren. Dies scheint mit der sprachlichen Kompetenz in der Fremdsprache (L2 und ihren bisherigen Erfahrungen auf Auslandsreisen zusammenzuhängen. Analysen des Mobilitätskapitals (Murphy-Lejeune 2003 könnten helfen, die Studierenden vor, während und nach dem Studienaufenthalt besser zu unterstützen. The support of ‘study abroad’ programs is part of an increasing effort made by Australian universities to internationalize the student experience. This study analyses student perceptions of colloquial language, manners and customs in the host country during a short-term study abroad program. The aim of the study is to identify the factors that influence intercultural learning and thus should be taken into account in order for administrators and instructors to best support students taking part in such short-term exchanges. Bennett’s model of the development of

  11. Tears of the devil. A history of petroleum; Traenen des Teufels. Eine Weltgeschichte des Erdoels

    Energy Technology Data Exchange (ETDEWEB)

    Barudio, G.

    2001-07-01

    Konsumenten-Boykott ausloeste. In den letzten zehn Jahren hat sich ein grundlegender Wandel der Rolle des Oels vom Energietraeger zum Grundstoff einer weltumspannenden 'Life science'-Industrie vollzogen. Gestiegenes Umweltbewusstsein, das Ozonloch, Mega-Fusionen auch in der Erdoel-Industrie, der Preiskrieg an unseren Tankstellen - bis in unsere Tage fuehrt diese faszinierende Darstellung. Ein grosses Werk der Wirtschafts- und Zivilisationsgeschichte. Es endet mit dem Appell, dass der Mensch sich seiner Treuhaenderrolle der Natur gegenueber bewusst werden muss. (orig.)

  12. On the current knowledge of noise effects: necessity to change the paradigm; Zum gegenwaertigen Erkenntnissstand der Laermwirkungsforschung: Notwendigkeit eines Paradigmenwechsels

    Energy Technology Data Exchange (ETDEWEB)

    Ising, H.; Kruppa, B. [Umweltbundesamt, Berlin (Germany)

    2001-07-01

    Previously, extra-aural noise effects were mostly assessed using a paradigm in which the sound level played the major role. On the basis of this paradigm the relatively low sound levels of environmental noise are not considered as causing any adverse health effects. In contrast to this numerous empirical results have demonstrated long-term noise-induced health risks. Therefore a radical change of attitude-a change of paradigm-- is necessary. For an immediate triggering of protective reactions (fight/flight or defeat reactions) the information conveyed by noise is very often more relevant than the sound level. The first and fastest signal detection is mediated by a subcortical area, the amygdala. For this reason even during sleep the noise from airplanes or heavy goods vehicles may be categorized as danger signals and induce the release of stress hormones. In accordance with the noise stress hypothesis chronic stress hormone dysregulations and increases of established endogenous risk factors of ischaemic heart diseases have been observed under long-term environmental noise exposure. Therefore, an increased risk of myocardial infarction is to be expected. The results of individual studies on this subject in most cases do not reach statistical significance. However, according to the Environmental Expert Council, they show a consistent trend towards an increased cardiovascular risk if the daytime immission levels exceed 65 dB(A).t of the present studies. (orig.) [German] In der Vergangenheit wurde vielfach von einem Paradigma der Laermwirkungen ausgegangen, bei dem allein der Schallpegel die dominierende Rolle spielt. Da hiernach bei den relativ niedrigen Pegeln des Umweltlaerms keine weitergehenden gesundheitlichen Beeintraechtigungen zu erwarten sind, andererseits aber empirische Befunde fuer die Existenz langfristiger laermbedingter Gesundheitsgefahren sprechen, ist ein radikales Umdenken - ein Paradigmenwechsel - erforderlich. Fuer die schnelle Ausloesung von

  13. „Weltwissen“ und/oder „Medienwissen“ von Kindern. „Wissensforschung“ – ein Desiderat pädagogisch orientierter Medienforschung?

    Directory of Open Access Journals (Sweden)

    Hans-Dieter Kübler

    2017-08-01

    Full Text Available „Was sollte heute ein Kind in den ersten sieben Lebensjahren wissen, können, erfahren haben? Womit sollte es zumindest in Berührung gekommen sein?“ (Elschenbroich 2002, S. 20. Mit ihrem Katalog eines so genannten „Weltwissens“ für Siebenjährige und seiner aus vielerlei Erfahrungen geschöpften Begründung hat Donata Elschenbroich, Pädagogin am Deutschen Jugendinstitut, einen Bestseller gelandet, der wie kaum ein anderes pädagogisches Buch schon fast zwei Jahre auf den Charts steht und eine ungeahnte Auflage erreicht hat. Zwar bleibt der zentrale Begriff „Weltwissen“ in dem Buch vage – wie bei den meisten Verwendungen, sofern man sich nicht an Karl Poppers Drei-Welten-Theorie hält, wonach das „Weltwissen“ die Welt 3 umfasst, also die „objektiven Produkte oder Ideen des menschlichen Geistes (einschließlich aller Theorien über die Welt und über uns“ [Popper 1993, S. 75], die externalisiert und dokumentiert sind; früher hatte man noch den Begriff des Alltagswissens im Gegensatz zum Schulwissen zur Verfügung; immerhin sind D. Elschenbroichs Konzept und ihre Argumentation weitaus vielfältiger und offener angelegt, als es der Titel mit seinem Kanonversprechen für Siebenjährige vermuten lässt, denn es wird ‚nur’ ein „offener Bildungskanon“ angeboten, der recht vielseitig und nicht nur durch Instruktion zu erreichen ist. Doch die öffentliche Rezeption des Buches hat sich schon – soweit erkennbar – darauf kapriziert, dass nun eine schlüssige Orientierung, ein vorbildlicher „Wissens- und Erfahrungskatalog“ für Eltern und Erzieher vorliegt, an den sie sich in ihrem Erziehungsverhalten halten können – wie normativ oder rigide er auch immer ausfällt.

  14. Fundamental investigations for a OWC-tidal power plant with a conventional hydraulic turbine; Basisuntersuchungen fuer ein OWC-Wellenenergiekraftwerk mit konventioneller Hydroturbine. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Graw, K.U.; Lengricht, J.; Schimmels, S.

    2001-07-01

    At the present the OWC-tidal power plant is the most forward-looking way of converting tidal energy into usable electric power. Current research works focus on the dimensions of the structures in terms of occurring loads, the minimisation of hydraulic losses and the development of new turbine-generator types. The development of all air-turbine systems, which have been investigated so far, is considered as problematic and the commercialisation is likely to be a hindrance. Based on international research results an inventory tata of available hydraulic turbines is supposed to be gathered and fundamental investigations are supposed to check, if the application of conventional hydraulic turbines are an energetic progress in the OWC-tidal power plant. In order to considerably increase the efficiency compared to current developments, small-scale investigations at a physical model are supposed to show if and how a hydraulic turbine can be realised in a OWC-tidal power plant and how a concept of flow rectification as well as a flow-optimised form of inflow and outflow chambers can be achieved. (orig.) [German] Das OWC-Wellenenergiekraftwerk ist der zur Zeit zukunftstraechtigste Typ zur Umwandlung von Wellenenergie in nutzbaren Strom. Die laufenden Forschungsarbeiten beschaeftigen sich insbesondere mit der Dimensionierung der Strukturen hinsichtlich auftretender Belastungen, der Minimierung der hydraulischen Verluste und der Entwicklung von neuartigen Turbinen-Generatoren-Typen. Die Entwicklung aller bisher untersuchten Luftturbinensysteme wird jedoch als problematisch und die Kommerzialisierung hindernd angesehen. Aufbauend auf den internationalen Forschungsergebnissen sollen eine Bestandaufnahme der verfuegbaren Hydroturbinen durchgefuehrt und mit Baisuntersuchungen geprueft werden, ob ein Einsatz konventionaller Hydroturbinen im OWC-Wellenenergiekraftwerk eine energetische Weiterentwicklung darstellen kann. Um den Wirkungsgrad gegenueber derzeitigen Entwicklungen

  15. Praktische Ansätze für ein familienfreundliches Medizinstudium [Practical Approaches to Family-friendly Medical Studies

    Directory of Open Access Journals (Sweden)

    Liebhardt, Hubert

    2012-04-01

    , beschrieben. Flexibilisierung und Individualisierung sind dabei wesentliche Merkmale und Voraussetzungen eines familienfreundlichen Medizinstudiums im Rahmen universitärer Ausbildungsstrukturen. Flexibilität und Individualisierung können dadurch erreicht werden, dass Stundenpläne und Studienordnungen so gestaltet werden, dass sowohl Kinderbetreuung gesichert ist, als auch in Notfällen schnell und unbürokratisch Hilfe angeboten werden kann. Zur Flexibilisierung gehören u.a. adäquate, individuelle Kompensationsmöglichkeiten von Anwesenheitspflicht und Prüfungsterminen. Dafür erforderliche Bewusstseinsveränderung und Kooperationsbereitschaften beim Führungs- und Lehrpersonal können durch das Audit zur Familienfreundlichkeit „berufundfamilie“ bzw. „familiengerechte hochschule“, sowie ein strategisches Managementinstrument einer familienbewussten Unternehmenspolitik, gefördert werden. Unterstützende Instrumente, wie ein effektiv vernetztes Beratungswesen, ein datengestütztes Studienverlaufsmonitoring, die Ausgabe eines Elternpasses mit einem semesterübergreifenden Ausbildungsvertrag, die Schaffung von mehr Austausch zwischen studierenden Eltern bzw. anderen Studierenden durch eine Elterncommunity bzw. durch Lerntandems und schließlich die verlässliche Aufklärung und Einhaltung der Mutterschutzregelungen für schwangere und stillende Medizinstudentinnen flankieren ein gelingendes Studium mit Kind(ern.

  16. Preisgestaltung von eBook-Angeboten für Bibliotheken: Die Perspektive eines Publikumsverlags

    Directory of Open Access Journals (Sweden)

    Jonathan Beck

    2016-04-01

    Full Text Available Am Beispiel des Publikumsverlags C.H.Beck zeigt dieser Beitrag, wie und unter welchen Rahmenbedingungen digitale Bibliotheksangebote entstehen in Verlagen, deren Veröffentlichungen sich nicht primär an akademisch arbeitende Leser richten. Nach einer Vorbemerkung zu den Zielgruppen der verschieden Verlagsbereiche von C.H.Beck und die sich daraus ergebende historische Entwicklung digitaler Angebote legt der Beitrag dar, wie es zur Entwicklung des spezifischen Bibliotheksangebots „C.H.Beck eLibrary“ kam und welche Erwägungen bei der Preisfindung für dieses Angebot eine Rolle gespielt haben. Besondere Aufmerksamkeit gilt dabei den Kalkulationsgrundlagen in Publikumsverlagen sowie den relevanten rechtlichen und ökonomischen Umständen im Buchmarkt. Using the trade imprint C.H.Beck as example, this article shows how and under which restrictions digital library offers are created by publishers whose publications are not primarily focused on academic readers. Following introductory remarks regarding the target groups of the various C.H.Beck publishing divisions and on the consequential historical development of its digital offers, the article describes how the specific library offer “C.H.Beck eLibrary” was developed and which considerations were important in determining its pricing. Particular attention is given to cost factors in trade publishing and to relevant legal and economic conditions in book publishing.

  17. Ursula Athenstaedt, Dorothee Alfermann: Geschlechterrollen und ihre Folgen. Eine sozialpsychologische Betrachtung. Stuttgart: W. Kohlhammer Verlag 2011.

    Directory of Open Access Journals (Sweden)

    Heike Kahlert

    2013-05-01

    Full Text Available Ursula Athenstaedt und Dorothee Alfermann knüpfen in ihrem Lehrbuch zur sozialpsychologischen Geschlechterforschung an das Konzept der Geschlechterrollen an, das von den Soziologen Parsons und Bales in den 1950er Jahren in den USA entwickelt wurde. Unbeeindruckt von der seitdem in der Geschlechterforschung formulierten Kritik am Rollenbegriff liefern sie in sechs Kapiteln einen sorgfältig recherchierten Überblick über den Forschungsstand. Der affirmative Duktus gegenüber empirisch belegten Geschlechterunterschieden wirkt auch angesichts der Prominenz sozialkonstruktivistischer Ansätze in der Geschlechterforschung befremdlich. Umso erfrischender ist das Schlusskapitel, in dem die Autorinnen Empfehlungen für eine geschlechtergerechte psychologische Forschung aussprechen.In their textbook on socio-psychological gender studies, Ursula Athenstaedt and Dorothee Alfermann draw on the concept of gender roles, which was developed by the sociologists Parsons and Bales in the 1950s in the USA. Indifferent towards the criticism of the concept of roles that has been formulated in gender studies since then, they offer a carefully researched overview on the current state of research. The affirmative style towards empirically proven gender differences seems rather strange considering the prominence of socio-constructivist approaches in gender studies. The conclusion, in which the authors state recommendations for gender-fair psychological research, is all the more refreshing.

  18. [Homöopathisch-phytotherapeutische Behandlung des Reizdarmsyndroms mit Magen-Darm-Entoxin N®: Eine Anwendungsbeobachtung].

    Science.gov (United States)

    Märtens, Diane; Range, Natasha; Günnewich, Nils; Gruber, Nicola; Schmidt, Stefan

    Hintergrund: In dieser Anwendungsbeobachtung wird zum ersten Mal die Behandlung des Reizdarmsyndroms (RDS) mit einem homöopathisch-phytotherapeutischen Komplexpräparat beschrieben. Methodik: Ziel der 6-wöchigen Therapie mit dem Magen-Darm-Entoxin N® war die Reduzierung der RDS-Symptomatik sowie die Verbesserung der Lebensqualität. Zielkriterien waren die Veränderungen in der Irritable Bowel Syndrome - Severity Scoring System (IBS-SSS) und der Irritable Bowel Syndrome - Quality-of-Life Scale (IBS-QoL). Die Patient/innen (N = 41; Alter 44,0 ± 15,74 Jahre) wurden zu gleichen Teilen in einer Hausarztpraxis (N = 20) und einer Heilpraktikerpraxis (N = 21) rekrutiert. Ergebnisse: Der IBS-QoL-Score verringerte sich signifikant (prä: 35,9 ± 16,3; post: 20,1 ± 13,4; t = 8,504; p mit einer Effektstärke von d = 1,24. Die Neben- und Wechselwirkungen waren minimal und signifikante Unterschiede zwischen beiden Praxen wurden nicht gefunden. Schlussfolgerungen: Magen-Darm-Entoxin N® ist eine sichere und sinnvolle Therapieoption bei der Behandlung des RDS. Allerdings sollten randomisierte kontrollierte Studien folgen, um die Spezifizität der Ergebnisse dieser Anwendungsbeobachtung zu stützen. © 2017 S. Karger GmbH, Freiburg.

  19. Silicon carbide, a ceramic material for the pump technology?; Siliciumcarbid - eine Keramik fuer die Pumpentechnologie

    Energy Technology Data Exchange (ETDEWEB)

    Vitzthum, E. [CeramTec AG, Lauf (Germany). Marketing und Customer Service

    2000-12-01

    Pumping of gases and liquids makes extreme demands on sliding bearings and their seals, especially if the material to be pumped is corrosive or contains abrasive constituents. Wear and corrosion are important economic factors. They shorten the life of machines and systems and cause standstill times and repair cost. All this decides the profitability of pumps and the competitive strength of products. In view of all this, it becomes clear why optimal materials selection is a crucial points in pumps and pumping systems. [German] Beim Foerdern von Gasen und Fluessigkeiten werden extrem hohe Anforderungen an Gleitlager und Gleitringdichtungen in Pumpen gestellt, die im direkten Kontakt mit dem zu foerdernden Medium sind, besonders dann, wenn das Medium korrosiv ist oder abrasive Bestandteile enthaelt. Verschleiss und Korrosion sind wesentliche Wirtschaftsfaktoren. Sie bestimmen die Standzeit von Maschinen und Anlagen, verursachen Betriebsstillstandszeiten und Reparaturkosten. Diese entscheiden ueber die Rentabilitaet von Prozessen und die Wettbewerbsfaehigkeit von Produkten, was eine optimale Auswahl des Werkstoffs auch in Pumpen und Pumpenanlagen unerlaesslich macht. (orig.)

  20. Ein Lehr- und Studienbuch der interkulturellen Pädagogik A Textbook of Inter-Cultural Pedagogy

    Directory of Open Access Journals (Sweden)

    Kerstin Schenkel

    2003-07-01

    Full Text Available Renate Nestvogel gibt anhand von Auszügen ausgewählter biographischer Romane und Erzählungen einen Einblick in Aspekte weibliche verschiedener Kulturen und Gesellschaften. Den Texten vorangestellt ist u. a. ein Forschungsüberblick zu Sozialisationskonzepten, zur weiblichen Sozialisation und den Geschlechterverhältnissen sowie zur Kindheit und Jugend. Die Texte werden thematisch nach unterschiedlichen Themen wie Lebensräumen, Kinderarbeit, Phantasie, Geschlechtersozialisation, Körpersozialisation differenziert und jeweils von theoretischen Einführungen begleitet. Die Publikation stellt den Abschlussband der Reihe „Einführung in die pädagogische Frauenforschung“ dar, die als Basis für erziehungswissenschaftliche Lehre dienen soll.Using excerpts from select biographical novels and stories, Renate Nestvogel offers an insight into aspects of female socialisation during youth and adolescence in cultures and societies across the world. The texts are introduced by (among other things a research survey of concepts of socialisation, female socialisation, gender relations, childhood and adolescence. The literary excerpts are grouped by topic and are accompanied by sophisticated theoretical introductions to various aspects of socialisation, such as, living arrangements, child labour, fantasy, socialisation of gender roles, and socialisation of the body. This publication represents the final issue of the series “Introduction to Pedagogical Women’s Studies”, a series intended to serve as a basis for educational studies.

  1. Problembasiertes kollaboratives Lernen mit virtuellen Patienten in der Kinderheilkunde: ein Beispiel aus der Ausbildungspraxis

    Directory of Open Access Journals (Sweden)

    Sostmann, Kai

    2009-02-01

    Full Text Available Der studentische Unterricht in der Kinderheilkunde an der Charité hat seit 1999 mehrere Umstrukturierungen durchlaufen. Mit der Einführung der neuen ärztlichen Approbationsordnung 2004 im Regelstudiengang (RSG und dem Modellcurriculum Reformstudiengang Medizin (RSM 1999 müssen zwei Curricula parallel neu konzipiert und gepflegt werden. Durch den Schwerpunkt Unterricht am Krankenbett (UaK im RSG ergaben sich neue didaktische, pädagogische und infrastrukturelle Anforderungen. Die technische und inhaltliche Weiterentwicklung der Einsatzmöglichkeiten elektronischer Lernszenarien durch e-Learning im Rahmen des BMBF-geförderten Projektes ELWIS-MED, ermöglichte die Erprobung der curricularen Implementierung von e-Learning-Modulen im Pflichtunterricht. Der UaK wurde durch die Bearbeitung kinderheilkundlicher elektronischer Lernfälle online ergänzt. Die Studierenden sollten tutoriell betreute Diskussionen zu fachlichen Aufgabenstellungen online führen. In der ersten Erprobungsstufe wurde der Einsatz der Diskussionsforen in Verbindung mit den Lernfällen von den Studierenden und Lehrenden als sinnvolle Ergänzung betrachtet. In zukünftigen Einsatzszenarien sollte eine Messung des studentischen Lernerfolgs mit dieser Methode erfolgen.

  2. eLEARNING - EINE CHANCE FÜR KLEINE UND MITTLERE UNTERNEHMEN

    Directory of Open Access Journals (Sweden)

    Ileana Hamburg

    2005-12-01

    Full Text Available eLearning wird durch seine Flexibilität und Zugänglichkeit als bedeutendes Instrument für die Implementierung lebenslangen Lernens (LLL angesehen. Es kann für kleine und mittelgroße Unternehmen (KMU einen Katalysator des Wandels sein und bietet damit die Chance zur Verbesserung der wirtschaftlichen Leistungsfähigkeit. Darüber hinaus kann eLearning dazu dienen, die Integration von KMU in den europäischen Markt zu fördern. Bis jetzt wird eLearning im Rahmen der beruflichen Aus- und Weiterbildung jedoch nahezu ausschließlich in Großunternehmen genutzt, während es in KMU allenfalls eine marginale Rolle spielt. Im ersten Kapitel dieses Artikels wird auf den Perspektivenwechsel in der beruflichen Aus- und Weiterbildung eingegangen. Im Anschluss daran werden die zentralen Elemente von eLearning vorgestellt (Kap. 2. Die mit eLearning verbundenen Chancen und Herausforderungen für KMU diskutiert (Kap. 3. Abschließend wird auf Erfahrungen mit eLearning in der Praxis am Beispiel von drei EU-finanzierten Projekten eingegangen. Das Hauptaugenmerk liegt dabei auf dem laufenden Projekt ARIEL -Analysing and Reporting the Implementation of Electronic Learning in Europe -, das vom Institut Arbeit und Technik, Gelsenkirchen, (IAT koordiniert wird.

  3. Schönheit und andere Provokationen - Eine neue evolutionsbiologische Theorie der Kunst

    Science.gov (United States)

    Junker, Thomas

    Die Evolution hat viele spektakuläre Phänomene hervorgebracht - von der Eleganz des Vogelflugs über die gigantischen Körper der Dinosaurier und die farbenprächtige Vielfalt der Korallenriffe bis hin zu ihrem jüngsten Geniestreich - der menschlichen Kunst. Die schönen Künste - Malerei, Bildhauerei und Architektur, Theater, Tanz, Oper und Filmkunst, Musik und Literatur - Produkte der Evolution? Diese Vorstellung mutet vielen Menschen fremd an, aber wie könnte es anders sein? Denn wenn Charles Darwin recht hat, dann sind nicht nur die körperlichen Merkmale der Menschen als Antworten auf die Erfordernisse des Lebens entstanden, sondern auch ihre geistigen Fähigkeiten und Verhaltensweisen. Im Jahr 1859 hatte er auf den letzten Seiten seines berühmten Buches über die Entstehung der Arten eine kühne Prophezeiung gemacht: Durch die Evolutionstheorie werde es "zu einer bemerkenswerten Revolution in der Naturwissenschaft kommen […]. Die Psychologie wird auf die neue Grundlage gestellt, dass jede geistige Kraft und Fähigkeit notwendigerweise durch graduelle Übergänge erworben wird“ (Darwin 1859, S. 484, 488; Junker 2008).

  4. RECHTSEXTREME LINKS LIEGEN LASSEN? EINE EINSCHÄTZUNG VON SZENEAUSSTEIGERN ZU MEDIENEFFEKTEN INNERHALB DER RECHTSEXTREMEN SZENE

    Directory of Open Access Journals (Sweden)

    Katharina Neumann

    2014-12-01

    Full Text Available Die vorliegende Arbeit geht der Frage nach, welche Reaktionen durch unterschiedliche Formen der Berichterstattung über Rechtsextremismus bei den Anhängern der rechten Szene ausgelöst werden und welche Strategien diese verfolgen, um ihre mediale Selbstinszenierung zu optimieren. Das Ziel der Arbeit ist es, Ansätze für einen verantwortungsbewussten Umgang mit Themen rechtsextremen Schwerpunkts für Medienmacher zu finden. Es werden 7 Aussteiger zu ihren Erfahrungen mit Medien in der Szene befragt. Zu den wichtigsten Ergebnissen dieser Arbeit zählt die Erkenntnis, dass die rechtsextreme Führungsriege aktiv Berichterstattung in den Massenmedien rezipiert und systematisch auswertet, um auf dieser Basis ihre politischen Selbstinszenierungsstrategien zu entwickeln. Die Szene reagiert also taktisch auf Berichte in den Massenmedien und versucht diese durch Anschlusskommunikation für ihre Zwecke zu instrumentalisieren. Wichtig für die Berichterstattung über Rechtsextremismus erscheint den Probanden die Betonung der Pluralität der Szene und eine ausführliche Hintergrundberichterstattung, die im besten Falle identitätsstiftende Attribute rechtsextremer Gruppen dekonstruiert und somit deren Glaubwürdigkeit in Frage stellt.

  5. Nahal Ein Gev II, a Late Natufian Community at the Sea of Galilee.

    Directory of Open Access Journals (Sweden)

    Leore Grosman

    Full Text Available The Natufian culture is of great importance as a starting point to investigate the dynamics of the transition to agriculture. Given its chronological position at the threshold of the Neolithic (ca. 12,000 years ago and its geographic setting in the productive Jordan Valley, the site of Nahal Ein Gev II (NEG II reveals aspects of the Late Natufian adaptations and its implications for the transition to agriculture. The size of the site, the thick archaeological deposits, invested architecture and multiple occupation sub-phases reveal a large, sedentary community at least on par with Early Natufian camps in the Mediterranean zone. Although the NEG II lithic tool kit completely lacks attributes typical of succeeding Pre Pottery Neolithic A (PPNA assemblages, the artistic style is more closely related to the early PPNA world, despite clear roots in Early Natufian tradition. The site does not conform to current perceptions of the Late Natufians as a largely mobile population coping with reduced resource productivity caused by the Younger Dryas. Instead, the faunal and architectural data suggest that the sedentary populations of the Early Natufian did not revert back to a nomadic way of life in the Late Natufian in the Jordan Valley. NEG II encapsulates cultural characteristics typical of both Natufian and PPNA traditions and thus bridges the crossroads between Late Paleolithic foragers and Neolithic farmers.

  6. Handlungsmuster von Lehrerinnen und Lehrern beim Einsatz neuer Medien. Grundlagen eines Projekts zur empirischen Unterrichtsforschung

    Directory of Open Access Journals (Sweden)

    Sigrid Blömeke

    2017-08-01

    Full Text Available Ziel des vorzustellenden Projekts ist es in einem ersten Schritt, Handlungsmuster von Lehrpersonen beim Einsatz von neuen Medien im Unterricht der Fächer Deutsch, Mathematik und Informatik der Sekundarstufe II zu identifizieren. Zu diesem Zweck werden Videoaufnahmen von 30 Unterrichtsstunden im Hinblick auf zugrunde liegende ‚Unterrichtsscripts’ (i.e. didaktische Routinen analysiert und die subjektiven Theorien der Lehrkräfte zum Lehren und Lernen erhoben. Bei der Zusammensetzung der Stichprobe findet neben der Variation der Fachzugehörigkeit der Expertisegrad der Lehrpersonen bezogen auf den Einsatz neuer Medien Berücksichtigung, und zwar in zwei Abstufungen (hoch – niedrig. Auf diese Weise wird ermöglicht, in einem zweiten Schritt begründet Hypothesen zu Zusammenhängen zwischen Handlungsmustern sowie Fach und Expertise als Kontextfaktoren zu generieren und mögliche Geltungsbereiche zu beschreiben. Über diese Grundlagenforschung hinausgehend sollen in einem dritten Schritt anhand der gewonnenen Erkenntnisse Interventionen entwickelt werden, die eine Weiterentwicklung von Lehrerhandeln beim Einsatz neuer Medien im Unterricht ermöglichen. Hier stellt sich allerdings die Frage, wie sich Handeln grundsätzlich verändern lässt.

  7. Neue Medien unter der Organisationsperspektive. Eine empirische Untersuchung in der Weiterbildung

    Directory of Open Access Journals (Sweden)

    Richard Stang

    2017-08-01

    Full Text Available Gesellschaftliche Modernisierungsprozesse haben zu immensen Veränderungsprozessen auf allen Ebenen gesellschaftlichen Lebens geführt. Wirtschaft, Politik, Bildungswesen etc. sind als Gesamtsysteme davon betroffen, genauso wie die Institutionen und Organisationen, die in deren Rahmen agieren. Stehr (2000, S. 17 spricht davon, dass wir uns in einem „Übergangsstadium zwischen zwei Gesellschaftsformationen“ befinden und meint damit den Übergang von der „Industriegesellschaft“ zur „Wissensgesellschaft“, in der Wissen konstitutiv für die Gesellschaftsformation ist. Mit dem Bedeutungszuwachs der Ressource „Wissen“ gehen Prozesse der voranschreitenden gesellschaftlichen Ausdifferenzierung einher. So unterschiedlich die sozialwissenschaftlichen Analysen der Gesellschaftsformation und die daraus gefolgerten theoretischen Konstrukte auch sein mögen (vgl. u.a. Beck 1986, Castells 2001, Gross 1994, Schulze 1993, wird doch in einem besonderen Maße die Entwicklung von Technik, besonders der Informations- und Kommunikationstechniken (im Folgenden: Neuen Medien, als ein wichtiger Motor der gesellschaftlichen Veränderungsprozesse gesehen. Besonders Castells (2001 hat die gesellschaftliche, kulturelle und ökonomische Bedeutung der Neuen Medien in seiner Studie über die Netzwerkgesellschaft eindrucksvoll herausgearbeitet.

  8. Verbesserte Ausbildung für neue Betriebsleiter und -ingenieure - eine wichtige Investition in die Zukunft

    Science.gov (United States)

    Franta, Oliver

    Bedingt durch die Globalisierung und die damit einhergehende Verschärfung des Wettbewerbs befinden sich die Produktionsbetriebe der chemischen Industrie in stetigem Wandel. Für Betriebsleiter und Betriebsingenieure werden damit Fähigkeiten wie Kostenmanagement, Sozial- und Organisationskompetenz, Führungsqualifikationen und unternehmerisches Handeln immer wichtiger. Neben den Anforderungsprofilen bei Neueinstellungen ist dies auch bei der Fortbildung zu berücksichtigen. Das Trainingsprogramm der Evonik Degussa wurde daher durch die Konzeption neuer Seminare und die Anpassung bestehender Weiterbildungsmaßnahmen weiterentwickelt. Neben Vorträgen und Fallbeispielen sind ebenfalls die Durchführung von Planspielen sowie das Kennenlernen eines Produktionsbetriebes einer anderen Organisationseinheit enthalten. Ziel ist es vor allem die unternehmerische Orientierung neuer Betriebsleiter und -ingenieure zu fördern, die Innovationsgeschwindigkeit zu erhöhen und durch Kenntnis und Nutzung bereits anderweitig entwickelter Lösungen und Methoden die Produktivität zu steigern. Die Produktionsmeister werden aufgrund der Bedeutung dieser Funktion für die Führung der Mitarbeiter und bei der Umsetzung von Veränderungsprojekten in das Ausbildungsprogramm einbezogen. Der Erfolg des Trainingsprogramms zeigt sich an den Teilnehmerzahlen und den ausgesprochen positiven Rückmeldungen.

  9. Publikationsservices im Dienstleistungsportfolio von Hochschulbibliotheken. Eine (Neu-Verortung in der wissenschaftlichen Publikationskette

    Directory of Open Access Journals (Sweden)

    Ralf Depping

    2014-12-01

    Full Text Available Nahezu alle Hochschulbibliotheken haben inzwischen ihre klassische Grundaufgabe der Informations- und Literaturversorgung um Dienstleistungen rund um die Publikationstätigkeit der eigenen Hochschule erweitert. Hochschulschriftenserver sind seit langem Standard, andere Dienstleistungen wie Hochschulbibliographien, Universitätsverlage, Forschungsdatenmanagement und Bibliometrie sind hingegen noch nicht sehr verbreitet. Auffallend ist jedoch, dass die meisten Hochschulbibliotheken ihre Publikationsdienstleistungen weder als wichtiges Standbein im Dienstleistungsportfolio offensiv vermarkten noch als zusammengehöriges Dienstleistungspaket verstehen, in dem einzelne Bausteine aufeinander aufbauen können. Eine strategische (Neu-Verortung könnte wesentlich dazu beitragen, dass die Wissenschaftlerinnen und Wissenschaftler die Hochschulbibliothek (wieder als wichtige Dienstleistungseinrichtung wahrnehmen. Almost all university libraries have by now expanded their conventional field of activity – provision with literature and information – and provide a number of services in the context of the university's publication processes. Institutional repositories have become standard while other services such as university bibliographies, university presses, research data management and bibliometrics are less widespread. Nevertheless, it is remarkable that most university libraries neither actively market their publication services nor consider them an important portfolio in its own right, with complementary modules. A new strategic orientation could help to make scholars recognize the university libraries as important service providers (again.

  10. Ein Entscheidungsmodell zur Weitergabe persönlicher Daten im Internet

    Science.gov (United States)

    Treiblmaier, Horst

    In den vergangenen zwei Jahrzehnten wandelte sich das Internet von einer Spielwiese für technikbegeisterte Computerspezialisten zu einem vielseitig einsetzbaren weltweiten Netzwerk für Privatpersonen und Unternehmen. Maßgeblichen Anteil daran besaß die rasante Entwicklung des World Wide Web (WWW), das, durch die Möglichkeit multimediale Inhalte zu vermitteln, für einen großen Teil der Bevölkerung industrialisierter Länder zu einem wesentlichen Bestandteil des täglichen Lebens wurde. Dass diese Entwicklung noch lange nicht abgeschlossen ist, zeigt die derzeitige Diskussion zum Thema Web 2.0 bzw. 3.0. Waren es in den letzten Jahren die hohen Umsatzzuwächse im E-Commerce und multimedial gestaltete Webseiten in Kombination mit aufwändigen Applikationen, die für ständig steigende Nutzerzahlen im World Wide Web sorgten, so wird dieser Innovationsschub nunmehr durch eine Vielzahl von Anwendungen fortgesetzt, die sich durch die zunehmende Vernetzung der Nutzer untereinander auszeichnen.

  11. IK-Veranstaltungen neu gestalten: Aufbau eines IK-Konzeptes an einer neu gegründeten Hochschule – Chancen, Möglichkeiten und Grenzen

    Directory of Open Access Journals (Sweden)

    Guido Kippelt

    2017-10-01

    Full Text Available Veranstaltungen zur Informationskompetenz sind ein fester Bestandteil an wissenschaftlichen Bibliotheken und spielen eine wichtige Rolle für eine erfolgreiche Hochschulausbildung. Durch die Neugründung der staatlichen Hochschule Hamm-Lippstadt konnten in den dortigen Bibliotheken Informationskompetenz-Veranstaltungen grundlegend neu konzipiert und umgesetzt werden. Bei der Neugestaltung mussten unterschiedliche Kriterien zu Inhalten, Formaten, Zielgruppen etc. berücksichtigt werden. Hierbei spielten auch Überlegungen eine Rolle, wie Informationskompetenz an der HSHL definiert werden soll. Im vorliegenden Artikel werden die zu berücksichtigenden Kriterien für die Umsetzung von Informationskompetenz-Veranstaltungen an der HSHL erläutert. Des Weiteren wird ein Ausblick gewagt, wie diese Veranstaltungen weiter ausgebaut werden können. Lectures on information literacy are an important part of the work of a scientific library and are crucial for a successful university education. The founding of the state University of Applied Sciences Hamm-Lippstadt created the opportunity to develop a completely new series of information literacy lectures. During the creation of this lecture series, different criteria such as content, format, target groups and others had to be considered. It was also a part of this process to specify how the term information literacy should be defined for the University of Applied Sciences Hamm Lippstadt. This article discusses the criteria applied to the implementation and also gives an outlook on possible further developments.

  12. Measures for a sustainable energy supply in the domain of mobility. Progress report; Massnahmen fuer eine nachhaltige Energieversorgung im Bereich Mobilitaet. Sachstandsbericht

    Energy Technology Data Exchange (ETDEWEB)

    Gruenwald, R.; Oertel, D.; Paschen, H.

    2002-06-01

    An efficient influence on traffic can generally not be achieved by an individual instrument or by few instruments. Numerous coordinated measures from all domains of traffic policy (Investment policy, price policy, order policy, organisational measures, public affairs work) are required instead. Thus it can be guaranteed that counter-productive effects do not impede reaching the desired targets. The effects of individual measures must supplement and strengthen each other. These synergy effects allow keeping the intensity of individual measures, such as the price policy at a low level and limiting adaptation shocks. A tendency scenario and sustainability scenario until 2020 are defined for a quantitative analysis of the effects of such measure bundle. The period from 2020 until 2050 is merely considered in terms of quality. (orig.) [German] Eine wirksame Verkehrsbeeinflussung kann grundsaetzlich nicht durch ein einzelnes Instrument oder durch wenige Instrumente erreicht werden. Vielmehr ist hierfuer ein abgestimmtes Buendel von Massnahmen aus allen verkehrspolitischen Bereichen (Investitionspolitik, Preispolitik, Ordnungspolitik, organisatorische Massnahmen, Oeffentlichkeitsarbeit) notwendig. Dadurch wird gewaehrleistet, dass die Erreichung der angestrebten Ziele nicht durch gegenlaeufige Wirkungen behindert wird. Die Wirkungen einzelner Massnahmen muessen sich ergaenzen und gegenseitig verstaerken. Solche Synergieeffekte wiederum gestatten es, die Intensitaet von einzelnen Massnahmen, z.B. der Preispolitik, vergleichsweise gering zu halten und damit Anpassungsschocks zu begrenzen. Zur quantitativen Analyse der Wirkungen solcher Massnahmenbuendel werden ein Trendszenario und ein Nachhaltigkeitsszenario bis 2020 definiert. Fuer den Zeitraum 2020 bis 2050 werden lediglich qualitative Ueberlegungen angestellt. (orig.)

  13. Research of the fluid flow in a radially orientated coolant channel of a turbine blade; Untersuchung der Stroemung in einem radial gerichteten Kuehlkanal eines Turbinenlaufrades

    Energy Technology Data Exchange (ETDEWEB)

    Hein, O.

    1999-07-01

    Due to rotation (Coriolis forces) in a coolant channel a secondary flow is superimposed to the basic flow. This leads to a change in the local heat transfer over the surface of the coolant channel as well as a change in the overall value of the heat transfer. Also the pressure loss over the channel length will change by rotation. By means of computational fluid dynamics (Finite Element Method) it was achieved to figure out the interaction between changing fluid flow and heat transfer. To validate the results obtained by a numerical flow simulation, a new measurement technique was developed. A laser-two-focus velocimeter has been combined with a rotation prism which allows continued measurements in a rotating scaled up channel. (orig.) [German] Bedingt durch die Rotationsbewegung eines Kuehlkanals wird die Grundstroemung von einem Sekundaerwirbel ueberlagert (Corioliskraefte). Durch diese Einfluesse aendert sich sowohl der lokale Waermeuebergang ueber der Kanaloberflaeche als auch die globalen Waermeuebertragungsraten ueber dem gesamten Kanal. Ebenfalls aendert sich durch die Rotation der Druckverlust ueber der Kanallaenge. Durch eine numerische Stroemungssimulation (Finite-Element-Methode) war es moeglich, einen detaillierten Zusammenhang zwischen dem veraenderten Stroemungsverhalten und dem Waermeuebertragungsverhalten darzustellen. Um die numerisch gewonnenen Ergebnisse experimentell abzusichern, wurde eine neuartige Messtechnik entwickelt. Ein Laser-2-Fokus-Velozimeter wurde mit einem Bilddrehprisma kombiniert, und dies erlaubte eine kontinuierliche Messung in einem rotierenden vergroesserten Modellkanal. (orig.)

  14. Improved patient repositioning accuracy by integrating an additional jaw fixation into a high precision face mask system in stereotactic radiotherapy of the head; Verbesserte lagerungsreproduzierbarkeit eines nichtinvasiven hochpraezisionsmaskensystems in der stereotaktischen Radiotherapie durch eine integrierte kieferfixierung

    Energy Technology Data Exchange (ETDEWEB)

    Lopatta, E.; Liesenfeld, S.M.; Bank, P.; Guenther, R.; Wiezorek, T.; Wendt, T.G. [Klinik fuer Radiologie, Abt. fuer Strahlentherapie, Friedrich-Schiller-Univ. Jena (Germany); Wurm, R. [Campus Charite Mitte, Klinik fuer Strahlentherapie, Berlin (Germany)

    2003-08-01

    Background: For high precision radiotherapy of the neurocranium a precise, reproducible positioning technique is the basic pre-requisite. The aim of this study was to assess the influence of a modification of the commercially available stereotactical BrainLab {sup trademark} -head mask system on accuracy in patient positioning during fractionated radiotherapy. Material and Methods: 29 patients were treated with stereotactic radiotherapy of the head. Immobilization was provided by a two layer thermoplastic mask system (BrainLab trademark). 18 of these patients received an additional custom made fixation either of the upper jaw (OKF) or of the mandibula (UKF). The positioning accuracy was assessed by measurements of the shifting of anatomical landmarks in relation to therigid mask system on biplanar simulator films using a digital imaging system. Before each measurement a fine adjustment of the simulator to an optical ring system was performed. The reference radiographs were done just before CT-planning. During a 2-7 weeks lasting course of radiotherapy displacement measurements in relation to the reference images for all three dimensions (z, y and x) were done once a week. In 29 patients 844 measurements were analyzed. Results: An additional jaw fixation improves the reproducibility of patient positioning significantly in all three spatial dimensions. The standard deviation in lateral direction (x) was 0.6 mm with jaw fixation vs. 0.7 mm without jaw fixation (p < 0.001); in longitudinal direction (z) (measured in 0 radiographs) 0.5 mm vs. 1.3 mm (p < 0.001); in longitudinal direction measured in 90 (orig.) [German] Hintergrund: Eine Grundvoraussetzung fuer die Praezisionsbestrahlung im Bereich des Neurokraniums ist eine genaue, reproduzierbare Lagerungstechnik. Die vorliegende Arbeit untersucht den Einfluss einer Modifikation am kommerziell erhaeltlichen stereotaktischen BrainLab trademark -Kopfmaskensystem auf die Lagerungsgenauigkeit waehrend einer fraktionierten

  15. Dual vehicle - Development, construction and testing of a dual vehicle for passenger transport on roads and railways. Final report; Zweiwegefahrzeug - Entwicklung, Bau und Erprobung eines Zweiwegefahrzeuges zur Personenbefoerderung Strasse/Schiene. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    This feasibility study investigated a prototype dual vehicle for railways and roads. Technical problems, acceptance specifications, legal and economic aspects were gone into. [German] Zielstellung fuer das Vorhaben war die Untersuchung ausgewaehlter technischer Fragestellungen hinsichtlich der Machbarkeit der Entwicklung und Erprobung eines Prototypes fuer ein Zweiwegefahrzeug fuer den Personenverkehr, das fuer den Einsatz auf der Schiene und der Strasse vorgesehen und dafuer entsprechend technisch ausgestattet ist. Damit erbringt das Vorhaben technisch-konstruktive Loesungsansaetze fuer ein vollstaendig neues Fahrzeuggrundkonzept und traegt hinsichtlich eines solchen zukuenftigen Fahrzeugtyps - zur Klaerung technischer Fragen (statische Zusammenbauuntersuchungen, geometrische und massliche Bedingungen sowie Konzipierung, Leistungsanforderungen der Komponenten, Konzept fuer Ein- und Ausspuren sowie fuer Ein- und Ausstieg), - zur Pruefung der technischen Zulassungsfaehigkeit des Fahrzeuges, - zur Klaerung von Rechtsfragen fuer die Sicherung des Betriebes des Fahrzeuges - sowie zum Nachweis des wirtschaftlicheren Betriebes des Fahrzeuges bei. Das Vorhaben unterbreitet unter Beruecksichtigung sicherheitstechnischer, gesetzlicher und wirtschaftlicher Rahmenbedingungen Loesungsvorschlaege fuer die konstruktive Konzipierung des Fahrgestells und ein technisches Konzept fuer das Ein- und Ausspuren fuer einen neuen Fahrzeugtyp, der sowohl fuer die Strassenbenutzung als auch fuer den Schienenverkehr zugelassen ist. (orig.)

  16. Molecular Regulation of Photosynthetic Carbon Dioxide Fixation in Nonsulfur Purple Bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Tabita, Fred Robert [The Ohio State Univ., Columbus, OH (United States)

    2015-12-01

    The overall objective of this project is to determine the mechanism by which a transcriptional activator protein affects CO2 fixation (cbb) gene expression in nonsulfur purple photosynthetic bacteria, with special emphasis to Rhodobacter sphaeroides and with comparison to Rhodopseudomonas palustris. These studies culminated in several publications which indicated that additional regulators interact with the master regulator CbbR in both R. sphaeroides and R. palustris. In addition, the interactive control of the carbon and nitrogen assimilatory pathways was studied and unique regulatory signals were discovered.

  17. Dose management in radiology. Review of the technological status; Dosismanagement in der Radiologie. Ein Ueberblick zum Stand der Technik

    Energy Technology Data Exchange (ETDEWEB)

    Verius, M. [LKH Innsbruck, Universitaetsklinik fuer Radiologie, Innsbruck (Austria)

    2015-08-15

    The Euratom directive 2013/59 (''EU directive for radiation protection'') has to be implemented into national law by spring 2018 and requires a complete recording of patient dosages and relevant parameters. Additionally, a medical physics expert has to be consulted for each radiological examination above a defined threshold. A complete recording of the dosage administered from all modalities and optimization of the radiological procedures should result in a reduction of the total dosage. This can be achieved by automated systems that incorporate not only the detection of the dose parameters but also the evaluation and analysis of these data. When provided with warning levels such a system should be able to inform or warn the operator when dose thresholds have been exceeded or even better inform the operator about possible excess dosages before an examination. Depending on the information provided by the modality, dose management systems can operate at different levels in the picture archiving and communication system (PACS), radiological and hospital information systems (RIS/HIS) or with the header information of a digital imaging and communications in medicine (DICOM) image and evaluate and analyze this data. A practicable use of such systems is only possible by close cooperation of medical personnel, medical physicists and information technology (IT) administrators. Various systems are available commercially or free but an individual adaptation of these systems is useful and necessary, depending on the requirements of the radiology practice or hospital. (orig.) [German] Die Euratom-Richtlinie 2013/59 (''EU-Richtlinie zum Strahlenschutz'') besagt, dass sie bis zum Fruehjahr 2018 in nationales Recht der Mitgliedstaaten umgesetzt werden muss, d. h. eine lueckenlose Erfassung der Patientendosen zu erfolgen hat. Ausserdem muss zu jeder Modalitaet in einem bestimmten Ausmass ein Medizinphysikexperte hinzugezogen werden. Die

  18. Der Briefwechsel zwischen Karl Kreil und Alexander von Humboldt, ein wichtiger Beitrag zur Geschichte des Erdmagnetismus

    Directory of Open Access Journals (Sweden)

    Karin Reich

    2016-11-01

    Full Text Available Abstract The correspondence between Alexander von Humboldt und Karl Kreil was voluminous, it concerned earth magnetism. But only one letter has survived. This letter was written by Kreil on September 3, 1836; one day later Kreil wrote a letter to Carl Friedrich Gauss with nearly the same contents, some sentences are even literally corresponding. Four letters from Kreil to Humboldt were published in the „Annalen der Physik und Chemie“. Some letters were mentioned in the biographical literature dealing with Kreil. These letters show, that the correspondence covered at least the period until 1851 and give information about the intensive relationship between the two scientists. A further interesting source is the library of Humboldt which unfortunately has not survived. The catalogue mentions nine works of Kreil some of them where annotated by Humboldt. This makes it plausible that the contacts even lasted until 1856. Zusammenfassung Die Korrespondenz zwischen Alexander von Humboldt und Karl Kreil war umfangreich und betraf den Erdmagnetismus. Aber heute ist nur noch ein einziger Brief im Original bekannt. Dieser Brief, den Kreil am 3. September 1836 Alexander von Humboldt zukommen ließ, stimmt inhaltlich und teilweise wortwörtlich mit dem Brief überein, den Kreil nur einen Tag später, am 4. September 1836, an Carl Friedrich Gauß schickte. Vier Briefe von Kreil an Humboldt wurden in den „Annalen der Physik und Chemie“ publiziert, eine nicht allzu große Anzahl weiterer Briefe an Humboldt wurde in der biographischen Literatur über Kreil und in Briefen Kreils an Koller und Gauß erwähnt. Aber nicht nur die lückenhafte und bruchstückhaft bekannte Korrespondenz zwischen Humboldt und Kreil, die bis 1851 reicht, gibt Aufschluss über die Beziehungen, sondern von besonderer Bedeutung ist des Weiteren der Bestand an Kreiliana in der Bibliothek Humboldts. Es handelt sich um neun Werke Kreils, das letzte aus dem Jahr 1856. Nachweisbare

  19. Significance of mercury in environmental health - an overview; Bedeutung von Quecksilber in der Umweltmedizin - eine Uebersicht

    Energy Technology Data Exchange (ETDEWEB)

    Schweinsberg, F. [Chemisches Labor, Institut fuer Allgemeine Hygiene und Umwelthygiene, Tuebingen (Germany)

    2002-07-01

    werden tubulaere Nekrosen gesehen. Bei Patienten mit schwerer Nierenfunktionsstoerung sollte auf Amalgamfuellungen verzichtet werden. Durch Amalgamfuellungen koennen in seltenen Faellen allergische Reaktionen (Spaettyp-IV) und intraorale lichenoide Reaktionen (oraler Lichen ruber planus) ausgeloest werden. Der Nachweis subklinischer Effekte durch Amalgamfuellungen und deren gesundheitliche Bedeutung sind noch immer Gegenstand kontroverser Diskussionen. Die Zuordnung unspezifischer Symptome zu einer Quecksilberbelastung aus Amalgamfuellungen ist wissenschaftlich nicht fundiert moeglich. Eine chronische Erkrankung des Nervensystems durch organisches Quecksilber fuehrt zu Paraesthesie, Ataxie, Dysarthrie, Einschraenkung des Sehfeldes und zu Hoerverlusten. Die Belastung mit Quecksilber waehrend der Schwangerschaft, speziell aus Fischkonsum, ist besonders kritisch zu bewerten. Die gesundheitliche Bewertung von Quecksilberbelastungen erfolgt durch Ableitung von Human-Biomonitoring-Werten (HBM): Bei langzeitiger Exposition mit anorganischem Quecksilber ist ab dem HBM-II-Wert fuer Quecksilber im Urin von 25 {mu}g/l eine gesundheitliche Beeintraechtigung moeglich. Der entsprechende HBM-II-Wert fuer organisches Quecksilber im Blut liegt bei 15{mu}g/l, das entspricht einem Quecksilbergehalt in den Haaren von ca. 5 mg/kg. (orig.)

  20. Regelwerke im multilingualen Kontext – ein Erfahrungsbericht aus einem multilingualen Verbund

    Directory of Open Access Journals (Sweden)

    Jürgen Küssow

    2017-10-01

    Full Text Available Der Bibliotheksverbund NEBIS (Netzwerk von Bibliotheken und Informationsstellen in der Schweiz ist der grösste Verbund wissenschaftlicher Bibliotheken der Schweiz. Ihm gehören rund 140 Bibliotheken an 154 Standorten aus allen Landesteilen der Schweiz an. Im NEBIS arbeiten Bibliotheken sowohl aus der Deutschschweiz als auch aus den Französisch und Italienisch sprechenden Landesteilen. Der Anteil der nicht-deutschsprachigen Bibliotheken beträgt im NEBIS über 15 Prozent. Auf den Jahresbeginn 2016 hat der NEBIS-Verbund das bisher verwendete Regelwerk KIDS (Katalogisierungsregeln des IDS durch das internationale Regelwerk RDA sowie die hauseigene Normdatenbank durch die deutschorientierte Normdatenbank GND abgelöst. Der Zustand der französischsprachigen Übersetzung der RDA sowie die Übersetzung der Anwendungsregeln des D-A-CH Raumes waren eine der grössten Herausforderungen bei der Einführung im Verbund. In einer mehrsprachigen Umgebung mit einer monolingualen Datenbank wie der GND zu arbeiten, bedeutete besonders für die französischsprachigen Bibliotheken viel Umstellung und Flexibilität. Die Arbeit mit deutschen Begriffen wie zum Beispiel die Berufsbegriffe in der GND erfordert sowohl von der NEBIS-Verbundzentrale wie auch von den französischsprachigen Bibliotheken einen ausserordentlichen Effort. Der NEBIS-Verbund wird auch künftig darauf angewiesen sein, dass die französische Übersetzung der RDA sowie die Übersetzung der Anwendungsregeln möglichst aktuell bleibt. Zudem wird auch im Bereich GND weiterhin eine flexible und geduldige Arbeitsweise aller Beteiligten erforderlich sein. The network of libraries NEBIS (Netzwerk von Bibliotheken und Informationsstellen in der Schweiz is the biggest network of scientific libraries in Switzerland. It comprises ca. 140 libraries with 154 locations in all over Switzerland. Libraries from the German, French and Italian speaking parts of the country are working together in NEBIS. More than

  1. ABC crescent. Energy concept with active storage system for a Hamburg office building; ABC - Bogen. Energiekonzept mit Aktivspeichersystem fuer ein Buerohaus in Hamburg

    Energy Technology Data Exchange (ETDEWEB)

    Stoll, J. [HL-Technik AG, Muenchen (Germany). Bereich Future Building Designs, Thermische Bauphysik-Bauklimatik

    1999-07-01

    This new multifunctional building will house a shopping mall and offices. Natural ventilation is favoured as far as possible. Technical facilities were minimised in order to save resources and reduce the operating cost. The architectural design was to be as functional as possible. [German] Mit dem ABC-Bogen in Hamburg entsteht in unmittelbarer Naehe zum Gaensemarkt ein multifunktionales Gebaeude mit Passagen, Laeden und Bueros - ein neuer Akzent in der Hamburger Innenstadt. Das grosszuegig verglaste Gebaeude sollte nach den Zielen der Hamburger Architekten BRT - Bothe, Richter, Teherani und der Projektentwicklung (SF-Bau Projektentwicklung GmbH, NL Hamburg) soweit wie moeglich natuerlich gelueftet werden. Die gebaeudetechnische Ausruestung der Bueros war zur Ressourcenschonung und Begrenzung der Betriebskosten auf ein Mindestmass zu beschraenken. Bei der Fassadengestaltung sollten funktionelle Aspekte absoluten Vorrang haben. (orig.)

  2. Mathematical modelling of the gasification of cellulose-containing biomass using a zoning model; Mathematische Modellierung der Vergasung zellulosehaltiger Biomasse mit Hilfe eines Zonenmodells

    Energy Technology Data Exchange (ETDEWEB)

    Jung, K; Saller, G; Funk, G; Krumm, W [Siegen Univ. (Gesamthochschule) (Germany). Inst. fuer Energietechnik

    1998-09-01

    The composition of the product gas is decisive for the further process stages. In contrast to coal gasification, which has been investigated for more than a century, there is still a lack of theoretical and experimental knowledge on biomass gasification. The contribution presents a mathematical model that is to provide deeper knowledge of the constant-flow fixed-bed gasifier, which is still widely regarded as a `black box`. (orig./SR) [Deutsch] Einen wesentlichen Prozessschritt der thermochemischen Konversion stellt der Vergasungsprozess dar, da die Zusammensetzung des erhaltenen Gases fuer die weiteren Prozessschritte von entscheidender Bedeutung ist. Im Gegensatz zur Vergasung von Kohle, die bereits seit fast 100 Jahren untersucht wird, besteht bei der Vergasung von Biomasse ein starker Nachholbedarf in Bezug auf das theoretische und experimentelle Detailwissen. In diesem Beitrag wird im Rahmen eines mathematischen Modells ein Ansatz vorgestellt, in dem der Gleichstrom-Festbettvergaser, der bisher meist als `blackbox` betrachtet wurde, weiter aufgeschluesselt wird. (orig./SR)

  3. Förderung von Werbekompetenz bei Kindern: Eine Bestandsaufnahme medienpädagogischer Materialien

    Directory of Open Access Journals (Sweden)

    Dorothee Meister

    2011-12-01

    Full Text Available Der vorliegende Beitrag knüpft an die aktuelle Debatte an, dass im Zuge medientechnischer Innovationen sowie der veränderten Mediennutzung von Kindern das Thema Werbung und damit einhergehend die Frage nach zeitgemäßen Fördermaßnahmen von Werbekompetenz stärker an Bedeutung gewinnen. Die Bestandsaufnahme von insgesamt 19 Projekten zeigt, dass die bestehenden Konzepte zur Förderung der Werbekompetenz von Kindern optimiert werden sollten. Insbesondere hinsichtlich der Berücksichtigung neuer Werbeformen wie Online-, Computerspiel- oder Handywerbung gibt es Handlungsbedarf, die Werbekompetenz von Kindern durch medienpädagogische Projekte zu schulen. Dabei scheint eine Kombination aus (1 Präsenzveranstaltungen, (2 medienpädagogischen Materialkoffern, mit denen in pädagogischen Einrichtungen gearbeitet werden kann, und (3 interaktiven Onlineangeboten zielführend. This article follows the discussion that triggered by media innovations and the changed media usage of children, promoting concepts of the competence in advertising gets more important within that group. Research was conducted on 19 different projects in Germany regarding the subject. The findings indicate that the existing concepts of promoting children’s advertising competence need to be optimized. Especially new advertising formats like online, digital game or mobile advertisements have to be taken into account in contemporary media educational concepts. A combination of (1 face-to-face courses, (2 suitcases with media educational material, which can be used in educational institutions and (3 corresponding interactive online websites seem to be an efficient way to enable children to judge new advertisements proficiently.

  4. Development of a portable test densimeter for natural gas meters; Entwicklung eines transportablen Dichtepruefgeraetes fuer Erdgasmessstationen

    Energy Technology Data Exchange (ETDEWEB)

    Bellado, B.G.; Kleinrahm, R.; Loesch, H.W.; Wagner, W. [Bochum Univ. (Germany); Brandt, O.; Boden, R. [Ruhrgas AG, Essen (Germany)

    2001-04-01

    For the accurate measurement of gas density in natural gas meter runs, a special test densimeter has been developed. It covers a temperature range from 0 C to 50 C at pressures up to 100 bar; its total uncertainty is {<=}{+-}0.05% for densities {>=}20 kg/m{sup 3}. The new densimeter has been specially designed as a portable device for in situ checking of commercial gas density transducers (with vibrating thin-walled metal cylinders or vibrating forks as density sensors) installed in natural gas meter runs with density converters or differential-producing meters. Also, it can be used in natural gas meter runs with PTZ converters to check the density calculated by the converter or to check verification measurements. This paper describes the measurement principle and the design of the densimeter and presents the results of field measurements performed. (orig.) [German] Zur genauen Messung der Dichte von Erdgasen unter Betriebsbedingungen wurde ein spezielles Dichtepruefgeraet entwickelt. Der Einsatz des Geraetes ist bei Gastemperaturen von 0 C bis 50 C und bei Druecken bis 100 bar moeglich; die Gesamtmessunsicherheit betraegt {<=}{+-}0,05% fuer Dichten {>=}20 kg/m{sup 3}. Das neue Dichtepruefgeraet ist gezielt als transportables Geraet zur Online-Pruefung von kommerziellen Betriebsdichteaufnehmern (mit Schwingzylindern oder Schwinggabeln als Dichtesensor) in Erdgasmessstationen mit Dichte-Mengenumwertern oder Wirkdruckgaszaehlern entwickelt worden. Es kann ebenfalls in Messstationen mit Zustands-Mengenumwertern zur Kontrolle der vom Umwerter errechneten Betriebsdichte oder zur Kontrolle von Revisions-Messungen eingesetzt werden. Im folgenden Artikel werden das Messprinzip, der Aufbau des Geraetes und der Einsatz vor Ort beschrieben. (orig.)

  5. Just charge it. Electromobility for the future; Einfach aufladen. Mit Elektromobilitaet in eine neue Zukunft

    Energy Technology Data Exchange (ETDEWEB)

    Canzler, Weert; Knie, Andreas

    2011-07-01

    By 2020, more than one million electric-powered vehicles are envisaged on German roads. But when will they be commercially available? How much power do they really consume? Will there be batteries with sufficient capacity? And wouldn't it be more sensible to make conventional cars more efficient? These and other questions about electric-powered cars and electromobility are answered by the authors, competently and in a manner that also addresses the non-expert public. It is shown that electric-powered cars will be operated in fleets, serving not only as vehicles but also as buffers for renewables-derived power, which is known to be volatile. Controlled charging will offer a solution. Professionally managed fleets of electric-powered vehicles can store excess wind power, or they could serve as buffers at noon when more solar power is generated than is required in factories and kitchens. [German] Bis zum Jahr 2020 sollen ueber hiesige Strassen eine Million Elektroautos rollen. Doch wann werden Elektrofahrzeuge in nennenswertem Ausmass angeboten? Wie hoch ist ihr Strombedarf wirklich? Ist in naher Zukunft mit leistungsfaehigen Batterien zu rechnen? Und waere es nicht sinnvoller, konventionell betriebene Autos effizienter zu machen? Kompetent und fuer den Laien verstaendlich beantworten die Autoren diese und weitere Fragen rund um das Thema Elektroauto und Elektromobilitaet. Demnach werden die Elektroautos in Flotten betrieben und dienen nicht nur als Verkehrsmittel, sondern zugleich als Puffer fuer die bekanntlich volatilen erneuerbaren Energien. Die Formel lautet hier: gesteuertes Laden. Professionell in Flotten gemanagte Elektrofahrzeuge koennen ueberschuessigen Windstrom aufnehmen, wenn beispielsweise nachts die Abnahme fehlt, oder sie koennen als Puffer bereit stehen fuer die Mittagsstunden, wenn mehr Sonnenstrom produziert wird als in den Fabriken und Kuechen benoetigt wird.

  6. Die goldene Frucht Ostindiens – Eine Warengeschichte der Muskatgewürze

    Directory of Open Access Journals (Sweden)

    Moritz Herrmann

    2012-05-01

    Full Text Available Moritz Herrmann writes about a different aspect of history: „Die goldene Frucht Ostindiens. Eine Warengeschichte der Muskatnuss.“ (The Golden Fruit of East-India: The History of the Nutmeg Trade. The story ranges from the discovery of nutmeg, its way to Europe and its significance in early modern times.The actual reason for the numerous voyages of discovery during the 15th and 16th century was the acquisition of trade items and exotic spices. Nutmeg trees only grew on a small island group in the east of what is nowadays known as Indonesia. Therefore, nutmeg became a rare trade item. Out of a cultural historical viewpoint, the reader is introduced to the nutmeg tree and its economical life conditions. The arduous production of the spice and its manifold use as a luxury foodstuff and as a medicine are also depicted. A subsequent in-depth analysis of the European trade relations shows the numerous conflicts of interest. The problematic relationship between the indigenous population and the European traders are also considered. At the end of the 16th century, the Portuguese domination in the high-sea spice trade was challenged by Britain and the Netherlands. Especially the Netherlands played a crucial role in this process, as they had a prosperous monopoly on the nutmeg trade until 1810.The historical importance of nutmeg spices not only had an impact on international trade and worldwide political relations, but also can be regarded as an example of European early capitalism as well as an example for the increasing colonialisation of indigenous people. Moritz Herrmann achieves the goal of showing the far-reaching dimensions of the inconspicuous little nut, which nowadays can be found in almost every German household.

  7. Mining lakes in Germany; Tagebauseen in Deutschland. Gegenwaertiger Kenntnisstand ueber wasserwirtschaftliche Belange von Braunkohlentagebaurestloechern - ein Ueberblick

    Energy Technology Data Exchange (ETDEWEB)

    Nixdorf, B.; Hemm, M.; Schlundt, A.; Kapfer, M.; Krumbeck, H. [Brandenburgische Technische Univ., Cottbus (Germany). Lehrstuhl Gewaesserschutz]|[UFZ - Umweltforschungszentrum Leipzig-Halle GmbH, Magdeburg (Germany)

    2001-06-01

    More than 500 mining lakes of different age and maturity have formed in the lignite mining areas in Germany during the last hundred years. Compared to natural lakes mining lakes have a complex and diverse morphometry. They will be among the largest and deepest lakes in Germany (Hambacher See, Goitsche, Garzweiler II, Geiseltal) and have good chance of avoiding eutrophication. About 100 mining lakes will be greater than 50 ha. 230 lakes are documented in this report concerning morphometry, flooding and mixis regime, hydrochemistry, limnology, colonization, use and development of water quality. They are among the largest (Hambacher See, Goitsche, Garzweiler II, Geiseltal) and most acidic lakes in Germany. The extremely high acidity is from both iron and hydrogen ions due to pyrit oxidation. It influences trophic situation and food webs in mining lakes and reduces a diverse use of these lakes. (orig.) [German] Die Seelandschaft Deutschlands wird durch den Braunkohlenbergbau um ueber 500 Seen reicher. Technologiebedingt herrscht dabei eine grosse morphologische Vielfalt innerhalb der Tagebauseen vor, welche die groessten und tiefsten Seen Deutschlands hervorbringen wird (Hambacher See, Goitsche, Garzweiler II, Geiseltal), aber auch zahlreiche kleine, meist flachere Gewaesser miteinschliesst. Etwa 100 Taugebauseen sind groesser als 50 ha. Kleinere Tagebauseen wie z.B. die der Ville in Nordrhein-Westfalen wurden ebenfalls ausfuehrlich dokumentiert. In dieser Dokumentation wurden ueber 490 Seen erfasst, 230 davon wurden in der Dokumentation nach folgenden Kriterien beschrieben: Entstehung, Flutungsregime, Morphometrie und Mixis, Chemismus und Gewaesserentwicklung, Besiedlung und Nutzung. Dem Problem der Versauerung durch die Verwitterung sulfidischer Mineralien (Pyrit, Markasit) wurde besondere Aufmerksamkeit gewidmet, weil sich biologische Komponenten und Gewaesserzustaende (Trophie, Nahrungsketten) abweichend zu den normalen Hartwasserseen Deutschlands verhalten und

  8. Municipal energy concepts. A service task for electric utility companies; Kommunale Energiekonzepte. Eine Dienstleistungsaufgabe fuer Energieversorgungsuntemehmen

    Energy Technology Data Exchange (ETDEWEB)

    Just, W. [Stadtwerke Gelsenkirchen GmbH (Germany)

    1994-11-01

    The article explains to what extent suitable measures can be realized and supported in a municipality with municipal energy concepts or even climate protection concepts. The target is to attain with limited financial means the most favourable economic and ecological effects in the municipality or in the region. Many electric utilities have in the last years forced the realization of energy conservation measures and have become energy service companies. With their expert knowledge they are ideal partners for politics, public adminstration and citizens. They have the best qualificatons for the development and realization of municipal concepts. In many cases it shows that with detailed studies the target can be quicker and more effectively attained as with extensive, time-consuming and expensive studies which are not particularly realization-oriented. The report is to give examples which might be helpful for the development of a concept. (orig./UA) [Deutsch] Der Beitrag erlaeutert, inwieweit umfangreiche kommunale Energiekonzepte oder sogar Klimaschutzkonzepte geeignete Massnahmen in der Kommune realisieren und foerdern koennen. Ziel sollte sein, mit begrenztem Mitteleinsatz die oekonomisch-oekologisch groessten Effekte in der Kommune bzw. in der Region zu erzielen. Viele Energie-Versorgungsunternehmen haben in den letzten Jahren die Realisierung von Energieparmassnahmen vorangetrieben und sich zu Energie-Dienstleistungsunternehmen entwickelt. Mit ihrer Sachkompetenz sind sie der ideale Partner fuer Politik, oeffentliche Verwaltung und Buerger/innen. Sie bringen die besten Voraussetzungen mit bei der Erarbeitung und Umsetzung von kommunalen Konzepten. Vielfach zeigt sich, dass Detailkonzepte schneller und wirkungsvoller zum Ziel fuehren, als umfachreiche, zeitaufwendige und teure Studien, die wenig umsetzungsorientiert sind. Die nachfolgenden Ausfuehrungen sind als Beispiele gedacht. Sie koennen Anregungen fuer die Erstellung eines Konzeptes vermitteln. (orig./UA)

  9. Intra- und postoperative Komplikationen bei Patienten mit roboterassistierter laparoskopischer radikaler Prostatektomie (RALP. Eine Analyse von 3000 konsekutiven Fällen

    Directory of Open Access Journals (Sweden)

    Zugor V

    2012-01-01

    Full Text Available Einleitung: Das Ziel dieser Studie ist es, die intra- und postoperativen Komplikationen bei Patienten mit roboterassistierter laparoskopischer radikaler Prostatektomie anhand von 3000 konsekutiven Fällen aufzuzeigen. Material und Methoden:3000 Männer, welche sich einer RALP unterzogen, wurden retrospektiv untersucht. Alle Patienten wurden sowohl hinsichtlich ihrer intra- als auch postoperativen Komplikationen beobachtet. Postoperative Komplikationen und Re-Interventionen wurden bis 30 Tage nach OP erfasst und anhand der Clavien-Klassifikation in „Minor“- (Clavien-Klassifikation I–IIIa und „Major“- Komplikationen (Clavien-Klassifikation IIIb–IVa eingeteilt. Ergebnisse: Die intraoperativen Komplikationen sind ebenso wie die „minor“ und „major“ postoperativen Komplikationen in Tabellen 3 und 4 aufgeführt. Das mediane Alter der Patienten betrug 64,1 Jahre, der mediane BMI 26,7 kg/m2 , das mediane Prostatagewicht 40,1 g und der mediane PSA-Wert 10,1 ng/ml. Der Gleason-Score bei Biopsie war in 65 % kleiner als 7, in 34,4 % gleich 7 und größer als 7 in 9,6 % der Fälle. Die Lymphknotendissektion wurde in 75,9 % durchgeführt. Ein organbeschränktes Stadium zeigte sich in 75 % und eine extraprostatische Ausbreitung in 25 %. Die gesamte intraoperative Komplikationsrate lag bei 5,1 %, die „minor“ postoperative Komplikationsrate bei 16,1 % und die „major“ bei 1,8 %. Zusammenfassung: Die RALP ist nicht komplikationslos. In erfahrenen Händen ist sie jedoch ein sicheres chirurgisches Verfahren mit einer niedrigen Morbidität und Mortalität.

  10. Assembly optimization realized by a die-cast magnesium construction; Montageverbesserungen verwirklicht durch eine Magnesium-Druckguss-Konstruktion

    Energy Technology Data Exchange (ETDEWEB)

    Tikal, F.; Vollmer, C.; Pippert, J.

    1996-11-01

    Vehicle development today cannot be envisaged without non-contact and slip free distance- and speed-measurement. As it is superior to contact methods in terms of reliability and accuracy, it has gained more and more acceptance in the past few years and now provides measurement results of the utmost precision. This is particularly necessary in the large application range of tyre and vehicle development to ensure high safety levels; moreover, it is required for future vehicle control systems, as they need precise speed information for ABS, ASC, or for navigation methods. In principle, optical acoustic and microwave sensors can be used for these applications. The microwave sensors can be used for these applications. The microwave-Doppler principle provides certain advantages over optical or ultrasound methods as it can be used under any weather conditions and provides a larger vertical operating range and a long lifespan. Datron-Messtechnik, market leader in the field of correlator optical speed sensors, has made use of this measurement principle and with its microwave sensor introduces a new development covering the great demands of speed measurement. (orig.) [Deutsch] Die Pkw-Tuer, ein Bestandteil der Karosserie, ist im Laufe der Automobilgeschichte nicht wesentlich veraendert worden. Jedoch mussten in den letzten Jahren Flankenschutz, Seitenairbag und andere neue Bauteile in die Tuer integriert werden. Diese Elemente der passiven Sicherheit sind vom Verbraucher gewuenschte Schutzmassnahmen. Mit dem gehobenen Sicherheitsimage bemuehen sich die Produzenten, den potentiellen Kaeufer zum Kauf ihres Produktes zu bewegen. Am Institut fuer Produktionstechnik und Logistik (IPL) der Universitaet Gesamthochschule Kassel (GhK) wurde eine Pkw-Tuer, basierend auf einem Magnesium-Druckgussrahmen, entwickelt. Zur Orientierung und Studienzwecken ist ein Holzmodell erstellt worden. Mit dem praxisnahen Modell konnte die Montage und der Einbau in das Automobil getestet werden. Das

  11. Acute chest pain: a purely clinical problem or a question for radiology; Der akute Thoraxschmerz, ein rein klinisches Problem oder radiologische Fragestellung

    Energy Technology Data Exchange (ETDEWEB)

    Loewe, C. [Medizinische Universitaet Wien, Klinische Abteilung fuer Kardiovaskulaere und Interventionelle Radiologie, Universitaetsklinik fuer Radiodiagnostik, Wien (Austria)

    2008-05-15

    Acute chest pain represents a very common clinical occurrence and at the same time poses a severe diagnostic dilemma. It can be due to an acute life-threatening event such as acute cardiac infarct, or a relatively harmless condition of pain and illness (e.g. vertebrogenic pain) under the main symptom category of acute chest pain. This often unclear symptomatic, behind which there can always be a life-threatening disease leads to an exaggerated grouping of patients into emergency cases and to an increased number of inpatients for observation. The diagnosis of acute coronary syndrome with no initial ECG changes typical for ischemia is especially problematic. The availability of modern multidetector computed tomography is becoming increasingly more important for radiologists in the diagnosis and clarification of acute chest pain. In this article the clinical difficulties and radiology options for the diagnosis of patients with acute chest pain will be presented and possible future algorithms for diagnosis will be discussed. (orig.) [German] Der akute Thoraxschmerz repraesentiert ein sehr haeufiges klinisches Beschwerdebild und gleichzeitig ein grosses diagnostisches Dilemma, koennen sich doch sowohl lebensbedrohliche akute Ereignisse (wie der akute Herzinfarkt) als auch mehr oder weniger harmlose Schmerzzustaende und Erkrankungen (wie vertebrogene Schmerzen) unter dem Leitsymptom 'akuter Thoraxschmerz' praesentieren. Diese oft nicht eindeutige Symptomatik, hinter der immer auch ein lebensbedrohliches Krankheitsbild stecken kann, fuehrt zu einer Uebertriagierung der Patienten in Notaufnahmen und zu einer grossen Anzahl an stationaeren 'Absicherungsaufnahmen'. Besonders die Diagnose eines akuten Koronarsyndroms (AKS) bei initial fehlenden ischaemietypischen EKG-Veraenderungen stellt eine spezielle Problematik dar. Durch die Verfuegbarkeit moderner ultraschneller Multidetektorcomputertomographen (MDCT) spielt der Radiologe in der Diagnostik und

  12. Ein Lehrbuch über Psychiatrie und Psychotherapie – Geschlechtsunterschiede unter der Lupe? A Textbook for Psychiatry and Psychotherapy—Gender Differences under the Microscope?

    Directory of Open Access Journals (Sweden)

    Isabella Heuser

    2007-07-01

    Full Text Available Anke Rohde und Andreas Marneros haben sich ein hohes Ziel gesetzt: ein übersichtliches Lehrbuch für Psychiatrie und Psychotherapie, das erstmals eine systematische Zusammenstellung des Wissens über geschlechtsspezifische Aspekte von Symptomatologie, Epidemiologie, Diagnostik, Pharmakotherapie und Psychotherapie psychischer Störungen enthält. Bemerkenswert ist dabei zweierlei: Erstens werden bei der Betrachtung geschlechtsspezifischer Unterschiede im Sinne der Genderforschung Frauen und Männer berücksichtigt, zweitens wird ein vollständiger Überblick sowohl über die häufigen und bekannten psychischen Störungen als auch die äußerst seltenen psychiatrischen Erkrankungen der gesamten Altersspanne gegeben. Wenngleich die Qualität der einzelnen Beiträge deutlich zwischen sehr differenzierter und leider auch für ein Handbuch eindeutig zu oberflächlicher Betrachtung variiert, liegt in dem Band ein weitgehend informatives Nachschlagewerk vor, das einen ersten Überblick über die geschlechtsspezifische Psychiatrie gibt.Anke Rohde and Andres Marneros have given themselves a lofty goal: To put together a systematic collection for the first time that contains the entire body of knowledge on the gender-specific aspects of symptomatology, epidemiology, diagnostics, pharmacotherapy, and psychotherapy of psychological disturbances. There are two notable aspects: First, in accordance with contemporary gender analysis, the examination of the gender-specific differences takes both women and men into account; second, the book provides a complete overview of the common and well-known psychological disturbances as well as the extremely rare psychiatric illnesses along the entire age spectrum. Although the quality of the individual articles clearly ranges from the very sophisticated to a superficial treatment inappropriate for a textbook, the volume itself is, for the most part, an informative work of reference that offers an initial overview of

  13. Hypocotyl shape in radishes - a useful impact criterion for biological indication of ozone?; Hypokotyl-Form bei Radieschen - ein sinnvolles Wirkungskriterium fuer die Bioindikation von Ozon?

    Energy Technology Data Exchange (ETDEWEB)

    Kostka-Rick, R.

    1992-12-31

    A consistent correlation between certain `source` leaves and specific `sink` regions in the root of Beta vulgaris L. justifies to study the impact of ozone (O{sub 3}) on the shape of the hypocotyl in radish (Raphanus sativus L.) and the potential use of shape variants as effect criteria. A 7-day period of exposure to O{sub 3} ranging within realistic immission levels caused a nonsignificant reduction of hypocotyl fresh weight in radish. Two out three of the shape indices under study were also changed by ozone exposure - sometimes significantly. A discriminance function derived from several shape indices with or without fresh weight allowed a significant separation between the two O{sub 3}-treatment variants. Treatment with the anti-oxidant ethylene diurea (EDU) had no essential effect on hypocotyl shape. The author discusses the use of shape variants for ozone bio-indication. (orig.) [Deutsch] Eine konsistente Beziehung zwischen bestimmten `source`-Blaettern und spezifischen `sink`-Regionen in der Wurzel von Beta vulgaris L. rechtfertigt die Ueberpruefung des Einflusses von Ozon (O{sub 3}) auf die Form des Hypokotyls bei Radies (Raphanus sativus L.) und der potentiellen Nutzung von Formvariablen als Wirkungskriterium. Eine 7taegige O{sub 3}-Belastung im Bereich realistischer Immissionskonzentrationen verursachte eine nicht-signifikante Minderung des Hypokotyl-Frischgewichtes von Radies. Zwei von drei der untersuchten Formindizes wurden durch die Ozon-Belastung ebenfalls, z.T. signifikant, veraendert. Eine Diskriminanzfunktion aus mehreren Formindizes, mit oder ohne Einbeziehung des Frischgewichtes, gestattete eine signifikante Trennung zwischen den beiden O{sub 3}-Behandlungsvarianten. Eine Behandlung mit dem Anti-oxidants Ethylendiurea (EDU) hatte keinen wesentlichen Einfluss auf die Hypokotylform. Die Moeglichkeiten des Einsatzes von Formvariablen in der Bioindikation von Ozon werden diskutiert. (orig.)

  14. Weiterentwicklung Gruppenleiter/innen-Kurs: Ein Projekt in der Freiwilligenarbeit des CVJM/CVJF Regionalverband Basels: Projektbericht

    OpenAIRE

    Fankhauser, Miriam

    2016-01-01

    Im folgenden Bericht geht es um das Projekt «Weiterentwicklung Gruppenleiter/innen-Kurs – Ein Pro- jekt in der Freiwilligenarbeit des CVJM/CVJF Regionalverband Basels». Dieses Projekt wurde von der Studentin Miriam Fankhauser im Rahmen der Praxisausbildung an der Hochschule Luzern für Soziale Arbeit durchgeführt. In Auftrag gegeben wurde das Projekt vom CVJM/CVJF Regionalverband Basel. Beim eben genannten Projekt ging es darum, den Gruppenleiter/innen-Kurs weiterzuentwickeln. Der Kurs rich...

  15. A new NMR measuring instrument for logging while drilling; Ein neues Logging While Drilling Kernspinresonanz-Messgeraet

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, D.M.; Thern, H.F.; Kruspe, T.; Blanz, M. [Baker Hughes INTEQ GmbH, Celle (Germany); Strobel, J. [RWE Dea AG, Hamburg (Germany)

    2003-07-01

    Since 1990, commercial wireline MR measurements are carried out in boreholes. Logging while drilling is a comparatively new technique, in which a MR sensor is integrated in the drilling equipment so that the measured data are available more quickly. Problems may be caused by movement of the drilling rig. The resulting vibrations may distort the MR signal. Current development activities therefore focus on design optimization for higher vibration stability. The contribution explains vibration-induced wrong measuring signals and presents measures to reduce the effects of vibration. Further, a new LWD-MR measuring instrument is presented, the so-called MagTrak{sup TM} which combines the quality and advantages of cable MR-T{sub 2} measurements with a minimum of vibration effects, as is shown by MR data from a commercial borehole. [German] Seit 1990 werden Wireline-MR-Messungen kommerziell im Bohrloch durchgefuehrt. In den letzten Jahren wird an Messgeraeten gearbeitet, die bereits waehrend des Bohrens MR-Daten aufzeichnen (Logging While Drilling, LWD). Dazu wird ein MR-Sensor in den Bohrstrang integriert. Neben der schnelleren Verfuegbarkeit der MR-Daten besteht ein grosser Vorteil der LWD-MR-Messung darin, dass die Daten bereits kurz nach dem Bohren gemessen werden. Die Invasion von Bohrlochspuelung in die Formation dauert dann noch nicht lange an, und die MR-Messung findet im relativ unveraenderten Gestein statt. Probleme beim Einsatz von MR-Messgeraeten waehrend des Bohrens werden vor allem durch die Bewegungen des Bohrstranges verursacht. Vibrationen des MR-Sensors fuehren zu veraenderten Messbedingungen waehrend des Messvorgangs, was zu Verzerrungen im MR-Signal fuehren kann. Den Aufbau des Messgeraetes so zu optimieren, dass Vibrationen einen moeglichst kleinen Einfluss auf die Messung haben, ist ein aktuelles Ziel der heutigen LWD-MR-Entwicklung. In diesem Artikel werden vibrationsverursachte Signalfehler erklaert und Massnahmen genannt, die die

  16. Estudi comparatiu del mercat de les eines de gestió de projectes informàtics

    OpenAIRE

    Jou Fàbrega, Carles

    2004-01-01

    Aquest treball es basa en l'avaluació de productes informàtics de gestió de projectes que hi ha al mercat. A més, en el segon capítol es presenten les diferents eines que ofereix Internet, com ara cercadors de cercadors, portals o comunitats i el Copèrnic (un programa que fa cerques dintre dels ginys que hi ha a Internet i que presenta els deu millors resultats de cada un), per tal de fer la recerca tan ràpida i eficient com sigui possible. Este trabajo se basa en la evaluación de los prod...

  17. Semantische Analyse unstrukturierter Daten. Review und Analyse: Big-Data Ansatz bei internen Untersuchungen anhand eines Beispiels

    Directory of Open Access Journals (Sweden)

    Jörg Fuchslueger

    2016-05-01

    Full Text Available In der juristischen Fallbearbeitung steht man immer häufiger vor der Herausforderung, unüberschaubare Massen an Unterlagen berücksichtigen zu müssen. Relevante Information ist verborgen in hunderttausenden E-Mails, Office Dokumenten und PDF-Dateien. All diese Unterlagen zu lesen, zu verstehen und zu beurteilen, ist in der Praxis nicht mehr möglich. Der vorliegende Artikel zeigt ein Vorgehensmodell, wie mit semantischer Inhaltsanalyse die notwendige Informationsgewinnung in umfangreichen, elektronisch gespeicherten Textbeständen durchgeführt werden kann.

  18. Erinnerung und Geschichte – Ein früher Bericht aus dem Frauen-KZ Moringen 1936/37

    Directory of Open Access Journals (Sweden)

    Christa Schikorra

    2007-03-01

    Full Text Available Der Erinnerungsbericht von Gabriele Herz ist einerseits bedeutsam wegen der Beschreibung individuelle Erfahrungen und der Einnahme einer persönlichen Perspektive. Andererseits stellt er ein bedeutendes Dokument für die Geschichtsschreibung zu frühen Konzentrationslagern dar, und hier insbesondere zu den Verfolgungserfahrungen jüdischer Frauen im Deutschland der 30er Jahre. In der äußerst aufschlussreichen Einleitung der Historikerin Jane Caplan, die den Anstoß für die Herausgabe dieses einzigartigen Dokuments gab, wird die Komplexität des Erinnerungszeugnisses von Gabriele Herz aufgezeigt und gewürdigt.

  19. Medien und Berufsvorstellungen von Kindern: eine experimentelle Studie zum Einfluss von Kinderbüchern auf das Berufsspektrum von Kindergartenkindern

    OpenAIRE

    Brüggemann, Tim; Gehrau, Volker; Handrup, Jutta

    2015-01-01

    "Der Beitrag thematisiert zunächst den Stand der beruflichen Orientierung von Jugendlichen sowie die pädagogischen Bemühungen beim Übergang Schule-Beruf, insbesondere im Hinblick auf eine Erweiterung des häufig engen Spektrums von Berufen, die bei der Berufswahl berücksichtig werden. Dabei richten sich die Bestrebungen, diesem Problem entgegenzuwirken, bislang vor allem auf Jugendliche. Anschließend wird anhand vorliegender Ergebnisse aus der Medienforschung diskutiert, in welcher Weise Masse...

  20. Medien und Informationstechnologien in der Lehrerausbildung – Plädoyer für ein Mindestcurriculum

    Directory of Open Access Journals (Sweden)

    Olaf Kos

    2001-11-01

    Full Text Available In diesem Beitrag werden konzeptionelle Überlegungen für die Integration eines Lehrkomplexes «Neue Medien und Informationstechnologien» im Rahmen des erziehungswissenschaftlichen Grundstudiums in der ersten Phase der Lehramtsausbildung vorgestellt. Dabei stützen sich die Autoren vor allem auf die Erfahrungen und Ergebnisse des zweijährigen Modellversuchs «Informatische Bildung für Lehrerstudenten», der im Rahmen des erziehungswissenschaftlichen Teils der Lehramtsausbildung an der Humboldt Universität zu Berlin sehr erfolgreich und mit hoher Akzeptanz auf Seiten der Studenten durchgeführt wurde.