WorldWideScience

Sample records for repens cyperales poaceae

  1. Invertebrate fauna associated with Torpedograss, Panicum repens (Cyperales: Poaceae), in Lake Okeechobee, Florida, and prospects for biological control

    International Nuclear Information System (INIS)

    Cuda, J.P.; Dunford, J.C.; Leavengood, J.M. Jr.

    2007-01-01

    Torpedograss, Panicum repens L., is an adventive, rhizomatous grass species that has become an invasive weed of terrestrial, wetland, and aquatic environments in tropical and subtropical regions worldwide. Until recently, strategies for controlling torpedograss in the USA have focused almost exclusively on mechanical and chemical methods, either alone or in combination, with varied results. A survey of the arthropods and nematodes currently associated with the plant in Lake Okeechobee, Florida, was conducted as part of a feasibility study to determine whether torpedograss is an appropriate target for a classical biological control program. Overall, approximately 4,000 arthropods and 400 nematode specimens were collected. Sweep, clipped vegetation, and soil core samples were dominated by representatives of the arthropod orders Hemiptera, Hymenoptera, Diptera, and Acari. Lesion nematodes of the genus Pratylenchus were commonly associated with the roots of torpedograss. None of the organisms collected were torpedograss specialists. Although classical biological control of torpedograss is feasible based on the extent of the infestation, economic losses, resistance to conventional controls, and the report of a potentially host specific natural enemy in India, the botanical position of this grass weed will require a formal risk assessment before proceeding with a classical biological control program. (author) [es

  2. Potential biological control agents for management of cogongrass (Cyperales: Poaceae) in the southeastern USA

    Science.gov (United States)

    Cogongrass, Imperata cylindrica (L.) Palisot de Beauvois (Cyperales: Poaceae), is a noxious invasive weed in the southeastern USA. Surveys for potential biological control agents of cogongrass were conducted in Asia and East Africa from 2013 to 2016. Several insect herbivores were found that may hav...

  3. Morphophysiological and chemical aspects of torpedograss (Panicum repens L., Poaceae

    Directory of Open Access Journals (Sweden)

    Simone Meredith Scheffer-Basso

    2007-09-01

    Full Text Available This work evaluated some of the morphophysiological and bromatological aspects of torpedograss (Panicum repens L. through the quantification of accumulation, allocation and chemical composition of dry matter (DM during spring-summer. Four destructive harvests of aerial and underground parts were carried out on 23 October 2003, 3 December 2003, 22 January 2004 and 20 February 2004, corresponding to 31, 73, 123 and 152 days after the start of the spring. In these harvests, the DM accumulation was respectively 1,650; 4,470; 10,900 and 14,540 kg/ha in the aerial part, with leaf percentages between 45% (first harvest and 35% (last harvest. The crude protein (CP, neutral detergent fiber (NDF and acid detergent fiber (ADF changed between the first and the last harvest, from 9.9 to 7% (CP, 63.9% to 70.3% (FDN, and 37% to 40.8% (FDA, in samples composed by leaves, culms, inflorescences and stolons. The DM allocation to rhizomes (Rh, roots (R, leaves (L, culms+stolons (C and inflorescences (I changed, between the first and the last harvest, from 42 to 19% (Rh, 10 to 7% (R, 22 to 27% (L, 25 to 44% (C, and 0 to 2% (I.

  4. Facilitation of a native pest of rice, Stenotus rubrovittatus (Hemiptera: Miridae), by the non-native Lolium multiflorum (Cyperales: Poaceae) in an agricultural landscape.

    Science.gov (United States)

    Yoshioka, Akira; Takada, Mayura; Washitani, Izumi

    2011-10-01

    Source populations of polyphagous pests often occur on host plants other than the economically damaged crop. We evaluated the contribution of patches of a non-native meadow grass, Lolium multiflorum Lam. (Poaceae), and other weeds growing in fallow fields or meadows as source hosts of an important native pest of rice, Stenotus rubrovittatus (Matsumura) (Hemiptera: Miridae), in an agricultural landscape of northern Japan. Periodical censuses of this mirid bug by using the sweeping method, vegetation surveys, and statistical analysis revealed that L. multiflorum was the only plant species that was positively correlated with the density of adult S. rubrovittatus through two generations and thus may be the most stable and important host of the mirid bug early in the season before the colonization of rice paddies. The risk and cost of such an indirect negative effect on a crop plant through facilitation of a native pest by a non-native plant in the agricultural landscape should not be overlooked.

  5. Hypoglycemic activity of polysaccharide fractions containing ß-glucans from extracts of Rhynchelytrum repens (Willd. C.E. Hubb., Poaceae

    Directory of Open Access Journals (Sweden)

    A.C.C.F.F. De Paula

    2005-06-01

    Full Text Available ß-Glucans are soluble fibers with physiological functions, such as interference with absorption of sugars and reduction of serum lipid levels. The objective of the present study was to analyze the distribution of ß-glucans in different tissues of the African grass species Rhynchelytrum repens and also to evaluate their hypoglycemic activity. Leaf blades, sheaths, stems, and young leaves of R. repens were submitted to extraction with 4 M KOH. Analysis of the fractions revealed the presence of arabinose, glucose, xylose, and traces of rhamnose and galactose. The presence of ß-glucan in these fractions was confirmed by hydrolyzing the polymers with endo-ß-glucanase from Bacillus subtilis, followed by HPLC analysis of the characteristic oligosaccharides produced. The 4 M KOH fractions from different tissues were subjected to gel permeation chromatography on Sepharose 4B, with separation of polysaccharides with different degrees of polymerization, the highest molecular mass (above 2000 kDa being found in young leaves. The molecular mass of the leaf blade polymers was similar (250 kDa to that of maize coleoptile ß-glucan used for comparison. The 4 M KOH fraction injected into rats with streptozotocin-induced diabetes showed hypoglycemic activity, reducing blood sugar to normal levels for approximately 24 h. This performance was better than that obtained with pure ß-glucan from barley, which decreased blood sugar levels for about 4 h. These results suggest that the activity of ß-glucans from R. repens is responsible for the use of this plant extract as a hypoglycemic drug in folk medicine.

  6. Gene Capture from Across the Grass Family in the Allohexaploid Elymus repens (L.) Gould (Poaceae, Triticeae) as Evidenced by ITS, GBSSI, and Molecular Cytogenetics

    Czech Academy of Sciences Publication Activity Database

    Mahelka, Václav; Kopecký, David

    2010-01-01

    Roč. 27, č. 6 (2010), s. 1370-1390 ISSN 0737-4038 R&D Projects: GA ČR GP206/09/P312; GA ČR GA206/09/1126 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z50380511 Keywords : Elymus repens * hybridization * Triticeae Subject RIV: EF - Botanics Impact factor: 5.510, year: 2010

  7. Gene capture from across the grass family in the allohexaploid Elymus repens (L.) Gould (Poaceae, Triticeae) as evidenced by ITS, GBSSI, and molecular cytogenetics.

    Science.gov (United States)

    Mahelka, Václav; Kopecký, David

    2010-06-01

    Four accessions of hexaploid Elymus repens from its native Central European distribution area were analyzed using sequencing of multicopy (internal transcribed spacer, ITS) and single-copy (granule-bound starch synthase I, GBSSI) DNA in concert with genomic and fluorescent in situ hybridization (GISH and FISH) to disentangle its allopolyploid origin. Despite extensive ITS homogenization, nrDNA in E. repens allowed us to identify at least four distinct lineages. Apart from Pseudoroegneria and Hordeum, representing the major genome constituents, the presence of further unexpected alien genetic material, originating from species outside the Triticeae and close to Panicum (Paniceae) and Bromus (Bromeae), was revealed. GBSSI sequences provided information complementary to the ITS. Apart from Pseudoroegneria and Hordeum, two additional gene variants from within the Triticeae were discovered: One was Taeniatherum-like, but the other did not have a close relationship with any of the diploids sampled. GISH results were largely congruent with the sequence-based markers. GISH clearly confirmed Pseudoroegneria and Hordeum as major genome constituents and further showed the presence of a small chromosome segment corresponding to Panicum. It resided in the Hordeum subgenome and probably represents an old acquisition of a Hordeum progenitor. Spotty hybridization signals across all chromosomes after GISH with Taeniatherum and Bromus probes suggested that gene acquisition from these species is more likely due to common ancestry of the grasses or early introgression than to recent hybridization or allopolyploid origin of E. repens. Physical mapping of rDNA loci using FISH revealed that all rDNA loci except one minor were located on Pseudoroegneria-derived chromosomes, which suggests the loss of all Hordeum-derived loci but one. Because homogenization mechanisms seem to operate effectively among Pseudoroegneria-like copies in this species, incomplete ITS homogenization in our samples

  8. Genetic analysis and gene fine mapping of aroma in rice (Oryza sativa L. Cyperales, Poaceae

    Directory of Open Access Journals (Sweden)

    Shu Xia Sun

    2008-01-01

    Full Text Available We investigated inheritance and carried out gene fine mapping of aroma in crosses between the aromatic elite hybrid rice Oryza sativa indica variety Chuanxiang-29B (Ch-29B and the non-aromatic rice O. sativa indica variety R2 and O. sativa japonica Lemont (Le. The F1 grains and leaves were non-aromatic while the F2 non-aroma to aroma segregation pattern was 3:1. The F3 segregation ratio was consistent with the expected 1:2:1 for a single recessive aroma gene in Ch-29B. Linkage analysis between simple sequence repeat (SSR markers and the aroma locus for the aromatic F2 plants mapped the Ch-29B aroma gene to a chromosome 8 region flanked by SSR markers RM23120 at 0.52 cM and RM3459 at 1.23 cM, a replicate F2 population confirming these results. Three bacterial artificial chromosome (BAC clones cover chromosome 8 markers RM23120 and RM3459. Our molecular mapping data from the two populations indicated that the aroma locus occurs in a 142.85 kb interval on BAC clones AP005301 or AP005537, implying that it might be the same gene reported by Bradbury et al (2005a; Plant Biotec J. 3:363-370. The flanking markers Aro7, RM23120 and RM3459 identified by us could greatly accelerate the efficiency and precision of aromatic rice breeding programs.

  9. Controle químico de Panicum repens e Paspalum repens Chemical control of Panicum repens and Paspalum repens

    Directory of Open Access Journals (Sweden)

    C.A. Carbonari

    2004-09-01

    Full Text Available Panicum repens e Paspalum repens são espécies infestantes de ambientes úmidos e alagados, freqüentes em margens de lagos, reservatórios, canais de irrigação e drenagem. O presente trabalho teve como objetivo avaliar a eficiência de diferentes herbicidas no controle dessas duas espécies. O experimento foi conduzido no Núcleo de Pesquisas Avançadas em Matologia, do Departamento de Produção Vegetal, pertencente à Faculdade de Ciências Agronômicas/UNESP, campus de Botucatu-SP. As plantas foram cultivadas em caixas d'água e as pulverizações foram realizadas utilizando-se um pulverizador costal pressurizado a CO2. Os tratamentos testados foram: glyphosate a 2.400, 3.360 e 4.320 g e.a. ha-1 + Aterbane 0,5% v/v, glyphosate a 2.400, 3.360 e 4.320 g e.a. ha-1 + Silwet 0.1% v/v, imazapyr a 750 e 1.500 g e.a. ha-1 e diquat a 400 e 800 g i.a. ha-1 (em aplicações seqüenciais de 200+200 g i.a. ha-1 e 400+400 g i.a. ha-1, além de uma testemunha sem aplicação de herbicidas. O delineamento experimental utilizado foi inteiramente casualizado, com quatro repetições. Avaliações visuais de controle foram realizadas, sendo a massa seca das plantas determinada ao final do estudo. O herbicida glyphosate na dose de 4.320 g e.a. ha-1, independentemente do adjuvante utilizado, assim como na dose de 3.360 g e.a. ha-1 com Aterbane, proporcionou bom controle de Panicum repens e, em todas as doses e adjuvantes testados, promoveu controle excelente de Paspalum repens. O herbicida imazapyr, independentemente da dose testada, apresentou resultados insatisfatórios no controle das plantas de Panicum repens, porém promoveu um excelente controle de Paspalum repens; o herbicida diquat, apesar das duas aplicações e independentemente da dose utilizada, mostrou-se ineficiente para controle das duas espécies.Two experiments were carried out to evaluate the susceptibility of Panicum repens and Paspalum repens Bergius to different herbicides applied in

  10. Dirofilaria repens transmission in southeastern Finland

    Directory of Open Access Journals (Sweden)

    Risto Pietikäinen

    2017-11-01

    Full Text Available Abstract Background The spread of vector-borne diseases to new regions has become a global threat due to climate change, increasing traffic, and movement of people and animals. Dirofilaria repens, the canine subcutaneous filarioid nematode, has expanded its distribution range northward during the last decades. The northernmost European locations, where the parasite life-cycle has been confirmed, are Estonia and the Novgorod Region in Russia. Results Herein, we describe an autochthonous D. repens infection in a Finnish woman. We also present two cases of D. repens infection in imported dogs indicating the life-cycle in the Russian Vyborg and St Petersburg areas, close to the Finnish border. Conclusions The most obvious limiting factor of the northern distribution of D. repens is the summer temperature, due to the temperature-dependent development of larvae in vectors. With continuing climate change, further spread of D. repens in Fennoscandia can be expected.

  11. Response to flooding intensity in Elytrigia repens, E. intermedia (Poaceae: Triticeae) and their hybrid

    Czech Academy of Sciences Publication Activity Database

    Mahelka, Václav

    2006-01-01

    Roč. 46, - (2006), s. 82-90 ISSN 0043-1737 R&D Projects: GA ČR GA206/05/0778; GA ČR GD206/03/H137; GA MZe QC1362 Institutional research plan: CEZ:AV0Z60050516 Keywords : phenotypic plasticity * flooding * weed Subject RIV: EF - Botanics Impact factor: 1.705, year: 2006

  12. Telogen effluvium treated with Serenoa repens supplement

    Directory of Open Access Journals (Sweden)

    Michele Pezza

    2014-03-01

    Full Text Available Telogen effluvium is a non-scarring form of hair loss. Clinically, the disease is characterized by hair loss where more than normalamounts of hair fall out; it usually affects the whole scalp in a widespread manner. When hair loss is very pronounced and persists fora long time, alopecia becomes clinically evident. It is not associated to subjective symptoms. In this paper, the authors describe theclinical case of a 67-year old patient suffering from telogen effluvium, treated with a supplement containing amino acids (L-cystineand L-methionine, vitamin E, iron and extract of Serenoa repens.

  13. IDENTIFIKASI TUMBUHAN SUKU POACEAE SEBAGAI SUPLEMEN MATAKULIAH KEANEKARAGAMAN TUMBUHAN

    Directory of Open Access Journals (Sweden)

    Desy Yanuarita Wulandari

    2017-01-01

    Full Text Available Poaceae known as plants used as food ingredients in Indonesian. One area thas has high level diversity of plants Poaceae is Tahura R. Soerjo. Morphological characterization Poaceae in that region are still rare. The Goal for this research are to identify Poaceae tribes, and make photography Poaceae data that can be used as a supplement on Diversity of Plants course. This study included descriptive exploratory study with free cruising method. The species Poaceae has identified are Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflor. Suku Poaceae dikenal sebagai tumbuhan yang dimanfaatkan sebagai bahan pangan masyarakat Indonesia. Salah satu daerah yang memiliki tingkat keanekaragaman tumbuhan Poaceae adalah di Tahura R. Soerjo. Karakterisasi morfologi terkait suku Poaceae di daerah tersebut masih sedikit. Tujuan dalam penelitian ini adalah untuk identifikasi suku Poaceae, membuat data fotografi suku Poaceae sehingga dapat digunakan sebagai suplemen keanekaragaman tumbuhan. Penelitian ini termasuk penelitian deskriptif eksploratif dengan metode jelajah bebas. Sebelas spesies suku Poaceae yang telah teridentifikasi, yaitu Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflora.

  14. Growth of Aspergillus repens in Flue-Cured Tobacco 1

    Science.gov (United States)

    Welty, Ronald E.; Nelson, Larry A.

    1971-01-01

    In laboratory tests, flue-cured tobacco inoculated with Aspergillus repens was stored at 75, 80, 85, 87, and 95% relative humidity at 20 and 30 C. Samples were taken weekly for 4 weeks and evaluated for mold growth (colony count) and moisture content (MC). The weekly rate of fungus increase was slower at 20 C than at 30 C. Tobacco at 20 C with MC between 25 to 30% supported a slight to moderate increase in A. repens after 3 weeks of storage. However, tobacco at the same MC stored at 30 C was subject to rapid invasion by the fungus in as few as 1 to 2 weeks. Tobacco with MC above 30% stored at either 20 or 30 C became moldy in about 1 week. A mold index is proposed for evaluating populations of A. repens in tobacco. PMID:16349905

  15. Growth of Aspergillus repens in Flue-Cured Tobacco.

    Science.gov (United States)

    Welty, R E; Nelson, L A

    1971-05-01

    In laboratory tests, flue-cured tobacco inoculated with Aspergillus repens was stored at 75, 80, 85, 87, and 95% relative humidity at 20 and 30 C. Samples were taken weekly for 4 weeks and evaluated for mold growth (colony count) and moisture content (MC). The weekly rate of fungus increase was slower at 20 C than at 30 C. Tobacco at 20 C with MC between 25 to 30% supported a slight to moderate increase in A. repens after 3 weeks of storage. However, tobacco at the same MC stored at 30 C was subject to rapid invasion by the fungus in as few as 1 to 2 weeks. Tobacco with MC above 30% stored at either 20 or 30 C became moldy in about 1 week. A mold index is proposed for evaluating populations of A. repens in tobacco.

  16. Human Dirofilaria repens Infection in Romania: A Case Report

    Directory of Open Access Journals (Sweden)

    Ioana Popescu

    2012-01-01

    Full Text Available Human dirofilariasis is a zoonotic infectious disease caused by the filarial nematodes of dogs Dirofilaria repens and Dirofilaria immitis. Depending on the species involved, human infections usually manifest as one cutaneous or visceral larva migrans that forms a painless nodule in the later course of disease. Dirofilariae are endemic in the Mediterranean, particularly in Italy. They are considered as emerging pathogens currently increasing their geographical range. We present one of the few known cases of human dirofilariasis caused by D. repens in Romania. The patient developed unusual and severe clinical manifestations that mimicked pathological conditions like cellulitis or deep venous thrombosis.

  17. Serenoa repens (saw palmetto): a systematic review of adverse events.

    Science.gov (United States)

    Agbabiaka, Taofikat B; Pittler, Max H; Wider, Barbara; Ernst, Edzard

    2009-01-01

    Serenoa repens (W. Bartram) Small, also known as saw palmetto, is one of the most widely used herbal preparations for the treatment of lower urinary tract symptoms (LUTS) and benign prostatic hyperplasia (BPH). Although a number of randomized controlled trials (RCTs) and systematic reviews of the efficacy of S. repens for the treatment of LUTS and BPH have been published, no systematic review on its drug interactions or adverse events currently exists. This review assesses all available human safety data of S. repens monopreparations. Systematic literature searches were conducted from date of inception to February 2008 in five electronic databases; reference lists and our departmental files were checked for further relevant publications. Information was requested from spontaneous reporting schemes of the WHO and national safety bodies. Twenty-four manufacturers/distributors of S. repens preparations and four herbalist organizations were contacted for additional information. No language restrictions were imposed. Only reports of adverse events in humans from monopreparations of S. repens were included. Data from all articles, regardless of study design, reporting adverse events or interactions were independently extracted by the first author and validated by the second. Forty articles (26 randomized controlled trials, 4 non-randomized controlled trials, 6 uncontrolled trials and 4 case reports/series) were included. They suggest that adverse events associated with the use of S. repens are mild and similar to those with placebo. The most frequently reported adverse events are abdominal pain, diarrhoea, nausea, fatigue, headache, decreased libido and rhinitis. More serious adverse events such as death and cerebral haemorrhage are reported in isolated case reports and data from spontaneous reporting schemes, but causality is questionable. No drug interactions were reported. Currently available data suggest that S. repens is well tolerated by most users and is not

  18. Variation in leaf anatomy within the Elytrigia intermedia – E. ×mucronata – E. repens (Poaceae) hybrid complex

    Czech Academy of Sciences Publication Activity Database

    Paštová, Ladislava

    2017-01-01

    Roč. 23, č. 2 (2017), s. 187-198 ISSN 1310-7771 Institutional support: RVO:67985939 Keywords : hybrid * leaf blade selection * micromorphology Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany

  19. Isolation of an Antioxidative Substance Produced by Aspergillus repens.

    Science.gov (United States)

    Yagi, R; Doi, M

    1999-01-01

    The acidic fraction of an extract of the culture liquid of Aspergillus repens MA0197 showed strong antioxidative activity when tested by the ferric thiocyanate and TBA methods. Chromatographic purification of this acidic fraction gave an active substance identified as Neoechinulin A. This compound showed higher antioxidative activity than α-tocopherol and could be expected to act as an antioxidant in Katsuobushi.

  20. Maxillary sinusitis from Microascus cinereus and Aspergillus repens.

    Science.gov (United States)

    Aznar, C; de Bievre, C; Guiguen, C

    1989-02-01

    Microascus was associated with Aspergillus repens in a left maxillary sinus. Tissue contained septale filaments of two types, conidia, ostiolate perithecia containing ascospores corresponding to Microascus cinereus which was identified by culture. The abundance of sexual fructifications in the tissue indicates that pathogenicity is due to Microascus cinereus.

  1. Discrimination analysis of ononis repens and ononis spinosa of the ...

    African Journals Online (AJOL)

    Discrimination analysis of ononis repens and ononis spinosa of the British Isles. CE Stephens. Abstract. No Abstract. Journal of the Ghana Association Vol. 2 (3) 1999: pp.88-94. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/jgsa.v2i3.17997.

  2. Mycorrhizal symbioses of Salix repens : diversity and functional significance

    NARCIS (Netherlands)

    Heijden, van der E.W.

    2000-01-01

    This thesis investigates the significance of different mycorrhizal fungi, belonging to different functional types (arbuscular mycorrhiza-AM and ectomycorrhiza-EcM), in Salix repens . A comparison between above-ground and below-ground observations on ectomycorrhizal

  3. Polyol concentrations in Aspergillus repens grown under salt stress.

    Science.gov (United States)

    Kelavkar, U P; Chhatpar, H S

    1993-09-01

    Na(+), K(+) and the ratio of Na(+)/K(+) were higher in cells of the halotolerant Aspergillus repens grown with 2 M NaCl than without NaCl. The osmolytes, proline, glycerol, betaine and glutamate, did not affect the Na(+)/K(+) ratio, nor the polyol content of cells under any conditions. The concentrations of polyols, consisting of glycerol, arabitol, erythritol and mannitol, changed markedly during growth, indicating that they have a crucial role in osmotic adaptation.

  4. Diuretic activity of ethanolic extract of Panicum repens L. roots and rhizomes.

    Science.gov (United States)

    Hozaien, Hoda E; El-Tantawy, Walid Hamdy; Temraz, Abeer; El-Gindi, Omayma D; Taha, Kamilia F

    2018-02-08

    The diuretic activity of ethanolic extract of Panicum repens was investigated in rats. A single oral dose of 500 mg/kg of P. repens extract were given to rats, after 24 h, urine volume, its sodium and potassium concentrations were estimated. Treatment with P. repens extract caused a significant increase in tested parameters as compared to their corresponding controls, p < 0.05.

  5. Forma de crecimiento en Leptochloa Chloridiformis (Poaceae

    Directory of Open Access Journals (Sweden)

    Mariel G. Perreta

    2000-01-01

    Full Text Available Perreta, M. G., Tivano, J. C. & Vegetti, A. C. 2000. Forma de crecimiento en Leptochloachloridiformis (Poaceae. Darwiniana 38(3-4: 219-226.El objetivo de este trabajo fue analizar la forma de crecimiento de Leptochloa chloridiformis (Hack.Parodi. En esta especie perenne la ramificación ocurre principalmente a través de yemas axilarespresentes en la zona de innovación. Este sistema de ramificación genera una planta cespitosa, en la cual lasconexiones entre unidades estructurales son rizomas cortos. Dependiendo de su posición estas conexio-nes muestran diferentes tendencias en relación a la desarticulación estructural. En algunas plantas seobservó ramificación en la zona de entrenudos largos posiblemente debido a cambios ambientalesrelacionados con las distintas estaciones

  6. Eurotium (Aspergillus) repens metabolites and their biological activity.

    Science.gov (United States)

    Podojil, M; Sedmera, P; Vokoun, J; Betina, V; Baráthová, H; Duracková, Z; Horáková, K; Nemec, P

    1978-01-01

    Eurotium repens mycelium cultivated under static conditions was used to isolate and identify metabolities--echinulin, physcion, erythroglaucin, flavoglaucin and asperentin; the filtrate of the culture yielded asperentin 8-methylether. The broadest biological activity spectrum was displayed by asperentin which had antibacterial and antifungal effects and, at a concentration of 86 microgram/ml, caused 50% mor7 tality in Artemia saline larvae. The highest cytotoxicity towards HeLa cells was found in physcion which caused 50% growth inhibition at a concentration of 0.1 microgram/ml.

  7. Se enhanced phytoremediation of diesel in soil by Trifolium repens.

    Science.gov (United States)

    Xi, Ying; Song, Yizhi; Johnson, David M; Li, Meng; Liu, Huigang; Huang, Yingping

    2018-06-15

    A pot-culture experiment was conducted to assess the effects of selenium (Se) (0.5 mg kg -1 ) on Trifolium repens exposed to various levels of diesel (0, 15, 20, 25 g kg -1 ) for 30 days and 60 days. Exposure to diesel for 60 day led to concentration-dependent decreases in root morphogenesis, chlorophyll content and CAT activity, and to dose-dependent increases in MDA content and SOD activity. The residual diesel concentration in soil increased and the removal efficiency decreased with soil diesel concentration. The chlorophyll content and residual diesel concentration after were slightly higher at 30 days than at 60days. Application of Se to soil increased Trifolium repens tolerance to diesel and significantly increased the phytoremediation effect at 60 days, with a removal rate of 36 ± 8%, compared to 28 ± 7% in the control. These results contribute to the ongoing effort to develop an effective phytoremediation system for soils highly contaminated by diesel. Copyright © 2018 Elsevier Inc. All rights reserved.

  8. Characterization of oils from Duranta repens leaf and seed

    Directory of Open Access Journals (Sweden)

    Agomuo Emmanuel

    2017-11-01

    Full Text Available The knowledge of the chemical composition of unpopular sources of edible oils has become paramount to supplement the usage of widely known vegetable oils. In this study, the gas chromatographic quantification of fatty acids and phytochemicals was carried out, and the physicochemical and micronutrient composition of Duranta repens leaf and seed oil were evaluated using standard methods. The leaf oils contained significantly higher (p  oleic > myristic > stearic > capric > linoleic > lauric > palmitoleic for the seed oil, while for the leaf oil linoleic > palmitoleic > oleic > stearic > palmitic > myristic > capric > lauric > myristoleic. The major phytochemical constituents of the seed oils were catechin (68.12 ug/ml, saponin (44.03 ug/ml, rutin (32.89 ug/ml, linamarin (22.66 ug/ml and tannins (19.62 ug/ml, while kaempherol (84.05 ug/ml, rutin (62.26 ug/ml and saponins (45.63 ug/ml were mostly predominant in the leaf oil. Spartein, anthocyanins and phytates were among the least phytochemicals in composition, for both samples. These chemical properties evaluated, suggest that Duranta repens seed oil is more suitable for industrial and therapeutic purposes.

  9. A RUMINATE EMBRYO IN BLEPHARIS REPENS (VAHL. ROTH. (ACANTHACEAE

    Directory of Open Access Journals (Sweden)

    Nitin M. LABHANE

    2014-12-01

    Full Text Available The study of morphology of embryo is very significant considering the fact that the embryo represents the important step in the determination of the viability of the seed. Ruminate endosperm has been reported in about 58 families of angiosperms. The rumination caused by the activity of the seed coat or by the endosperm itself is quite recurrent in angiosperm. Ruminate endosperm due to seed coat is reported from the family Acanthaceae in Andrographis paniculata. The rumination of endosperm is also considered as phylogenetically important. Rumination of endosperm is very common, however very little is known about rumination in embryo. The present papers reports the de novo development of ruminate embryo in Blepharis repens. The development of ruminate embryo is seen as an adaptation to ensure proper aeration and optimum germination for survival of the species.

  10. First insights into the evolutionary history of the Davallia repens complex

    NARCIS (Netherlands)

    Chen, C.-W.; Ngan, L.T.; Hidayat, A.; Evangelista, L.; Nooteboom, H.P.; Chiou, W.-L.

    2014-01-01

    Davallia repens and its close relatives have been identified as a species complex in this study because of the existence of continuously morphological variation. To decipher its evolutionary history, integrated methodologies were applied in this study including morphology, cytology, reproductive

  11. Antioxidative potential of Duranta repens (linn.) fruits against H 2 O 2 ...

    African Journals Online (AJOL)

    The effects of Duranta repens fruits were investigated on H2O2 induced oxidative cell death to evaluate its antioxidative potential in vitro. HEK293T cells were treated with different concentrations [0-1000 ìg/ ml] of ethanol extract (E-Ex) and methanol extract (M-Ex) of D. repens for 24h, and then treated with 100 ìM H2O2 for ...

  12. Treatment of male androgenetic alopecia with topical products containing Serenoa repens extract.

    Science.gov (United States)

    Wessagowit, Vesarat; Tangjaturonrusamee, Chinmanat; Kootiratrakarn, Tanawatt; Bunnag, Thareena; Pimonrat, Tanatya; Muangdang, Nattaporn; Pichai, Pitchayasak

    2016-08-01

    Male androgenetic alopecia (AGA) is a common hair problem. Serenoa repens extract has been shown to inhibit both types of 5-α reductase and, when taken orally, has been shown to increase hair growth in AGA patients. The aim of this study was to assess the efficacy of topical products containing S. repens extract for the treatment of male AGA. This was a pilot, prospective, open, within-subject comparison limited to 24 weeks using no placebo controls. In all, 50 male volunteers aged between 20 and 50 years received topical S. repens products for 24 weeks. The primary end-point was a hair count in an area of 2.54 cm(2) at week 24. Secondary end-points included hair restoration, investigators' photographic assessment, patients' evaluation and discovering adverse events. The average hair count and terminal hair count increased at weeks 12 and 24 compared to baseline. Some of these positive results levelled off at week 24, presumably because the concentrated topical product containing S. repens extract was stopped after 4 weeks. The patients were satisfied with the products and the side-effects were limited. The topical application of S. repens extract could be an alternative treatment in male pattern baldness in male patients who do not want or cannot tolerate the side-effects of standard medications, but the use of a concentrated S. repens product beyond 4 weeks may be necessary for sustained efficacy. © 2015 The Australasian College of Dermatologists.

  13. Produção de mudas de Duranta repens L. pelo processo de estaquia Seedlings production ofduranta Duranta repens L. using cuttings process

    Directory of Open Access Journals (Sweden)

    Genilda Canuto Amaral

    2012-06-01

    Full Text Available Devido a fácil adaptação ao clima, solo e por ter um potencial ornamental, a Duranta repens L. é muito utilizada no Brasil. Contudo, objetivou-se avaliar a produção de mudas de D. repens L. pelo processo de estaquia com fornecimento exógeno de AIB em diferentes estações do ano. O delineamento experimental foi inteiramente casualizado, com quatro concentrações de AIB (0, 1000, 3000 e 5000 mg kg-1, três tipos de estacas (herbáceas, semilenhosas e lenhosas e duas épocas do ano (chuvosa e seca. Realizaram-se as avaliações do número de estacas com raízes, sobrevivência das estacas, número de brotações por estaca, comprimento médio da maior raiz e massa seca da parte aérea e da raiz. A dose indicada para propagação de D. repens é de 3000 mg kg-1AIB. As estacas herbáceas e semilenhosas são as mais indicadas e a época chuvosa é mais propícia para produção de mudas de D. repens.Due to easy adaptation to climate, soil and ornamental potential, Duranta repens L. is widely used in Brazil. The study evaluated the production of seedlings of D. repens L. using cutting process with the supply of exogenous IBA in different seasons. The experimental design was completely randomized, with four concentrations of IBA (0, 1000, 3000 e 5000 mg kg-1, three types of cuttings (softwood, semi-hardwood and hardwood and two seasons (wet and dry. We assessed the number of rooted cuttings, survival cuttings, number of shoots per cutting, average length of the longest root and dry mass of shoots and roots. The best dose for propagation of D. repens was 3000 mg kg-1 IBA. The softwood and semi-hardwood cuttings were the most suitable and the rainy season the more favorable for D. repens seedling production.

  14. Nature of ergastic substances in some Poaceae seeds | Idu | African ...

    African Journals Online (AJOL)

    Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and protein and were devoid of tannins and inulin. Only 12 seed samples indicated the presence of alkaloids. The Positively ...

  15. Nature of ergastic substances in some Poaceae seeds

    African Journals Online (AJOL)

    ajl yemi

    2011-08-29

    Aug 29, 2011 ... 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011. Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and ...

  16. Hepatotoxicity potential of saw palmetto (Serenoa repens) in rats.

    Science.gov (United States)

    Singh, Y N; Devkota, A K; Sneeden, D C; Singh, K K; Halaweish, F

    2007-02-01

    Saw palmetto (Serenoa repens L.) is an herbal drug used to treat symptoms of benign prostatic hyperplasia (BPH) and lower urinary tract symptoms (LUTS). There has been a report that a preparation containing this herb has caused cholestatic hepatitis in one person and some indications exist that it may have the potential to produce liver toxicity. The purpose of this study was to evaluate the effect of saw palmetto on rat liver function by measuring its effects on several enzymes and formation of malondialdehyde (MDA), a byproduct of lipid peroxidation. A significant increase in these parameters is considered an indication of liver toxicity. Thirty-six rats were divided into 6 groups of 6 animals each. They were treated for 2 or 4 weeks with a placebo or saw palmetto at doses of 9.14 or 22.86 mg/kg/body wt./day; that is, 2 x and 5 x the maximum recommended daily human dosages. After 2 or 4 weeks, the animals were sacrificed and blood was collected to prepare serum for enzyme assays, which were performed using commercially available kits. A portion of the liver was removed, and a homogenate prepared for the lipid peroxidation assay. Results showed no significant difference in animal body weight, enzyme activity, or MDA formation at either time or dosage level, as compared to controls. The data indicate that at the doses and time periods tested, saw palmetto did not produce any significant effect on the normal biological markers of liver toxicity.

  17. Androgen-independent effects of Serenoa repens extract (Prostasan®) on prostatic epithelial cell proliferation and inflammation

    DEFF Research Database (Denmark)

    Iglesias-Gato, Diego; Carsten, Tober; Vesterlund, Mattias

    2012-01-01

    Extracts from Serenoa repens are widely used for the treatment of benign prostatic hyperplasia (BPH) and traditionally for prostatitis. In the present study we evaluated the biological effects of Serenoa repens extract (Prostasan®) on prostate cells beyond its known antiandrogenic actions. Prosta...

  18. Human Ocular Infection with Dirofilaria repens (Railliet and Henry, 1911) in an Area Endemic for Canine Dirofilariasis

    Science.gov (United States)

    Otranto, Domenico; Brianti, Emanuele; Gaglio, Gabriella; Dantas-Torres, Filipe; Azzaro, Salvatore; Giannetto, Salvatore

    2011-01-01

    Dirofilaria repens, which is usually found in canine subcutaneous tissues, is the main causative agent of human dirofilariasis in the Old Word. However, a relationship between animal and human cases of dirofilariasis caused by D. repens in a given area has never been demonstrated. The uneven distribution of D. repens in provinces in Sicily, Italy represented the foundation for this study. We report a human case of ocular infection with D. repens from Trapani Province, where canine dirofilariasis is endemic. The nematode was morphologically and molecularly identified and surgical removal of the parasite was documented. The relationship between the prevalence of D. repens in dogs and the occurrence of human cases of ocular dirofilariasis is discussed on the basis of a review of the historical literature. PMID:21633041

  19. Dirofilaria in Humans, Dogs, and Vectors in Austria (1978-2014)-From Imported Pathogens to the Endemicity of Dirofilaria repens.

    Science.gov (United States)

    Fuehrer, Hans-Peter; Auer, Herbert; Leschnik, Michael; Silbermayr, Katja; Duscher, Georg; Joachim, Anja

    2016-05-01

    Dirofilaria repens and D. immitis are filarioid helminths with domestic and wild canids as main hosts and mosquitoes as vectors. Both species are known to cause zoonotic diseases, primarily pulmonary (D. immitis), ocular (D. repens), and subcutaneous (D. repens) dirofilariosis. Both D. immitis and D. repens are known as invasive species, and their distribution seems associated with climate change. Until very recently, both species were known to be nonendemic in Austria. Metadata on introduced and possibly autochthonous cases of infection with Dirofilaria sp. in dogs and humans in Austria are analysed, together with analyses of mosquito populations from Austria in ongoing studies. In Austria, most cases of Dirofilaria sp. in humans (30 cases of D. repens-six ocular and 24 subcutaneous) and dogs (approximately 50 cases-both D. immitis and D. repens) were most likely imported. However, occasionally infections with D. repens were discussed to be autochthonous (one human case and seven in dogs). The introduction of D. repens to Austria was confirmed very recently, as the parasite was detected in Burgenland (eastern Austria) for the first time in mosquito vectors during a surveillance program. For D. immitis, this could not be confirmed yet, but data from Germany suggest that the successful establishment of this nematode species in Austria is a credible scenario for the near future. The first findings of D. repens in mosquito vectors indicate that D. repens presumably invaded in eastern Austria. Climate analyses from central Europe indicate that D. immitis also has the capacity to establish itself in the lowland regions of Austria, given that both canid and culicid hosts are present.

  20. Poaceae pollen as the leading aeroallergen worldwide: A review.

    Science.gov (United States)

    García-Mozo, H

    2017-12-01

    The Poaceae family comprises over 12 000 wind-pollinated species, which release large amounts of pollen into the atmosphere. Poaceae pollen is currently regarded as the leading airborne biological pollutant and the chief cause of pollen allergy worldwide. Sensitization rates vary by country, and those variations are reviewed here. Grass pollen allergens are grouped according to their protein structure and function. In Poaceae, although species belonging to different subfamilies are characterized by distinct allergen subsets, there is a considerable degree of cross-reactivity between many species. Cross-reactivity between grass pollen protein and fresh fruit pan-allergens is associated with the appearance of food allergies. The additional influence of urban pollution may prompt a more severe immunological response. The timing and the intensity of the pollen season are governed by species genetics, but plant phenology is also influenced by climate; as a result, climate changes may affect airborne pollen concentrations. This article reviews the findings of worldwide research which has highlighted the major impact of climate change on plant phenology and also on the prevalence and severity of allergic disease. © 2017 EAACI and John Wiley and Sons A/S. Published by John Wiley and Sons Ltd.

  1. Optical Analysis of Reduction Products of 2-Methylcyclohexanone by Aspergillus repens MA0197.

    Science.gov (United States)

    Onishi, H; Doi, M; Shuto, Y; Kinoshita, Y

    1996-01-01

    The products of reduction of 2-methylcyclohexanone by Aspergillus repens MA0197 were analyzed quantitatively by GC after conversion to corresponding diastereoisomeric ( -)-menthyl carbonate derivatives. Although the contents varied considerably with time, the predominant production of S-alcohol was observed, that is, Prelog's rule was obeyed.

  2. A First Human Case of Ocular Dirofilariosis due to Dirofilaria repens in Northeastern France

    Science.gov (United States)

    Argy, Nicolas; Sabou, Marcela; Billing, Alain; Hermsdorff, Christian; Candolfi, Ermanno; Abou-Bacar, Ahmed

    2011-01-01

    We report the first case of ocular dirofilariasis to be diagnosed in northeast France (Alsace region), in a man who presented with a suborbital mass after a journey to Senegal. Microscopic examination of the surgical specimen identified Dirofilaria repens. PMID:21461355

  3. A First Human Case of Ocular Dirofilariosis due to Dirofilaria repens in Northeastern France

    Directory of Open Access Journals (Sweden)

    Nicolas Argy

    2011-01-01

    Full Text Available We report the first case of ocular dirofilariasis to be diagnosed in northeast France (Alsace region, in a man who presented with a suborbital mass after a journey to Senegal. Microscopic examination of the surgical specimen identified Dirofilaria repens.

  4. Dirofilaria repens: emergence of autochthonous human infections in the Czech Republic (case reports)

    Czech Academy of Sciences Publication Activity Database

    Matějů, J.; Chanová, M.; Modrý, David; Mitková, B.; Hrazdilová, K.; Žampachová, V.; Kolářová, L.

    2016-01-01

    Roč. 16, APR 19 (2016), č. článku 171. ISSN 1471-2334 Institutional support: RVO:60077344 Keywords : Dirofilaria repens * Human dirofilariasis * Emerging disease * Autochthonous diseases in Czech Republic Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.768, year: 2016

  5. Zoonotic Dirofilaria repens (Nematoda: Filarioidea) in Aedes vexans mosquitoes, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Rudolf, Ivo; Šebesta, Oldřich; Mendel, Jan; Betášová, Lenka; Bocková, E.; Jedličková, Petra; Venclíková, Kristýna; Blažejová, Hana; Šikutová, Silvie; Hubálek, Zdeněk

    2014-01-01

    Roč. 113, č. 12 (2014), s. 4663-4667 ISSN 0932-0113 EU Projects: European Commission(XE) 261504 - EDENEXT Institutional support: RVO:68081766 Keywords : Aedes vexans * Mosquito vectors * Dirofilaria repens * Dogs * Zoonotic dirofilariosis * Setaria spp. Subject RIV: EG - Zoology Impact factor: 2.098, year: 2014

  6. Dirofilaria immitis and D. repens show circadian co-periodicity in naturally co-infected dogs

    Czech Academy of Sciences Publication Activity Database

    Ionică, A.M.; Matei, I.A.; D'Amico, G.; Bel, L.; Dumitrache, M.O.; Modrý, David; Mihalca, A. D.

    2017-01-01

    Roč. 10, FEB 28 (2017), č. článku 116. ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : periodicity * microfilariae * co-infection * Dirofilaria immitis * Dirofilaria repens Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 3.080, year: 2016

  7. Subcutaneous dirofilariosis (Dirofilaria repens: an infection spreading throughout the old world

    Directory of Open Access Journals (Sweden)

    Claudio Genchi

    2017-11-01

    Full Text Available Abstract Background Two main Dirofilaria species infect dogs: D. immitis and D. repens. While D. immitis has a worldwide distribution, D. repens is currently found only in Europe, Asia, and Africa. Adult D. repens are located in subcutaneous tissues of natural hosts where they survive for long periods of time. First-stage larvae, microfilariae, circulate in the peripheral bloodstream, where they are taken up by the mosquito intermediate hosts. Infected mosquitoes then transmit infective third-stage (L3 larvae to new hosts through the blood meal. In dogs, most infections are asymptomatic, although cutaneous disorders such as pruritus, dermal swelling, subcutaneous nodules, and ocular conjunctivitis can be observed. Currently, two factors have increased the concerns about this parasitic infection 1 its spread throughout the European countries and to other continents and its prevalence in dog populations, where in some cases it has overcome D. immitis; and 2 its zoonotic potential, which is much greater than that of D. immitis. Results Different hypotheses can be put forward to explain these concerns. First, climate change has allowed more favorable conditions for survival of culicid vectors. Second, accidental hosts such as humans may have a less efficient immune reaction against a parasite that is located in subcutaneous tissues, and thus less exposed to the host’s immune response than, for instance, D. immitis. Furthermore, the absence of clinical signs in the majority of canine infections and the difficulty in diagnosing the infection, due to the lack of serologic tests and thus the reliance on the identification of microfilariae and differentiation from D. immitis to confirm the presence of the parasite, favor the further spread of this species. Finally, among the macrocyclic lactones currently used to prevent heartworm infection, only moxidectin has been found to be fully effective against the infective larvae transmitted by mosquitoes and

  8. First record of the alien pest Rhaponticum repens (Compositae in the Iberian Peninsula

    Directory of Open Access Journals (Sweden)

    Martínez-Flores, F.

    2011-12-01

    Full Text Available First record of the alien pest Rhaponticum repens (Compositae in the Iberian Peninsula.- Rhaponticum repens is reported for the first time for the flora of the Iberian Peninsula. The species is native from Central Asia and has become invasive in Argentina, Canada, Europe and the USA. It was detected for the first time in abandoned fields from Vilablareix, near the city of Girona (Catalonia, Spain and in the valley of the Vinalopó in Alicante (Valencia, Spain, where it was collected as early as in 1959 but misdentified. Molecular data, based on nrDNA region ITS, suggest that the reported populations may be closely related to plants from the United States. Due to the extremely noxious character of the species and the possible relationship of Spanish plants with the invasive American populations, some kind of monitoring is recommended.Rhaponticum repens (Compositae, una nueva planta alóctona para la Península Ibérica.- Se cita por primera vez la especie Rhaponticum repens para la flora de la Península Ibérica. Rhaponticum repens es una especie nativa de Asia central que actúa como invasora en diversos países como Argentina, Canadá o los Estados Unidos. Se ha encontrado por primera vez en campos de cultivo abandonados en el pueblo de Vilablareix, cerca de la ciudad de Girona (Cataluña, España y en el valle del Vinalopó (Valencia, España, donde fue recolectada y mal identificada en 1959. Los datos moleculares, obtenidos a partir de la región ITS del nrDNA, sugieren que estas poblaciones podrían estar relacionadas con plantas invasoras de Estados Unidos. Debido al carácter extremadamente invasor de la especie, y a su posible origen secundario a partir de las poblaciones norteamericanas, se recomienda el seguimiento de estas poblaciones.

  9. O gênero Chloris (Poaceae) em Pernambuco, Brasil

    OpenAIRE

    Maciel, Jefferson Rodrigues; Silva, Wegliane Campelo da; Costa-e-Silva, Maria Bernadete

    2013-01-01

    Com o objetivo de colaborar com o conhecimento da riqueza de Poaceae em Pernambuco, foi estudado o gênero Chloris Sw. As coletas foram realizadas no estado, bem como dados foram coligidos de levantamento em herbários da região. Foram registradas sete espécies de Chloris em Pernambuco: C. barbata Sw., C. elata Desv., C. exilis Renv., C. gayana Kunth, C. orthonoton Döll, C. pycnothrix Trin. e C. virgata Sw. O gênero apresenta distribuição ampla em todas as zonas fitogeográficas do estado. Chlor...

  10. Sodium chloride stress induced morphological and ultrastructural changes in Aspergillus repens.

    Science.gov (United States)

    Kelavkar, U; Rao, K S; Ghhatpar, H S

    1993-06-01

    Halotolerant fungus, A. repens, showed a considerable difference in its growth rate, morphology, ultrastructural and molecular composition under NaCl stress as compared to control i.e. non-stressed condition. Light microscopic observations revealed significant differences in their mycelial thickness, their branching and septa. Transmission electron microscopic observations of both the conditions depicted significant differences in the qualitative and quantitative changes in mitochondria. Frequent pinocytotic vesiculation (vacuoles) of plasma membrane was observed in fungus under stress but no such vesiculation in control. The multivesiculate structures observed under stress with their origin from the cell membranes and subsequent release into vacuoles have not been reported in fungi under normal physiological conditions. The observations on pinocytosis are discussed in relation to ion compartmentation and salt tolerance in A. repens.

  11. [A case of human dirofilariasis (D. repens) of the spermatic cord].

    Science.gov (United States)

    Fini, M; Perrone, A; Vagliani, G; Andreini, C; Salvi, G; Misuriello, G; Di Silverio, A

    1992-01-01

    A 52 year old man, living in the province of Trapani (Sicily), presented with right hydrocele and slight orchialgia. The patient underwent epididymectomy and resection of T. vaginalis. The "tunica" was involved by a granulomatous process, containing a parasite of genus Dirofilaria (D. repens). Dirofilaria repens is a filarial nematode. Dogs, foxes and cats are the definitive hosts and principal reservoirs of the parasite. In humans the parasite dies before reaching sexual maturity and the result is an inconspicuous granulomatous reaction in the subcutaneous tissue. S. Pampiglione et al. (Cattedra di Parassitologia Veterinaria dell'Università di Bologna-Italy) reported from 1971 more than 30 cases of human Dirofilariasis in Italy, suggesting that the parasite is able to migrate from the inoculation site to other districts (lung, eye etc.). The case is exceptional for the localization of the parasite (never reported) and can contribute to a better knowledge of the disease.

  12. Dirofilaria repens eyepiece: a case in Calabria and diagnostic indications concerning dirofilariosis

    Directory of Open Access Journals (Sweden)

    Carlo Mancuso

    2013-04-01

    Full Text Available Dirofilaria repens is a nematode that affects dogs and other carnivores such as cats, wolves, foxes, which are final hosts. It is carried to the men by mosquitos (Anopheles, Culex and Aedes and, particularly, by Aedes albopictus. It causes in the humans the formation of subcutaneous nodules and, at ocular conjunctiva level, the formation of cysts. Its diagnosis is made by methods of Molecular Biology because the identification based only on the morphology is very difficult. In the mounth of November 2012, comes to the first aid of Cetraro Hospital a old woman with a conjunctival cyst to right eye which causes pain, itch and lachrymation. From this cyst, is extracted a worm, identified as Dirofilaria repens. This diagnosis is confirmed by investigations of Molecular Biology discharged in the Superior Institute of Health of Rome.

  13. Trifolium pratense and T. repens (Leguminosae: Edible Flower Extracts as Functional Ingredients

    Directory of Open Access Journals (Sweden)

    Rosa Tundis

    2015-08-01

    Full Text Available Trifolium pratense (red clover and T. repens (white clover edible flowers were investigated for their chemical profile and health properties. The total phenols and flavonoids contents were evaluated. Quercetin, kaempferol, luteolin, rutin, and myricetin were used as markers and quantified by HPLC. The antioxidant effects were investigated by using different in vitro assays. Moreover, α-amylase, α-glucosidase and lipase inhibitory activities were evaluated. T. repens flowers extract showed a good radical scavenging activity in both DPPH and ABTS tests with IC50 values of 10.3 and 21.4 μg/mL, respectively. White clover extract demonstrated promising α-amylase and lipase inhibitory activities with IC50 values of 25.0 and 1.3 μg/mL, respectively. The obtained results support the use of Trifolium flowers as healthy food ingredients.

  14. Phytochemical screening, antiglycation and antioxidant activities of whole plant of Boerhavia repens L. from Cholistan, Pakistan.

    Science.gov (United States)

    Nazneen, Fariha; Sheikh, Munir A; Jameel, Amir; Rahman, Ziaur

    2016-05-01

    Present study was aimed to explore a traditionally used indigenous medicinal plant Boerhavia repens (Nyctaginaceae family) of the Cholistan desert, Pakistan. Crude aqueous and methanolic extracts of the whole plant were investigated in vitro for preliminary phytochemical screening, antioxidant and antiglycation activities. Antioxidant activities were determined by total phenolic contents, 1,1-diphenyl-2-picrylhydrazyl (DPPH) free radical scavenging and inhibition of lipid peroxidation. For antiglycation activities browning production was noted and thiobarbituric acid (TBA) technique was used to determine glycation level. Boerhavia repens expressed considerable amounts of phytochemicals. Extract yield was found to be 4.59%-7.85% g/100g of dry matter with total phenolics ranging from 47.9- 190.77mg/GAE per g for aqueous and methanol extract respectively. Strong inhibitory effect was exhibited by methanolic extract in linoleic acid per oxidation system (86.11%, EC50=0.99mg/mL) and DPPH assay (88.65%, EC50=212.33μg/ml). In term of browning maximum inhibition (81.50%) was exhibited by methanolic extract at 37°C at third week of incubation. Both extracts expressed significant (P>0.05) and comparable inhibition of glycation level. In conclusion, Boerhavia repens showed promising antioxidant and antiglycation activities validating its therapeutic potential.

  15. Mitigation of salt stress in white clover (Trifolium repens) by Azospirillum brasilense and its inoculation effect.

    Science.gov (United States)

    Khalid, Muhammad; Bilal, Muhammad; Hassani, Danial; Iqbal, Hafiz M N; Wang, Hang; Huang, Danfeng

    2017-12-01

    Salinity is one of the increasingly serious environmental problems worldwide for cultivating agricultural crops. The present study was aimed to ascertain the potential of beneficial soil bacterium Azospirillum brasilense to alleviate saline stress in Trifolium repens. Experimental plants (white clover) were grown from seeds and inoculated with or without A. brasilense bacterial strain supplemented with 0, 40, 80, or 120 mM NaCl into soil. The growth attributes including, shoot heights, root lengths, fresh and dry weights, leaf area and chlorophyll content were significantly enhanced in T. repens plants grown in A. brasilense inoculated soil than un-inoculated controls, particularly under elevated salinity conditions (40, 80 and 120 mM NaCl). Malondialdehyde content of leaf was recorded to be declined under saline conditions. Moreover, the K + /Na + ratio was also improved in bacterium-inoculated plants, since A. brasilense significantly reduced the root and shoot Na + level under high salty environment. Results revealed that soil inoculation with A. brasilense could significantly promote T. repens growth under both non-saline and saline environments, and this study might be extended to other vegetables and crops for the germination and growth enhancement.

  16. Morphological response to competition for light in the clonal Trifolium repens (Fabaceae).

    Science.gov (United States)

    Bittebiere, Anne-Kristel; Renaud, Nolwenn; Clément, Bernard; Mony, Cendrine

    2012-04-01

    Plant communities in temperate zones are dominated by clonal plants that can plastically modify their growth characteristics in response to competition. Given that plants compete with one another, and the implications this has for species coexistence, we conducted a study to assess how clonal species morphologically respond to competition for light depending on its intensity and heterogeneity, which are determined by the competitor species. We assessed the morphological response to competition for light of the clonal species Trifolium repens L. by measuring its growth performance, and vertical and horizontal growth traits. We used five competitive environments, i.e., one without competitor and four differing by their competitor species creating different conditions of competition intensity and heterogeneity. The morphological response of Trifolium repens to competition for light depended on the competitor identity. Competition intensity and heterogeneity, determined by competitor identity, had an interactive effect on most traits. The increase in petiole elongation and specific leaf area due to increased competition intensity was observed only at low to intermediate competition heterogeneity. Competition heterogeneity promoted the elongation of clone connections allowing space exploration. Our results demonstrated that the intensity and heterogeneity of competition, which depended on competitor identity, are of primary importance in determining the plastic response of Trifolium repens. This emphasizes that it is important to consider the fine-scale spatial distribution of individuals when studying their interactions within plant communities.

  17. Chemotaxonomy as a tool for interpreting the cryptic diversity of Poaceae pollen

    NARCIS (Netherlands)

    Julier, A.C.M.; Jardine, P.E.; Coe, A.L.; Gosling, W.D.; Lomax, B.H.; Fraser, W.T.

    2016-01-01

    The uniform morphology of different species of Poaceae (grass) pollen means that identification to below family level using light microscopy is extremely challenging. Poor taxonomic resolution reduces recoverable information from the grass pollen record, for example, species diversity and

  18. Development of Dirofilaria immitis and Dirofilaria repens in Aedes japonicus and Aedes geniculatus

    Directory of Open Access Journals (Sweden)

    Cornelia Silaghi

    2017-02-01

    Full Text Available Abstract Background The mosquito-borne filarial nematodes Dirofilaria immitis and Dirofilaria repens primarily affect dogs but also cats, causing heartworm disease or subcutaneous dirofilariosis, respectively, and both may also cause zoonotic diseases in humans. Several mosquito species have been reported as competent vectors for these nematodes, but no data are available for the invasive mosquito species Aedes japonicus (Theobald, 1901. The objective of this study was to describe the development of both D. immitis and D. repens under standardised experimental laboratory conditions in mosquitoes. Methods For this purpose, both a laboratory strain and field-collected individuals of the invasive mosquito species Ae. japonicus and, for comparative purposes, a laboratory strain of Aedes geniculatus, a rare indigenous species sharing habitats with Ae. japonicus, and of the tropical species Aedes aegypti were used. Anticoagulated microfilariaemic blood was fed at a density of 3000 mf/ml to mosquitoes with a hemotek system. Blood-fed mosquitoes were incubated at 27 °C and 85% relative humidity, and specimens were dissected under the microscope at pre-set time points to observe developmental stages of both Dirofilaria species. Additionally, real-time PCRs were carried out in some microscopically negative samples to determine the infection rates. Results In field-collected Ae. japonicus infectious L3 larvae of both D. immitis and D. repens developed, rendering this mosquito species an efficient vector for both filarial species. Additionally, Ae. geniculatus was shown to be an equally efficient vector for both filarial species. Aedes japonicus mosquitoes from a laboratory colony were refractory to D. immitis but susceptible to D. repens, whereas Ae. aegypti was refractory to both filarial species. Conclusions To our knowledge, Aedes japonicus was for the first time shown to be an efficient vector for both D. immitis and D. repens, indicating that this

  19. Révision du genre Digitaria Haller (Poaceae) au Sénégal ...

    African Journals Online (AJOL)

    Le genre Digitaria Haller (Poaceae) constitue l'un des genres les plus diversifiés des Poaceae du Sénégal avec 19 espèces. Bien qu'il y ait une monographie mondiale du genre, la détermination des espèces reste difficile et repose essentiellement sur les caractères de l'appareil reproducteur. Ce travail, qui est une ...

  20. CATÁLOGO DE LA FAMILIA POACEAE EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    Diego Giraldo-Cañas

    2011-01-01

    Full Text Available Se presenta un inventario de las especies de Poaceae de Colombia junto con un análisis de la diversidad específica de esta familia según las regiones naturales colombianas, los gradientes de altitud y de precipitaciones, y la distribución sistemática. Se realizaron 96 expediciones de campo a las diez grandes regiones naturales de Colombia (Amazonia, Andes, Caribe, Chocó Biogeográfico, Guayana, islas caribeñas, Orinoquia, Sierra Nevada de Santa Marta, valle del río Cauca y valle del río Magdalena con un muestreo total de alrededor de 5800 ejemplares. Además, se consultaron colecciones de los herbarios CAUP, COAH, COL, CUVC, CHOCO, HFAB, HUA, HUQ, JAUM, MEDEL, MEXU, MO, NY, PSO, RSA, SI, UDBC, UIS, US, VALLE y VEN, y se realizó una investigación bibliográfica exhaustiva. Las Poaceae están representadas en Colombia por 840 especies y 173 géneros. Se reconocieron 74 especies y un género (Agrostopoa endémicos. Por otra parte, se documentaron 83 especies introducidas-naturalizadas y 50 introducidas-cultivadas. Los géneros más ricos en especies son Paspalum (89 especies, Panicum (42, Festuca (36, Eragrostis (29, Calamagrostis (25, Chusquea (25, Digitaria (24, Axonopus (21, Setaria (20, Cenchrus (18, Poa (17, Muhlenbergia (16, Andropogon (15, Aristida (15, Agrostis (14, Lasiacis (12, Urochloa (12, Pariana (11, Sporobolus (11, Arthrostylidium (10, Cortaderia (10, Nassella (10, Neurolepis (10 y Schizachyrium (10. Durante el desarrollo de esta investigación, se descubrieron 10 nuevos registros para la flora colombiana. La regiones Andina, Orinocense, Caribe y Guayanesa son las más ricas en especies, con 583, 233, 186 y 179 especies, respectivamente. La Región Andina presenta el mayor número de especies endémicas (57 especies. Los gradientes altitudinales más diversos corresponden a los de las tierras bajas (por debajo de 1200 m s.m.. Al igual que en otras áreas tropicales, en Colombia las subfamilias de Poaceae muestran una

  1. Effectiveness on urinary symptoms and erectile function of Prostamev Plus® vs only extract Serenoa repens

    Directory of Open Access Journals (Sweden)

    Raffaele Marzano

    2015-03-01

    Full Text Available Prostatic inflammation is widespread in the male population. Two groups of 50 patients each with symptoms of prostatic inflammation and ecocolorDoppler indicative of prostatitis were identified. Both groups were further subdivided into two subgroups (respectively A1, A2, B1, and B2. Group A1 underwent therapy with oral levofloxacin 500 mg daily for 10 days plus co-treatment with oral Serenoa repens (320 mg plus Bromeline plus Nettle (Prostamev Plus® daily for two months; Group A2 with oral levofloxacin 500 mg daily for 10 days plus oral Serenoa repens extract 320 mg/day for two months; Group B1 specific antibiotic treatment for 10 days (included levofloxacin if sensitive plus co-treatment with oral Serenoa repens (320 mg plus Bromeline plus Nettle (Prostamev Plus® daily for two months; Group B2 with specific antibiotic treatment for 10 days plus Serenoa repens 320 mg/day for two months. The groups treated with Prostamev Plus® in comparison to the groups treated with Serenoa repens extract (saw palmetto achieved better improvements of both IPSS score, urinary flow and sexual life.

  2. The effects of arbuscular mycorrhizal fungi and root interaction on the competition between Trifolium repens and Lolium perenne.

    Science.gov (United States)

    Ren, Haiyan; Gao, Tao; Hu, Jian; Yang, Gaowen

    2017-01-01

    Understanding the factors that alter competitive interactions and coexistence between plants is a key issue in ecological research. A pot experiment was conducted to test the effects of root interaction and arbuscular mycorrhizal fungi (AMF) inoculation on the interspecies competition between Trifolium repens and Lolium perenne under different proportions of mixed sowing by the combination treatment of two levels of AMF inoculation (inoculation and non-inoculation) and two levels of root interaction (root interaction and non-root interaction). Overall, the aboveground and belowground biomass of T. repens and L. perenne were not altered by AMF inoculation across planting ratios, probably because the fertile soil reduced the positive effect of AMF on plant growth. Both inter- and intraspecies root interaction significantly decreased the aboveground biomass of T. repens , but tended to increase the aboveground biomass of L. perenne across planting ratios, and thus peaked at the 4:4 polyculture. These results showed that T. repens competed poorly with L. perenne because of inter and intraspecies root interaction. Our results indicate that interspecies root interaction regulates the competitive ability of grass L. perenne and legume T. repens in mixtures and further makes great contribution for overyielding. Furthermore, AMF may not be involved in plant-plant interaction in fertile condition.

  3. The effects of arbuscular mycorrhizal fungi and root interaction on the competition between Trifolium repens and Lolium perenne

    Directory of Open Access Journals (Sweden)

    Haiyan Ren

    2017-12-01

    Full Text Available Understanding the factors that alter competitive interactions and coexistence between plants is a key issue in ecological research. A pot experiment was conducted to test the effects of root interaction and arbuscular mycorrhizal fungi (AMF inoculation on the interspecies competition between Trifolium repens and Lolium perenne under different proportions of mixed sowing by the combination treatment of two levels of AMF inoculation (inoculation and non-inoculation and two levels of root interaction (root interaction and non-root interaction. Overall, the aboveground and belowground biomass of T. repens and L. perenne were not altered by AMF inoculation across planting ratios, probably because the fertile soil reduced the positive effect of AMF on plant growth. Both inter- and intraspecies root interaction significantly decreased the aboveground biomass of T. repens, but tended to increase the aboveground biomass of L. perenne across planting ratios, and thus peaked at the 4:4 polyculture. These results showed that T. repens competed poorly with L. perenne because of inter and intraspecies root interaction. Our results indicate that interspecies root interaction regulates the competitive ability of grass L. perenne and legume T. repens in mixtures and further makes great contribution for overyielding. Furthermore, AMF may not be involved in plant–plant interaction in fertile condition.

  4. Genome-wide distribution comparative and composition analysis of the SSRs in Poaceae.

    Science.gov (United States)

    Wang, Yi; Yang, Chao; Jin, Qiaojun; Zhou, Dongjie; Wang, Shuangshuang; Yu, Yuanjie; Yang, Long

    2015-02-15

    The Poaceae family is of great importance to human beings since it comprises the cereal grasses which are the main sources for human food and animal feed. With the rapid growth of genomic data from Poaceae members, comparative genomics becomes a convinent method to study genetics of diffierent species. The SSRs (Simple Sequence Repeats) are widely used markers in the studies of Poaceae for their high abundance and stability. In this study, using the genomic sequences of 9 Poaceae species, we detected 11,993,943 SSR loci and developed 6,799,910 SSR primer pairs. The results show that SSRs are distributed on all the genomic elements in grass. Hexamer is the most frequent motif and AT/TA is the most frequent motif in dimer. The abundance of the SSRs has a positive linear relationship with the recombination rate. SSR sequences in the coding regions involve a higher GC content in the Poaceae than that in the other species. SSRs of 70-80 bp in length showed the highest AT/GC base ratio among all of these loci. The result shows the highest polymorphism rate belongs to the SSRs ranged from 30 bp to 40 bp. Using all the SSR primers of Japonica, nineteen universal primers were selected and located on the genome of the grass family. The information of SSR loci, the SSR primers and the tools of mining and analyzing SSR are provided in the PSSRD (Poaceae SSR Database, http://biodb.sdau.edu.cn/pssrd/). Our study and the PSSRD database provide a foundation for the comparative study in the Poaceae and it will accelerate the study on markers application, gene mapping and molecular breeding.

  5. Development of saw palmetto (Serenoa repens) fruit and extract standard reference materials.

    Science.gov (United States)

    Schantz, Michele M; Bedner, Mary; Long, Stephen E; Molloy, John L; Murphy, Karen E; Porter, Barbara J; Putzbach, Karsten; Rimmer, Catherine A; Sander, Lane C; Sharpless, Katherine E; Thomas, Jeanice B; Wise, Stephen A; Wood, Laura J; Yen, James H; Yarita, Takashi; NguyenPho, Agnes; Sorenson, Wendy R; Betz, Joseph M

    2008-10-01

    As part of a collaboration with the National Institutes of Health's Office of Dietary Supplements and the Food and Drug Administration's Center for Drug Evaluation and Research, the National Institute of Standards and Technology has developed two standard reference materials (SRMs) representing different forms of saw palmetto (Serenoa repens), SRM 3250 Serenoa repens fruit and SRM 3251 Serenoa repens extract. Both of these SRMs have been characterized for their fatty acid and phytosterol content. The fatty acid concentration values are based on results from gas chromatography with flame ionization detection (GC-FID) and mass spectrometry (GC/MS) analysis while the sterol concentration values are based on results from GC-FID and liquid chromatography with mass spectrometry analysis. In addition, SRM 3250 has been characterized for lead content, and SRM 3251 has been characterized for the content of beta-carotene and tocopherols. SRM 3250 (fruit) has certified concentration values for three phytosterols, 14 fatty acids as triglycerides, and lead along with reference concentration values for four fatty acids as triglycerides and 16 free fatty acids. SRM 3251 (extract) has certified concentration values for three phytosterols, 17 fatty acids as triglycerides, beta-carotene, and gamma-tocopherol along with reference concentration values for three fatty acids as triglycerides, 17 fatty acids as free fatty acids, beta-carotene isomers, and delta-tocopherol and information values for two phytosterols. These SRMs will complement other reference materials currently available with concentrations for similar analytes and are part of a series of SRMs being developed for dietary supplements.

  6. Literature as a source for history The case of the Repen Ripangi (1886

    Directory of Open Access Journals (Sweden)

    Willem van der Molen

    2008-10-01

    Full Text Available Teks sejarah berbeda dengan teks sastra. Teks sejarah menceritakan apa yangbenar-benar terjadi di masa lalu sementara teks sastra tidaklah demikian.Oleh karena itu, sejarawan sering menghindari penggunaan teks sastra dalampenelitian mereka. Saya berargumen bahwa teks sastra dapat menambahkandimensi lain pada wawasan sejarah, yang tidak ditemukan dalam dokumensejarah. Analisis puisi Jawa berjudul Repen Ripangi dari abad kesembilan belasmenunjukkan bahwa teks ini, selain memberikan laporan yang sangat menariktentang pendamaian ideologis seorang reformis muslim, juga membuka jalanbagi penulisnya dalam menyuarakan kritiknya terhadap kekuasaan kolonialBelanda.

  7. Evaluation of health state and growth of Gypsophila paniculata L. and Gypsophila repens L. groving in soil in variable fertilization

    Directory of Open Access Journals (Sweden)

    Maria Warner

    2013-12-01

    Full Text Available The influence of NPK fertilization on plant growth and roots yield of Gypsophila paniculata and Gypsophila repens was investigated. The nutrients were applied in different proportions. The health state of Gypsophila was also analyzed. The pathogens isolated from plants showing the diseases symptoms represented eight species: Alternaria dianthicola Neergaard; Fusarium avenaceum (Fr. Sacc.; Fusarium culmorum (W. G.Smith Sacc.; F.equiseti (Cola Sacc.; F.oxysporum Schlecht., Snyder et Hansen; F.sambucinum Fuck; Phytophthora sp. de Bary; Rhizoctonia solani K. Fusarium oxysporum and other species of fungi were isolated from Gypsophila paniculata, whilst from Gypsophila repens only Fusarium oxysporum was obtained.

  8. Combining mechanical rhizome removal and cover crops for Elytrigia repens control in organic barley systems

    DEFF Research Database (Denmark)

    Melander, B; Nørremark, M; Kristensen, E F

    2013-01-01

    of vegetative propagules located within the plough layer to allow for quick re-establishment of a plant cover. A field experiment comparing the effects of conventional practices (stubble cultivation) with different combinations of rotary cultivation (One, Two or four passes) and cover crops (none vs. rye......-vetch-mustard mixture) on Elytrigia repens rhizome removal, shoot growth and suppression of a subsequent barley crop was examined in two growing seasons. Four passes with a modified rotary cultivator, where each pass was followed by rhizome removal, reduced E. repens shoot growth in barley by 84% and 97%. In general...

  9. Building supertrees: an empirical assessment using the grass family (Poaceae).

    Science.gov (United States)

    Salamin, Nicolas; Hodkinson, Trevor R; Savolainen, Vincent

    2002-02-01

    Large and comprehensive phylogenetic trees are desirable for studying macroevolutionary processes and for classification purposes. Such trees can be obtained in two different ways. Either the widest possible range of taxa can be sampled and used in a phylogenetic analysis to produce a "big tree," or preexisting topologies can be used to create a supertree. Although large multigene analyses are often favored, combinable data are not always available, and supertrees offer a suitable solution. The most commonly used method of supertree reconstruction, matrix representation with parsimony (MRP), is presented here. We used a combined data set for the Poaceae to (1) assess the differences between an approach that uses combined data and one that uses different MRP modifications based on the character partitions and (2) investigate the advantages and disadvantages of these modifications. Baum and Ragan and Purvis modifications gave similar results. Incorporating bootstrap support associated with pre-existing topologies improved Baum and Ragan modification and its similarity with a combined analysis. Finally, we used the supertree reconstruction approach on 55 published phylogenies to build one of most comprehensive phylogenetic trees published for the grass family including 403 taxa and discuss its strengths and weaknesses in relation to other published hypotheses.

  10. Anther and pollen development in some species of Poaceae (Poales

    Directory of Open Access Journals (Sweden)

    AT. Nakamura

    Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.

  11. Late Cretaceous origin of the rice tribe provides evidence for early diversification in Poaceae.

    Science.gov (United States)

    Prasad, V; Strömberg, C A E; Leaché, A D; Samant, B; Patnaik, R; Tang, L; Mohabey, D M; Ge, S; Sahni, A

    2011-09-20

    Rice and its relatives are a focal point in agricultural and evolutionary science, but a paucity of fossils has obscured their deep-time history. Previously described cuticles with silica bodies (phytoliths) from the Late Cretaceous period (67-65 Ma) of India indicate that, by the latest Cretaceous, the grass family (Poaceae) consisted of members of the modern subclades PACMAD (Panicoideae-Aristidoideae-Chloridoideae-Micrairoideae-Arundinoideae-Danthonioideae) and BEP (Bambusoideae-Ehrhartoideae-Pooideae), including a taxon with proposed affinities to Ehrhartoideae. Here we describe additional fossils and show that, based on phylogenetic analyses that combine molecular genetic data and epidermal and phytolith features across Poaceae, these can be assigned to the rice tribe, Oryzeae, of grass subfamily Ehrhartoideae. The new Oryzeae fossils suggest substantial diversification within Ehrhartoideae by the Late Cretaceous, pushing back the time of origin of Poaceae as a whole. These results, therefore, necessitate a re-evaluation of current models for grass evolution and palaeobiogeography.

  12. Dirofilaria in Humans, Dogs, and Vectors in Austria (1978–2014)—From Imported Pathogens to the Endemicity of Dirofilaria repens

    Science.gov (United States)

    Fuehrer, Hans-Peter; Auer, Herbert; Leschnik, Michael; Silbermayr, Katja; Duscher, Georg; Joachim, Anja

    2016-01-01

    Background Dirofilaria repens and D. immitis are filarioid helminths with domestic and wild canids as main hosts and mosquitoes as vectors. Both species are known to cause zoonotic diseases, primarily pulmonary (D. immitis), ocular (D. repens), and subcutaneous (D. repens) dirofilariosis. Both D. immitis and D. repens are known as invasive species, and their distribution seems associated with climate change. Until very recently, both species were known to be nonendemic in Austria. Methodology and Principal Findings Metadata on introduced and possibly autochthonous cases of infection with Dirofilaria sp. in dogs and humans in Austria are analysed, together with analyses of mosquito populations from Austria in ongoing studies. In Austria, most cases of Dirofilaria sp. in humans (30 cases of D. repens—six ocular and 24 subcutaneous) and dogs (approximately 50 cases—both D. immitis and D. repens) were most likely imported. However, occasionally infections with D. repens were discussed to be autochthonous (one human case and seven in dogs). The introduction of D. repens to Austria was confirmed very recently, as the parasite was detected in Burgenland (eastern Austria) for the first time in mosquito vectors during a surveillance program. For D. immitis, this could not be confirmed yet, but data from Germany suggest that the successful establishment of this nematode species in Austria is a credible scenario for the near future. Conclusions The first findings of D. repens in mosquito vectors indicate that D. repens presumably invaded in eastern Austria. Climate analyses from central Europe indicate that D. immitis also has the capacity to establish itself in the lowland regions of Austria, given that both canid and culicid hosts are present. PMID:27196049

  13. Badania mieszańców w rodzaju Trifolium L. IV. Cytogenetyka mieszańca Trifolium repens L. × T. isthomocarpum Brot. [Investigations on hybrids of the genus Trifolium L. P. IV. Cytogenetics of the cross T. repens L. × T. isthomocarpum Brot.

    Directory of Open Access Journals (Sweden)

    T. Kazimierski

    2015-01-01

    Full Text Available Interspecific F1 hybrid between Trifolium repens (2n = 32 and T. isthomocarpum (2n = 16 was obtained. The hybrid is sterile and its disturbed meiotic divisions are described. It is suggested from cytogenetic evidence that one of the genomes of T. repens is similar to the genome of T. isthomacarpum.

  14. Novedades nomenclaturales en Cenchrus s.l. (Poaceae: Panicoideae: Paniceae

    Directory of Open Access Journals (Sweden)

    Hugo F Gutiérrez

    2012-06-01

    Full Text Available Recientes estudios filogenéticos con datos morfológicos y moleculares aportaron evidencia sobre la monofilia de los géneros Cenchrus, Pennisetum y Odontelytrum y, por ello, se propuso su unificación y transferencia a Cenchrus, el cual tiene prioridad. Resultados preliminares de la revisión taxonómica del género Cenchrus s.l. para América (Gutiérrez, en preparación permitieron detectar problemas nomenclaturales. Para resolver dichos inconvenientes, en el presente trabajo se presentan nueve lectotipificaciones: Cenchrus bambusoides Caro & E.A. Sánchez, C. brevisetus E. Fourn., C. pennisetiformis Hochst. & Steud. var. intermedia Chiov., C. roseus E. Fourn., Gymnotrix mexicana E. Fourn., Hymenachne montana Griseb., Pennisetum amoenum Hochst. ex A. Rich., P. cenchroides Rich. var. hamphilahense Terracc., P. ciliare (L. Link var. anachoreticum Chiov., P. petraeum Steud., P. pringlei Leeke, P. tristachyum (Kunth Spreng. subsp. boliviense Chase, y se propone un nombre nuevo para Gymnotrix crinita Kunth.Nomenclatural novelties in Cenchrus s.l. (Poaceae: Panicoideae: Paniceae. Recent phylogenetic studies with morphological and molecular data provided evidence on the monophyly of the genera Cenchrus, Pennisetum and Odontelytrum. Therefore, these studies propose the unification and transfer of species of Pennisetum and Odontelytrum to the genus Cenchrus, which has priority. Nomenclatural problems were detected when conducting a preliminary taxonomic revision of the genus Cenchrus s.l. from America (Gutiérrez, in preparation. To resolve these inconveniences, nine lectotypifications: Cenchrus bambusoides Caro & E.A. Sánchez, C. brevisetus E. Fourn., C. pennisetiformis Hochst. & Steud. var. intermedia Chiov., C. roseus E. Fourn., Gymnotrix mexicana E. Fourn., Hymenachne montana Griseb., Pennisetum amoenum Hochst. ex A. Rich., P. cenchroides Rich. var. hamphilahense Terracc., P. ciliare (L. Link var. anachoreticum Chiov., P. petraeum Steud., P

  15. Relations of enzymes inAspergillus repens grown under sodium chloride stress.

    Science.gov (United States)

    Kelavkar, U P; Chhatpar, H S

    1993-09-01

    Aspergillus repens, a salt-pan isolate, was halotolerant. When grown for 72 h (log phase) and 144 h (beginning of stationary phase) in a medium containing 2M sodium chloride, the activities of invertase, malate dehydrogenase (MDH), glucose-6-phosphate dehydrogenase (G6PDH), and glutamate dehydrogenase (GDH) were found to have increased. Control cultures grown in a medium devoid of 2M NaCl failed to show such changes. The activities of MDH, G6PDH, and GDH increased with rising concentrations of Na(+) (as NaCl) when added up to 100MM in vitro. At higher concentrations they decreased. Changes in kinetic constants, Km and Vmax of these enzymes, as well as their de novo synthesis, were found to be some of the responses to NaCl stress-mediated changes.

  16. Variable response of three Trifolium repens ecotypes to soil flooding by seawater.

    Science.gov (United States)

    White, Anissia C; Colmer, Timothy D; Cawthray, Greg R; Hanley, Mick E

    2014-08-01

    Despite concerns about the impact of rising sea levels and storm surge events on coastal ecosystems, there is remarkably little information on the response of terrestrial coastal plant species to seawater inundation. The aim of this study was to elucidate responses of a glycophyte (white clover, Trifolium repens) to short-duration soil flooding by seawater and recovery following leaching of salts. Using plants cultivated from parent ecotypes collected from a natural soil salinity gradient, the impact of short-duration seawater soil flooding (8 or 24 h) on short-term changes in leaf salt ion and organic solute concentrations was examined, together with longer term impacts on plant growth (stolon elongation) and flowering. There was substantial Cl(-) and Na(+) accumulation in leaves, especially for plants subjected to 24 h soil flooding with seawater, but no consistent variation linked to parent plant provenance. Proline and sucrose concentrations also increased in plants following seawater flooding of the soil. Plant growth and flowering were reduced by longer soil immersion times (seawater flooding followed by drainage and freshwater inputs), but plants originating from more saline soil responded less negatively than those from lower salinity soil. The accumulation of proline and sucrose indicates a potential for solute accumulation as a response to the osmotic imbalance caused by salt ions, while variation in growth and flowering responses between ecotypes points to a natural adaptive capacity for tolerance of short-duration seawater soil flooding in T. repens. Consequently, it is suggested that selection for tolerant ecotypes is possible should the predicted increase in frequency of storm surge flooding events occur. © The Author 2014. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  17. Desenvolvimento pós-seminal de espécies de Poaceae (Poales Post-seminal development of Poaceae species (Poales

    Directory of Open Access Journals (Sweden)

    Adriana Tiemi Nakamura

    2009-03-01

    Full Text Available O presente estudo objetivou verificar a existência de um padrão do desenvolvimento pós-seminal em Poaceae. Para tanto, foram estudadas as seguintes espécies: Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae. Procurou-se também comparar as estruturas da plântula de Poaceae com as demais monocotiledôneas. As espécies estudadas são plantas perenes, rizomatosas, cespitosas e apresentam cariopses de tamanhos diferentes. Apresentam sementes albuminosas; embrião lateral, diferenciado, com raiz endógena (adventícia; cotilédone dividido em hiperfilo (escutelo, bainha reduzida e hipofilo (coleóptilo; coleorriza (raiz primária reduzida e mesocótilo (eixo localizado entre o escutelo e coleóptilo. A presença de epiblasto (folha embrionária foi observada em Olyra humilis, Chloris elata e Eragrostis solida. O desenvolvimento pós-seminal é semelhante nas espécies estudadas e forma um padrão em Poaceae. Primeiramente, observa-se a emissão da coleorriza, que cresce no sentido geotrópico positivo, seguida do coleóptilo e plúmula que crescem em sentido contrário, a partir do desenvolvimento do mesocótilo. As primeiras folhas são semelhantes às folhas definitivas (metafilos das espécies, exceto em Olyra humilis, que são modificadas em catafilos e podem ser interpretadas como caráter basal em Bambusoideae. Raiz primária reduzida (coleorriza e hipofilo modificado em coleóptilo são considerados caracteres derivados em Poaceae, quando comparados com as demais monocotiledôneas.This work has aimed to verify the existence of a pattern of the post-seminal development in Poaceae. Thus, Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae have been studied. Besides, it was compared the structures of

  18. Antioxidant defense gene analysis in Brassica oleracea and Trifolium repens exposed to Cd and/or Pb.

    Science.gov (United States)

    Bernard, F; Dumez, S; Brulle, F; Lemière, S; Platel, A; Nesslany, F; Cuny, D; Deram, A; Vandenbulcke, F

    2016-02-01

    This study focused on the expression analysis of antioxidant defense genes in Brassica oleracea and in Trifolium repens. Plants were exposed for 3, 10, and 56 days in microcosms to a field-collected suburban soil spiked by low concentrations of cadmium and/or lead. In both species, metal accumulations and expression levels of genes encoding proteins involved and/or related to antioxidant defense systems (glutathione transferases, peroxidases, catalases, metallothioneins) were quantified in leaves in order to better understand the detoxification processes involved following exposure to metals. It appeared that strongest gene expression variations in T. repens were observed when plants are exposed to Cd (metallothionein and ascorbate peroxidase upregulations) whereas strongest variations in B. oleracea were observed in case of Cd/Pb co-exposures (metallothionein, glutathione transferase, and peroxidase upregulations). Results also suggest that there is a benefit to use complementary species in order to better apprehend the biological effects in ecotoxicology.

  19. In vitro antioxidant assessment and a rapid HPTLC bioautographic method for the detection of anticholinesterase inhibitory activity of Geophila repens

    Institute of Scientific and Technical Information of China (English)

    Umesh Chandra Dash; Atish Kumar Sahoo

    2017-01-01

    OBJECTIVE:Geophila repens (L.) I.M.Johnst.(Rubiaceae),a small,creeping,perennial herb,is claimed to have memory-enhancing property.The goal of this study was to assess its antioxidant and anticholinesterase activity and conduct a rapid bioautographic enzyme assay for screening acetylcholinesterase (ACHE) and butyrylcholinesterase (BChE) inhibition of G.repens extracts.METHODS:Antioxidant activity of G.repens extracts was assessed by performing 1,1-diphenyl-2-picrylhydrazyl (DPPH),nitric oxide (NO),superoxide (SOD),hydroxyl (OH) and total antioxidant capacity (TAC) assays.Anticholinesterase activity was investigated by quantifying the AChE and BChE inhibitory activities of chloroform (CGR),ethyl acetate (EGR) and methanol (MGR) extract fractions from G.repens leaves.A rapid high-performance thin-layer chromatography (HPTLC) bioautographic method for the detection of AChE and BChE inhibition was performed.RESULTS:Among all extract fractions,EGR exhibited the highest half maximal inhibitory concentration (IC50) in DPPH,SOD,NO,OH and TAC assays,with IC50 of (38.33 ± 3.21),(45.14 ± 1.78),(59.81 ± 1.32),(39.45 ± 0.79) and (43.76 ± 0.81) μg/mL respectively.EGR displayed competitive,reversible inhibition of AChE and BChE activities with IC50 of (68.63 ± 0.45) and (59.45 ± 0.45) μg/mL,respectively.Total phenolic and flavonoids contents of EGR were found to be 360.42 mg gallic acid equivalents and 257.31 mg quercetin equivalents per gram of extract.Phytoconstituents of the EGR extract that were inhibitors of cholinesterase produced white spots on the yellow background of HPTLC plates in the bioautographic test.CONCLUSION:The results of this study revealed that phenols and flavonoids could be responsible for the antioxidant,anticholinesterase activities of G.repens.

  20. Variability of Pyrrolizidine Alkaloid Occurrence in Species of the Grass Subfamily Pooideae (Poaceae)

    Science.gov (United States)

    Wesseling, Anne-Maria; Demetrowitsch, Tobias J.; Schwarz, Karin; Ober, Dietrich

    2017-01-01

    Pyrrolizidine alkaloids (PAs) are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae). Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae). In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid. PMID:29250094

  1. Variability of Pyrrolizidine Alkaloid Occurrence in Species of the Grass Subfamily Pooideae (Poaceae

    Directory of Open Access Journals (Sweden)

    Anne-Maria Wesseling

    2017-11-01

    Full Text Available Pyrrolizidine alkaloids (PAs are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae. Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae. In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid.

  2. A 250 plastome phylogeny of the grass family (Poaceae): topological support under different data partitions

    Science.gov (United States)

    Burke, Sean V.; Wysocki, William P.; Clark, Lynn G.

    2018-01-01

    The systematics of grasses has advanced through applications of plastome phylogenomics, although studies have been largely limited to subfamilies or other subgroups of Poaceae. Here we present a plastome phylogenomic analysis of 250 complete plastomes (179 genera) sampled from 44 of the 52 tribes of Poaceae. Plastome sequences were determined from high throughput sequencing libraries and the assemblies represent over 28.7 Mbases of sequence data. Phylogenetic signal was characterized in 14 partitions, including (1) complete plastomes; (2) protein coding regions; (3) noncoding regions; and (4) three loci commonly used in single and multi-gene studies of grasses. Each of the four main partitions was further refined, alternatively including or excluding positively selected codons and also the gaps introduced by the alignment. All 76 protein coding plastome loci were found to be predominantly under purifying selection, but specific codons were found to be under positive selection in 65 loci. The loci that have been widely used in multi-gene phylogenetic studies had among the highest proportions of positively selected codons, suggesting caution in the interpretation of these earlier results. Plastome phylogenomic analyses confirmed the backbone topology for Poaceae with maximum bootstrap support (BP). Among the 14 analyses, 82 clades out of 309 resolved were maximally supported in all trees. Analyses of newly sequenced plastomes were in agreement with current classifications. Five of seven partitions in which alignment gaps were removed retrieved Panicoideae as sister to the remaining PACMAD subfamilies. Alternative topologies were recovered in trees from partitions that included alignment gaps. This suggests that ambiguities in aligning these uncertain regions might introduce a false signal. Resolution of these and other critical branch points in the phylogeny of Poaceae will help to better understand the selective forces that drove the radiation of the BOP and PACMAD

  3. Two New Records from Lebanon: Chamaesyce nutans (Lag.) Small (Euphorbiaceae) and Eleusine indica (L.) Gaertner (Poaceae)

    OpenAIRE

    HABER, Ricardus M.; SEMAAN, Myrna T.

    2007-01-01

    Chamaesyce nutans (Lag.) Small (Euphorbiaceae) and Eleusine indica (L.) Gaertner (Poaceae) are described as new records for the flora of Lebanon. Specimens of C. nutans collected from roadsides and rocks in a middle mountain forest confirm the occurrence of the species on the western slopes of the Mount Lebanon Range. Additionally, specimens of E. indica were collected from wasteland and roadsides in the coastal town of Kaslik. The species were observed to thrive abundantly in similar habitat...

  4. Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae) para la Flora Argentina

    OpenAIRE

    Ana María Cialdella

    2010-01-01

    Durante la revisión de los géneros de Stipeae (Poaceae) para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P...

  5. Analgesic and Anti-Inflammatory Activities of Methanol Extract of Cissus repens in Mice

    Directory of Open Access Journals (Sweden)

    Ching-Wen Chang

    2012-01-01

    Full Text Available The aim of this study was to investigate possible analgesic and anti-inflammatory mechanisms of the CRMeOH. Analgesic effect was evaluated in two models including acetic acid-induced writhing response and formalin-induced paw licking. The anti-inflammatory effect was evaluated by λ-carrageenan-induced mouse paw edema and histopathologic analyses. The results showed that CRMeOH (500 mg/kg decreased writhing response in the acetic acid assay and licking time in the formalin test. CRMeOH (100 and 500 mg/kg significantly decreased edema paw volume at 4th to 5th hours after λ-carrageenan had been injected. Histopathologically, CRMeOH abated the level of tissue destruction and swelling of the edema paws. These results were indicated that anti-inflammatory mechanism of CRMeOH may be due to declined levels of NO and MDA in the edema paw through increasing the activities of SOD, GPx, and GRd in the liver. Additionally, CRMeOH also decreased IL-1β, IL-6, NFκB, TNF-α, COX-2, and iNOS levels. The contents of two active ingredients, ursolic acid and lupeol, were quantitatively determined. This paper demonstrated possible mechanisms for the analgesic and anti-inflammatory effects of CRMeOH and provided evidence for the classical treatment of Cissus repens in inflammatory diseases.

  6. Study on the phenolic constituents of the flowers and leaves of Trifolium repens L.

    Science.gov (United States)

    Kicel, Agnieszka; Wolbiś, Maria

    2012-11-01

    The flowers and leaves of Trifolium repens L. (Fabaceae) were subjected to phytochemical investigation in order to identify their major chemical constituents and to evaluate in vitro antioxidant activity of the isolated compounds against DPPH˙. A total of 12 flavonoids, pterocarpan and methyl caffeate were isolated, then characterised by UV, MS, NMR spectroscopy and identified as quercetin and kaempferol 3-O-(6″-α-rhamnopyranosyl-2″-β-xylopyranosyl)-β-galactopyranosides (1, 2), kaempferol 3-O-(2″,6″-α-dirhamnopyranosyl)-β-galactopyranoside, mauritianin (3), quercetin and kaempferol 3-O-(2″-β-xylopyranosyl)-β-galactopyranosides (4, 5), kaempferol and quercetin 3-O-β-(6″-O-acetyl)-galactopyranosides (6, 7), trifolin (8), hyperoside (9), myricetin 3-O-β-galactopyranoside (10), quercetin (11), ononin (12), medicarpin 3-O-β-glucopyranoside (13) and methyl caffeate (14). Mauritianin, ononin, pterocarpan and methyl caffeate have been reported in this plant for the first time. The compounds 4, 7, 9, 10, and 11 were tested for their antioxidant effect against DPPH˙. All studied compounds were found to have potent activity, but the most effective in the test were compounds 9, 10 and 11 (EC(50) values in the range 7.51-9.52 µM).

  7. Molecular evolution of the Li/li chemical defence polymorphism in white clover (Trifolium repens L.).

    Science.gov (United States)

    Olsen, K M; Sutherland, B L; Small, L L

    2007-10-01

    White clover (Trifolium repens) is naturally polymorphic for cyanogenesis (hydrogen cyanide release following tissue damage). The ecological factors favouring cyanogenic and acyanogenic plants have been examined in numerous studies over the last half century, making this one of the best-documented examples of an adaptive polymorphism in plants. White clover cyanogenesis is controlled by two, independently segregating Mendelian genes: Ac/ac controls the presence/absence of cyanogenic glucosides; and Li/li controls the presence/absence of their hydrolysing enzyme, linamarase. In this study, we examine the molecular evolution and population genetics of Li as it relates to the cyanogenesis polymorphism. We report here that Li exists as a single-copy gene in plants possessing linamarase activity, and that the absence of enzyme activity in li/li plants is correlated with the absence of much or all of the gene from the white clover genome. Consistent with this finding, we confirm by reverse transcription-polymerase chain reaction that Li gene expression is absent in plants lacking enzyme activity. In a molecular population genetic analysis of Li and three unlinked genes using a worldwide sample of clover plants, we find an absence of nucleotide variation and statistically significant deviations from neutrality at Li; these findings are consistent with recent positive directional selection at this cyanogenesis locus.

  8. Assessing universality of DNA barcoding in geographically isolated selected desert medicinal species of Fabaceae and Poaceae

    Science.gov (United States)

    Hussain, Fatma; Ahmed, Nisar; Ghorbani, Abdolbaset

    2018-01-01

    In pursuit of developing fast and accurate species-level molecular identification methods, we tested six DNA barcodes, namely ITS2, matK, rbcLa, ITS2+matK, ITS2+rbcLa, matK+rbcLa and ITS2+matK+rbcLa, for their capacity to identify frequently consumed but geographically isolated medicinal species of Fabaceae and Poaceae indigenous to the desert of Cholistan. Data were analysed by BLASTn sequence similarity, pairwise sequence divergence in TAXONDNA, and phylogenetic (neighbour-joining and maximum-likelihood trees) methods. Comparison of six barcode regions showed that ITS2 has the highest number of variable sites (209/360) for tested Fabaceae and (106/365) Poaceae species, the highest species-level identification (40%) in BLASTn procedure, distinct DNA barcoding gap, 100% correct species identification in BM and BCM functions of TAXONDNA, and clear cladding pattern with high nodal support in phylogenetic trees in both families. ITS2+matK+rbcLa followed ITS2 in its species-level identification capacity. The study was concluded with advocating the DNA barcoding as an effective tool for species identification and ITS2 as the best barcode region in identifying medicinal species of Fabaceae and Poaceae. Current research has practical implementation potential in the fields of pharmaco-vigilance, trade of medicinal plants and biodiversity conservation. PMID:29576968

  9. New records of the Genus Festuca L. (Poaceae for Colombia and Venezuela New records of the Genus Festuca L. (Poaceae for Colombia and Venezuela

    Directory of Open Access Journals (Sweden)

    Stancik Daniel

    2001-07-01

    Full Text Available The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.

  10. Salinity gradient in the Manamo River, a dammed distributary of the Orinoco Delta, and its influence on the presence of Eichhornia crassipes and Paspalum repens

    International Nuclear Information System (INIS)

    Olivares, E.; Colonnello, G.

    2000-01-01

    We describe a saline gradient established by the damming of the Manamo River, a former freshwater environment, in the Orinoco Delta and the influence of this gradient on the distribution of Eichhornia crassipes Solms (water hyacinth), and Paspalum repens Berg, The two most abundant aquatic macrophytes. The present work demonstrates, on the basis of measurements of leaf osmolality and ion concentrations, that salinity is acting in the dammed river as a regulator of the studied species E. Crassipes is a potential weed which was originally controlled by the hydrodynamics of waters in the Orinoco River. Plants and river water were sampled in ten sites, three of them with high salinity. The osmolality as well as relative proportions of the main soluble ions explain the relative tolerance to salinity of E. Crassipes in comparison with P. Repens. In sites where both species were present, the K+/Na+ ratio in the leaf sap was higher in the E. Crassipes than in P. repens (authors)

  11. Survival of Ranunculus repens L. (creeping buttercup) in an amphibious habitat.

    Science.gov (United States)

    Lynn, D E; Waldren, S

    2003-01-01

    The turlough form of Ranunculus repens is subjected to several months' complete inundation with hard groundwater. Experimental flooding to the level of the soil surface had no effect on turlough or ruderal populations relative to drained controls. Experimental submergence resulted in direct tissue death of the ruderal population but did not affect the turlough population relative to drained controls. There was no detectable difference in the proportion of aerenchyma in drained, flooded and submerged roots of plants from either population. The proportion of aerenchyma increased with root age in the ruderal population. Up to twice the proportion of aerenchyma occurred in the lower third of the root in the turlough population relative to the middle and upper thirds. Submergence in artificially hardened tap water increased the amount of tissue death in the ruderal population, whereas it appeared to enhance the growth of plants from the turlough population relative to that of plants submerged in tap water. Only the ruderal population demonstrated a depth accommodation response in submerged conditions. Root concentrations of ethanol-soluble carbohydrates were up to three times higher in a field- collected turlough population during winter and autumn months than those in a ruderal population. Low levels of ethanol-insoluble carbohydrates were present in the turlough population but were absent from the ruderal population. Starch concentrations fluctuated greatly in the turlough population and were generally higher than those in the ruderal population. These results, together with those from previous investigations, suggest that the turlough population survives prolonged submergence by maintaining low levels of submerged photosynthesis, which may circulate oxygen within the plant tissues, and by utilizing storage carbohydrates for maintenance respiration. Copyright 2003 Annals of Botany Company

  12. Influencia de la pendiente del terreno en la persistencia de Trifolium repens Ladino en pastizales de monte en Galicia

    OpenAIRE

    de Zulueta y Artaloytia, Julián

    2011-01-01

    R E S U M E NEnsayo comparativo de la diferencia de persistencia que presenta Trifolium repens Ladino cuando se siembra en laderas de pendiente 12 por 100 o menor del 4 por 100 en pastizales de monte con suelo arenoso y período de sequía estival. Estas condiciones de suelo y clima concurren, más o menos, en el polígono que tiene como vértices: Corcubión, Negreira, La Entrada, Cercedo y toda la zona al sur de esta localidad en la provincia de Pontevedra, exceptuando las altitudes superiores a ...

  13. Scanning electron microscopy of the leaf epidermis of Merostachys Spreng. (Poaceae: Bambusoideae Microscopia eletrônica de varredura da epiderme foliar de Merostachys Spreng. (Poaceae: Bambusoideae

    Directory of Open Access Journals (Sweden)

    Doria Maria Saiter Gomes

    2009-06-01

    Full Text Available This study presents data on leaf micromorphology of 13 species of Merostachys Spreng. (Poaceae: Bambusoideae, a neotropical genus with numerous endemic species. Greatest species richness is found in Central and Southern Brazil, with 41 of the 46 species described. Species were collected in the field at the localities: Itatiaia National Park and Tijuca National Park, Rio de Janeiro State; Fontes do Ipiranga State Park, São Paulo state; Santa Teresa, Espírito Santo State and Rio Doce State Park, Minas Gerais State. Dried plant material came from the herbarium at the São Paulo Botany Institute. The presence of prickles, silica bodies and macro hairs may be especially useful in delimiting species.São apresentados dados relativos à micromorfologia foliar de 13 espécies de Merostachys Spreng. (Poaceae:Bambusoideae, um gênero neotropical, com numerosas espécies endêmicas, que tem sua maior diversidade nas regiões central e sul do Brasil, onde ocorrem 41 das 46 espécies descritas. O material coletado foi obtido nas seguintes localidades: Parque Nacional do Itatiaia e Parque Nacional da Tijuca (RJ; Parque Estadual das Fontes do Ipiranga (SP; Propriedade dos Irmãos Martinelli, Vargem Alta, Santa Teresa (ES e Parque Estadual do Rio Doce (MG. As espécies herborizadas são provenientes do herbário do Instituto de Botânica de São Paulo (SP. Atenção especial é dada à presença de cerdas, corpúsculos silicosos e macropêlos, características que podem ser úteis na delimitação das espécies.

  14. Poaceae vs. Abiotic Stress: Focus on Drought and Salt Stress, Recent Insights and Perspectives

    Directory of Open Access Journals (Sweden)

    Simone Landi

    2017-07-01

    Full Text Available Poaceae represent the most important group of crops susceptible to abiotic stress. This large family of monocotyledonous plants, commonly known as grasses, counts several important cultivated species, namely wheat (Triticum aestivum, rice (Oryza sativa, maize (Zea mays, and barley (Hordeum vulgare. These crops, notably, show different behaviors under abiotic stress conditions: wheat and rice are considered sensitive, showing serious yield reduction upon water scarcity and soil salinity, while barley presents a natural drought and salt tolerance. During the green revolution (1940–1960, cereal breeding was very successful in developing high-yield crops varieties; however, these cultivars were maximized for highest yield under optimal conditions, and did not present suitable traits for tolerance under unfavorable conditions. The improvement of crop abiotic stress tolerance requires a deep knowledge of the phenomena underlying tolerance, to devise novel approaches and decipher the key components of agricultural production systems. Approaches to improve food production combining both enhanced water use efficiency (WUE and acceptable yields are critical to create a sustainable agriculture in the future. This paper analyzes the latest results on abiotic stress tolerance in Poaceae. In particular, the focus will be directed toward various aspects of water deprivation and salinity response efficiency in Poaceae. Aspects related to cell wall metabolism will be covered, given the importance of the plant cell wall in sensing environmental constraints and in mediating a response; the role of silicon (Si, an important element for monocots' normal growth and development, will also be discussed, since it activates a broad-spectrum response to different exogenous stresses. Perspectives valorizing studies on landraces conclude the survey, as they help identify key traits for breeding purposes.

  15. Characterization of polymorphic microsatellites for the invasive grass Microstegium vimineum (Poaceae).

    Science.gov (United States)

    Novy, Ari; Flory, S Luke; Honig, Joshua A; Bonos, Stacy; Hartman, Jean Marie

    2012-02-01

    Microsatellite markers were developed for the invasive plant Microstegium vimineum (Poaceae) to assess its population structure and to facilitate tracking of invasion expansion. Using 454 sequencing, 11 polymorphic and six monomorphic microsatellite primer sets were developed for M. vimineum. The primer sets were tested on individuals sampled from six populations in the United States and China. The polymorphic primers amplified di-, tri-, and tetranucleotide repeats with three to 10 alleles per locus. These markers will be useful for a variety of applications including tracking of invasion dynamics and population genetics studies.

  16. Cross-species amplification of 105 Lolium perenne SSR loci in 23 species within the Poaceae

    DEFF Research Database (Denmark)

    Jensen, Louise Bach; Holm, Preben Bach; Lübberstedt, Thomas

    2007-01-01

    Amplification of 105 Lolium perenne SSR markers was studied in 23 grass species representing seven tribes from three subfamilies of Poaceae. Twelve of the SSR markers are published for the first time. Between 2% and 96% of the SSR markers could be amplified within a given species. A subset of eight...... SSR markers was evaluated for polymorphism across nine of the 23 grass species. Four to seven of the markers were polymorphic within each species, with an average detection of 2.4 alleles per species....

  17. Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae para la Flora Argentina

    Directory of Open Access Journals (Sweden)

    Ana María Cialdella

    2010-01-01

    Full Text Available Durante la revisión de los géneros de Stipeae (Poaceae para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P. mapuche, P. marqueziana y P. zulmae. Se incluye también una clave para identificar los géneros de Stipeae en la Argentina.

  18. Phalaris canariensis L. (Poaceae: A new alien plant record for Kashmir Himalaya, India

    Directory of Open Access Journals (Sweden)

    Shugufta Rasheed

    2016-03-01

    Full Text Available The correct taxonomic identification assumes first and foremost priority in the scientific documentation of biodiversity. The Kashmir Himalaya, located in the north-western side of the Himalayan biodiversity hotspot, is well-known for its diverse flora which merits immediate scientific documentation. In this context, the present study reports Phalaris canariensis L. (Poaceae as a new alien plant record to the flora of Kashmir Himalaya, India. In this paper, a detailed description, photographs, and comparison of diagnostic characters with allied species are provided to scientifically validate this alien plant record for this Himalayan region.

  19. A new species of Rhopalosiphum (Hemiptera, Aphididae) on Chusquea tomentosa (Poaceae, Bambusoideae) from Costa Rica

    Science.gov (United States)

    Hidalgo, Nicolás Pérez; Martínez-Torres, David; Collantes-Alegre, Jorge Mariano; Muller, William Villalobos; Nafría, Juan M. Nieto

    2012-01-01

    Abstract The new species Rhopalosiphum chusqueae Pérez Hidalgo & Villalobos Muller, is described from apterous viviparous females caught on Chusquea tomentosa in Cerro de la Muerte (Costa Rica). The identity of the species is supported both by the morphological features and by a molecular phylogenetic analysis based on a fragment of the mitochondrial DNA containing the 5’ region of the cytochrome c oxidase 1 (COI) and on the nuclear gene coding for the Elongation factor-1 alpha (EF1α). The taxonomic position of the new species is discussed. An identification key to the Aphidinae species living on plants of Bambusoideae (Poaceae) is presented. PMID:22328859

  20. Kunitz Proteinase Inhibitors Limit Water Stress Responses in White Clover (Trifolium repens L.) Plants.

    Science.gov (United States)

    Islam, Afsana; Leung, Susanna; Nikmatullah, Aluh; Dijkwel, Paul P; McManus, Michael T

    2017-01-01

    The response of plants to water deficiency or drought is a complex process, the perception of which is triggered at the molecular level before any visible morphological responses are detected. It was found that different groups of plant proteinase inhibitors (PIs) are induced and play an active role during abiotic stress conditions such as drought. Our previous work with the white clover ( Trifolium repens L.) Kunitz Proteinase Inhibitor ( Tr-KPI ) gene family showed that Tr-KPIs are differentially regulated to ontogenetic and biotic stress associated cues and that, at least some members of this gene family may be required to maintain cellular homeostasis. Altered cellular homeostasis may also affect abiotic stress responses and therefore, we aimed to understand if distinct Tr-PKI members function during drought stress. First, the expression level of three Tr-KPI genes, Tr-KPI1 , Tr-KPI2 , and Tr-KPI5 , was measured in two cultivars and one white clover ecotype with differing capacity to tolerate drought. The expression of Tr-KPI1 and Tr-KPI5 increased in response to water deficiency and this was exaggerated when the plants were treated with a previous period of water deficiency. In contrast, proline accumulation and increased expression of Tr-NCED1 , a gene encoding a protein involved in ABA biosynthesis, was delayed in plants that experienced a previous drought period. RNAi knock-down of Tr-KPI1 and Tr-KPI5 resulted in increased proline accumulation in leaf tissue of plants grown under both well-watered and water-deficit conditions. In addition, increased expression of genes involved in ethylene biosynthesis was found. The data suggests that Tr-KPIs , particularly Tr-KPI5 , have an explicit function during water limitation. The results also imply that the Tr-KPI family has different in planta proteinase targets and that the functions of this protein family are not solely restricted to one of storage proteins or in response to biotic stress.

  1. Presence of Trifolium repens promotes complementarity of water use and N facilitation in diverse grass mixtures

    Directory of Open Access Journals (Sweden)

    Pauline eHernandez

    2016-04-01

    Full Text Available Legume species promote productivity and increase the digestibility of herbage in grasslands. Considerable experimental data also indicate that communities with legumes produce more above-ground biomass than is expected from monocultures. While it has been attributed to N facilitation, evidence to identify the mechanisms involved is still lacking and the role of complementarity in soil water acquisition by vertical root differentiation remains unclear. We used a 20-month mesocosm experiment to investigate the effects of species richness (single species, two- and five-species mixtures and functional diversity (presence of the legume Trifolium repens on a set of traits related to light, N and water use and measured at community level. We found a positive effect of Trifolium presence and abundance on biomass production and complementarity effects in the two-species mixtures from the second year. In addition the community traits related to water and N acquisition and use (leaf area, N, water-use efficiency and deep root growth were higher in the presence of Trifolium. With a multiple regression approach, we showed that the traits related to water acquisition and use were with N the main determinants of biomass production and complementarity effects in diverse mixtures. At shallow soil layers, lower root mass of Trifolium and higher soil moisture should increase soil water availability for the associated grass species. Conversely at deep soil layer, higher root growth and lower soil moisture mirror soil resource use increase of mixtures. Altogether, these results highlight N facilitation but almost soil vertical differentiation and thus complementarity for water acquisition and use in mixtures with Trifolium. Contrary to grass-Trifolium mixtures, no significant over-yielding was measured for grass mixtures even those having complementary traits (short and shallow vs tall and deep. Thus, vertical complementarity for soil resources uptake in mixtures

  2. Presence of Trifolium repens Promotes Complementarity of Water Use and N Facilitation in Diverse Grass Mixtures.

    Science.gov (United States)

    Hernandez, Pauline; Picon-Cochard, Catherine

    2016-01-01

    Legume species promote productivity and increase the digestibility of herbage in grasslands. Considerable experimental data also indicate that communities with legumes produce more above-ground biomass than is expected from monocultures. While it has been attributed to N facilitation, evidence to identify the mechanisms involved is still lacking and the role of complementarity in soil water acquisition by vertical root differentiation remains unclear. We used a 20-months mesocosm experiment to investigate the effects of species richness (single species, two- and five-species mixtures) and functional diversity (presence of the legume Trifolium repens) on a set of traits related to light, N and water use and measured at community level. We found a positive effect of Trifolium presence and abundance on biomass production and complementarity effects in the two-species mixtures from the second year. In addition the community traits related to water and N acquisition and use (leaf area, N, water-use efficiency, and deep root growth) were higher in the presence of Trifolium. With a multiple regression approach, we showed that the traits related to water acquisition and use were with N the main determinants of biomass production and complementarity effects in diverse mixtures. At shallow soil layers, lower root mass of Trifolium and higher soil moisture should increase soil water availability for the associated grass species. Conversely at deep soil layer, higher root growth and lower soil moisture mirror soil resource use increase of mixtures. Altogether, these results highlight N facilitation but almost soil vertical differentiation and thus complementarity for water acquisition and use in mixtures with Trifolium. Contrary to grass-Trifolium mixtures, no significant over-yielding was measured for grass mixtures even those having complementary traits (short and shallow vs. tall and deep). Thus, vertical complementarity for soil resources uptake in mixtures was not only

  3. Does white clover (Trifolium repens abundance in temperate pastures determine Sitona obsoletus (Coleoptera: Curculionidae larval populations?

    Directory of Open Access Journals (Sweden)

    Mark Richard McNeill

    2016-09-01

    Full Text Available To determine if host plant abundance determined the size of clover root weevil (CRW Sitona obsoletus larval populations, a study was conducted over four years in plots sown in ryegrass (Lolium perenne (cv. Nui sown at either 6 or 30 kg/ha and white clover (Trifolium repens sown at a uniform rate of 8 kg/ha. This provided a range of % white clover content to investigate CRW population establishment and impacts on white clover survival. Larval sampling was carried out in spring (October when larval densities are near their spring peak at Lincoln (Canterbury, New Zealand with % clover measured in autumn (April and spring (September of each year. Overall, mean larval densities measured in spring 2012, 2013, 2014 and 2015 were 310, 38, 59 and 31 larvae m-2, respectively. There was a significant decline in larval populations between 2012 and 2013, but spring populations were relatively uniform thereafter. The mean % white clover measured in autumns of 2012 to 2015 was 17, 10, 3 and 11%, respectively. In comparison, mean spring % white clover from 2012 to 2015, averaged c. 5% each year. Analysis relating spring (October larval populations to % white clover measured in each plot in autumn (April found the 2012 larval population to be statistically significantly larger in the ryegrass 6 kg/ha plots than 30 kg/ha plots. Thereafter, sowing rate had no significant effect on larval populations. From 2013 to 2015, spring larval populations had a negative relationship with the previous autumn % white clover with the relationship highly significant for the 2014 data. When CRW larval populations in spring 2013 to 2015 were predicted from the 2013 to 2015 autumn % white clover, respectively, based on their positive relationship in 2012, the predicted densities were substantially larger than those observed. Conversely, when 2015 spring larval data and % clover was regressed against 2012-2014 larval populations, observed densities tended to be higher than predicted

  4. Does the addition of Serenoa repens to tamsulosin improve its therapeutical efficacy in benign prostatic hyperplasia?

    Directory of Open Access Journals (Sweden)

    Argirović Aleksandar

    2013-01-01

    Full Text Available Background/Aim. It has been observed that a large number of patients with low urinary tract symptoms due to benign prostatic hyperplasia (LUTS/BPH has been treated with a combination of tamsulosin (TAM + Serenoa repens (SR (TAM + SR. The aim of this study was to compare a combination TAM + SR with TAM and SR alone, to see if there was any difference in efficacy and tolerance of each in patients with LUTS/BPH. Methods. In this prospective study patients had to have prostate volume (PV 3, a maximal flow rate (Qmax of 5-15 mL/s, with post voiding residual volume (PVR < 150 mL and serum prostatic antigen (PSA < 4 ng/mL. TAM (0.4 mg was administered once a day, SR (320 mg daily or SR (320 mg + TAM (0.4 mg daily for a median period of 6 months. Results. A total of 297 patients were recruited, whereas 265 patients were fully available: 87 into the group TAM, 97 into the group SR and 81 into the group TAM + SR. There was no statistically significant difference between the treatment groups in the sense of demographic and other baseline parameters. No difference was found among the 3 treatment groups, neither in the major endpoint of the study in the sense of a change between baseline and final evaluation in total IPSS, obstructive and irritative subscores, improvement of QoLs, increase in Qmax, nor for the second endpoint including diminution of PV, PSA and PVR. During the treatment period 20 (23% of the patients managed with TAM and 17 (21% with TAM + SR had drug-treated with related adverse reactions. No adverse effect was detected in the group SR. Conclusion. Treatment of BPH by both SR and TAM seems to be efficacious alone. None of them had superiority over another and, additionally, a combined therapy (TAM + SR does not provide extra benefits. Furthermore, SR is a well-tolerated agent that can be used alternatively in the treatment of LUTS/BPH.

  5. Rooting depth and root depth distribution of Trifolium repens × T. uniflorum interspecific hybrids.

    Science.gov (United States)

    Nichols, S N; Hofmann, R W; Williams, W M; van Koten, C

    2016-05-20

    Traits related to root depth distribution were examined in Trifolium repens × T. uniflorum backcross 1 (BC 1 ) hybrids to determine whether root characteristics of white clover could be improved by interspecific hybridization. Two white clover cultivars, two T. uniflorum accessions and two BC 1 populations were grown in 1 -m deep tubes of sand culture. Maximum rooting depth and root mass distribution were measured at four harvests over time, and root distribution data were fitted with a regression model to provide measures of root system shape. Morphological traits were measured at two depths at harvest 3. Root system shape of the hybrids was more similar to T. uniflorum than to white clover. The hybrids and T. uniflorum had a higher rate of decrease in root mass with depth than white clover, which would result in higher proportions of root mass in the upper profile. Percentage total root mass at 100-200 mm depth was higher for T. uniflorum than white clover, and for Crusader BC 1 than 'Crusader'. Roots of the hybrids and T. uniflorum also penetrated deeper than those of white clover. T. uniflorum had thicker roots at 50-100 mm deep than the other entries, and more of its fine root mass at 400-500 mm. The hybrids and white clover had more of their fine root mass higher in the profile. Consequently, T. uniflorum had a higher root length density at 400-500 mm than most entries, and a smaller decrease in root length density with depth. These results demonstrate that rooting characteristics of white clover can be altered by hybridization with T. uniflorum, potentially improving water and nutrient acquisition and drought resistance. Root traits of T. uniflorum are likely to be adaptations to soil moisture and fertility in its natural environment. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  6. Kunitz Proteinase Inhibitors Limit Water Stress Responses in White Clover (Trifolium repens L. Plants

    Directory of Open Access Journals (Sweden)

    Afsana Islam

    2017-10-01

    Full Text Available The response of plants to water deficiency or drought is a complex process, the perception of which is triggered at the molecular level before any visible morphological responses are detected. It was found that different groups of plant proteinase inhibitors (PIs are induced and play an active role during abiotic stress conditions such as drought. Our previous work with the white clover (Trifolium repens L. Kunitz Proteinase Inhibitor (Tr-KPI gene family showed that Tr-KPIs are differentially regulated to ontogenetic and biotic stress associated cues and that, at least some members of this gene family may be required to maintain cellular homeostasis. Altered cellular homeostasis may also affect abiotic stress responses and therefore, we aimed to understand if distinct Tr-PKI members function during drought stress. First, the expression level of three Tr-KPI genes, Tr-KPI1, Tr-KPI2, and Tr-KPI5, was measured in two cultivars and one white clover ecotype with differing capacity to tolerate drought. The expression of Tr-KPI1 and Tr-KPI5 increased in response to water deficiency and this was exaggerated when the plants were treated with a previous period of water deficiency. In contrast, proline accumulation and increased expression of Tr-NCED1, a gene encoding a protein involved in ABA biosynthesis, was delayed in plants that experienced a previous drought period. RNAi knock-down of Tr-KPI1 and Tr-KPI5 resulted in increased proline accumulation in leaf tissue of plants grown under both well-watered and water-deficit conditions. In addition, increased expression of genes involved in ethylene biosynthesis was found. The data suggests that Tr-KPIs, particularly Tr-KPI5, have an explicit function during water limitation. The results also imply that the Tr-KPI family has different in planta proteinase targets and that the functions of this protein family are not solely restricted to one of storage proteins or in response to biotic stress.

  7. Does White Clover (Trifolium repens) Abundance in Temperate Pastures Determine Sitona obsoletus (Coleoptera: Curculionidae) Larval Populations?

    Science.gov (United States)

    McNeill, Mark R; van Koten, Chikako; Cave, Vanessa M; Chapman, David; Hodgson, Hamish

    2016-01-01

    To determine if host plant abundance determined the size of clover root weevil (CRW) Sitona obsoletus larval populations, a study was conducted over 4 years in plots sown in ryegrass ( Lolium perenne ) (cv. Nui) sown at either 6 or 30 kg/ha and white clover ( Trifolium repens ) sown at a uniform rate of 8 kg/ha. This provided a range of % white clover content to investigate CRW population establishment and impacts on white clover survival. Larval sampling was carried out in spring (October) when larval densities are near their spring peak at Lincoln (Canterbury, New Zealand) with % clover measured in autumn (April) and spring (September) of each year. Overall, mean larval densities measured in spring 2012-2015 were 310, 38, 59, and 31 larvae m -2 , respectively. There was a significant decline in larval populations between 2012 and 2013, but spring populations were relatively uniform thereafter. The mean % white clover measured in autumns of 2012 to 2015 was 17, 10, 3, and 11%, respectively. In comparison, mean spring % white clover from 2012 to 2015, averaged c. 5% each year. Analysis relating spring (October) larval populations to % white clover measured in each plot in autumn (April) found the 2012 larval population to be statistically significantly larger in the ryegrass 6 kg/ha plots than 30 kg/ha plots. Thereafter, sowing rate had no significant effect on larval populations. From 2013 to 2015, spring larval populations had a negative relationship with the previous autumn % white clover with the relationship highly significant for the 2014 data. When CRW larval populations in spring 2013 to 2015 were predicted from the 2013 to 2015 autumn % white clover, respectively, based on their positive relationship in 2012, the predicted densities were substantially larger than those observed. Conversely, when 2015 spring larval data and % clover was regressed against 2012-2014 larval populations, observed densities tended to be higher than predicted, but the numbers

  8. Lipid Nanocarriers for Oral Delivery of Serenoa repens CO2 Extract: A Study of Microemulsion and Self-Microemulsifying Drug Delivery Systems.

    Science.gov (United States)

    Guccione, Clizia; Bergonzi, Maria Camilla; Awada, Khaled M; Piazzini, Vieri; Bilia, Anna Rita

    2018-07-01

    The aim of this study was the development and characterization of lipid nanocarriers using food grade components for oral delivery of Serenoa repens CO 2 extract, namely microemulsions (MEs) and self-microemulsifying drug delivery systems (SMEDDSs) to improve the oral absorption. A commercial blend (CB) containing 320 of S. repens CO 2 extract plus the aqueous soluble extracts of nettle root and pineapple stem was formulated in two MEs and two SMEDDSs. The optimized ME loaded with the CB (CBM2) had a very low content of water (only 17.3%). The drug delivery systems were characterized by dynamic light scattering, transmission electron microscopy, and high-performance liquid chromatography (HPLC) with a diode-array detector analyses in order to evaluate the size, the homogeneity, the morphology, and the encapsulation efficiency. β -carotene was selected as marker for the quantitative HPLC analysis. Additionally, physical and chemical stabilities were acceptable during 3 wk at 4 °C. Stability of these nanocarriers in simulated stomach and intestinal conditions was proved. Finally, the improvement of oral absorption of S. repens was studied in vitro using parallel artificial membrane permeability assay. An enhancement of oral permeation was found in both CBM2 and CBS2 nanoformulations comparing with the CB and S. repens CO 2 extract. The best performance was obtained by the CBM2 nanoformulation (~ 17%) predicting a 30 - 70% passive oral human absorption in vivo . Georg Thieme Verlag KG Stuttgart · New York.

  9. Mycorrhizal associations as Salix repens L. communities in succession of dune ecosystems II Mycorrhizal dynamics and interactions of ectomycorrhizal and arbuscular mycorrhizal fungi

    NARCIS (Netherlands)

    Heijden, van der E.W.; Vosatka, M.

    2000-01-01

    Ectomycorrhizal (EcM) and arbuscular mycorrhizal (AM) associations of Salix repens were studied at 16 sites in different successional stages of dune ecosystems (calcareous-acidic, dry-wet) in the Netherlands. High EcM colonization, low AM colonization, and lack of differences between habitats

  10. The prevalence of Dirofilaria repens in cats, healthy dogs and dogs with concurrent babesiosis in an expansion zone in central Europe.

    Science.gov (United States)

    Bajer, Anna; Rodo, Anna; Mierzejewska, Ewa J; Tołkacz, Katarzyna; Welc-Faleciak, Renata

    2016-09-05

    Dirofilaria repens is a mosquito-transmitted, filarial nematode parasitizing dogs, cats and other carnivores. Recently, this parasite has spread in central Europe, including Poland. The aim of the present study was to estimate the prevalence of D. repens in cats and dogs in different regions of the country and to investigate the occurrence and consequences of co-infection with another fast-spreading vector-borne parasite, Babesia canis. In the period 2013-2015, 147 blood samples from cats from central Poland and 257 blood samples from dogs from central, northern, southern and western Poland were collected. Prevalence of D. repens was determined by amplification and sequencing of the 12S rDNA gene fragment. Among dogs, 94 samples originated from clinically healthy dogs from central Poland (Masovia) and 58 samples originated from dogs that were infected with B. canis. Prevalence of D. repens was compared between these two groups of dogs. For the first time D. repens was identified in a cat from central Europe (0.7 % [95 % CL: 0-4.1 %]). The DNA of the filarial endosymbiotic bacterium Wolbachia was detected in two cats (1.4 % [95 % CL: 0-5.5 %]). In dogs, the parasite was detected only in samples from central Poland (Masovia) (local prevalence = 38 % [95 % CL: 25.9-51.8 %]). Prevalence of D. repens was significantly higher in dogs with babesiosis (90 % [95 % CL: 81.6-94.5 %]). Co-infections of D. repens and B. canis were confirmed by sequencing in 30 dogs with babesiosis, but no co-infections were identified in healthy dogs from Masovia. Statistical analyses of blood parameters revealed that dogs with co-infections suffered more severe anemia and thrombocytopenia, but presented milder changes in biochemical parameters (i.e. less elevated concentration of alkaline phosphatase [ALP] and serum urea) suggesting lower risk of hepatic or renal failure in comparison to dogs infected only with B. canis. These findings are important due to the spread of

  11. Reconstructing the Evolutionary History of Paralogous APETALA1/FRUITFULL-Like Genes in Grasses (Poaceae)

    Science.gov (United States)

    Preston, Jill C.; Kellogg, Elizabeth A.

    2006-01-01

    Gene duplication is an important mechanism for the generation of evolutionary novelty. Paralogous genes that are not silenced may evolve new functions (neofunctionalization) that will alter the developmental outcome of preexisting genetic pathways, partition ancestral functions (subfunctionalization) into divergent developmental modules, or function redundantly. Functional divergence can occur by changes in the spatio-temporal patterns of gene expression and/or by changes in the activities of their protein products. We reconstructed the evolutionary history of two paralogous monocot MADS-box transcription factors, FUL1 and FUL2, and determined the evolution of sequence and gene expression in grass AP1/FUL-like genes. Monocot AP1/FUL-like genes duplicated at the base of Poaceae and codon substitutions occurred under relaxed selection mostly along the branch leading to FUL2. Following the duplication, FUL1 was apparently lost from early diverging taxa, a pattern consistent with major changes in grass floral morphology. Overlapping gene expression patterns in leaves and spikelets indicate that FUL1 and FUL2 probably share some redundant functions, but that FUL2 may have become temporally restricted under partial subfunctionalization to particular stages of floret development. These data have allowed us to reconstruct the history of AP1/FUL-like genes in Poaceae and to hypothesize a role for this gene duplication in the evolution of the grass spikelet. PMID:16816429

  12. Complete plastid genome sequence of goosegrass (Eleusine indica) and comparison with other Poaceae.

    Science.gov (United States)

    Zhang, Hui; Hall, Nathan; McElroy, J Scott; Lowe, Elijah K; Goertzen, Leslie R

    2017-02-05

    Eleusine indica, also known as goosegrass, is a serious weed in at least 42 countries. In this paper we report the complete plastid genome sequence of goosegrass obtained by de novo assembly of paired-end and mate-paired reads generated by Illumina sequencing of total genomic DNA. The goosegrass plastome is a circular molecule of 135,151bp in length, consisting of two single-copy regions separated by a pair of inverted repeats (IRs) of 20,919 bases. The large (LSC) and the small (SSC) single-copy regions span 80,667 bases and 12,646 bases, respectively. The plastome of goosegrass has 38.19% GC content and includes 108 unique genes, of which 76 are protein-coding, 28 are transfer RNA, and 4 are ribosomal RNA. The goosegrass plastome sequence was compared to eight other species of Poaceae. Although generally conserved with respect to Poaceae, this genomic resource will be useful for evolutionary studies within this weed species and the genus Eleusine. Copyright © 2016. Published by Elsevier B.V.

  13. Microfilaricidal efficacy of a single administration of Advocate(®) (Bayer Animal Health) in dogs naturally infected with Dirofilaria immitis or Dirofilaria repens.

    Science.gov (United States)

    Frangipane di Regalbono, Antonio; Di Cesare, Angela; Traversa, Donato; Simonato, Giulia; Poser, Helen; Danesi, Patrizia; Furnari, Carmelo; Russi, Ilaria; Raele, Donato Antonio; Crisi, Paolo; Pampurini, Fabrizio; Pietrobelli, Mario

    2016-08-15

    The present study evaluated the microfilaricidal efficacy of a single application of the spot-on containing imidacloprid 10%/moxidectin 2.5% (Advocate(®), Bayer Animal Health) in dogs naturally infected either by Dirofilaria immitis or Dirofilaria repens. Dogs living in north-eastern and central-southern Italy, endemic for D. immitis and D. repens respectively, were randomly screened. Sixteen animals, eight infected with D. immitis and eight with D. repens, and fulfilling inclusion criteria were enrolled. Dogs infected with D. immitis received an adulticide treatment prior to the study and Advocate(®) 3 weeks after. The animals were divided in blocks of two (1:1, T1:T2) animals each, where Day 0 (D0) had an interval of 15days to compare T2 vs. T1 dogs during the first fortnight of examination (i.e. T2 dogs acted as control animals at each examination). At baseline (Days -15 and 0 for T2 and T1 dogs, respectively) the animals had a range of microfilaraemia of 180-99.700mff/ml (D. immitis) and 60-750 mff/ml (D. repens). All animals received a topical administration of Advocate(®) at D0 and were examined for microfilariae with microscopic and molecular tests at D15, D30, D60 and D90. All animals scored negative for mff at the first control post-treatment and throughout the study, with the exception of two D. immitis- infected animals that had a 2 mff/ml count at D15, and then become negative from Day 30 onwards. No adverse events were observed. The present study demonstrates the safety and the high microfilaricidal efficacy (99.97% and 100% for D. immitis and D. repens, respectively) of a single dose of moxidectin contained in Advocate(®) in naturally infected dogs. Copyright © 2016 Elsevier B.V. All rights reserved.

  14. Combined use of isotopic fingerprint and metabolomics analysis for the authentication of saw palmetto (Serenoa repens) extracts.

    Science.gov (United States)

    Perini, Matteo; Paolini, Mauro; Camin, Federica; Appendino, Giovanni; Vitulo, Francesca; De Combarieu, Eric; Sardone, Nicola; Martinelli, Ernesto Marco; Pace, Roberto

    2018-04-22

    Saw palmetto (Serenoa repens, SP) is the most expensive oil source of the pharmaceutical and healthfood market, and its high cost and recurrent shortages have spurred the development of designer blends of fatty acids to mimic its phytochemical profile and fraudulently comply with the current authentication assays. To detect this adulteration, the combined use of isotopic fingerprint and omic analysis has been investigated, using Principal Component Analysis (PCA) to handle the complex databases generated by these techniques and to identify the possible source of the adulterants. Surprisingly, the presence of fatty acids of animal origin turned out to be widespread in commercial samples of saw palmetto oil. Copyright © 2018 Elsevier B.V. All rights reserved.

  15. Potential for the development of tolerance by Aspergillus amstelodami, A. repens and A. ruber after repeated exposure to potassium sorbate.

    Science.gov (United States)

    Viñas, I; Morlans, I; Sanchis, V

    1990-01-01

    Three strains of A. amstelodami, A. repens and A. ruber were exposed to various levels of potassium sorbate, and the MICs were determined. Selected strains of the molds were then repeatedly exposed to subinhibitory levels of the compound to determine whether increased tolerance might develop. The MIC of sorbate (pH 5.5 or 6.5) for 3 species of Aspergillus was 0.07%. Increasing levels of sorbate resulted in increasing growth suppression of the molds. The 3 Aspergillus species were tested for increased tolerance to potassium sorbate, and none was found. They developed a slight increase in tolerance dependent upon pH and the mold strain by subculturing at low levels of sorbate.

  16. Influence of quantity and lability of sediment organic matter on the biomass of two isoetids, Littorella uniflora and Echinodorus repens

    DEFF Research Database (Denmark)

    Pulido Pérez, Cristina; Lucassen, E.C.H.E.; Pedersen, Ole

    2011-01-01

    of the experiment, plants were harvested and their biomass, tissue nutrient concentration and (for L. uniflora) uprooting force were measured. 3. For both species, all plants survived and showed no signs of stress on all types of sediment. The biomass of E. repens increased as the fraction of organic matter...... was increased (from 6 to 39% of organic content, depending upon sediment type). However, in some of the sediment types, a higher fraction of organic matter led to a decline in biomass. The biomass of L. uniflora was less responsive to organic content and was decreased significantly only when the least labile......P>1. Despite real improvement in the water quality of many previously eutrophic lakes, the recovery of submerged vegetation has been poor. This lack of recovery is possibly caused by the accumulation of organic matter on the top layer of the sediment, which is produced under eutrophic conditions...

  17. Experimental evidence for the ancestry of allotetraploid Trifolium repens and creation of synthetic forms with value for plant breeding

    Directory of Open Access Journals (Sweden)

    Williams Warren M

    2012-04-01

    Full Text Available Abstract Background White clover (Trifolium repens is a ubiquitous weed of the temperate world that through use of improved cultivars has also become the most important legume of grazed pastures world-wide. It has long been suspected to be allotetraploid, but the diploid ancestral species have remained elusive. Putative diploid ancestors were indicated by DNA sequence phylogeny to be T. pallescens and T. occidentale. Here, we use further DNA evidence as well as a combination of molecular cytogenetics (FISH and GISH and experimental hybridization to test the hypothesis that white clover originated as a hybrid between T. pallescens and T. occidentale. Results T. pallescens plants were identified with chloroplast trnL intron DNA sequences identical to those of white clover. Similarly, T. occidentale plants with nuclear ITS sequences identical to white clover were also identified. Reciprocal GISH experiments, alternately using labeled genomic DNA probes from each of the putative ancestral species on the same white clover cells, showed that half of the chromosomes hybridized with each probe. F1 hybrids were generated by embryo rescue and these showed strong interspecific chromosome pairing and produced a significant frequency of unreduced gametes, indicating the likely mode of polyploidization. The F1 hybrids are inter-fertile with white clover and function as synthetic white clovers, a valuable new resource for the re-incorporation of ancestral genomes into modern white clover for future plant breeding. Conclusions Evidence from DNA sequence analyses, molecular cytogenetics, interspecific hybridization and breeding experiments supports the hypothesis that a diploid alpine species (T. pallescens hybridized with a diploid coastal species (T. occidentale to generate tetraploid T. repens. The coming together of these two narrowly adapted species (one alpine and the other maritime, along with allotetraploidy, has led to a transgressive hybrid with a

  18. Experimental evidence for the ancestry of allotetraploid Trifolium repens and creation of synthetic forms with value for plant breeding.

    Science.gov (United States)

    Williams, Warren M; Ellison, Nicholas W; Ansari, Helal A; Verry, Isabelle M; Hussain, S Wajid

    2012-04-24

    White clover (Trifolium repens) is a ubiquitous weed of the temperate world that through use of improved cultivars has also become the most important legume of grazed pastures world-wide. It has long been suspected to be allotetraploid, but the diploid ancestral species have remained elusive. Putative diploid ancestors were indicated by DNA sequence phylogeny to be T. pallescens and T. occidentale. Here, we use further DNA evidence as well as a combination of molecular cytogenetics (FISH and GISH) and experimental hybridization to test the hypothesis that white clover originated as a hybrid between T. pallescens and T. occidentale. T. pallescens plants were identified with chloroplast trnL intron DNA sequences identical to those of white clover. Similarly, T. occidentale plants with nuclear ITS sequences identical to white clover were also identified. Reciprocal GISH experiments, alternately using labeled genomic DNA probes from each of the putative ancestral species on the same white clover cells, showed that half of the chromosomes hybridized with each probe. F1 hybrids were generated by embryo rescue and these showed strong interspecific chromosome pairing and produced a significant frequency of unreduced gametes, indicating the likely mode of polyploidization. The F1 hybrids are inter-fertile with white clover and function as synthetic white clovers, a valuable new resource for the re-incorporation of ancestral genomes into modern white clover for future plant breeding. Evidence from DNA sequence analyses, molecular cytogenetics, interspecific hybridization and breeding experiments supports the hypothesis that a diploid alpine species (T. pallescens) hybridized with a diploid coastal species (T. occidentale) to generate tetraploid T. repens. The coming together of these two narrowly adapted species (one alpine and the other maritime), along with allotetraploidy, has led to a transgressive hybrid with a broad adaptive range.

  19. Genotypic and Phenotypic Diversity Does Not Affect Productivity and Drought Response in Competitive Stands of Trifolium repens.

    Science.gov (United States)

    Huber, Heidrun; During, Heinjo J; Bruine de Bruin, Fabienne; Vermeulen, Peter J; Anten, Niels P R

    2016-01-01

    Clonal plants can form dense canopies in which plants of different genetic origin are competing for the uptake of essential resources. The competitive relationships among these clones are likely to be affected by extreme environmental conditions, such as prolonged drought spells, which are predicted to occur more frequently due to global climate change. This, in turn, may alter characteristics of the ecological system and its associated functioning. We hypothesized that the relative success of individual clones will depend on the size of the ramets as ramets with larger leaves and longer petioles (large ramets) were predicted to have a competitive advantage in terms of increased light interception over smaller-sized ramets. Under drier conditions the relative performances of genotypes were expected to change leading to a change in genotype ranking. We also hypothesized that increased genotypic and phenotypic diversity will increase stand performance and resistance to drought. These hypotheses and the mechanisms responsible for shifts in competitive relationships were investigated by subjecting genotypes of the important pasture legume Trifolium repens to competition with either genetically identical clones, genetically different but similarly sized clones, or genetically as well as morphologically different clones under well-watered and dry conditions. Competitive relationships were affected by ramet size with large genotypes outperforming small genotypes in diverse stands in terms of biomass production. However, large genotypes also produced relatively fewer ramets than small genotypes and could not benefit in terms of clonal reproduction from competing with smaller genotypes, indicating that evolutionary shifts in genotype composition will depend on whether ramet size or ramet number is under selection. In contrast to our hypotheses, diversity did not increase stand performance under different selection regimes and genotype ranking was hardly affected by soil

  20. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz

    2013-01-01

    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  1. La familia Poaceae del distrito de Arahuay (Canta, Lima, Perú

    Directory of Open Access Journals (Sweden)

    Paúl Gonzáles

    2011-08-01

    Full Text Available Se reportan para el distrito de Arahuay (Canta, Lima, Perú (zona baja y media un total de 49 especies de la familia Poaceae agrupadas en 28 géneros, 14 tribus y 4 subfamilias. El género Poa es el más diverso con cinco especies, seguido por Eragrostis y Nassella con cuatro especies cada una. Las especies Calamagrostis spiciformis Hack. ex Stuck., Chloris halophila Parodi, Lamprothyrsus peruvianus Hitchc., Festuca glyceriantha Pilg., Lolium multiflorum Lam. y Poa supina Schrad. son nuevos reportes para el departamento de Lima. Se presentan claves dicotómicas para la determinación de los géneros y para las especies en los casos pertinentes. Para cada especie se incluye datos sobre su hábitat, distribución y el material estudiado.

  2. Poaceae: Triticeae

    Indian Academy of Sciences (India)

    Department of Bioengineering and Biotechnology, Qingdao University of Science and Technology, Qingdao, Shandong ... entire chloroplast DNA sequence of common wheat (T. aes- ... a CTAB method as previously described by Liu et al.

  3. Poaceae: Paniceae

    Indian Academy of Sciences (India)

    1987; Bernini and Marin-Morales. 2001; Mendes-Bonato et al. 2002, 2006; Utsunomiya et al. 2005). More recently, a new number, x = 6, was determined for several accessions of B. dictyoneura (Risso-Pascotto et al. 2006), a species suggested to belong to the same agamic complex as B. humidicola (Renvoize et al. 1996).

  4. Development of Simple Sequence Repeats (SSR) markers in Setaria italica (Poaceae) and cross-amplification in related species.

    Science.gov (United States)

    Lin, Heng-Sheng; Chiang, Chih-Yun; Chang, Song-Bin; Kuoh, Chang-Sheng

    2011-01-01

    Foxtail millet is one of the world's oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR) markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21%) and CAT (46.15%). The average number of alleles (N(a)), the average heterozygosities observed (H(o)) and expected (H(e)) are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.

  5. Development of Simple Sequence Repeats (SSR Markers in Setaria italica (Poaceae and Cross-Amplification in Related Species

    Directory of Open Access Journals (Sweden)

    Chih-Yun Chiang

    2011-11-01

    Full Text Available Foxtail millet is one of the world’s oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21% and CAT (46.15%. The average number of alleles (Na, the average heterozygosities observed (Ho and expected (He are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.

  6. Molecular, phylogenetic and comparative genomic analysis of the cytokinin oxidase/dehydrogenase gene family in the Poaceae.

    Science.gov (United States)

    Mameaux, Sabine; Cockram, James; Thiel, Thomas; Steuernagel, Burkhard; Stein, Nils; Taudien, Stefan; Jack, Peter; Werner, Peter; Gray, John C; Greenland, Andy J; Powell, Wayne

    2012-01-01

    The genomes of cereals such as wheat (Triticum aestivum) and barley (Hordeum vulgare) are large and therefore problematic for the map-based cloning of agronomicaly important traits. However, comparative approaches within the Poaceae permit transfer of molecular knowledge between species, despite their divergence from a common ancestor sixty million years ago. The finding that null variants of the rice gene cytokinin oxidase/dehydrogenase 2 (OsCKX2) result in large yield increases provides an opportunity to explore whether similar gains could be achieved in other Poaceae members. Here, phylogenetic, molecular and comparative analyses of CKX families in the sequenced grass species rice, brachypodium, sorghum, maize and foxtail millet, as well as members identified from the transcriptomes/genomes of wheat and barley, are presented. Phylogenetic analyses define four Poaceae CKX clades. Comparative analyses showed that CKX phylogenetic groupings can largely be explained by a combination of local gene duplication, and the whole-genome duplication event that predates their speciation. Full-length OsCKX2 homologues in barley (HvCKX2.1, HvCKX2.2) and wheat (TaCKX2.3, TaCKX2.4, TaCKX2.5) are characterized, with comparative analysis at the DNA, protein and genetic/physical map levels suggesting that true CKX2 orthologs have been identified. Furthermore, our analysis shows CKX2 genes in barley and wheat have undergone a Triticeae-specific gene-duplication event. Finally, by identifying ten of the eleven CKX genes predicted to be present in barley by comparative analyses, we show that next-generation sequencing approaches can efficiently determine the gene space of large-genome crops. Together, this work provides the foundation for future functional investigation of CKX family members within the Poaceae. © 2011 National Institute of Agricultural Botany (NIAB). Plant Biotechnology Journal © 2011 Society for Experimental Biology, Association of Applied Biologists and Blackwell

  7. Complete chloroplast genome sequence of common bermudagrass (Cynodon dactylon (L.) Pers.) and comparative analysis within the family Poaceae.

    Science.gov (United States)

    Huang, Ya-Yi; Cho, Shu-Ting; Haryono, Mindia; Kuo, Chih-Horng

    2017-01-01

    Common bermudagrass (Cynodon dactylon (L.) Pers.) belongs to the subfamily Chloridoideae of the Poaceae family, one of the most important plant families ecologically and economically. This grass has a long connection with human culture but its systematics is relatively understudied. In this study, we sequenced and investigated the chloroplast genome of common bermudagrass, which is 134,297 bp in length with two single copy regions (LSC: 79,732 bp; SSC: 12,521 bp) and a pair of inverted repeat (IR) regions (21,022 bp). The annotation contains a total of 128 predicted genes, including 82 protein-coding, 38 tRNA, and 8 rRNA genes. Additionally, our in silico analyses identified 10 sets of repeats longer than 20 bp and predicted the presence of 36 RNA editing sites. Overall, the chloroplast genome of common bermudagrass resembles those from other Poaceae lineages. Compared to most angiosperms, the accD gene and the introns of both clpP and rpoC1 genes are missing. Additionally, the ycf1, ycf2, ycf15, and ycf68 genes are pseudogenized and two genome rearrangements exist. Our phylogenetic analysis based on 47 chloroplast protein-coding genes supported the placement of common bermudagrass within Chloridoideae. Our phylogenetic character mapping based on the parsimony principle further indicated that the loss of the accD gene and clpP introns, the pseudogenization of four ycf genes, and the two rearrangements occurred only once after the most recent common ancestor of the Poaceae diverged from other monocots, which could explain the unusual long branch leading to the Poaceae when phylogeny is inferred based on chloroplast sequences.

  8. Genotypic and phenotypic diversity does not affect productivity and drought response in competitive stands of Trifolium repens

    Directory of Open Access Journals (Sweden)

    Heidrun eHuber

    2016-03-01

    Full Text Available Clonal plants can form dense canopies in which plants of different genetic origin are competing for the uptake of essential resources. The competitive relationships among these clones are likely to be affected by extreme environmental conditions, such as prolonged drought spells, which are predicted to occur more frequently due to global climate change. This, in turn, may alter characteristics of the ecological system and its associated functioning.We hypothesized that the relative success of individual clones will depend on the size of the ramets as ramets with larger leaves and longer petioles (large ramets were predicted to have a competitive advantage in terms of increased light interception over smaller-sized ramets. Under drier conditions the relative performances of genotypes were expected to change leading to a change in genotype ranking. We also hypothesized that increased genotypic and phenotypic diversity will increase stand performance and resistance to drought. These hypotheses and the mechanisms responsible for shifts in competitive relationships were investigated by subjecting genotypes of the important pasture legume Trifolium repens to competition with either genetically identical clones, genetically different but similarly sized clones, or genetically as well as morphologically different clones under well-watered and dry conditions.Competitive relationships were affected by ramet size with large genotypes outperforming small genotypes in diverse stands in terms of biomass production. However, large genotypes also produced relatively fewer ramets than small genotypes and could not benefit in terms of clonal reproduction from competing with smaller genotypes, indicating that evolutionary shifts in genotype composition will depend on whether ramet size or ramet number is under selection. In contrast to our hypotheses, diversity did not increase stand performance under different selection regimes and genotype ranking was hardly

  9. Seed storage protein gene promoters contain conserved DNA motifs in Brassicaceae, Fabaceae and Poaceae

    Science.gov (United States)

    Fauteux, François; Strömvik, Martina V

    2009-01-01

    Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP) gene promoters from three plant families, namely Brassicaceae (mustards), Fabaceae (legumes) and Poaceae (grasses) using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L.) Heynh.), soybean (Glycine max (L.) Merr.) and rice (Oryza sativa L.) respectively. We have identified three conserved motifs (two RY-like and one ACGT-like) in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination of conserved motifs

  10. Seed storage protein gene promoters contain conserved DNA motifs in Brassicaceae, Fabaceae and Poaceae

    Directory of Open Access Journals (Sweden)

    Fauteux François

    2009-10-01

    Full Text Available Abstract Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP gene promoters from three plant families, namely Brassicaceae (mustards, Fabaceae (legumes and Poaceae (grasses using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L. Heynh., soybean (Glycine max (L. Merr. and rice (Oryza sativa L. respectively. We have identified three conserved motifs (two RY-like and one ACGT-like in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination

  11. Pharmacological characterization and chemical fractionation of a liposterolic extract of saw palmetto (Serenoa repens): effects on rat prostate contractility.

    Science.gov (United States)

    Chua, Thiam; Eise, Nicole T; Simpson, Jamie S; Ventura, Sabatino

    2014-03-14

    Saw palmetto (Serenoa repens) was first used medicinally by native American Indians to treat urological disorders. Nowadays, saw palmetto extracts are widely used in Europe and North America to treat the urinary symptoms associated with benign prostatic hyperplasia even though its mechanisms of action are poorly understood. This study aimed to characterize the bioactive constituents of a lipid extract of saw palmetto that are able to affect contractility of the rat prostate gland. The mechanism of action will also be investigated. A commercially available lipid extract of saw palmetto was subjected to fractionation using normal phase column chromatography. Composition of fractions was assessed by proton nuclear magnetic resonance spectroscopy ((1)H NMR) and mass spectrometry (MS). Contractile activities of these fractions were evaluated pharmacologically using isolated preparations of rat prostate gland and compared to the activity of the crude extract. Saw palmetto extract inhibited contractions of the rat prostate gland which were consistent with smooth muscle relaxant activity. Only the ethyl acetate fraction resulting from chromatography inhibited contractions of isolated rat prostates similarly to the inhibition produced by the crude lipid extract. Comparison with authentic samples and analysis of NMR data revealed that this bioactivity was due to the fatty acid components present in the ethyl acetate fraction. Bioassay using various pharmacological tools identified multiple contractile mechanisms which were affected by the bioactive constituents. A fatty acid component of saw palmetto extract causes inhibition of prostatic smooth muscle contractions via a non-specific mechanism. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  12. Aspartic protease from Aspergillus (Eurotium) repens strain MK82 is involved in the hydrolysis and decolourisation of dried bonito (Katsuobushi).

    Science.gov (United States)

    Aoki, Kenji; Matsubara, Sayaka; Umeda, Mayo; Tachibanac, Shusaku; Doi, Mikiharu; Takenaka, Shinji

    2013-04-01

    Katsuobushi is a dried, smoked and fermented bonito used in Japanese cuisine. During the fermentation process with several Aspergillus species, the colour of Katsuobushi gradually changes from a dark reddish-brown derived from haem proteins to pale pink. The change in colour gives Katsuobushi a higher ranking and price. This study aimed to elucidate the mechanism of decolourisation of Katsuobushi. A decolourising factor from the culture supernatant of Aspergillus (Eurotium) repens strain MK82 was purified to homogeneity. The purification was monitored by measuring the decolourising activity using equine myoglobin and bovine haemoglobin as substrates. It was found that the decolourising factor had protease activity towards myoglobin and haemoglobin. Complete inhibition of the enzyme by the inhibitor pepstatin A and the internal amino acid sequence classified the protein as an aspartic protease. The enzyme limitedly hydrolysed myoglobin between 1-Met and 2-Gly, 43-Lys and 44-Phe, and 70-Leu and 71-Thr. The purified enzyme decolourised blood of Katsuwonus pelamis (bonito) and a slice of dried bonito. It is proposed that aspartic protease plays a role in the decolourisation of Katsuobushi by the hydrolysis of haem proteins that allows the released haem to aggregate in the dried bonito. © 2012 Society of Chemical Industry.

  13. Allelopathic effects of aqueous extracts of Duranta repens on the germination and early growth of Lactuca sativa and Lycopersicum esculentum

    Directory of Open Access Journals (Sweden)

    Junior Borella

    2010-04-01

    effect by one plant on another through production of chemical compounds released into the environment. In this work, the effects of aqueous extracts of Duranta repens fresh, dried leaves and fruit on the germination and early growth of lettuce and tomato were investigated. Aqueous extracts at concentrations of 1%, 2% and 4% (w/v were prepared and characterized as to pH and osmotic potential. Phytochemical analysis of leaves and fruits was also carried out. Germination parameters consisted of the percentage of germination (PG, speed of germination (VG and speed of germination index (IVG. Initial growth was evaluated through length (root and shoot and mass (fresh, dried and water content. Extracts of fresh and dry leaves altered the tomato PG and lettuce and tomato VG and IVG. All extracts affected the root length of the lettuce and tomato, as well as the length of the shoots and mass (dry and fresh of the lettuce. The phytochemical analysis revealed the presence of saponins and flavonoids. The action of the extracts was disassociated from any effect of osmotic potential and pH, indicating allelopathic activity.

  14. Allelopathic effects of aqueous extracts of Duranta repens on the germination and early growth of Lactuca sativa and Lycopersicum esculentum

    Directory of Open Access Journals (Sweden)

    Celia Maria Tur

    2010-06-01

    Full Text Available Allelopathy can be efined as any stimulatory or inhibitory effect by one plant on another through production of chemical compounds released into the environment. In this work, the effects of aqueous extracts of Duranta repens fresh, dried leaves and fruit on the germination and early growth of lettuce and tomato were investigated. Aqueous extracts at concentrations of 1%, 2% and 4% (w/v were prepared and characterized as to pH and osmotic potential. Phytochemical analysis of leaves and fruits was also carried out. Germination parameters consisted of the percentage of germination (PG, speed of germination (VG and speed of germination index (IVG. Initial growth was evaluated through length (root and shoot and mass (fresh, dried and water content. Extracts of fresh and dry leaves altered the tomato PG and leaf lettuce and tomato VG and IVG. All extracts affected the root length of the lettuce and tomato, as well as the length of the shoots and mass (dry and fresh of the lettuce. The phytochemical analysis revealed the presence of saponins and flavonoids. The action of the extracts was disassociated from any effect of osmotic potential and pH, indicating allelopathic activity.

  15. Efecto antibacteriano del extracto etanólico del botoncillo (ACMELLA REPENS sobre Porphyromona gingivalis: Estudio in Vitro

    Directory of Open Access Journals (Sweden)

    Andrea Lizbeth Chamorro Benalcázar

    2016-09-01

    Full Text Available Objetivo: Determinar el efecto antibacteriano del extracto etanólico de Botoncillo (Acmella repens en diferentes concentraciones sobre la cepa de Porphyromona gingivalis. Materiales y metodos: En el presente estudio experimental, fueron utilizadas 24 cajas Petri con agar sangre, se inoculó P. gingivalis, y se colocaron discos con diferentes concentraciones del extracto etanólico de Botoncillo (25%, 50% y 100%, como sustancias control Clorhexidina al 0,12% y suero fisiológico. A los 7 días de incubación se midieron con una regla milimetrada los halos de inhibición formados alrededor de los respectivos discos. Resultados: el extracto de Botoncillo al 100% mostró diferencias significativas en comparación con la concentración del 25% y 50% (0 < 0.05. Al comparar el extracto de Botoncillo al 100% con la Clorhexidina 0,12% se observó valores de inhibición más altos para Clorhexidina 0,12%. Conclusión: El extracto etanólico de Botoncillo presentó un efecto antibacteriano sobre P. gingivalis.

  16. Chemical composition and spasmolytic activity of Cymbopogon schoenanthus (L. Spreng. (Poaceae essential oil from Sudan

    Directory of Open Access Journals (Sweden)

    Pavlović Ivan

    2017-01-01

    Full Text Available The plants of genus Cymbopogon are well known for their use in traditional medicine and for their high content of essential oils that are widely used as flavoring agents, fragrances, cosmetics, and pharmaceuticals. Essential oils isolated from the dried stems and inflorescence of cultivated Cymbopogon schoenanthus (L. Spreng. (Poaceae collected from Khartoum state (Sudan in two periods were studied. The results of chemical analysis of C. schoenanthus revealed that this plant is rich in essential oil which is a valuable source of the commercially important monoterpene, piperitone (47.7-71.5%. Other abundant constituents of the oils were intermedeol (6.1-17.3%, δ-2-carene (4.5-10.0% and elemol (2.7-9.0%. The essential oil from the inflorescence was tested for spasmolytic activity using three different experimental models: against spontaneous contractions, contractions induced with acetylcholine and contractions induced with potassium chloride. The oil exhibited strong, significant and dose-dependent spasmolytic activity, indicating the possibility for further investigations of this essential oil for its medicinal purposes or application in food industry. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no.173021 and Grant no. III41018

  17. Intergenomic rearrangements after polyploidization of Kengyilia thoroldiana (Poaceae: Triticeae) affected by environmental factors.

    Science.gov (United States)

    Wang, Qiuxia; Liu, Huitao; Gao, Ainong; Yang, Xinming; Liu, Weihua; Li, Xiuquan; Li, Lihui

    2012-01-01

    Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae) are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng) J.L.Yang et al. (2n = 6x = 42, StStPPYY), collected from different environments, were studied using genome in situ hybridization (GISH). We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15%) and Y (22.22%), in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05). The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01). Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.

  18. Morphology and anatomy of the diaspores and seedling of Paspalum (Poaceae, Poales

    Directory of Open Access Journals (Sweden)

    MAYRA T. EICHEMBERG

    2013-09-01

    Full Text Available ABSTRACT The knowledge regarding of the diaspore and post-seminal development of Paspalum L. is important for grassland biodiversity conservation, based on their representativeness and genetic improvement of forage. The morphology of the diaspore and the post-seminal development of Paspalum dilatatum Poir. (rhizomatous, P. mandiocanum Trin. var. subaequiglume Barreto (stoloniferous, P. pumilum Nees. (decumbent caespitose and P. urvillei Steud. (erect caespitose was described to distinguish species with different growth forms and to survey the characters useful for taxonomy. P. dilatatum differs by presenting oval diaspores larger than the others, with five prominent nerves and trichomes; P. urvillei presents diaspores with one central nerve that is more developed than the two lateral nerves and trichomes; P. mandiocanum var. subaequiglume presents diaspores with trichomes only in the margin; and P. pumilum differs by presenting glabrous diaspores. The caryopsis involves the seed that presents the differentiated embryo and disposed laterally, an elliptical hilum in all of the studied species and a rostellum in P. dilatatum and P. mandiocanum var. subaequiglume. The post-seminal development is similar in the four species and begins with germination that is marked by the emergence of the coleorhiza, followed by the coleoptile. These characteristics are common to other Poaceae previously studied, indicating a pattern to the family and do not distinguish the growth forms.

  19. Intergenomic rearrangements after polyploidization of Kengyilia thoroldiana (Poaceae: Triticeae affected by environmental factors.

    Directory of Open Access Journals (Sweden)

    Qiuxia Wang

    Full Text Available Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng J.L.Yang et al. (2n = 6x = 42, StStPPYY, collected from different environments, were studied using genome in situ hybridization (GISH. We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15% and Y (22.22%, in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05. The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01. Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.

  20. Transcriptomic analysis, genic SSR development, and genetic diversity of proso millet (Panicum miliaceum; Poaceae).

    Science.gov (United States)

    Hou, Siyu; Sun, Zhaoxia; Li, Yaoshen; Wang, Yijie; Ling, Hubin; Xing, Guofang; Han, Yuanhuai; Li, Hongying

    2017-07-01

    Proso millet ( Panicum miliaceum ; Poaceae) is a minor crop with good nutritional qualities and strong tolerance to drought stress and soil infertility. However, studies on genetic diversity have been limited due to a lack of efficient genetic markers. Illumina sequencing technology was used to generate short read sequences of proso millet, and de novo transcriptome assemblies were used to develop a de novo assembly of proso millet. Genic simple sequence repeat (SSR) markers were identified and used to detect polymorphism among 56 accessions. Population structure and genetic similarity coefficient were estimated. In total, 25,341 unique gene sequences and 4724 SSR loci were obtained from the transcriptome, of which 229 pairs of SSR primers were validated, which resulted in 14 polymorphic genic SSR primers exhibiting 43 total alleles. According to the ratio of polymorphic markers (6.1%, 14/229), there are potentially 288 polymorphic genic SSR markers available for genetic assay development in the future. Bayesian population analyses showed that the 56 accessions comprised two distinct groups. A genetic structure and cluster assay indicated that the accessions from the Loess Plateau of China shared a high genetic similarity coefficient with those from other regions and that there was no correlation between genetic diversity and geographic origin. The transcriptome sequencing data and millet-specific SSR markers developed in this study establish an excellent resource for gene discovery and may improve the development of breeding programs in proso millet in the future.

  1. Transcriptomic analysis, genic SSR development, and genetic diversity of proso millet (Panicum miliaceum; Poaceae)1

    Science.gov (United States)

    Hou, Siyu; Sun, Zhaoxia; Li, Yaoshen; Wang, Yijie; Ling, Hubin; Xing, Guofang; Han, Yuanhuai; Li, Hongying

    2017-01-01

    Premise of the study: Proso millet (Panicum miliaceum; Poaceae) is a minor crop with good nutritional qualities and strong tolerance to drought stress and soil infertility. However, studies on genetic diversity have been limited due to a lack of efficient genetic markers. Methods: Illumina sequencing technology was used to generate short read sequences of proso millet, and de novo transcriptome assemblies were used to develop a de novo assembly of proso millet. Genic simple sequence repeat (SSR) markers were identified and used to detect polymorphism among 56 accessions. Population structure and genetic similarity coefficient were estimated. Results: In total, 25,341 unique gene sequences and 4724 SSR loci were obtained from the transcriptome, of which 229 pairs of SSR primers were validated, which resulted in 14 polymorphic genic SSR primers exhibiting 43 total alleles. According to the ratio of polymorphic markers (6.1%, 14/229), there are potentially 288 polymorphic genic SSR markers available for genetic assay development in the future. Bayesian population analyses showed that the 56 accessions comprised two distinct groups. Discussion: A genetic structure and cluster assay indicated that the accessions from the Loess Plateau of China shared a high genetic similarity coefficient with those from other regions and that there was no correlation between genetic diversity and geographic origin. The transcriptome sequencing data and millet-specific SSR markers developed in this study establish an excellent resource for gene discovery and may improve the development of breeding programs in proso millet in the future. PMID:28791202

  2. Nitric oxide contributes to minerals absorption, proton pumps and hormone equilibrium under cadmium excess in Trifolium repens L. plants.

    Science.gov (United States)

    Liu, Shiliang; Yang, Rongjie; Pan, Yuanzhi; Ma, Mingdong; Pan, Jiang; Zhao, Yan; Cheng, Qingsu; Wu, Mengxi; Wang, Maohua; Zhang, Lin

    2015-09-01

    Nitric oxide (NO) is a stress-signaling molecule in plants that mediates a wide range of physiological processes and responses to metal toxicity. In this work, various NO modulators (NO donor: SNP; NO scavenger: cPTIO; NO synthase inhibitor: l-NAME; and SNP analogs: sodium nitrite/nitrate and sodium ferrocyanide) were investigated to determine the role of NO in Trifolium repens L. plants exposed to Cd. Cd (100μM) markedly reduced biomass, NO production and chlorophyll (Chl a, Chl b and total Chl) concentration but stimulated reactive oxygen species (ROS) and Cd accumulation in plants. SNP (50μM) substantially attenuated growth inhibition, reduced hydrogen peroxide (H2O2) and malonyldialdehyde (MDA) levels, stimulated ROS-scavenging enzymes/agents, and mitigated the H(+)-ATPase inhibition in proton pumps. Interestingly, SNP considerably up-regulated the levels of jasmonic acid (JA) and proline in plant tissues but down-regulated the levels of ethylene (ET) in both shoots and roots and the level of salicylic acid (SA) in roots only, which might be related to the elevated NO synthesis. Additionally, SNP (25-200μM) regulated mineral absorption and, particularly at 50μM, significantly enhanced the uptake of shoot magnesium (Mg) and copper (Cu) and of root calcium (Ca), Mg and iron (Fe). Nevertheless, the effects of SNP on plant growth were reversed by cPTIO and l-NAME, suggesting that the protective effect of SNP might be associated with NO synthesis in vivo. Moreover, SNP analogs did not display roles similar to that of SNP. These results indicated that NO depleted Cd toxicity by eliminating oxidative damage, enhancing minerals absorption, regulating proton pumps, and maintaining hormone equilibrium. Copyright © 2015 Elsevier Inc. All rights reserved.

  3. Lipido-sterolic extract of Serenoa repens (LSESr, Permixon) treatment affects human prostate cancer cell membrane organization.

    Science.gov (United States)

    Petrangeli, E; Lenti, L; Buchetti, B; Chinzari, P; Sale, P; Salvatori, L; Ravenna, L; Lococo, E; Morgante, E; Russo, A; Frati, L; Di Silverio, F; Russo, M A

    2009-04-01

    The molecular mechanism by which the lipido-sterolic extract of Serenoa repens (LSESr, Permixon) affects prostate cells remains to be fully elucidated. In androgen-independent PC3 prostate cancer cells, the LSESr-induced effects on proliferation and apoptosis were evaluated by counting cells and using a FACScan cytofluorimeter. PC3 cells were stained with JC-1 dye to detect mitochondrial membrane potential. Cell membrane lipid composition was evaluated by thin layer chromatography and gas chromatographic analysis. Akt phosphorylation was analyzed by Western blotting and cellular ultrastructure through electron microscopy. LSESr (12.5 and 25 microg/ml) administration exerted a biphasic action by both inhibiting proliferation and stimulating apoptosis. After 1 h, it caused a marked reduction in the mitochondrial potential, decreased cholesterol content and modified phospholipid composition. A decrease in phosphatidylinositol-4,5-bisphosphate (PIP2) level was coupled with reduced Akt phosphorylation. After 24 h, all of these effects were restored to pre-treatment conditions; however, the saturated (SFA)/unsaturated fatty acid (UFA) ratio increased, mainly due to a significant decrease in omega 6 content. The reduction in cholesterol content could be responsible for both membrane raft disruption and redistribution of signaling complexes, allowing for a decrease of PIP2 levels, reduction of Akt phosphorylation and apoptosis induction. The decrease in omega 6 content appears to be responsible for the prolonged and more consistent increase in the apoptosis rate and inhibition of proliferation observed after 2-3 days of LSESr treatment. In conclusion, LSESr administration results in complex changes in cell membrane organization and fluidity of prostate cancer cells that have progressed to hormone-independent status. (c) 2008 Wiley-Liss, Inc.

  4. Isolation by distance and isolation by environment contribute to population differentiation in Protea repens (Proteaceae L.), a widespread South African species.

    Science.gov (United States)

    Prunier, Rachel; Akman, Melis; Kremer, Colin T; Aitken, Nicola; Chuah, Aaron; Borevitz, Justin; Holsinger, Kent E

    2017-05-01

    The Cape Floristic Region (CFR) of South Africa is renowned for its botanical diversity, but the evolutionary origins of this diversity remain controversial. Both neutral and adaptive processes have been implicated in driving diversification, but population-level studies of plants in the CFR are rare. Here, we investigate the limits to gene flow and potential environmental drivers of selection in Protea repens L. (Proteaceae L.), a widespread CFR species. We sampled 19 populations across the range of P. repens and used genotyping by sequencing to identify 2066 polymorphic loci in 663 individuals. We used a Bayesian F ST outlier analysis to identify single-nucleotide polymorphisms (SNPs) marking genomic regions that may be under selection; we used those SNPs to identify potential drivers of selection and excluded them from analyses of gene flow and genetic structure. A pattern of isolation by distance suggested limited gene flow between nearby populations. The populations of P. repens fell naturally into two or three groupings, which corresponded to an east-west split. Differences in rainfall seasonality contributed to diversification in highly divergent loci, as do barriers to gene flow that have been identified in other species. The strong pattern of isolation by distance is in contrast to the findings in the only other widespread species in the CFR that has been similarly studied, while the effects of rainfall seasonality are consistent with well-known patterns. Assessing the generality of these results will require investigations of other CFR species. © 2017 Prunier et al. Published by the Botanical Society of America. This work is licensed under a Creative Commons Attribution License (CC-BY-NC).

  5. Effet d'un deficit hydrique sur le trefle blanc (Trifolium repens L.). I. Role d'un apport de potassium

    OpenAIRE

    Shamsun-Noor, L.; Robin, Christophe; Guckert, Armand

    1990-01-01

    Le comportement du trèfle blanc (Trifolium repens L cv Crau) est étudié en situation de contrainte hydrique et après réhydratation en liaison avec la fertilisation potassique. Le déficit en eau occasionne une décroissance progressive importante du potentiel hydrique des feuilles et une fermeture rapide des stomates. Ces manifestations sont accompagnées d’une chute de l’activité photosynthétique et de la fixation symbiotique de l’azote. En présence de potassium, la diminution de l’activité...

  6. Heat treatment and false-positive heartworm antigen testing in ex vivo parasites and dogs naturally infected by Dirofilaria repens and Angiostrongylus vasorum

    Directory of Open Access Journals (Sweden)

    Luigi Venco

    2017-11-01

    Full Text Available Abstract Background Heartworm antigen testing is considered sensitive and specific. Currently available tests are reported as detecting a glycoprotein found predominantly in the reproductive tract of the female worm and can reach specificity close to 100%. Main concerns regard sensitivity in the case of light infections, the presence of immature females or cases of all-male infections. Research and development have been aimed at increasing sensitivity. Recently, heat treatment of serum prior to antigen testing has been shown to result in an increase in positive antigen test results, presumably due to disruption of natural antigen–antibody complexes. Cross-reactions in dogs with both natural and experimental infections with Angiostrongylus vasorum and Spirocerca lupi have been reported, but cross-reactions with other helminths have not been extensively studied. In order to evaluate potential cross-reactivity with other canine and feline parasites, two studies were performed. Study 1: Live adults of Dirofilaria immitis, Dirofilaria repens, Toxocara canis, Toxocara cati, Dipylidium caninum, Taenia taeniaeformis and Mesocestoides spp. larvae were washed and incubated in tubes with saline solution. All worms were alive at the time of removal from the saline. Saline solutions containing excretory/secretory antigens were then tested for heartworm with six different, commercially available antigen tests. All results were evaluated blind by three of the authors. Study 2: Sera from dogs with natural infections by A. vasorum or D. repens, living in areas free of heartworm disease, were tested with the same tests before and after heat treatment (103 °C for 10 min. Results Results suggest that antigens detected by currently available tests are not specific for D. immitis. They may give positive results through detection of different parasites’ antigens that are normally not released into the bloodstream or released in a low amount and/or bound to

  7. Comparison of tamsulosin plus serenoa repens with tamsulosin in the treatment of benign prostatic hyperplasia in Korean men: 1-year randomized open label study.

    Science.gov (United States)

    Ryu, Young Woo; Lim, Song Won; Kim, Jung Hoon; Ahn, Seung Hyun; Choi, Jae Duck

    2015-01-01

    In Korea, increasing attention has recently been given to the use of phytotherapeutic agents to alleviate the symptoms of BPH. Serenoa repens has been shown to have an equivalent efficacy to Finasteride or Tamsulosin in the treatment of BPH in previous studies. The present study was designed to compare the efficacy and safety of Serenoa repens plus tamsulosin with tamsulosin only over 12 months in men with LUTS secondary to BPH. One hundred forty men with symptomatic BPH (IPSS≥10) were recruited in our hospital for a 12-month, open-label, randomized trial. Patients were randomly assigned to either tamsulosin 0.2 mg/day plus Serenoa repens 320 mg/day (n=60) or tamsulosin 0.2 mg/day only (n=60). Prostate volume and PSA were measured at baseline and at end-point, whereas total IPSS, and its storage and voiding subscores, LUTS-related QoL, Qmax, and PVR were evaluated at baseline and later every 6 months. Total 103 patients were finally available: 50 in the TAM+SR group and 53 in the TAM group. At 12 months, total IPSS decreased by 5.8 with TAM+SR and 5.5 with TAM (p=0.693); the storage symptoms improved significantly more with TAM+SR (-1.7 vs. -0.8 with TAM, p=0.024). This benefit with regard to storage symptom in the TAM+SR group lasts at 12 months (-1.9 vs. -0.9, p=0.024). The changes of voiding subscore, LUTS-related QoL, Qmax, PVR, PSA, and prostate volume showed no significant differences between the TAM+SR and TAM groups. During the treatment period, 8 patients (16.9%) with TAM and 10 (20%) with TAM+SR had drug-related adverse reactions, which included ejaculatory disorders, postural hypotension, dizziness, headache, gastro-intestinal disorders, rhinitis, fatigue and asthenia. The combination treatment of Serenoa repens and tamsulosin was shown to be more effective than tamsulosin monotherapy in reducing storage symptoms in BPH patients after 6 months and up to 12 months of treatment. © 2015 S. Karger AG, Basel.

  8. Radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (Family: Poaceae), against radiation-induced cytogenetic damage

    International Nuclear Information System (INIS)

    Satish Rao, B.S.; Upadhya, D.; Adiga, S.K.

    2007-01-01

    The exposure of humans to ionizing radiations may be advertently by routine diagnostic and therapeutic purposes or inadvertently during natural, occupational and nuclear accident situations. Therefore, in order to overcome the deleterious biological effects of radiation several chemical agents have been studied for their radioprotective potential. The medicinal plants being one of the resources for such clinically important natural agents, used extensively in several drug discovery related research. Here the radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (Family: Poaceae), against radiation-induced cytogenetic damage was analyzed using Chinese hamster fibroblast cells (V79) and human peripheral blood lymphocytes (HPBLs) growing in vitro is reported

  9. Study of the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal

    OpenAIRE

    Diop, Serigne Mbacké; Guèye, Momar Talla; Ndiaye, Ibrahima; Diop, Michel Bakar; Ndiaye, El Hadji Barka; Thiam, Abdoulaye; Fauconnier, Marie-Laure; Lognay, Georges

    2017-01-01

    This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried out by GC/FID and GC/MS. Oils from Dakar were dominated by geranial which represented 46.0-43.9%, neral 31.8-31.0%, myrcene 10.8-11.7% and geraniol 2.7-4.2% in the fresh and d...

  10. Phylogenomics and taxonomy of Lecomtelleae (Poaceae), an isolated panicoid lineage from Madagascar.

    Science.gov (United States)

    Besnard, Guillaume; Christin, Pascal-Antoine; Malé, Pierre-Jean G; Coissac, Eric; Ralimanana, Hélène; Vorontsova, Maria S

    2013-10-01

    An accurate characterization of biodiversity requires analyses of DNA sequences in addition to classical morphological descriptions. New methods based on high-throughput sequencing may allow investigation of specimens with a large set of genetic markers to infer their evolutionary history. In the grass family, the phylogenetic position of the monotypic genus Lecomtella, a rare bamboo-like endemic from Madagascar, has never been appropriately evaluated. Until now its taxonomic treatment has remained controversial, indicating the need for re-evaluation based on a combination of molecular and morphological data. The phylogenetic position of Lecomtella in Poaceae was evaluated based on sequences from the nuclear and plastid genomes generated by next-generation sequencing (NGS). In addition, a detailed morphological description of L. madagascariensis was produced, and its distribution and habit were investigated in order to assess its conservation status. The complete plastid sequence, a ribosomal DNA unit and fragments of low-copy nuclear genes (phyB and ppc) were obtained. All phylogenetic analyses place Lecomtella as an isolated member of the core panicoids, which last shared a common ancestor with other species >20 million years ago. Although Lecomtella exhibits morphological characters typical of Panicoideae, an unusual combination of traits supports its treatment as a separate group. The study showed that NGS can be used to generate abundant phylogenetic information rapidly, opening new avenues for grass phylogenetics. These data clearly showed that Lecomtella forms an isolated lineage, which, in combination with its morphological peculiarities, justifies its treatment as a separate tribe: Lecomtelleae. New descriptions of the tribe, genus and species are presented with a typification, a distribution map and an IUCN conservation assessment.

  11. Cercosporoid fungi (Mycosphaerellaceae) 2. Species on monocots (Acoraceae to Xyridaceae, excluding Poaceae).

    Science.gov (United States)

    Braun, Uwe; Crous, Pedro W; Nakashima, Chiharu

    2014-12-01

    Cercosporoid fungi (formerly Cercospora s. lat.) represent one of the largest groups of hyphomycetes belonging to the Mycosphaerellaceae (Ascomycota). They include asexual morphs, asexual holomorphs, or species with mycosphaerella-like sexual morphs. Most of them are leaf-spotting plant pathogens with special phytopathological relevance. In the first part of a new monographic work, cercosporoid hyphomycetes occurring on other fungi (fungicolous species), on ferns (pteridophytes) and gymnosperms were treated. This second part deals with cercosporoid fungi on monocots (Liliopsida; Equisetopsida, Magnoliidae, Lilianae), which covers species occurring on host plants belonging to families arranged in alphabetical order from Acoraceae to Xyridaceae, excluding Poaceae (cereals and grasses) which requires a separate treatment. The species are described and illustrated in alphabetical order under the particular cercosporoid genera, supplemented by keys to the species concerned. A detailed introduction, a survey of currently recognised cercosporoid genera, a key to the genera concerned, and a discussion of taxonomically relevant characters were published in the first part of this series. Neopseudocercospora, an additional recently introduced cercosporoid genus, is briefly discussed. The following taxonomic novelties are introduced: Cercospora alpiniigena sp. nov., C. neomaricae sp. nov., Corynespora palmicola comb. nov., Exosporium miyakei comb. nov., E. petersii comb. nov., Neopseudocercospora zambiensis comb. nov., Passalora caladiicola comb. nov., P. streptopi comb. nov., P. togashiana comb. nov., P. tranzschelii var. chinensis var. nov., Pseudocercospora beaucarneae comb. nov., P. constrictoflexuosa comb. et stat. nov., P. curcumicola sp. nov., P. dispori comb. nov., P. smilacicola sp. nov., P. urariigena nom. nov., Zasmidium agavicola comb. nov., Z. cercestidis-afzelii comb. nov., Z. citri-griseum comb. nov., Z. cyrtopodii comb. nov., Z. gahnae comb. nov., Z. indicum

  12. Serenoa repens extract additionally to quinolones in the treatment of chronic bacterial prostatitis. The preliminary results of a long term observational study

    Directory of Open Access Journals (Sweden)

    Konstantinos Stamatiou

    2013-12-01

    Full Text Available Introduction: Chronic prostatitis displays a variety of symptoms (mainly local pain exhibiting variability in origin and intensity. The purpose of this article is to briefly present the preliminary results of our study examining the role of phytotherapeutic agents in the treatment of chronic prostatitis patients. Materials and methods: The study included in total fifty-six consecutive patients who visited the outpatient department. Subjects were randomized into two groups. Subjects in the first group (28 patients received prulifloxacin 600 mg for 15 days, while subjects in the second group (28 patients received prulifloxacin 600 mg for 15 days and Serenoa repens extract for 8 weeks. The response was tested using laboratory and clinical criteria. Results: We found statistically significant differences between the two groups regarding pain regression and no statistically significant regarding bacterial eradication. Moreover however while sexual dysfunction improvement was equally achieved in both groups, improvement of urinary symptoms was more evident in the 2nd group especially after the completion of the antibiotic treatment. Conclusions: Serenoa repens extract for 8 weeks seems to improve prostatitis related pain. Further randomized, placebo-controlled studies are needed to substantiate safer conclusions.

  13. Acrapex azumai Sugi (Lepidoptera, Noctuidae) as a possible biological control agent of the invasive weed Imperata cylindrica (L.) Beauv. (Poaceae) in the United States

    Science.gov (United States)

    Lepidopteran larvae were discovered boring in the basal stems of Imperata cylindrica (L.) Beauv. (Poaceae) in Itoshima city, Fukuoka Prefecture, Kyushu, Japan. Adults reared from these larvae were identified as Acrapex azumai Sugi (Lepidoptera: Noctuidae). Sequencing of the CO1 (cytochrome oxidase 1...

  14. Chloroplast phylogenomic analyses resolve deep-level relationships of an intractable bamboo tribe Arundinarieae (poaceae).

    Science.gov (United States)

    Ma, Peng-Fei; Zhang, Yu-Xiao; Zeng, Chun-Xia; Guo, Zhen-Hua; Li, De-Zhu

    2014-11-01

    The temperate woody bamboos constitute a distinct tribe Arundinarieae (Poaceae: Bambusoideae) with high species diversity. Estimating phylogenetic relationships among the 11 major lineages of Arundinarieae has been particularly difficult, owing to a possible rapid radiation and the extremely low rate of sequence divergence. Here, we explore the use of chloroplast genome sequencing for phylogenetic inference. We sampled 25 species (22 temperate bamboos and 3 outgroups) for the complete genome representing eight major lineages of Arundinarieae in an attempt to resolve backbone relationships. Phylogenetic analyses of coding versus noncoding sequences, and of different regions of the genome (large single copy and small single copy, and inverted repeat regions) yielded no well-supported contradicting topologies but potential incongruence was found between the coding and noncoding sequences. The use of various data partitioning schemes in analysis of the complete sequences resulted in nearly identical topologies and node support values, although the partitioning schemes were decisively different from each other as to the fit to the data. Our full genomic data set substantially increased resolution along the backbone and provided strong support for most relationships despite the very short internodes and long branches in the tree. The inferred relationships were also robust to potential confounding factors (e.g., long-branch attraction) and received support from independent indels in the genome. We then added taxa from the three Arundinarieae lineages that were not included in the full-genome data set; each of these were sampled for more than 50% genome sequences. The resulting trees not only corroborated the reconstructed deep-level relationships but also largely resolved the phylogenetic placements of these three additional lineages. Furthermore, adding 129 additional taxa sampled for only eight chloroplast loci to the combined data set yielded almost identical

  15. Disentangling the effects of feedback structure and climate on Poaceae annual airborne pollen fluctuations and the possible consequences of climate change.

    Science.gov (United States)

    García de León, David; García-Mozo, Herminia; Galán, Carmen; Alcázar, Purificación; Lima, Mauricio; González-Andújar, José L

    2015-10-15

    Pollen allergies are the most common form of respiratory allergic disease in Europe. Most studies have emphasized the role of environmental processes, as the drivers of airborne pollen fluctuations, implicitly considering pollen production as a random walk. This work shows that internal self-regulating processes of the plants (negative feedback) should be included in pollen dynamic systems in order to give a better explanation of the observed pollen temporal patterns. This article proposes a novel methodological approach based on dynamic systems to investigate the interaction between feedback structure of plant populations and climate in shaping long-term airborne Poaceae pollen fluctuations and to quantify the effects of climate change on future airborne pollen concentrations. Long-term historical airborne Poaceae pollen data (30 years) from Cordoba city (Southern Spain) were analyzed. A set of models, combining feedback structure, temperature and actual evapotranspiration effects on airborne Poaceae pollen were built and compared, using a model selection approach. Our results highlight the importance of first-order negative feedback and mean annual maximum temperature in driving airborne Poaceae pollen dynamics. The best model was used to predict the effects of climate change under two standardized scenarios representing contrasting temporal patterns of economic development and CO2 emissions. Our results predict an increase in pollen levels in southern Spain by 2070 ranging from 28.5% to 44.3%. The findings from this study provide a greater understanding of airborne pollen dynamics and how climate change might impact the future evolution of airborne Poaceae pollen concentrations and thus the future evolution of related pollen allergies. Copyright © 2015 Elsevier B.V. All rights reserved.

  16. Vector-borne parasitic infections in dogs in the Baltic and Nordic countries: A questionnaire study to veterinarians on canine babesiosis and infections with Dirofilaria immitis and Dirofilaria repens.

    Science.gov (United States)

    Tiškina, Valentina; Jokelainen, Pikka

    2017-09-15

    Canine vector-borne diseases have been spreading northwards in Europe, and canine babesiosis and infections with Dirofilaria immitis (heartworm) and Dirofilaria repens have been diagnosed also in the Baltic and the Nordic countries. We used an online questionnaire to survey how large a proportion of veterinarians in the Baltic (Estonia, Latvia, and Lithuania) and the Nordic countries (Denmark, Finland, Iceland, Norway, and Sweden) saw canine babesiosis cases and dogs infected with D. immitis and D. repens in 2016. In addition, questions regarding transmission, zoonotic potential, clinical signs, and treatment of the infections were asked. The questionnaire was completed by 122 veterinarians. In 2016, 23% of them had seen at least one case of canine babesiosis, 15% at least one dog with D. immitis infection, and 9% at least one dog with D. repens infection. A veterinarian working in the Baltic countries had 12.2 times higher odds to have seen a canine babesiosis case and 9.3 times higher odds to have seen a dog with D. repens infection than a veterinarian working in the Nordic countries did. While 48% of the veterinarians knew that canine babesiosis is not considered a zoonosis, 26% knew that D. immitis is zoonotic and 34% knew that D. repens is zoonotic. The results suggested that autochthonous cases of the three vector-borne parasitic infections were seen by veterinarians in the Baltic countries, whereas most cases seen by veterinarians in the Nordic countries appeared to be imported. A substantial proportion of the veterinarians did not know whether the parasites are zoonotic. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Heavy metal tolerance in Agropyron repens (L. P. Bauv. populations from the Legnica copper smelter area, Lower Silesia

    Directory of Open Access Journals (Sweden)

    Teresa Brej

    2014-01-01

    Full Text Available The copper smelter "Legnica" is one of the oldest plants in Lower Silesia. Among the few weed species spontaneously migrating to the area around the emitter there is couch grass (Agropyron repens (L. P. Bauv.. The purpose of this study was to analyse whether the local couch grass populations, growing at various distances from the smelter, differ in tolerance to heavy metals occurring in this area. The populations were tested for tolerance to five metals (Cu, Zn, Pb, Cd, Ni using the root elongation method. The highest tolerance to Pb developed in two populations localized nearest the smelter. Similarly, all populations of couch grass from the vicinity of the smelter show a high tolerance to copper, particularly the plants from the most contaminated site. The IT for the latter population is almost 1509r, even at the highest dose of Cu. For Zn a nearing IT as for Cu was obtained. Comparing the shape of IT curves for Cd, special emphasis is put on the fact that a fixed tolerance to cadmium occurs only in the population localized closest to the emitter. The analysis of Ni-tolerance curves, of which the content in local soil is minimal, does not confirm the thesis on possibility of development of co-tolerance in the surveyed populations. It appeared that stress conditions existing near the smelter do not inhibit seed production in couch grass, but prevent a successful course of their germination on polluted soil. The improvement of soil even by 50% (addition of unpolluted soil does not improve the poor process of germination in couch grass growing nearest to the smelter. Of importance is the fact that the highest number of seeds germinated on their own, polluted soil. The need of metals' content for plant germination in populations most distant from the smelter is evidenced by an almost 30% reduction of germination ability of local seeds after addition of unpolluted soil. Another significant observation was the fact that, in spite of a poor

  18. Simple Web-based interactive key development software (WEBiKEY) and an example key for Kuruna (Poaceae: Bambusoideae).

    Science.gov (United States)

    Attigala, Lakshmi; De Silva, Nuwan I; Clark, Lynn G

    2016-04-01

    Programs that are user-friendly and freely available for developing Web-based interactive keys are scarce and most of the well-structured applications are relatively expensive. WEBiKEY was developed to enable researchers to easily develop their own Web-based interactive keys with fewer resources. A Web-based multiaccess identification tool (WEBiKEY) was developed that uses freely available Microsoft ASP.NET technologies and an SQL Server database for Windows-based hosting environments. WEBiKEY was tested for its usability with a sample data set, the temperate woody bamboo genus Kuruna (Poaceae). WEBiKEY is freely available to the public and can be used to develop Web-based interactive keys for any group of species. The interactive key we developed for Kuruna using WEBiKEY enables users to visually inspect characteristics of Kuruna and identify an unknown specimen as one of seven possible species in the genus.

  19. Seasonal and annual variations of metal uptake, bioaccumulation, and toxicity in Trifolium repens and Lolium perenne growing in a heavy metal-contaminated field.

    Science.gov (United States)

    Bidar, Géraldine; Pruvot, Christelle; Garçon, Guillaume; Verdin, Anthony; Shirali, Pirouz; Douay, Francis

    2009-01-01

    The reclamation of nonferrous metal-polluted soil by phytoremediation requires an overall and permanent plant cover. To select the most suitable plant species, it is necessary to study metal effects on plants over the time, thereby checking that metals remain stored in root systems and not transferred to aerial parts. In this purpose, the seasonal and annual variations of metal bioaccumulation, transfer, and phytotoxicity in Trifolium repens and Lolium perenne grown in a Cd-, Pb-, and Zn-contaminated soil were also studied. The experimental site was located near a closed smelter. In spring 2004, two areas were sown with T. repens and L. perenne, respectively. Thereafter, the samplings of plant roots and shoots and surrounding soils were realized in autumn 2004 and spring and autumn 2005. The soil agronomic characteristics, the Cd, Pb, and Zn concentrations in the surrounded soils and plant organs, as well as the oxidative alterations (superoxide dismutase [SOD], malondialdehyde [MDA], and 8-hydroxy-2'-deoxyguanosine [8-OHdG]) in plant organs were carried out. Whatever the sampling period, metal concentrations in soils and plants were higher than background values. Contrary to the soils, the fluctuations of metal concentrations were observed in plant organs over the time. Bioaccumulation and transfer factors confirmed that metals were preferentially accumulated in the roots as follows: Cd>Zn>Pb, and their transfer to shoots was limited. Foliar metal deposition was also observed. The results showed that there were seasonal and annual variations of metal accumulation in the two studied plant species. These variations differed according to the organs and followed nearly the same pattern for the two species. Oxidative alterations were observed in plant organs with regard to SOD antioxidant activities, MDA, and 8-OHdG concentrations. These alterations vary according to the temporal variations of metal concentrations. Metal concentrations in surrounded soils and plant

  20. Plant Responses to Climate Change: The Case Study of Betulaceae and Poaceae Pollen Seasons (Northern Italy, Vignola, Emilia-Romagna

    Directory of Open Access Journals (Sweden)

    Anna Maria Mercuri

    2016-12-01

    Full Text Available Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change.

  1. Plant Responses to Climate Change: The Case Study of Betulaceae and Poaceae Pollen Seasons (Northern Italy, Vignola, Emilia-Romagna)

    Science.gov (United States)

    Mercuri, Anna Maria; Torri, Paola; Fornaciari, Rita; Florenzano, Assunta

    2016-01-01

    Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region) that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change. PMID:27929423

  2. Global grass (Poaceae) success underpinned by traits facilitating colonization, persistence and habitat transformation.

    Science.gov (United States)

    Linder, H P; Lehmann, Caroline E R; Archibald, Sally; Osborne, Colin P; Richardson, David M

    2018-05-01

    Poaceae (the grasses) is arguably the most successful plant family, in terms of its global occurrence in (almost) all ecosystems with angiosperms, its ecological dominance in many ecosystems, and high species richness. We suggest that the success of grasses is best understood in context of their capacity to colonize, persist, and transform environments (the "Viking syndrome"). This results from combining effective long-distance dispersal, efficacious establishment biology, ecological flexibility, resilience to disturbance and the capacity to modify environments by changing the nature of fire and mammalian herbivory. We identify a diverse set of functional traits linked to dispersal, establishment and competitive abilities. Enhanced long-distance dispersal is determined by anemochory, epizoochory and endozoochory and is facilitated via the spikelet (and especially the awned lemma) which functions as the dispersal unit. Establishment success could be a consequence of the precocious embryo and large starch reserves, which may underpin the extremely short generation times in grasses. Post-establishment genetic bottlenecks may be mitigated by wind pollination and the widespread occurrence of polyploidy, in combination with gametic self-incompatibility. The ecological competitiveness of grasses is corroborated by their dominance across the range of environmental extremes tolerated by angiosperms, facilitated by both C 3 and C 4 photosynthesis, well-developed frost tolerance in several clades, and a sympodial growth form that enabled the evolution of both annual and long-lived life forms. Finally, absence of investment in wood (except in bamboos), and the presence of persistent buds at or below ground level, provides tolerance of repeated defoliation (whether by fire, frost, drought or herbivores). Biotic modification of environments via feedbacks with herbivory or fire reinforce grass dominance leading to open ecosystems. Grasses can be both palatable and productive

  3. Effect of Mycorrhizal Fungi and Trifluralin Herbicide on Emergence, Growth and Root Colonization of Clover (Trifolium repens L.

    Directory of Open Access Journals (Sweden)

    Hassan Shahgholi

    2016-09-01

    Full Text Available Introduction: Herbicides, despite of their control of weeds, have the potential to affect sensitive crops in rotation and also beneficial non-targeted soil microbes including vesicular arbuscular mycorrhiza (VAM fungi (6. AM fungi can increase the growth of crops through increasing uptake of phosphorus and insoluble micronutrients, and indirectly by improving soil quality parameters (30. However, several authors have reported different effects of herbicides on VAM symbiosis, which ranges from no adverse effects to slightly or highly toxic effects (6. Pesticides have also been reported to stimulate colonization of plant roots by AM fungi (27. Therefore, the objective of this study was to investigate the interaction effects of mycorrhizal fungi and Trifluralin herbicide on the growth and root colonization of clover. Materials and Methods: A factorial experiment was arranged in randomized complete block design with three replicates at the College of Agricultural, University of Shahrood during 2012. Treatments were included three levels of mycorrhiza inoculation, M1: non mycorrhiza (control, M2: Glommus mosseae and M3: Glommus intraradices and herbicide treatments were included four levels of Trifluralin(T1: 0, T2: 1000, T3: 1500 and T4: 2000 ml ha-1. In mycorrhizal treatments, 20 g inoculums were thoroughly mixed with soil. Seeds of clover (Trifolium repens L. were sown in the pots maintained near the field in order to provide normal environmental conditions. Seedlings were thinned to two plants per pot at three leaf stages. At the time of harvesting, the emergence and growth characteristics of clover and root colonization was also registered. Statistical analyses of data were performed with statistical software MSTATC. Significant differences between means refer to the probability level of 0.05 calculated by LSD test. Results and Discussion: The results showed that emergence, uniformity (EU values decreased and time to 10% (D10 and 90% (D90 of

  4. Anti-methicillin-resistant Staphylococcus aureus (MRSA) activity of Rubiaceae, Fabaceae and Poaceae plants: A search for new sources of useful alternative antibacterials against MRSA infections.

    Science.gov (United States)

    Sharifi-Rad, M; Iriti, M; Sharifi-Rad, M; Gibbons, S; Sharifi-Rad, J

    2016-08-29

    In this study, we evaluated the effects of the extracts of the leaves of species from the Rubiaceae (Galium aparine L. and Asperula arvensis L.), Fabaceae (Lathyrus aphaca L. and Vicia narbonensis L.) and Poaceae (Digitaria sanguinalis (L.) Scop. and Hordeum murinum L.) plant families on a wide and extensive panel of isolated methicillin-resistant Staphylococcus aureus strains (MRSA). The effects of the methanolic leaf extracts of Rubiaceae, Fabaceae and Poaceae plants on MRSA were evaluated by the disc diffusion assay and the broth dilution method. Among a total of 177 S. aureus isolates, 92 (51.97%) were found to be methicillin-resistant in an antibiogram and this was confirmed by the presence of the mecA gene in polymerase chain reaction method. All MRSA isolates were sensitive to all extracts. There were dose-dependent inhibitions on tested microorganisms for all plant extracts which showed maximum inhibition zones at a concentration of 300 mg/L. L. aphaca, G. aparine and H. murinum exhibited the highest antibacterial activity on the MRSA strains compared to the positive control (P Fabaceae), G. aparine (Rubiaceae), and H. murinum (Poaceae) proved to have high antibacterial activity on MRSA isolates, thus representing promising antimicrobial agents in clinical settings.

  5. Evaluating sampling strategy for DNA barcoding study of coastal and inland halo-tolerant Poaceae and Chenopodiaceae: A case study for increased sample size.

    Science.gov (United States)

    Yao, Peng-Cheng; Gao, Hai-Yan; Wei, Ya-Nan; Zhang, Jian-Hang; Chen, Xiao-Yong; Li, Hong-Qing

    2017-01-01

    Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.

  6. Anther and pollen development in some species of Poaceae (Poales Desenvolvimento da antera e do grão de pólen em espécies de Poaceae (Poales

    Directory of Open Access Journals (Sweden)

    AT. Nakamura

    2010-05-01

    Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.O desenvolvimento da antera e do grão de pólen de Olyra humilis Nees, Sucrea monophylla Soderstr. (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees and Chloris elata Desv. (Chloridoideae foi estudado visando caracterizar embriologicamente essas espécies de subfamílias consideradas basal, intermediária e derivada, respectivamente. As espécies são similares entre si e entre as demais Poaceae. Apresentam os seguintes caracteres: anteras tetrasporangiadas; desenvolvimento da parede da antera do tipo monocotiledôneo, endotécio com espessamento de parede anelar, tapete secretor; microsporogênese sucessiva; tétrades isobilaterais; grãos de

  7. Serenoa repens associated with selenium and lycopene extract and bromelain and methylsulfonylmethane extract are able to improve the efficacy of levofloxacin in chronic bacterial prostatitis patients

    Directory of Open Access Journals (Sweden)

    Tommaso Cai

    2016-10-01

    Full Text Available Objective: To date, the management of patients with chronic bacterial prostatitis (CBP is not satisfactory, especially in terms of symptoms relief. Here, we evaluated the efficacy and the safety of a combination of serenoa repens, selenium and lycopene extract + bromelain and methylsulfonylmethane extract associated with levofloxacin in patients with CBP. Materials and methods: All patients with clinical and instrumental diagnosis of CBP, admitted to a single Urological Institution from March to June 2015 were enrolled in this phase III study. All enrolled patients were randomized into two groups: Group A received levofloxacin 500 mg o.d. for 14 days associated with lycopene and methylsulfonylmethane; Group B received levofloxacin (500 mg o.d. for 14 days only. Clinical and microbiological analyses were carried out at the time of admission (T0 and during the followups at 1 month (T1 and 6 months (T2 from the end of the treatment. NIH Chronic Prostatitis Symptom Index (CPSI, International Prostatic Symptom Score (IPSS and Quality of Well-Being (QoL questionnaires were used. The main outcome measures were the rate of microbiological cure and the improvement in questionnaire results from baseline at the end of the follow-ups period. Results: Forty patients were enrolled in Group A and 39 in Group B. During the follow-up (T1, we recorded a significant changes in terms of NIH-CPSI and IPSS in Group A (mean difference: 17.6 ± 2.65; 12.2 ± 2.33; p < 0.01; p < 0.05, respectively and versus Group B at the intergroup analysis (mean difference: -9 ± 1.82; -8.33 ± 1.71; p < 0.05; p < 0.05, respectively. No differences were reported in terms of microbiological findings between the two groups. At the second follow-up visit (T2, questionnaire results demonstrated statistically significant differences between groups (p < 0.001. One patient in Group A (2.5% and 7 patients (17.9% in Group B showed a symptomatic and microbiological recurrence (p = 0

  8. [Associating Serenoa repens, Urtica dioica and Pinus pinaster. Safety and efficacy in the treatment of lower urinary tract symptoms. Prospective study on 320 patients].

    Science.gov (United States)

    Pavone, C; Abbadessa, D; Tarantino, M L; Oxenius, I; Laganà, A; Lupo, A; Rinella, M

    2010-01-01

    Serenoa repens (saw palmetto) has been employed for the treatment of lower urinary tract symptoms (LUTS) for several years. Its mechanism of action is believed to be due to antiandrogenic, antiproliferative and antinflammatory properties. An association of Serenoa with the nettle "Urtica dioica" showing antiproliferative activity and the pine "Pinus pinaster" derivative, showing antinflammatory action, has been proposed in recent years. Such an action is hoped to act not only by reducing LUTS but also by preventing the development of prostate cancer. During the years 2007 and 2008, 320 patients suffering from LUTS were treated with an association of Serenoa repens 320 mg, Urtica dioica 120 mg and Pinus pinaster 5 mg, named IPBTRE. This treatment was administered to all patients for a minimal duration of 30 days to a maximum of a year, either alone or in association with antibiotics or alpha-blockers, if needed. Outcome analysis was based on evaluation of symptoms, prostate volume and maximum flow rate (Qmax). From a careful analysis of the data collected in our database, the following observations can be made: ages varied between 19 and 78 years. The patients were affected by BPH in 46% of cases, chronic prostatitis syndrome in 43%, chronic genital-pelvic pain in 7% and other conditions in 4%, the absolute numbers being 147, 138, 22 and 7 patients, respectively. No untoward side effect was reported in any case. Variations in symptom score could be fully evaluated only in 80 of 320 patients (25%), of whom 68 (85%) reported a significant benefit, with special reference to an improvement of pain, urgency, strangury and nocturia. Data on variations in prostate volume, as measured by digital rectal examination, were available in 84 (26.5%) patients. No significant change was observed. Qmax after treatment was measured in 83 (26%) patients. It did not show significant changes from the initial values. The association tested in our study appeared to be safe and well

  9. Anatomía ecológica de algunas especies del género Paspalum (Poaceae, Panicoideae, Paniceae

    Directory of Open Access Journals (Sweden)

    Sandra S. Aliscioni

    2000-01-01

    Full Text Available Aliscioni, S. S. 2000. Anatomía ecológica de algunas especies del género Paspalum(Poaceae, Panicoideae, Paniceae. Darwiniana 38(3-4: 187-207.El género Paspalum L. presenta un elevado número de especies, con una amplia variabilidadmorfológica y una extensa distribución geográfica. Sus especies crecen en hábitats sumamente diversos,desde ambientes muy húmedos o acuáticos, a lugares secos de suelos arcillosos o arenosos, muchas vecessalinos. Dada la diversidad de ambientes en los que puede hallarse Paspalum, se estudiaron lascaracterísticas anatómico-foliares presentes en el género con la finalidad de interpretar diferentesestrategias adaptativas en distintas especies. Se presenta una descripción general de la anatomía foliar delgénero y se discuten ciertos caracteres anatómicos, interpretando su posible relación con las condicionesdel hábitat

  10. Black Rice (Oryza sativa L., Poaceae) Extract Reduces Hippocampal Neuronal Cell Death Induced by Transient Global Cerebral Ischemia in Mice.

    Science.gov (United States)

    Hwang, Sun-Nyoung; Kim, Jae-Cheon; Bhuiyan, Mohammad Iqbal Hossain; Kim, Joo Youn; Yang, Ji Seon; Yoon, Shin Hee; Yoon, Kee Dong; Kim, Seong Yun

    2018-04-01

    Rice is the most commonly consumed grain in the world. Black rice has been suggested to contain various bioactive compounds including anthocyanin antioxidants. There is currently little information about the nutritional benefits of black rice on brain pathology. Here, we investigated the effects of black rice ( Oryza sativa L ., Poaceae) extract (BRE) on the hippocampal neuronal damage induced by ischemic insult. BRE (300 mg/kg) was orally administered to adult male C57BL/6 mice once a day for 21 days. Bilateral common carotid artery occlusion (BCCAO) was performed for 23 min on the 8th day of BRE or vehicle administration. Histological analyses conducted on the 22nd day of BRE or vehicle administration revealed that administering BRE profoundly attenuated neuronal cell death, inhibited reactive astrogliosis, and prevented loss of glutathione peroxidase expression in the hippocampus when compared to vehicle treatment. In addition, BRE considerably ameliorated BCCAO-induced memory impairment on the Morris water maze test from the 15th day to the 22nd day of BRE or vehicle administration. These results indicate that chronic administration of BRE is potentially beneficial in cerebral ischemia.

  11. Cytomorphological studies in some members of tribe Paniceae (Poaceae) from district Kangra of Himachal Pradesh (Western Himalayas).

    Science.gov (United States)

    Kaur, H; Kumari, S; Gupta, R C

    2013-01-01

    The present paper deals with cytological studies on the population basis of 21 species belonging to 9 genera of tribe Paniceae of family Poaceae from cytologically unexplored area of Western Himalayas i.e. district Kangra of Himachal Pradesh for the assessment of genetic diversity of grass flora. On world-wide basis, the chromosome counts have been made for the first time for three species such as Brachiaria remota (n = 16), Digitaria granularis (n = 36) and Isachne albens (n = 5). Similarly, on India basis, altogether new records are made for two species such as Echinochloa cruspavonis (n = 27) and Paspalum distichum (2n = 50). A comparison of the different euploid cytotypes studied at present for Digitaria adscendens, D. setigera and Oplismenus compositus revealed significant variations in their morphology, depicting increase in some of the characters of polyploid cytotypes. The course of meiosis has been observed to be normal in all the studied populations with high pollen fertility except for two species such as Paspalum dilatatum and P. distichum marked with abnormal meiosis and reduced pollen fertility.

  12. Molecular analysis of the genera eremopyrum (ledeb). jaub. and spach and agropyron gaertner (poaceae) by pcr methods

    International Nuclear Information System (INIS)

    Yilmaz, R.; Cabi, E.; Dogan, M.

    2014-01-01

    RAPD-PCR (Random Amplified Polymorphic DNA Polymerase Chain Reaction) and Post PCR (Polymerase Chain Reaction) Melting Curve Analysis (MCA) have been used to investigate the pattern of genetic variation among some species in the genera Eremopyrum (Ledeb.) Jaub. and Spach and Agropyron Gaertner (Poaceae). Thirteen primers have been used in the study based on the RAPD-PCR and MCA analyses. Each species produced a distinct pattern of DNA fragments which have been used as a measure of the degree of relationship between species by means of using the RAPD-PCR results with three primers selected for identifying the genetic similarities. Polymorphic melting profiles have been obtained with Post PCR MCA method using three primers. Genetic similarities are calculated for all the species studied with RAPD-PCR and MCA methods, the dendrograms are obtained with the MVSP (Multi Variate Statistical Package) software using UPGMA (Unweighted Pair Group Method with Arithmetic Averages) and Jaccard's Coefficient. Polymorphism between 18 populations of Eremopyrum and 6 Agropyron populations and within the species are determined by using RAPD-PCR and Post PCR melting curve analysis (MCA) respectively. (author)

  13. Phylogeny of Eleusine (Poaceae: Chloridoideae) based on nuclear ITS and plastid trnT-trnF sequences.

    Science.gov (United States)

    Neves, Susana S; Swire-Clark, Ginger; Hilu, Khidir W; Baird, Wm Vance

    2005-05-01

    Phylogenetic relationships in the genus Eleusine (Poaceae: Chloridoideae) were investigated using nuclear ITS and plastid trnT-trnF sequences. Separate and combined data sets were analyzed using parsimony, distance, and likelihood based methods, including Bayesian. Data congruence was examined using character and topological measures. Significant data heterogeneity was detected, but there was little conflict in the topological substructure measures for triplets and quartets, and resolution and clade support increased in the combined analysis. Data incongruence may be a result of noise and insufficient information in the slower evolving trnT-trnF. Monophyly of Eleusine is strongly supported in all analyses, but basal relationships in the genus remain uncertain. There is good support for a CAIK clade (E. coracana subsp. coracana and africana, E. indica, and E. kigeziensis), with E. tristachya as its sister group. Two putative ITS homeologues (A and B loci) were identified in the allotetraploid E. coracana; the 'B' locus sequence type was not found in the remaining species. Eleusine coracana and its putative 'A' genome donor, the diploid E. indica, are confirmed close allies, but sequence data contradicts the hypothesis that E. floccifolia is its second genome donor. The 'B' genome donor remains unidentified and may be extinct.

  14. Chemical composition and cardiovascular effects induced by the essential oil of Cymbopogon citratus DC. Stapf, Poaceae, in rats

    Directory of Open Access Journals (Sweden)

    Flávia V. Moreira

    2010-08-01

    Full Text Available Cymbopogon citratus DC. Stapf, Poaceae, is used in the folk medicine for hypertension treatment. This work investigated the chemical composition and cardiovascular effects in rats of C. citratus essential oil (EOCC. A phytochemical screening demonstrated the presence of eight constituents, being geranial the major compound (43.08%. In rats, EOCC (1, 5, 10, and 20 mg/kg, i.v. induced transient hypotension and bradycardia that were attenuated by atropine and sodium thiopental, but not by L-NAME or indomethacin. In rings of rat superior mesenteric artery pre-contracted with phenylephrine, EOCC (1 to 3000 µg/mL induced relaxation that was not affected after removal of the endothelium, after TEA or in rings pre-contracted with KCl (80 mM. Furthermore, EOCC (1000 µg/mL was not able to induce additional effect on maximal relaxation of nifedipine (10 µM. In conclusions, EOCC induces hypotension, possibly by reduction in vascular resistance caused by inhibition of the Ca2+ influx, and bradycardia probably due to an activation of cardiac muscarinic receptors.

  15. Analysis of Mycosporine-Like Amino Acids in Selected Algae and Cyanobacteria by Hydrophilic Interaction Liquid Chromatography and a Novel MAA from the Red Alga Catenella repens

    Directory of Open Access Journals (Sweden)

    Anja Hartmann

    2015-10-01

    Full Text Available Mycosporine-like amino acids (MAAs, a group of small secondary metabolites found in algae, cyanobacteria, lichens and fungi, have become ecologically and pharmacologically relevant because of their pronounced UV-absorbing and photo-protective potential. Their analytical characterization is generally achieved by reversed phase HPLC and the compounds are often quantified based on molar extinction coefficients. As an alternative approach, in our study a fully validated hydrophilic interaction liquid chromatography (HILIC method is presented. It enables the precise quantification of several analytes with adequate retention times in a single run, and can be coupled directly to MS. Excellent linear correlation coefficients (R2 > 0.9991 were obtained, with limit of detection (LOD values ranging from 0.16 to 0.43 µg/mL. Furthermore, the assay was found to be accurate (recovery rates from 89.8% to 104.1% and precise (intra-day precision: 5.6%, inter-day precision ≤6.6%. Several algae were assayed for their content of known MAAs like porphyra-334, shinorine, and palythine. Liquid chromatography-mass spectrometry (LC-MS data indicated a novel compound in some of them, which could be isolated from the marine species Catenella repens and structurally elucidated by nuclear magnetic resonance spectroscopy (NMR as (E-3-hydroxy-2-((5-hydroxy-5-(hydroxymethyl-2-methoxy-3-((2-sulfoethylaminocyclohex-2-en-1-ylideneamino propanoic acid, a novel MAA called catenelline.

  16. Arbuscular mycorrhiza enhanced arsenic resistance of both white clover (Trifolium repens Linn.) and ryegrass (Lolium perenne L.) plants in an arsenic-contaminated soil

    International Nuclear Information System (INIS)

    Dong Yan; Zhu Yongguan; Smith, F. Andrew; Wang Youshan; Chen Baodong

    2008-01-01

    In a compartmented cultivation system, white clover (Trifolium repens Linn.) and ryegrass (Lolium perenne L.), with their roots freely intermingled, or separated by 37 μm nylon mesh or plastic board, were grown together in an arsenic (As) contaminated soil. The influence of AM inoculation on plant growth, As uptake, phosphorus (P) nutrition, and plant competitions were investigated. Results showed that both plant species highly depended on mycorrhizas for surviving the As contamination. Mycorrhizal inoculation substantially improved plant P nutrition, and in contrast markedly decreased root to shoot As translocation and shoot As concentrations. It also showed that mycorrhizas affected the competition between the two co-existing plant species, preferentially benefiting the clover plants in term of nutrient acquisition and biomass production. Based on the present study, the role of AM fungi in plant adaptation to As contamination, and their potential use for ecological restoration of As contaminated soils are discussed. - Both white clover and ryegrass highly depend on the mycorrhizal associations for surviving heavy arsenic contamination

  17. Effect of Water Extract Originated from Different Part of Russian Knapweed (Acroptilon repens L. on Growth of Purslane (Portulaca oleracea L.

    Directory of Open Access Journals (Sweden)

    Alireza PIRZAD

    2012-05-01

    Full Text Available To evaluate probable allelopathic effect of water extract originated from different parts of russian knapweed (Acroptilon repens L. on growth of purslane (Portulaca oleracea L., a factorial experiment was conducted based on randomized complete block design with three replications at greenhouse condition in 2011. Treatments were water extract concentrations (0, 5, 10, 15 and 20 percent obtained from different part of russian knapweed (aerial part, flower and root. Results showed the significant effect of extract type on seedling length, and extract concentration on shoot length, root length and seedling length. Interaction effect between extract type and concentration on the ratio of root/shoot length, seedling fresh weight, seedling dry weight and germination percentage was significant, too. Means comparison indicated that the longest root (3.55 cm, shoot (4.65 cm and seedling (8.20 cm were obtained from control treatment, reducing with higher concentration of extract. The longest shoot (6.95 cm belonged to extract originated from russian knapweed flowers. The highest ratio of root/shoot length (0.73, seedling fresh weight (0.61g and seedling dry weight (0.044 g belonged to control treatment. In general, increasing of extract concentration caused in reduction of germination and seedling traits. Meanwhile, extracts of aerial part had more sever reducing effect than root and flower extracts.

  18. Analysis of Mycosporine-Like Amino Acids in Selected Algae and Cyanobacteria by Hydrophilic Interaction Liquid Chromatography and a Novel MAA from the Red Alga Catenella repens

    Science.gov (United States)

    Hartmann, Anja; Becker, Kathrin; Karsten, Ulf; Remias, Daniel; Ganzera, Markus

    2015-01-01

    Mycosporine-like amino acids (MAAs), a group of small secondary metabolites found in algae, cyanobacteria, lichens and fungi, have become ecologically and pharmacologically relevant because of their pronounced UV-absorbing and photo-protective potential. Their analytical characterization is generally achieved by reversed phase HPLC and the compounds are often quantified based on molar extinction coefficients. As an alternative approach, in our study a fully validated hydrophilic interaction liquid chromatography (HILIC) method is presented. It enables the precise quantification of several analytes with adequate retention times in a single run, and can be coupled directly to MS. Excellent linear correlation coefficients (R2 > 0.9991) were obtained, with limit of detection (LOD) values ranging from 0.16 to 0.43 µg/mL. Furthermore, the assay was found to be accurate (recovery rates from 89.8% to 104.1%) and precise (intra-day precision: 5.6%, inter-day precision ≤6.6%). Several algae were assayed for their content of known MAAs like porphyra-334, shinorine, and palythine. Liquid chromatography-mass spectrometry (LC-MS) data indicated a novel compound in some of them, which could be isolated from the marine species Catenella repens and structurally elucidated by nuclear magnetic resonance spectroscopy (NMR) as (E)-3-hydroxy-2-((5-hydroxy-5-(hydroxymethyl)-2-methoxy-3-((2-sulfoethyl)amino)cyclohex-2-en-1-ylidene)amino) propanoic acid, a novel MAA called catenelline. PMID:26473886

  19. Influence of fly ash aided phytostabilisation of Pb, Cd and Zn highly contaminated soils on Lolium perenne and Trifolium repens metal transfer and physiological stress

    International Nuclear Information System (INIS)

    Lopareva-Pohu, Alena; Verdin, Anthony; Garcon, Guillaume; Lounes-Hadj Sahraoui, Anissa; Pourrut, Bertrand; Debiane, Djouher; Waterlot, Christophe; Laruelle, Frederic

    2011-01-01

    Due to anthropogenic activities, large extends of soils are highly contaminated by Metal Trace Element (MTE). Aided phytostabilisation aims to establish a vegetation cover in order to promote in situ immobilisation of trace elements by combining the use of metal-tolerant plants and inexpensive mineral or organic soil amendments. Eight years after Coal Fly Ash (CFA) soil amendment, MTE bioavailability and uptake by two plants, Lolium perenne and Trifolium repens, were evaluated, as some biological markers reflecting physiological stress. Results showed that the two plant species under study were suitable to reduce the mobility and the availability of these elements. Moreover, the plant growth was better on CFA amended MTE-contaminated soils, and the plant sensitivity to MTE-induced physiological stress, as studied through photosynthetic pigment contents and oxidative damage was lower or similar. In conclusion, these results supported the usefulness of aided phytostabilisation of MTE-highly contaminated soils. - Highlights: → Aided phytostabilisation aims to establish a vegetation cover in order to promote immobilisation of MTE. → 8 years after the soil amendments, a pot culture study was carried out in greenhouse conditions. → MTE bioavailability and uptake by the two plants was drastically decreased with amendments. → Our results support the usefulness of aided phytostabilisation of MTE-highly contaminated soils. → CFA addition contributed to the reduction of the MTE mobility and availability for the plants. - Efficiency of Coal Fly Ash amendment for phytostabilisation of Pb, Cd and Zn in MTE-highly contaminated soils.

  20. Arbuscular mycorrhiza enhanced arsenic resistance of both white clover (Trifolium repens Linn.) and ryegrass (Lolium perenne L.) plants in an arsenic-contaminated soil

    Energy Technology Data Exchange (ETDEWEB)

    Dong Yan; Zhu Yongguan [Department of Soil Environmental Science, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China); Smith, F. Andrew [Soil and Land Systems, School of Earth and Environmental Sciences, Waite Campus, University of Adelaide, Adelaide, SA 5005 (Australia); Wang Youshan [Institute of Plant Nutrition and Resources, Beijing Academy of Agriculture and Forestry, Beijing 100089 (China); Chen Baodong [Department of Soil Environmental Science, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China)], E-mail: bdchen@rcees.ac.cn

    2008-09-15

    In a compartmented cultivation system, white clover (Trifolium repens Linn.) and ryegrass (Lolium perenne L.), with their roots freely intermingled, or separated by 37 {mu}m nylon mesh or plastic board, were grown together in an arsenic (As) contaminated soil. The influence of AM inoculation on plant growth, As uptake, phosphorus (P) nutrition, and plant competitions were investigated. Results showed that both plant species highly depended on mycorrhizas for surviving the As contamination. Mycorrhizal inoculation substantially improved plant P nutrition, and in contrast markedly decreased root to shoot As translocation and shoot As concentrations. It also showed that mycorrhizas affected the competition between the two co-existing plant species, preferentially benefiting the clover plants in term of nutrient acquisition and biomass production. Based on the present study, the role of AM fungi in plant adaptation to As contamination, and their potential use for ecological restoration of As contaminated soils are discussed. - Both white clover and ryegrass highly depend on the mycorrhizal associations for surviving heavy arsenic contamination.

  1. Seasonal dynamics in arbuscular mycorrhizal fungal colonization and spore numbers in the rhizosphere of dactylis glomerata l. and trifolium repens L

    International Nuclear Information System (INIS)

    Xin, G.; Ye, S.; Wang, Y.; Wu, E.; Sugawara, K.

    2012-01-01

    The seasonal dynamics in the colonization of the rhizosphere of orchardgrass (Dactylis glomerata L.) and white clover (Trifolium repens L.) pastures by arbuscular mycorrhizal (AM) fungi and the production of spores in an artifical Japanese grassland was investigated over 12 months (between December 2001 and December 2002). The results showed that the AM fungal colonization fluctuated seasonally in the rhizosphere of both pastures. The total AM fungal colonization of the two pastures decreased during winter, then increased from March to June as the pastures grew, but slightly decreased again in July and August, and again followed an increase in September. There was significant difference of the colonization by arbuscules and vesicles between the two pastures ( p <0.05). Besides, the vesicular colonization of orchardgrass was higher than that of white clover, but the opposite trend was observed for arbuscular colonization. Similarly, the numbers of AM fungal spores in the pastures varied throughout the year, decreasing from spring to summer, then slowly increasing in late summer, reaching peak levels in winter. There is significant correlation between the frequency of spores in the rhizosphere soil and both soil temperature and pH. (author)

  2. Evaluating sampling strategy for DNA barcoding study of coastal and inland halo-tolerant Poaceae and Chenopodiaceae: A case study for increased sample size.

    Directory of Open Access Journals (Sweden)

    Peng-Cheng Yao

    Full Text Available Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P < 0.01. These results suggest that increasing the sample size in specialist habitats can improve measurements of intraspecific genetic diversity, and will have a positive effect on the application of the DNA barcodes in widely distributed species. The results of random sampling showed that when sample size reached 11 for Chloris virgata, Chenopodium glaucum, and Dysphania ambrosioides, 13 for Setaria viridis, and 15 for Eleusine indica, Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.

  3. Helicoverpa zea (Lepidoptera: Noctuidae) and Spodoptera frugiperda (Lepidoptera: Noctuidae) Responses to Sorghum bicolor (Poales: Poaceae) Tissues From Lowered Lignin Lines.

    Science.gov (United States)

    Dowd, Patrick F; Sattler, Scott E

    2015-01-01

    The presence of lignin within biomass impedes the production of liquid fuels. Plants with altered lignin content and composition are more amenable to lignocellulosic conversion to ethanol and other biofuels but may be more susceptible to insect damage where lignin is an important resistance factor. However, reduced lignin lines of switchgrasses still retained insect resistance in prior studies. Therefore, we hypothesized that sorghum lines with lowered lignin content will also retain insect resistance. Sorghum excised leaves and stalk pith Sorghum bicolor (L.) Moench (Poales: Poaceae) from near isogenic brown midrib (bmr) 6 and 12 mutants lines, which have lowered lignin content and increased lignocellulosic ethanol conversion efficiency, were examined for insect resistance relative to wild-type (normal BTx623). Greenhouse and growth chamber grown plant tissues were fed to first-instar larvae of corn earworms, Helicoverpa zea (Boddie) and fall armyworms Spodoptera frugiperda (J.E. Smith) (Lepidoptera: Noctuidae), two sorghum major pests. Younger bmr leaves had significantly greater feeding damage in some assays than wild-type leaves, but older bmr6 leaves generally had significantly less damage than wild-type leaves. Caterpillars feeding on the bmr6 leaves often weighed significantly less than those feeding on wild-type leaves, especially in the S. frugiperda assays. Larvae fed the pith from bmr stalks had significantly higher mortality compared with those larvae fed on wild-type pith, which suggested that bmr pith was more toxic. Thus, reducing lignin content or changing subunit composition of bioenergy grasses does not necessarily increase their susceptibility to insects and may result in increased resistance, which would contribute to sustainable production. Published by Oxford University Press on behalf of the Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  4. Linkage Maps of a Mediterranean × Continental Tall Fescue Population and their Comparative Analysis with Other Poaceae Species

    Directory of Open Access Journals (Sweden)

    Ryan Dierking

    2015-03-01

    Full Text Available Temperate grasses belonging to the complex are important throughout the world in pasture and grassland agriculture. Tall fescue ( Schreb. is the predominant species in the United States, covering approximately 15 million ha. Tall fescue has distinctive morphotypes, two of which are Continental (summer active and Mediterranean (summer semidormant. This is the first report of a linkage map created for Mediterranean tall fescue, while updating the Continental map with additional simple sequence repeat and sequence-tagged site markers. Additionally, this is the first time that diversity arrays technology (DArT markers were used in the construction of a tall fescue map. The male parent (Continental, R43-64, map consisted of 594 markers arranged in 22 linkage groups (LGs and covered a total of 1577 cM. The female parent (Mediterranean, 103-2, map was shorter (1258 cM and consisted of only 208 markers arranged in 29 LGs. Marker densities for R43-64 and 103-2 were 2.65 and 6.08 cM per marker, respectively. When compared with the other Poaceae species, meadow fescue ( Huds., annual ryegrass ( Lam., perennial ryegrass ( L., (L. Beauv., and barley ( L., a total of 171 and 98 orthologous or homologous sequences, identified by DArT analysis, were identified in R43-64 and 103-2, respectively. By using genomic in situ hybridization, we aimed to identify potential progenitors of both morphotypes. However, no clear conclusion on genomic constitution was reached. These maps will aid in the search for quantitative trait loci of various traits as well as help define and distinguish genetic differences between the two morphotypes.

  5. Multiple doses of saw palmetto (Serenoa repens) did not alter cytochrome P450 2D6 and 3A4 activity in normal volunteers.

    Science.gov (United States)

    Markowitz, John S; Donovan, Jennifer L; Devane, C Lindsay; Taylor, Robin M; Ruan, Ying; Wang, Jun-Sheng; Chavin, Kenneth D

    2003-12-01

    Saw palmetto (Serenoa repens) is the most commonly used herbal preparation in the treatment of benign prostatic hyperplasia. The objective of this study was to determine whether a characterized saw palmetto product affects the activity of cytochrome P450 (CYP) 2D6 or 3A4 in healthy volunteers (6 men and 6 women). The probe substrates dextromethorphan (CYP2D6 activity) and alprazolam (CYP3A4 activity) were administered orally at baseline and again after exposure to saw palmetto (320-mg capsule once daily) for 14 days. Dextromethorphan metabolic ratios and alprazolam pharmacokinetics were determined at baseline and after saw palmetto treatment. The mean ratio of dextromethorphan to its metabolite was 0.038 +/- 0.044 at baseline and 0.048 +/- 0.080 after 14 days of saw palmetto administration (P =.704, not significant [NS]), indicating a lack of effect on CYP2D6 activity. The area under the plasma alprazolam concentration versus time curve was 476 +/- 178 h. ng. mL(-1) at baseline and 479 +/- 125 h. ng. mL(-1) after saw palmetto treatment (P =.923, NS), indicating a lack of effect on CYP3A4 activity. The elimination half-life of alprazolam was 11.4 +/- 3.1 hours at baseline and 11.6 +/- 2.7 hours after saw palmetto treatment (P =.770, NS), also indicating a lack of effect on CYP3A4 activity. Our results indicate that extracts of saw palmetto at generally recommended doses are unlikely to alter the disposition of coadministered medications primarily dependent on the CYP2D6 or CYP3A4 pathways for elimination. These conclusions must be weighed in the context of the study's limited assessments and regarded as only the initial investigation into the drug interaction potential of saw palmetto.

  6. Inhibition of the DHT-induced PSA secretion by Verbascum xanthophoeniceum and Serenoa repens extracts in human LNCaP prostate epithelial cells.

    Science.gov (United States)

    Marcoccia, D; Georgiev, M I; Alipieva, K I; Lorenzetti, S

    2014-08-08

    Verbascum xanthophoeniceum is a mullein plant, typical of Balkan region and some parts of Turkey, traditionally used as phytotherapeutic agent due to its anti-inflammatory properties. It is rich in phenylethanoid and iridoid metabolites whose anti-inflammatory properties are under characterization. The role of Verbascum xanthophoeniceum crude methanolic extract and its isolated phenylethanoid glycoside verbascoside have been evaluated, in comparison to a saw palmetto extract, on a human in vitro model of androgen-regulated prostate epithelium, the LNCaP cell line. Cytotoxicity and DHT-induced free and total PSA secretion have been thoroughly studied. We have found that similar to saw palmetto, Verbascum xanthophoeniceum extract and its isolated phenylethanoid glycoside verbascoside have no cytotoxicity in human LNCaP prostate epithelial cells, whereas an inhibitory effect on the DHT-induced free and total PSA secretion, a recognized anti-androgen like activity, has been shown in case of both Verbascum xanthophoeniceum extract and pure verbascoside. Furthermore, in the absence of the endogenous androgen DHT, an androgen-like activity in Verbascum xanthophoeniceum is detectable as it is for saw palmetto, suggesting that a mixed androgen-antiandrogen activity is present. For the first time, Serenoa repens and Verbascum xanthophoeniceum extracts have shown an absence of cytotoxicity and an inhibitory effect on DHT-induced PSA secretion in an in vitro model of human prostate epithelium, whereas the phenylethanoid glycoside verbascoside appeared to explain only part of the Verbascum xanthophoeniceum inhibitory activity on PSA secretion. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  7. Mercury and flooding cycles in the Tapajos river basin, Brazilian Amazon: The role of periphyton of a floating macrophyte (Paspalum repens)

    International Nuclear Information System (INIS)

    Coelho-Souza, Sergio A.; Guimaraes, Jean R.D.; Miranda, Marcio R.; Poirier, Hugo; Mauro, Jane B.N.; Lucotte, Marc; Mergler, Donna

    2011-01-01

    Methylmercury (MeHg) increases mercury (Hg) toxicity and is biomagnified in the trophic chain contaminating riverine Amazon populations. Freshwater macrophyte roots are a main site of Hg methylation in different Brazilian environments. Paspalum repens periphyton was sampled in four floodplain lakes during the dry, rainy and wet seasons for measurement of total Hg (THg), MeHg, Hg methylation potentials, %C, %N, δ 13 C, δ 15 N and bacterial heterotrophic production as 3 H-leucine incorporation rate. THg concentration varied from 67 to 198 ng/g and the potential of Me 203 Hg formation was expressive (1-23%) showing that periphyton is an important matrix both in the accumulation of Hg and in MeHg production. The concentration of MeHg varied from 1 to 6 ng/g DW and was positively correlated with Me 203 Hg formation. Though methylmercury formation is mainly a bacterial process, no significant correlation was observed between the methylation potentials and bacterial production. The multiple regressions analyses suggested a negative correlation between THg and %C and %N and between methylation potential and δ 13 C. The discriminant analysis showed a significant difference in periphyton δ 15 N, δ 13 C and THg between seasons, where the rainy season presented higher δ 15 N and the wet period lighter δ 13 C, lower THg values and higher Me 203 Hg formation. This exploratory study indicates that the flooding cycle could influence the periphyton composition, mercury accumulation and methylmercury production. - Research highlights: → During rainy season mercury (Hg 2+ ) is carried out from terrestrial to aquatic systems by runoff. → Macrophyte roots accumulates Hg 2+ from suspended particulate matter (SPM). → Hg methylation increases during the wet season. → Flooded forest is a source of labile organic carbon and bioavailable Hg. → Macrophytes decompose during the dry season and made up terrestrial soil.

  8. Air quality biomonitoring: assessment of air pollution genotoxicity in the Province of Novara (North Italy) by using Trifolium repens L. and molecular markers.

    Science.gov (United States)

    Piraino, F; Aina, R; Palin, L; Prato, N; Sgorbati, S; Santagostino, A; Citterio, S

    2006-12-15

    Mixed air pollutants are considered a major cause of DNA damage in living species. In this study Trifolium repens L. cv Regal was used as a bioindicator to assess the genotoxicity of air stressors in the Italian province of Novara. Two on-site biomonitoring experiments were performed during the spring and autumn of 2004. Test plants were exposed at 19 monitoring sites distributed homogeneously throughout the province, and each experiment lasted for a period of 6 weeks. Genotoxicity was evaluated with Amplified Fragment Length Polymorphism (AFLP) molecular markers. The results show the predominantly rural central-west region of the Novara Province to have the worst air quality with regard to genotoxicity. Analyses of geomorphology, land use and climatic factors suggest that the compromised air quality in the region could be attributed to wind strength and direction, transporting pollution from vehicular traffic on the A4 highway and from the urban/industrialized centres of Novara and Vercelli. Plant growth, changes in plant photochemical efficiency and the presence of ozone related leaf injuries were also measured to better interpret the results of genotoxicity. Statistical analyses show that although climatic factors such as light intensity and temperature influence plant growth, they do not contribute to atmospheric stressor-induced DNA damage. Further analyses indicated that, as expected, a mixture of genotoxic and non-genotoxic pollutants coexist in the Novara Province troposphere, and that the elevated ozone concentrations experienced during the study may have contributed to the DNA damage in the tested plants by enhancing genotoxicity via interaction with other air stressors.

  9. Serenoa repens extracts promote hair regeneration and repair of hair loss mouse models by activating TGF-β and mitochondrial signaling pathway.

    Science.gov (United States)

    Zhu, H-L; Gao, Y-H; Yang, J-Q; Li, J-B; Gao, J

    2018-06-01

    Plenty of plant extracts have been used for treating hair loss. This study aims to investigate the effects of liposterolic extracts of Serenoa repens (LSESr) on hair cell growth and regeneration of hair, and clarify the associated mechanisms. Human keratinocyte cells (HACAT) were cultured, incubated with dihydrotestosterone (DHT) and treated with LSESr. Cell viability was examined by using 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2-H- tetrazolium bromide (MTT) assay. Hair loss C57BL/6 mouse model was established by inducing with DHT. Hair growth, density, and thickness were evaluated. Back skin samples were collected and stained with hematoxylin and eosin (HE) assay. B-cell lymphoma-2 (Bcl-2), Bcl-2 associated protein X (Bax), cleaved caspase 3 and transforming growth factor β2 (TGF-β2) were examined using Western blot assay. LSESr treatment significantly increased HACAT cell viabilities compared to DHT-only treated cells (p<0.05). LSESr treatment post injection of DHT significantly converted skin color from pink to gray and increased hair density, weight and thickness compared to DHT-only treated mice (p<0.05). LSESr treatment significantly triggered follicle growth and decreased inflammatory response. LSESr treatment significantly decreased TGF-β2 and cleaved caspase 3 expression of hair loss mouse models compared to that of DHT treated mice (p<0.05). LSESr treatment significantly enhanced Bcl-2 expression and reduced Bax expression compared to that of DHT treated mice (p<0.05). Meanwhile, effects of LSESr were substantial even achieving to the potential of finasteride. LSESr promoted the hair regeneration and repair of hair loss mouse models by activating TGF-β signaling and mitochondrial signaling pathway.

  10. Knock-down of transcript abundance of a family of Kunitz proteinase inhibitor genes in white clover (Trifolium repens) reveals a redundancy and diversity of gene function.

    Science.gov (United States)

    Islam, Afsana; Leung, Susanna; Burgess, Elisabeth P J; Laing, William A; Richardson, Kim A; Hofmann, Rainer W; Dijkwel, Paul P; McManus, Michael T

    2015-12-01

    The transcriptional regulation of four phylogenetically distinct members of a family of Kunitz proteinase inhibitor (KPI) genes isolated from white clover (Trifolium repens; designated Tr-KPI1, Tr-KPI2, Tr-KPI4 and Tr-KPI5) has been investigated to determine their wider functional role. The four genes displayed differential transcription during seed germination, and in different tissues of the mature plant, and transcription was also ontogenetically regulated. Heterologous over-expression of Tr-KPI1, Tr-KPI2, Tr-KPI4 and Tr-KPI5 in Nicotiana tabacum retarded larval growth of the herbivore Spodoptera litura, and an increase in the transcription of the pathogenesis-related genes PR1 and PR4 was observed in the Tr-KPI1 and Tr-KPI4 over-expressing lines. RNA interference (RNAi) knock-down lines in white clover displayed significantly altered vegetative growth phenotypes with inhibition of shoot growth and a stimulation of root growth, while knock-down of Tr-KPI1, Tr-KPI2 and Tr-KPI5 transcript abundance also retarded larval growth of S. litura. Examination of these RNAi lines revealed constitutive stress-associated phenotypes as well as altered transcription of cellular signalling genes. These results reveal a functional redundancy across members of the KPI gene family. Further, the regulation of transcription of at least one member of the family, Tr-KPI2, may occupy a central role in the maintenance of a cellular homeostasis. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.

  11. Field clinical study evaluating the efficacy and safety of an oral formulation containing milbemycin oxime/praziquantel (Milbemax®, Novartis Animal Health) in the chemoprevention of the zoonotic canine infection by Dirofilaria repens.

    Science.gov (United States)

    Di Cesare, Angela; Braun, Gabriele; Di Giulio, Emanuela; Paoletti, Barbara; Aquilino, Vincenzo; Bartolini, Roberto; La Torre, Francesco; Meloni, Silvana; Drake, Jason; Pandolfi, Federico; Avolio, Stefania; Traversa, Donato

    2014-07-29

    Dirofilaria repens is the causative agent of subcutaneous dirofilariosis of dogs, other animals and humans. This nematode is transmitted by mosquitoes of Aedes, Anopheles and Culex genera. In dogs, the parasite may cause subclinical infection or cutaneous signs. Recently, D. repens has emerged and spread in different geographical areas, with an increase of cases in dogs and humans. Chemoprevention in dogs in endemic areas is the most reliable approach for controlling this infection. This paper describes a randomized, blocked and multicentric clinical field study investigating the efficacy of an oral, chewable formulation containing milbemycin oxime/praziquantel (Milbemax®, Novartis Animal Health) in the chemoprevention of subcutaneous dirofilariosis in dogs. This study was conducted in endemic areas of Italy. A total of 249 dogs, at two sites, negative for D. repens, were allocated into two groups (i.e. Treated -T1 vs Untreated-T2) with a ratio of 1:1, and subjected to clinical visits and blood sampling once monthly until the end of the study. All blood samples were microscopically and genetically examined. Animals belonging to T1 group received a minimum target dose of 0.5 mg/kg bodyweight of milbemycin oxime and 5 mg/kg of praziquantel in commercial tablets (Milbemax®) according body weight once every 4 weeks. Animals of group T2 were not treated with Milbemax® but received, when necessary, specific parasiticide treatments. The study duration was 336 ± 2 days for each dog. A total of 219 dogs completed the study (i.e. 111 in T1 and 108 in T2), while 30 dogs (i.e. 13 in T1, 17 in T2) were withdrawn for a variety of reasons unrelated to administration of Milbemax®. The percentages of animals not showing microfilariae of D. repens were 100% (111 animals) in T1 and 94.7% (108 animals out of 114) in group T2. Milbemax® was shown to be safe in treated dogs. The results of this study confirm that the monthly use of Milbemax® in dogs is effective and safe for the

  12. Efeito de diferentes sistemas de pastejo sobre o desempenho de suínos mantidos em pastagem de trevo-branco (Trifolium repens L. Effect of different grazing systems on the performance of pigs, in growing and finishing phases, kept on white clover (Trifolium repens L. pasture

    Directory of Open Access Journals (Sweden)

    Denyse Maria Galvão Leite

    2006-06-01

    Full Text Available Este estudo foi conduzido com o objetivo de avaliar o efeito dos sistemas de pastejo contínuo, alternado e rotativo sobre as características de desempenho de suínos (consumo de ração, ganho de peso, conversão alimentar e espessura de toucinho nas fases de crescimento e terminação mantidos em pastagem de trevo-branco (Trifolium repens L.. Foram realizadas também avaliações da disponibilidade e composição química da pastagem. Trinta e seis suínos machos foram distribuídos em um delineamento de blocos casualizados, com três tratamentos e três repetições, e doze foram mantidos em sistema de confinamento. Não foi observada influência significativa dos sistemas de pastejo sobre as características de desempenho dos animais e a disponibilidade de forragem. Entretanto, houve diferença significativa na composição química da pastagem entre os sistemas de pastejo estudados. Os suínos em sistemas de pastejo contínuo, alternado e rotativo consumiram de 13,41 a 15,92% a menos de ração e apresentaram menores ganhos de peso e espessura de toucinho que aqueles criados em confinamento. Não foram registradas diferenças significativas na conversão alimentar entre os suínos mantidos em confinamento e em pastagem.This trial was carried out to determine the effect of continuous, alternated or rotational grazing systems on the performance of pigs (feed intake, weight gain, feed conversion and backfat thickness, in the growing and finishing phases, as well as the forage availability and chemical composition of a white clover pasture (Trifolium repens L.. Thirty-six castrated pigs were allotted to a randomized complete-block experimental design with three treatments and three replications. Twelve feedlot pigs were kept on a rearing system. No significant differences were found between grazing systems on parameters of animal performance and forage on offer. However, significant differences were observed on the pasture chemical composition

  13. Testing efficacy of distance and tree-based methods for DNA barcoding of grasses (Poaceae tribe Poeae) in Australia.

    Science.gov (United States)

    Birch, Joanne L; Walsh, Neville G; Cantrill, David J; Holmes, Gareth D; Murphy, Daniel J

    2017-01-01

    In Australia, Poaceae tribe Poeae are represented by 19 genera and 99 species, including economically and environmentally important native and introduced pasture grasses [e.g. Poa (Tussock-grasses) and Lolium (Ryegrasses)]. We used this tribe, which are well characterised in regards to morphological diversity and evolutionary relationships, to test the efficacy of DNA barcoding methods. A reference library was generated that included 93.9% of species in Australia (408 individuals, [Formula: see text] = 3.7 individuals per species). Molecular data were generated for official plant barcoding markers (rbcL, matK) and the nuclear ribosomal internal transcribed spacer (ITS) region. We investigated accuracy of specimen identifications using distance- (nearest neighbour, best-close match, and threshold identification) and tree-based (maximum likelihood, Bayesian inference) methods and applied species discovery methods (automatic barcode gap discovery, Poisson tree processes) based on molecular data to assess congruence with recognised species. Across all methods, success rate for specimen identification of genera was high (87.5-99.5%) and of species was low (25.6-44.6%). Distance- and tree-based methods were equally ineffective in providing accurate identifications for specimens to species rank (26.1-44.6% and 25.6-31.3%, respectively). The ITS marker achieved the highest success rate for specimen identification at both generic and species ranks across the majority of methods. For distance-based analyses the best-close match method provided the greatest accuracy for identification of individuals with a high percentage of "correct" (97.6%) and a low percentage of "incorrect" (0.3%) generic identifications, based on the ITS marker. For tribe Poeae, and likely for other grass lineages, sequence data in the standard DNA barcode markers are not variable enough for accurate identification of specimens to species rank. For recently diverged grass species similar challenges are

  14. Mercury and flooding cycles in the Tapajos river basin, Brazilian Amazon: The role of periphyton of a floating macrophyte (Paspalum repens)

    Energy Technology Data Exchange (ETDEWEB)

    Coelho-Souza, Sergio A., E-mail: sacs@biof.ufrj.br [Lab. Tracadores Wolfgang C. Pfeiffer, SL 049, Instituto de Biofisica Carlos Chagas Filho/UFRJ, Bloco G, Centro de Ciencias e Saude, Ilha do Fundao, Rio de Janeiro, RJ, CEP 21949-902 (Brazil); Guimaraes, Jean R.D.; Miranda, Marcio R. [Lab. Tracadores Wolfgang C. Pfeiffer, SL 049, Instituto de Biofisica Carlos Chagas Filho/UFRJ, Bloco G, Centro de Ciencias e Saude, Ilha do Fundao, Rio de Janeiro, RJ, CEP 21949-902 (Brazil); Poirier, Hugo [Chaire de Reserche en Environment, Universite du Quebec a Montreal (UQaM), CP 8888, Montreal, H3C 3P8 (Canada); Mauro, Jane B.N. [Lab. Tracadores Wolfgang C. Pfeiffer, SL 049, Instituto de Biofisica Carlos Chagas Filho/UFRJ, Bloco G, Centro de Ciencias e Saude, Ilha do Fundao, Rio de Janeiro, RJ, CEP 21949-902 (Brazil); Lucotte, Marc [Chaire de Reserche en Environment, Universite du Quebec a Montreal (UQaM), CP 8888, Montreal, H3C 3P8 (Canada); Mergler, Donna [CINBIOSE, UQaM, CP 8888, succ. Centre-ville, Montreal, H3C 3P8 (Canada)

    2011-06-15

    Methylmercury (MeHg) increases mercury (Hg) toxicity and is biomagnified in the trophic chain contaminating riverine Amazon populations. Freshwater macrophyte roots are a main site of Hg methylation in different Brazilian environments. Paspalum repens periphyton was sampled in four floodplain lakes during the dry, rainy and wet seasons for measurement of total Hg (THg), MeHg, Hg methylation potentials, %C, %N, {delta}{sup 13}C, {delta}{sup 15}N and bacterial heterotrophic production as {sup 3}H-leucine incorporation rate. THg concentration varied from 67 to 198 ng/g and the potential of Me{sup 203}Hg formation was expressive (1-23%) showing that periphyton is an important matrix both in the accumulation of Hg and in MeHg production. The concentration of MeHg varied from 1 to 6 ng/g DW and was positively correlated with Me{sup 203}Hg formation. Though methylmercury formation is mainly a bacterial process, no significant correlation was observed between the methylation potentials and bacterial production. The multiple regressions analyses suggested a negative correlation between THg and %C and %N and between methylation potential and {delta}{sup 13}C. The discriminant analysis showed a significant difference in periphyton {delta}{sup 15}N, {delta}{sup 13}C and THg between seasons, where the rainy season presented higher {delta}{sup 15}N and the wet period lighter {delta}{sup 13}C, lower THg values and higher Me{sup 203}Hg formation. This exploratory study indicates that the flooding cycle could influence the periphyton composition, mercury accumulation and methylmercury production. - Research highlights: {yields} During rainy season mercury (Hg{sup 2+}) is carried out from terrestrial to aquatic systems by runoff. {yields} Macrophyte roots accumulates Hg{sup 2+} from suspended particulate matter (SPM). {yields} Hg methylation increases during the wet season. {yields} Flooded forest is a source of labile organic carbon and bioavailable Hg. {yields} Macrophytes

  15. Observational study: daily treatment with a new compound “tradamixina” plus serenoa repens for two months improved the lower urinary tract symptoms

    Science.gov (United States)

    2012-01-01

    Background Lower urinary tract symptoms (LUTS) are associated with great emotional costs to individuals and substantial economic costs to society. This study seeks to evaluate the effect of a new natural compound “Tradamixina plus Serenoa Repens” in order to improve lower urinary tract symptoms. Methods 100 patients (≥45years) who had had LUTS/BPH for >6 mo at screening and with IPSS -The international Prostate symptom scores- ≥13 and maximum urinary flow rate (Qmax) ≥4 to ≤15 ml/s. were recruited. The compound “Tradamixina plus Serenoa Repens” (80 mg of Alga Ecklonia Bicyclis, 100 mg of Tribulus Terrestris and 100 mg of D-Glucosamine and N-Acetyl-D-Glucosamine plus 320 mg of Serenoa Repens) was administered daily for 2 months. At visit and after 60 days of treatment patients were evaluated by means of detailed medical urological history, clinical examination, laboratory investigations (total PSA), and instrumental examination like urolfowmetry. Efficacy measures included IPSS-International Prostate Sympto, BPH Impact Index (BII), Quality-of-Life (QoL) Index. Measures were assessed at baseline and end point (12 wk or end of therapy) and also at screening, 1 and 4 wk for IPSS, and 4 wk for BII. Statistical significance was interpreted only if the results of the preceding analysis were significant at the 0.05 level. Results After 2 months of treatment the change from baseline to week 12 relative to “Tradamixina plus Seronea Repens” in total IPSS and Qol was statistically significant. Differences from baseline in BII were statistically significant for “Tradamixina plus Seronea Repens” above all differences in BII were also significant at 4 wk (LSmean ± SE: -0.8 ± 0.2). In the distribution of subjects over the PGI-I and CGI-I response categories were significant for”Tradamixina plus Seronea Repens” (PGI-I: p = 0.001; CGI-I). We also observed a decrease of total PSA. Conclusion The daily treatment with a new compound “Tradamixina plus

  16. Transcription of Biotic Stress Associated Genes in White Clover (Trifolium repens L.) Differs in Response to Cyst and Root-Knot Nematode Infection.

    Science.gov (United States)

    Islam, Afsana; Mercer, Chris F; Leung, Susanna; Dijkwel, Paul P; McManus, Michael T

    2015-01-01

    The transcription of four members of the Kunitz proteinase inhibitor (KPI) gene family of white clover (Trifolium repens L.), designated as Tr-KPI1, Tr-KPI2, Tr-KPI4 and Tr-KPI5, was investigated at both local infection (roots) and systemic (leaf tissue) sites in white clover in response to infection with the clover root knot nematode (CRKN) Meloidogyne trifoliophila and the clover cyst nematode (CCN) Heterodera trifolii. Invasion by the CRKN resulted in a significant decrease in transcript abundance of Tr-KPI4 locally at both 4 days post-infection (dpi) and at 8 dpi, and an increase in transcription of Tr-KPI1 systemically at 8 dpi. In contrast, an increase in transcript abundance of all four Tr-KPI genes locally at 4 and 8 dpi, and an increase of Tr-KPI1, Tr-KPI2, and Tr-KPI5 at 8 dpi systemically was observed in response to infection with the CCN. Challenge of a resistant (R) genotype and a susceptible (S) genotype of white clover with the CCN revealed a significant increase in transcript abundance of all four Tr-KPI genes locally in the R genotype, while an increase in abundance of only Tr-KPI1, Tr-KPI2, and Tr-KPI5 was observed in the S genotype, and only at 4 dpi. The transcript abundance of a member of the1-AMINOCYCLOPROPANE-1-CARBOXYLATE (ACC) SYNTHASE gene family from white clover (Tr-ACS1) was significantly down-regulated locally in response to CRKN infection at 4 and 8 dpi and at 4 dpi, systemically, while abundance increased locally and systemically at 8 dpi in response to CCN challenge. Conversely, the abundance of the jasmonic acid (JA) signalling gene, CORONATINE-INSENSITIVE PROTEIN 1 from white clover (Tr-COI1) increased significantly at 8 dpi locally in response to CRKN infection, but decreased at 8 dpi in response to CCN infection. The significance of this differential regulation of transcription is discussed with respect to differences in infection strategy of the two nematode species.

  17. Dataset on the structural characterization of organosolv lignin obtained from ensiled Poaceae grass and load-dependent molecular weight changes during thermoplastic processing

    Directory of Open Access Journals (Sweden)

    Jörg Dörrstein

    2018-04-01

    Full Text Available This article presents experimental data of organosolv lignin from Poacea grass and structural changes after compounding and injection molding as presented in the research article “Effects of high-lignin-loading on thermal, mechanical, and morphological properties of bioplastic composites” [1]. It supplements the article with morphological (SEM, spectroscopic (31P NMR, FT-IR and chromatographic (GPC, EA data of the starting lignin as well as molar mass characteristics (mass average molar mass (Mw and Polydispersity (D of the extracted lignin. Refer to Schwarz et al. [2] for a detailed description of the production of the organosolv residue and for further information on the raw material used for lignin extraction. The dataset is made publicly available and can be useful for extended lignin research and critical analyzes.

  18. A plastome primer set for comprehensive quantitative real time RT-PCR analysis of Zea mays: a starter primer set for other Poaceae species

    Directory of Open Access Journals (Sweden)

    Dunn Sade N

    2008-06-01

    Full Text Available Abstract Background Quantitative Real Time RT-PCR (q2(RTPCR is a maturing technique which gives researchers the ability to quantify and compare very small amounts of nucleic acids. Primer design and optimization is an essential yet time consuming aspect of using q2(RTPCR. In this paper we describe the design and empirical optimization of primers to amplify and quantify plastid RNAs from Zea mays that are robust enough to use with other closely related species. Results Primers were designed and successfully optimized for 57 of the 104 reported genes in the maize plastome plus two nuclear genes. All 59 primer pairs produced single amplicons after end-point reverse transcriptase polymerase chain reactions (RT-PCR as visualized on agarose gels and subsequently verified by q2(RTPCR. Primer pairs were divided into several categories based on the optimization requirements or the uniqueness of the target gene. An in silico test suggested the majority of the primer sets should work with other members of the Poaceae family. An in vitro test of the primer set on two unsequenced species (Panicum virgatum and Miscanthus sinensis supported this assumption by successfully producing single amplicons for each primer pair. Conclusion Due to the highly conserved chloroplast genome in plant families it is possible to utilize primer pairs designed against one genomic sequence to detect the presence and abundance of plastid genes or transcripts from genomes that have yet to be sequenced. Analysis of steady state transcription of vital system genes is a necessary requirement to comprehensively elucidate gene expression in any organism. The primer pairs reported in this paper were designed for q2(RTPCR of maize chloroplast genes but should be useful for other members of the Poaceae family. Both in silico and in vitro data are presented to support this assumption.

  19. Sinopse das espécies nativas e subespontâneas de Andropogoneae Dumort. (Poaceae na Ilha de Santa Catarina, Brasil A synopsis of the Andropogoneae Dumort. (Poaceae native and subspontaneous to the Island of Santa Catarina, Florianópolis, SC, Brazil

    Directory of Open Access Journals (Sweden)

    Bárbara Toncic Neves

    2011-12-01

    Full Text Available O presente trabalho consiste no levantamento dos táxons da tribo Andropogoneae (Panicoideae - Poaceae ocorrentes na Ilha de Santa Catarina, Florianópolis, Brasil. A partir da revisão de materiais de herbários e coletas a campo foi confirmada a ocorrência de 10 gêneros e 20 espécies, 17 nativas e duas subespontâneas: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 e Sorghum Moench (1. Os gêneros Bothriochloa e Rhytachne são registrados pela primeira vez para a Ilha de Santa Catarina. São apresentadas chaves de identificação para gêneros e espécies, ilustrações, informações sobre distribuição geográfica, habitat, período de floração e comentários para cada táxon.The present work is a survey of the taxa in the tribe Andropogoneae (Panicoideae - Poaceae that occur on the Island of Santa Catarina, Florianópolis, Brazil. Based on a review of herbarium specimens and fieldwork, 20 species were recorded in the following 10 genera: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 and Sorghum Moench (1. Seventeen of the species are native, and two species are subspontaneous. Bothriochloa and Rhytachne are recorded here, for the first time, for the Island of Santa Catarina. This work provides key to the genera and species, as well as illustrations, information about geographic distribution, habitat, phenology, and comments about each taxon presented in the study.

  20. Atividade de glutationa S-transferase na metabolização de acetochlor, atrazine e oxyfluorfen em milho (Zea mays L., sorgo (Sorghum bicolor L. e trigo (Triticum aestivum L. (Poaceae Glutathione S-transferase activity in acetochlor, atrazine and oxyfluorfen metabolization in maize (Zea mays L., sorghum (Sorghum bicolor L. and wheat (Triticum aestivumL. (Poaceae

    Directory of Open Access Journals (Sweden)

    Ethel Lourenzi Barbosa Novelli

    2002-05-01

    Full Text Available Este experimento foi conduzido para avaliar a seletividade em plantas dos herbicidas acetochlor, atrazine e oxyfluorfen em relação à atividade da glutationa S-transferase (GST em plantas de milho (Zea mays L., sorgo (Sorghum bicolor L. e trigo (Triticum aestivum L. (Poaceae. A atividade da GST foi detectada às 24, 48 e 72 horas após as aplicaç��es dos tratamentos. Os tratamentos do experimento consistiram de aplicação com água (controle, acetochlor (3 L.ha-1, atrazine (4 L.ha-1 e oxyfluorfen (1 L.ha-1. As maiores atividades de GST foram observadas na presença de acetochlor, principalmente às 48 horas após o tratamento. Esses aumentos foram 105, 148 e 118% em relação ao controle para milho, sorgo e trigo, respectivamente. É sugerido que a GST pode ter papel na degradação de acetochlor e pode ser uma das razões para a seletividade desse herbicida para essas culturas.This experiment was conducted to evaluate the acetochlor, atrazine and oxyfluorfen herbicides plant selectivity, in relation to glutathione S-transferase activity (GST in maize (Zea mays L., sorghum (Sorghum bicolor L. and wheat (Triticum aestivum L (Poaceae plants. GST activity was detected 24, 48 and 72 hours after treatment applications. The experiment's treatments consisted of spraying plants with water (control, acetochlor (3 L.ha-1`, atrazine (4 L.ha-1 and oxyfluorfen (1 L.ha-1. The highest GST activities were observed in presence of acetochlor, mainly at 48 hours after treatment. These increments were 105, 148 and 118% when compared to maize, sorghum and wheat control groups, respectively. It is suggested that the GST may have a role in acetochlor degradation and it may be a reason for this herbicide's selectivity in these crops.

  1. Effects of livestock exclusion on density, survival and biomass of the perennial sagebrush grass Hymenachne pernambucense (Poaceae) from a temperate fluvial wetland

    Science.gov (United States)

    Magnano, Andrea L.; Nanni, Analía S.; Krug, Pamela; Astrada, Elizabeth; Vicari, Ricardo; Quintana, Rubén D.

    2018-01-01

    In Argentina, the intensification of soybean production has displaced a substantial proportion of cattle ranching to fluvial wetlands such as those in the Delta of the Paraná River. Cattle grazing affects structure and dynamics of native forage plants but there is little information on this impact in populations from fluvial wetlands. This study addresses the effect of cattle ranching on density, survival, mean life-span and aerial biomass of Hymenachne pernambucense (Poaceae), an important forage species in the region. The study was carried out monthly for one year in permanents plots subject to continuous grazing and plots excluded from grazing in the Middle Delta of the Paraná River. In plots excluded from grazing, tillers showed significantly higher population density and survival, and a two-fold increase in mean life-span, while continuous grazing decreased survival of cohorts. The largest contribution to tiller density in ungrazed and grazed populations was made by spring and summer cohorts, respectively. Total and green biomass were significantly higher in the ungrazed population, with highest differences in late spring-early summer. Cattle grazing affected the relationship between tiller density and green biomass suggesting that cattle prefer sprouts because they are more palatable and nutritious than older tissue.

  2. Serenoa repens, lycopene and selenium versus tamsulosin for the treatment of LUTS/BPH. An Italian multicenter double-blinded randomized study between single or combination therapy (PROCOMB trial).

    Science.gov (United States)

    Morgia, Giuseppe; Russo, Giorgio I; Voce, Salvatore; Palmieri, Fabiano; Gentile, Marcello; Giannantoni, Antonella; Blefari, Franco; Carini, Marco; Minervini, Andrea; Ginepri, Andrea; Salvia, Giuseppe; Vespasiani, Giuseppe; Santelli, Giorgio; Cimino, Sebastiano; Allegro, Rosalinda; Collura, Zaira; Fragalà, Eugenia; Arnone, Salvatore; Pareo, Rosaria M

    2014-11-01

    Phytotherapy has been used to treat patients with lower urinary tract symptoms (LUTS). We evaluated the efficacy and tolerability of combination therapy between Serenoa Repens (SeR), Lycopene (Ly), and Selenium (Se) + tamsulosin versus single therapies. PROCOMB trial (ISRCTN78639965) was a randomized double-blinded, double-dummy multicenter study of 225 patients between 55 and 80 years old, PSA ≤ 4 ng/ml, IPSS ≥12, prostate volume ≤60 cc, Qmax ≤15 ml/sec, postvoid residual urine (PVR) tamsulosin 0.4 mg), group C (SeR-Se-Ly + tamsulosin 0.4 mg). The primary endpoints of the study were the reduction of IPSS, PVR, and increase of Qmax in group C versus monotherapy groups. The decrease for combination therapy was significantly greater versus group A (P tamsulosin therapy is more effective than single therapies in improving IPSS and increasing Qmax in patients with LUTS. © 2014 Wiley Periodicals, Inc.

  3. Karyotype evolution in Phalaris (Poaceae): The role of reductional dysploidy, polyploidy and chromosome alteration in a wide-spread and diverse genus.

    Science.gov (United States)

    Winterfeld, Grit; Becher, Hannes; Voshell, Stephanie; Hilu, Khidir; Röser, Martin

    2018-01-01

    Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae) is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH) of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1) the exclusively Mediterranean genome A based on x = 6, (2) the cosmopolitan genome B based on x = 7 and (3) a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.

  4. Karyotype evolution in Phalaris (Poaceae: The role of reductional dysploidy, polyploidy and chromosome alteration in a wide-spread and diverse genus.

    Directory of Open Access Journals (Sweden)

    Grit Winterfeld

    Full Text Available Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1 the exclusively Mediterranean genome A based on x = 6, (2 the cosmopolitan genome B based on x = 7 and (3 a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.

  5. Allotetraploid origin and divergence in Eleusine (Chloridoideae, Poaceae): evidence from low-copy nuclear gene phylogenies and a plastid gene chronogram.

    Science.gov (United States)

    Liu, Qing; Triplett, Jimmy K; Wen, Jun; Peterson, Paul M

    2011-11-01

    Eleusine (Poaceae) is a small genus of the subfamily Chloridoideae exhibiting considerable morphological and ecological diversity in East Africa and the Americas. The interspecific phylogenetic relationships of Eleusine are investigated in order to identify its allotetraploid origin, and a chronogram is estimated to infer temporal relationships between palaeoenvironment changes and divergence of Eleusine in East Africa. Two low-copy nuclear (LCN) markers, Pepc4 and EF-1α, were analysed using parsimony, likelihood and Bayesian approaches. A chronogram of Eleusine was inferred from a combined data set of six plastid DNA markers (ndhA intron, ndhF, rps16-trnK, rps16 intron, rps3, and rpl32-trnL) using the Bayesian dating method. The monophyly of Eleusine is strongly supported by sequence data from two LCN markers. In the cpDNA phylogeny, three tetraploid species (E. africana, E. coracana and E. kigeziensis) share a common ancestor with the E. indica-E. tristachya clade, which is considered a source of maternal parents for allotetraploids. Two homoeologous loci are isolated from three tetraploid species in the Pepc4 phylogeny, and the maternal parents receive further support. The A-type EF-1α sequences possess three characters, i.e. a large number of variations of intron 2; clade E-A distantly diverged from clade E-B and other diploid species; and seven deletions in intron 2, implying a possible derivation through a gene duplication event. The crown age of Eleusine and the allotetraploid lineage are 3·89 million years ago (mya) and 1·40 mya, respectively. The molecular data support independent allotetraploid origins for E. kigeziensis and the E. africana-E. coracana clade. Both events may have involved diploids E. indica and E. tristachya as the maternal parents, but the paternal parents remain unidentified. The habitat-specific hypothesis is proposed to explain the divergence of Eleusine and its allotetraploid lineage.

  6. Variação dos teores de constituintes voláteis de Cymbopogon citratus (DC Staf, Poaceae, coletados em diferentes regiões do Estado de São Paulo Variation in the amounts of volatile constituents of Cymbopogon citratus (DC Staf, Poaceae, collected in different regions of São Paulo State

    Directory of Open Access Journals (Sweden)

    Marcos R. Furlan

    2010-11-01

    Full Text Available O óleo essencial extraído de Cymbopogon citratus (DC Staf, Poaceae, é rico em citral sendo amplamente empregado na indústria química e farmacêutica. Os objetivos desse estudo foram avaliar o conteúdo de citral entre populações de C. citratus coletados em duas regiões diferentes (Ibiúna e Pindamonhangaba, Estado de São Paulo. O óleo essencial extraído de uma população cultivada em Pindamonhangaba-SP apresentou uma concentração alta de citral (aproximadamente 96,0%, enquanto que o óleo extraído da população de Ibiúna-SP apresentou, além de citral, proporções elevadas de outro monoterpeno, o geraniol. Adicionalmente, os óleos essenciais obtidos desta população de C. citratus foram extraídos e analisados ao longo de 24 h (a cada 3 h, sendo que o teor de citral foi maior no período da noite, o que mostra a importância de estudos que avaliam as diferenças químicas associadas às mudanças circadianas. Os componentes dos óleos essenciais foram identificados por RMN de 13C, CG/EM e CG através do índice de Kovats.The essential oil extracted from Cymbopogon citratus (DC Staf, Poaceae, is rich in citral and has many applications in chemical and pharmaceutical industry. The aims of this study were evaluate the amount of citral in populations of C. citratus collected in two different regions (Ibiúna and Pindamonhangaba, São Paulo State. The essential oil extracted of a cultivated population in Pidamonhangaba-SP, showed a high content of citral (approximately 96.0%, while the essential oil from Ibiuna-SP, showed citral and high amounts of another monoterpene, geraniol. Additionally, the essential oils from this population of C. citratus were extracted and analyzed during 24 h (each 3 h, being the major concentration of citral in the night period, indicating that studies which evaluated the chemical differences associated to circadian changes. The components of essential oils were identified through 13C NMR, GC/MS, GC and

  7. Padrão de resposta de Mimosa pudica e Senna obtusifolia à atividade potencialmente alelopática de espécies de Poaceae Response pattern of Mimosa pudica e Senna obtusifolia to potentially allelopathic activity of Poaceae species

    Directory of Open Access Journals (Sweden)

    A.P.S. Souza Filho

    2010-01-01

    Full Text Available A alelopatia é um importante mediador de interferências que alteram a dinâmica de espécies de plantas em sistemas agrícolas. Neste trabalho, procurou-se determinar a existência de padrão de respostas das plantas daninhas Mimosa pudica e Senna obtusifolia a espécies da família Poaceae, via interação entre espécies e frações e ordenamento dos efeitos. Bioensaios de germinação de sementes e alongamento da radícula e do hipocótilo foram desenvolvidos, em condições controladas. Os testes foram realizados utilizando-se extratos hidroalcoólicos na concentração de 1,0% das frações folha, raiz e sementes de quatro espécies de Poaceae. Diferenças na intensidade dos efeitos para os fatores espécie e fração foram verificadas. O padrão de atividade observado foi de Paspalum maritimum apresentar as inibições mais intensas. Entre as espécies de Brachiaria, as inibições mais intensas foram produzidas por B. brizantha. Houve resposta efetiva para a especificidade entre espécies e fração para a germinação e alongamento da radícula, especialmente na espécie Mimosa pudica. Apenas para os extratos de P. maritimum foram observadas especificidade e efetividade em relação à germinação de sementes e alongamento da radícula da espécie Senna obtusifolia. A fração folha foi mais efetiva nas inibições, sobretudo na espécie P. maritimum. Comparativamente, a espécie Mimosa pudica foi mais sensível aos efeitos dos extratos, especialmente em relação ao desenvolvimento da radícula e do hipocótilo. A intensidade dos efeitos alelopáticos variou na seguinte ordem: alongamento da radícula > germinação de sementes > alongamento do hipocótilo. A ordenação dos resultados, para os indicadores de inibição, indicou discriminação no padrão para as espécies receptoras, o que sugere especificidade dos extratos.Allelopathy is an important device to measure interferences affecting the dynamics of plant species in

  8. Effects of D-004, a lipid extract of the fruit of the Cuban royal palm (Roystonea regia) or the lipidosterolic extract of saw palmetto (Serenoa repens) on the sexual activity in male rats: A controlled, experimental study.

    Science.gov (United States)

    Fernández, Lilia C; Mas, Rosa; Fernández, Julio; Mendoza, Sarahí; Gámez, Rafael; Pardo, Balia

    2008-02-01

    The etiology of benign prostatic hyperplasia (BPH) is not completely understood, but hormonal changes in aging men seem to be pivotal. Dihydrotestosterone, a potent, active metabolite of testosterone, is formed by the enzymatic action of prostate 5α-reductase and causes cell growth and hyperplasia. Consistent with this action, male sexual dysfunction has been clinically documented to be among the drug-related adverse events associated with 5α-reductase inhibitors. The lipidosterolic extract of saw palmetto (LESP) fruit (Serenoa repens) has been used to treat BPH. D-004, a lipid extract of Roystonea regia Royal palm fruit, has been found to prevent prostatic hyperplasia induced by testoste-rone in rodents and to competitively inhibit prostate 5α-reductase activity in vitro. The purpose of this study was to assess the effects of D-004 and LESP, administered as single or repeated doses, on the sexual activity in male rats. This controlled, experimental study was conducted at the Pharmacology Department, Centre of Natural Products, National Centre for Scientific Research, Havana City, Cuba. Adult male Wistar rats weighing 250 to 300 g were randomized into 5 groups: 2 groups treated orally with D-004 (400 and 800 mg/kg); 2 groups treated orally with LESP (400 and 800 mg/kg); and 1 control group orally administered a water vehicle. Sexual activity behavior (the number of mounts and intromissions, mount latency, and intromission latency) was assessed during 2 observation periods: 90 minutes after the initial dose and at the end of the 30-day treatment. Latency was defined as time elapsed between the first mount and intromission. A total of 50 rats (mean [SD] age, 10 [3] weeks; mean [SD] weight, 295 [10] g) were included in the experiment. There were no significant difterences in the mean number of mounts, intromissions, mount latency, or intromission latency in the groups treated with single or repeated doses of D-004 or LESP (400 and 800 mg/kg) compared with the

  9. Chemical composition and cardiovascular effects induced by the essential oil of Cymbopogon citratus DC. Stapf, Poaceae, in rats Composição química e efeitos cardiovasculares do óleo essencial de Cymbopogon citratus DC. Stapf, Poaceae, em ratos

    Directory of Open Access Journals (Sweden)

    Flávia V. Moreira

    2010-12-01

    Full Text Available Cymbopogon citratus DC. Stapf, Poaceae, is used in the folk medicine for hypertension treatment. This work investigated the chemical composition and cardiovascular effects in rats of C. citratus essential oil (EOCC. A phytochemical screening demonstrated the presence of eight constituents, being geranial the major compound (43.08%. In rats, EOCC (1, 5, 10, and 20 mg/kg, i.v. induced transient hypotension and bradycardia that were attenuated by atropine and sodium thiopental, but not by L-NAME or indomethacin. In rings of rat superior mesenteric artery pre-contracted with phenylephrine, EOCC (1 to 3000 µg/mL induced relaxation that was not affected after removal of the endothelium, after TEA or in rings pre-contracted with KCl (80 mM. Furthermore, EOCC (1000 µg/mL was not able to induce additional effect on maximal relaxation of nifedipine (10 µM. In conclusions, EOCC induces hypotension, possibly by reduction in vascular resistance caused by inhibition of the Ca2+ influx, and bradycardia probably due to an activation of cardiac muscarinic receptors.C. citratus é utilizada na medicina popular para tratar hipertensão. Este trabalho investigou a composição química e os efeitos cardiovasculares do óleo essencial do C. citratus (OECC. Foram identificados oito constituintes no OECC, sendo geranial o majoritário (43,08%. Em ratos, o OECC (1, 5, 10 e 20 mg/kg, i.v. induziu hipotensão e bradicardia que foram atenuadas pela atropina e tiopental sódico, mas não por L-NAME ou indometacina. Em anéis de artéria mesentérica de ratos pré-contraídos com fenilefrina, o OECC (1 a 3000 µg/mL induziu relaxamento que não foi afetado após remoção do endotélio, após TEA ou em anéis pré-contraídos com KCl (80 mM. Além disso, o OECC (1000 µg/mL não induziu efeito adicional sobre o relaxamento máximo da nifedipina (10 µM. Em conclusão, o OECC induz hipotensão possivelmente devido à redução da resistência vascular que pode ser causada

  10. Variação dos teores de constituintes voláteis de Cymbopogon citratus (DC Staf, Poaceae, coletados em diferentes regiões do Estado de São Paulo

    Directory of Open Access Journals (Sweden)

    Marcos R. Furlan

    2010-10-01

    Full Text Available O óleo essencial extraído de Cymbopogon citratus (DC Staf, Poaceae, é rico em citral sendo amplamente empregado na indústria química e farmacêutica. Os objetivos desse estudo foram avaliar o conteúdo de citral entre populações de C. citratus coletados em duas regiões diferentes (Ibiúna e Pindamonhangaba, Estado de São Paulo. O óleo essencial extraído de uma população cultivada em Pindamonhangaba-SP apresentou uma concentração alta de citral (aproximadamente 96,0%, enquanto que o óleo extraído da população de Ibiúna-SP apresentou, além de citral, proporções elevadas de outro monoterpeno, o geraniol. Adicionalmente, os óleos essenciais obtidos desta população de C. citratus foram extraídos e analisados ao longo de 24 h (a cada 3 h, sendo que o teor de citral foi maior no período da noite, o que mostra a importância de estudos que avaliam as diferenças químicas associadas às mudanças circadianas. Os componentes dos óleos essenciais foram identificados por RMN de 13C, CG/EM e CG através do índice de Kovats.

  11. Efficacy and safety of a hexanic extract of Serenoa repens (Permixon® ) for the treatment of lower urinary tract symptoms associated with benign prostatic hyperplasia (LUTS/BPH): Systematic review and meta-analysis of randomized controlled trials and observational studies.

    Science.gov (United States)

    Vela-Navarrete, Remigio; Alcaraz, Antonio; Rodríguez-Antolín, Alfredo; Miñana López, Bernardino; Fernández-Gómez, Jesús M; Angulo, Javier C; Castro Díaz, David; Romero-Otero, Javier; Brenes, Francisco J; Carballido, Joaquín; Molero García, José M; Fernández-Pro Ledesma, Antonio; Cózar Olmos, José Manuel; Manasanch Dalmau, José; Subirana Cachinero, Isaac; Herdman, Michael; Ficarra, Vincenzo

    2018-04-25

    To comprehensively evaluate the efficacy and safety of the hexanic extract of Serenoa repens (HESr, Permixon), at a dose of 320 mg daily, as monotherapy for the treatment of LUTS/BPH. Systematic review and meta-analysis of randomized and observational studies in patients with LUTS/BPH identified through searches in Medline, Web of Knowledge [ISI], Scopus, the Cochrane Library, and bibliographic references up to March 2017. Articles studying S. repens extracts other than Permixon were excluded. Data was collected on IPSS score, peak urinary flow (Qmax), nocturia, quality of life, prostate volume, sexual function, and adverse drug reactions (ADR). Data obtained from randomized controlled trials (RCT) and observational studies (OS) were analysed jointly and separately using a random effects model. A sub-group analysis was performed of studies which included patients on longer-term treatment (≥one year). Data from 27 studies (15 RCTs and 12 OS) were included for meta-analysis (total N=5,800). Compared with placebo, the HESr was associated with 0.64 (95% CI -0.98 to -0.31) fewer voids per night (p=0.0001) and an additional mean increase in Qmax of 2.75 mL/s (95% CI 0.57 to 4.93; p=0.01). When compared with alpha-blockers, the HESr showed similar improvements on IPSS (WMD 0.57; 95%CI, -0.27 to 1.42; p=0.18) and a comparable increase in Qmax to tamsulosin (WMD -0.02; 95%CI, -0.71 to 0.66; p=0.95). Efficacy assessed using the IPSS was similar after 6 months of treatment between the HESr and 5ARIs. Analysis of all available published data for the HESr showed a mean improvement in IPSS score from baseline of -5.73 points (95% CI -6.91 to -4.54; pBPH. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  12. Genome Evolution in the Genus Sorghum (Poaceae)

    OpenAIRE

    PRICE, H. JAMES; DILLON, SALLY L.; HODNETT, GEORGE; ROONEY, WILLIAM L.; ROSS, LARRY; JOHNSTON, J. SPENCER

    2005-01-01

    • Background and Aims The roles of variation in DNA content in plant evolution and adaptation remain a major biological enigma. Chromosome number and 2C DNA content were determined for 21 of the 25 species of the genus Sorghum and analysed from a phylogenetic perspective.

  13. Bromus interruptus (Hack.) Druce (Poaceae) in Nederland

    NARCIS (Netherlands)

    Rich, Tim C.G.

    2001-01-01

    Bromus interruptus is a grass which was endemic to England but is now extinct in the wild. Attention is drawn to the two historic records from the Netherlands, where it was probably introduced with agricultural seed, in case it still survives in the wild. It is readily recognised from the contracted

  14. Monograph of Diplachne (Poaceae, Chloridoideae, Cynodonteae).

    Science.gov (United States)

    Snow, Neil; Peterson, Paul M; Romaschenko, Konstantin; Simon, Bryan K

    2018-01-01

    Diplachne P. Beauv. comprises two species with C 4 (NAD-ME) photosynthesis. Diplachne fusca has a nearly pantropical-pantemperate distribution with four subspecies: D. fusca subsp. fusca is Paleotropical with native distributions in Africa, southern Asia and Australia; the widespread Australian endemic D. f. subsp. muelleri; and D. f. subsp. fascicularis and D. f. subsp. uninervia occurring in the New World. Diplachne gigantea is known from a few widely scattered, older collections in east-central and southern Africa, and although Data Deficient clearly is of conservation concern. A discussion of previous taxonomic treatments is provided, including molecular data supporting Diplachne in its newer, restricted sense. Many populations of Diplachne fusca are highly tolerant of saline substrates and most prefer seasonally moist to saturated soils, often in disturbed areas. Some populations of Diplachne fusca in southern Asia combine nitrogen-fixation, high salinity tolerance and palatibilty to livestock, which should be pursued with further research for purposes of soil reclamation. Diplachne fusca subsp. uninervia is the most invasive of the subspecies and is becoming weedy in some non-native areas, including in the Old World. This monograph provides detailed descriptions of all taxa, a key to the species and subspecies, geographic distributions and information on the anatomy of leaves, stems, lemmatal micromorphology and discussions of the chromosome numbers. Lectotypes are designated for: Atropis carinata Grisb.; Diplachne acuminata Nash; Diplachne capensis (Nees) Nees var. concinna Nees; Diplachne capensis (Nees) Nees var. obscura Nees, Diplachne capensis (Nees) Nees var. prolifera subvar. minor Nees, Diplachne halei Nash, Diplachne maritima E.P. Bicknel, Diplachne muelleri Benth., Diplachne reverchonii Vasey, Diplachne tectoneticola Backer, Leptochloa imbricata Thurb., Leptochloa neuroglossa Peter, Leptochloa uninervia var. typica fo. abbreviata Parodi, Triodia ambigua R. Br. and Triodia parviflora R. Br.

  15. Early inflorescence development in the grasses (Poaceae

    Directory of Open Access Journals (Sweden)

    Elizabeth A. Kellogg

    2013-07-01

    Full Text Available The shoot apical meristem of grasses produces the primary branches of the inflorescence, controlling inflorescence architecture and hence seed production. Whereas leaves are produced in a distichous pattern, with the primordia separated from each other by an angle of 180o, inflorescence branches are produced in a spiral in most species. The morphology and developmental genetics of the shift in phyllotaxis have been studied extensively in maize and rice. However, in wheat, Brachypodium, and oats, all in the grass subfamily Pooideae, the change in phyllotaxis does not occur; primary inflorescence branches are produced distichously. It is unknown whether the distichous inflorescence originated at the base of Pooideae, or whether it appeared several times independently. In this study, we show that Brachyelytrum, the genus sister to all other Pooideae has spiral phyllotaxis in the inflorescence, but that in the remaining 3000+ species of Pooideae, the phyllotaxis is two-ranked. These two-ranked inflorescences are not perfectly symmetrical, and have a clear front and back; this developmental axis has never been described in the literature and it is unclear what establishes its polarity. Strictly distichous inflorescences appear somewhat later in the evolution of the subfamily. Two-ranked inflorescences also appear in a few grass outgroups and sporadically elsewhere in the family, but unlike in Pooideae do not generally correlate with a major radiation of species. After production of branches, the inflorescence meristem may be converted to a spikelet meristem or may simply abort; this developmental decision appears to be independent of the branching pattern.

  16. Two New American Species of Hordeum (Poaceae)

    DEFF Research Database (Denmark)

    Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke

    1985-01-01

    Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....

  17. Distribution of Vulpia species (Poaceae in Poland

    Directory of Open Access Journals (Sweden)

    Ludwik Frey

    2011-01-01

    Full Text Available The distribution of four species of the genus Vulpia [V. myuros (L. C.C. Gmel., V. bromoides (L. S.F. Gray, V. ciliata Dumort. and V. geniculata (L. Link] reported in Poland has been studied. Currently, V. myuros and especially V. bromoides are very rare species, and their greatest concentration can be found only in the Lower Silesia region. The number of their localities decreased after 1950 and it seems resonable to include both species in the "red list" of threatened plants in Poland: V. myuros in the EN category, V. bromoides in the CR category. V. ciliata and V. geniculata are very rare ephemerophytes and their localities not confirmed during ca 60 years are of historical interest only.

  18. Karyotype asymmetry in Cynodon Rich. (Poaceae) accessions.

    Science.gov (United States)

    Chiavegatto, R B; Paula, C M P; Souza Sobrinho, F; Benites, F R G; Techio, V H

    2016-12-02

    Cynodon is a genus of plants with forage potential that has attracted the interest of breeders. These species have high morphological variability in a large number of varieties and cytotypes, hampering identification. This study aimed to determine the karyotype asymmetry index among accessions of Cynodon to discriminate between them. Karyotype symmetry was based on three estimates, which were compared. The basic number for the genus is x = 9. The results of the chromosome count and DNA quantification, respectively, were as follows: two diploid accessions (2n = 2x = 18 and 1.08 ± 0.094 to 1.17 ± 0.036 pg DNA and ± standard deviation), one triploid accession (2n = 3x = 27 and 1.63 ± 0.017 pg DNA), four tetraploid accessions (2n = 4x = 36 and 1.88 ± 0.069 to 2.10 ± 0.07 pg DNA), and one pentaploid accession (2n = 5x = 45 and 2.55 ± 0.098 pg DNA). C. incompletus var. hirsutus had the longest total length of the haploid lot (29.05 µm), with chromosomes that ranged from 1.7 to 6.2 µm in length. On the basis of the karyotype asymmetry indices, the accessions were divided into two groups: 1) C. dactylon var. dactylon, C. transvaalensis, C. dactylon var. polevansii, three accessions of Cynodon sp, and C. nlemfuensis; and 2) C. incompletus var. hirsutus. This is the first description of tetraploidy in C. transvaalensis. The karyotypic data facilitated a determination of the degree of proximity between the accessions.

  19. Genetic variation of white clover ( Trifolium repens L.) collections ...

    African Journals Online (AJOL)

    amplified polymorphic DNA (RAPD) and simple sequence repeat (SSR) to investigate the genetic relationships among white clover germplasms of China, and four commercial cultivars were included for a comparison. The results revealed that the populations showed diverse morphological traits, RAPD and SSR patterns.

  20. Dirofilaria repens microfilariae in Aedes vexans mosquitoes in Slovakia

    Czech Academy of Sciences Publication Activity Database

    Bocková, E.; Rudolf, Ivo; Kočišová, A.; Betášová, Lenka; Venclíková, Kristýna; Mendel, Jan; Hubálek, Zdeněk

    2013-01-01

    Roč. 112, č. 10 (2013), s. 3465-3470 ISSN 0932-0113 Institutional support: RVO:68081766 Keywords : Dirofilaria * mosquitoes * Aedes vexans Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.327, year: 2013

  1. Genetic variation of white clover (Trifolium repens L.) collections ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-05-24

    May 24, 2010 ... incompatibility mechanism of disomic inheritance (Thomas,. 1987). In essence ..... Badr A, Sayed-Ahmed H, El-Shanshouri A, Watson LE (2002). Ancestors of white ... Caradus JR, Woodfield DR (1997). World checklist of ... within a natural population of white clover (Trifolium repense L). J. Ecol. 73: 615-624 ...

  2. Het cyanophore karakter van witte klaver (Trifolium repens L.)

    NARCIS (Netherlands)

    Waal, de D.

    1942-01-01

    The positive correlation found in New Zealand between quality of white clover and its hydrocyanic acid content, could not be confirmed for Dutch white clover in the Netherlands. HCN occurred bound to an incompletely identified glucoside. As Weevers and Treub et al. found the glucoside and HCN

  3. Comparison of foliar anatomy of ten bread wheat (triticum, poaceae) and ten barley (hordeum, poaceae) cultivars

    International Nuclear Information System (INIS)

    Ardic, M.; Sezer, O.; Ozgdsd, K.; Yaylaci, O. K.; Koyuncu, O.; Olgun, M.; Bascdftcd, Z. B.; Ayter, N. G.

    2015-01-01

    The aim of this study is to determine anatomical differences and classification of leaf and leaf cell characteristics (cuticle thickness, upper epidermis thickness, lower epidermis thickness, mesophyll thickness, parenchyma thickness and leaf thickness) between 10 bread wheat cultivars (Triticum aestivum L.) and 10 barley cultivars (Hordeum vulgare L.). Classification of leaf characteristics in bread wheat and barley cultivars and relationship between leaf characteristics are made by principal component and correlation analyses. Highest thickness belongs to W8 Mufitbey cultivar in mesophyll and lower epidermis and W1 Sonmez 01 cultivar have the lowest thickness of upper epidermis in bread wheat. In Barley, B1 Ince cultivar has highest leaf thickness mesophyll and parenchyma; lowest thickness of cuticle is included B7 Cumhuriyet 50 cultivar. All other cultivars have homogenous contents of leaf characteristics. (author)

  4. Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)

    DEFF Research Database (Denmark)

    Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke

    1986-01-01

    The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species...

  5. Cynodon dactylon (L) Pers (Poaceae) root extract induces apoptotic ...

    African Journals Online (AJOL)

    has also been used for the treatment of weak vision, urinary tract infection, .... with an alternating 12 h dark/light cycle in ... detected by Western blot analysis as described previously .... the cyclin signaling pathways, induced apoptotic cell death ...

  6. In vitro anthelmintic and cytotoxicity activities the Digitaria insularis (Poaceae).

    Science.gov (United States)

    Santos, Francianne Oliveira; de Lima, Hélimar Gonçalves; de Souza Santos, Nathália Silva; Serra, Taiane Menezes; Uzeda, Rosângela Soares; Reis, Isabella Mary Alves; Botura, Mariana Borges; Branco, Alexsandro; Batatinha, Maria José Moreira

    2017-10-15

    This study aimed to evaluate the in vitro activity of D. insularis extracts and fractions against gastrointestinal nematodes of goats and its cytotoxicity on Vero cells. The egg hatch (EHT) and larval motility (LMT) tests were conducted to investigate the anthelmintic effects of the crude hydroethanolic (CH), ethyl acetate (EA), butanolic (BT) and residual hydroethanolic (RH) extracts. The elution of the active extract (EA) on column chromatography (SiO 2 ) using organic solvents furnished six fractions (FR1 to FR6), which were also tested. Cytotoxicity was determined using 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) and Trypan Blue exclusion assays. All extracts, FR2 and FR3, inhibited egg hatching in a concentration-dependent manner. The EHT led to EC 50 values (effective concentration 50%) of 0.64; 0.69; 0.77; 0.96; 0.27 and 0.65mg/mL for CH, EA, BT, RH, FR2 and FR3, respectively. However, the extracts exhibited low effect on the motility of L 3. In the cytotoxicity evaluation (MTT assay), the IC 50 (inhibitory concentration 50%) was 1.18 (EA), 1.65 (FR2) and 1.59mg/mL (FR3), which was relatively high (low toxicity) in comparison to the EC 50 values in EHT, mainly for FR2. The chemical analyses of most active fractions (FR2) by Liquid Chromatography coupled to Mass Spectrometry (LC-MS) led the characterization of the flavones tricin and diosmetin. These results showed the high anthelmintic effect and low cytotoxicity of D. insularis and also that the flavones can be probably responsible for the nematocidal activity of this plant. Copyright © 2017 Elsevier B.V. All rights reserved.

  7. Genomic homeology between Pennisetum purpureum and Pennisetum glaucum (Poaceae

    Directory of Open Access Journals (Sweden)

    Gabriela Barreto dos Reis

    2014-08-01

    Full Text Available The genus Pennisetum (Richard, 1805 includes two economically important tropical forage plants: Pennisetum purpureum (Schumacher, 1827 (elephant grass, with 2n = 4x = 28 chromosomes and genomes A'A'BB, and Pennisetum glaucum (Linnaeus, 1753 (pearl millet, with 2n = 2x = 14 chromosomes and genomes AA. The genetic proximity between them allows obtaining hybrids (2n = 3x = 21 that yield forage of higher quality in relation to the parents. The study of genomic relationships provides subsidies for the knowledge about phylogenetic relations and evolution, and is useful in breeding programs seeking gene introgression. Concerning elephant grass and pearl millet, the homeology between the genomes A and A', and between these and the genome B, has been reported by conventional cytogenetic techniques. The objective of the present study was to demonstrate the degree of homeology between these genomes by means of genomic in situ hybridization (GISH. The results confirmed the homeology between the genomes A of pearl millet and A'B of elephant grass, and showed that there are differences in the distribution and proportion of homologous regions after hybridization. Discussion regarding the evolutionary origin of P. purpureum and P. glaucum was also included.

  8. Ecological Genetics of Vernalization Response in Bromus tectorum L. (Poaceae)

    Science.gov (United States)

    MEYER, SUSAN E.; NELSON, DAVID L.; CARLSON, STEPHANIE L.

    2004-01-01

    • Background and Aims Bromus tectorum (cheatgrass or downy brome) is an exotic annual grass that is dominant over large areas of former shrubland in western North America. To flower in time for seed production in early summer, B. tectorum plants generally require vernalization at winter temperatures, either as imbibed seeds or as established seedlings. • Methods Variation in response to increasing periods of vernalization as seeds or seedlings for progeny of ten full‐sib families from each of four B. tectorum populations from contrasting habitats was studied. • Key Results As vernalization was increased from 0 to 10 weeks, the proportion of plants flowering within 20 weeks increased, weeks to initiation of flowering decreased, and seed yield per plant increased, regardless of whether plants were vernalized as seeds or seedlings. Most of the variation was accounted for by differences among populations. Plants of the warm desert population flowered promptly even without vernalization, while those of the cold desert, foothill and montane populations showed incremental changes in response variables as a function of vernalization period. Populations differed in among‐family variance, with the warm desert population generally showing the least variance and the cold desert population the most. Variation among populations and among families within populations decreased as vernalization period increased, whereas the non‐genetic component of variance showed no such pattern. • Conclusions Variation in vernalization response was found to be adaptively significant and apparently represents the result of contrasting selection regimes on a range of founder genotypes. PMID:15087300

  9. Sequencing and De Novo Transcriptome Assembly of Brachypodium sylvaticum (Poaceae

    Directory of Open Access Journals (Sweden)

    Samuel E. Fox

    2013-03-01

    Full Text Available Premise of the study: We report the de novo assembly and characterization of the transcriptomes of Brachypodium sylvaticum (slender false-brome accessions from native populations of Spain and Greece, and an invasive population west of Corvallis, Oregon, USA. Methods and Results: More than 350 million sequence reads from the mRNA libraries prepared from three B. sylvaticum genotypes were assembled into 120,091 (Corvallis, 104,950 (Spain, and 177,682 (Greece transcript contigs. In comparison with the B. distachyon Bd21 reference genome and GenBank protein sequences, we estimate >90% exome coverage for B. sylvaticum. The transcripts were assigned Gene Ontology and InterPro annotations. Brachypodium sylvaticum sequence reads aligned against the Bd21 genome revealed 394,654 single-nucleotide polymorphisms (SNPs and >20,000 simple sequence repeat (SSR DNA sites. Conclusions: To our knowledge, this is the first report of transcriptome sequencing of invasive plant species with a closely related sequenced reference genome. The sequences and identified SNP variant and SSR sites will provide tools for developing novel genetic markers for use in genotyping and characterization of invasive behavior of B. sylvaticum.

  10. Ecological genetics of floret mass variation in Bromus tectorum (Poaceae)

    Science.gov (United States)

    Susan E. Meyer

    2010-01-01

    Bromus tectorum L. (cheatgrass, downy brome) is a highly invasive inbreeding annual grass that dominates millions of hectares of former shrubland in interior western North America. Factors contributing to its success include strong genetic regulation of key adaptive traits coupled with high phenotypic plasticity in response to resource availability (Meyer and Allen...

  11. Aira (Poaceae: a new generic record for Nicobar Islands, India

    Directory of Open Access Journals (Sweden)

    Kumar Vinod Chhotupuri Gosavi

    2016-06-01

    Full Text Available During plant exploration of Andaman and Nicobar in 2014, we were collected some interesting grass specimens from Kamorta Islands of Nicobar. After critical study and taxonomic analysis the unidentified grass species has identified as an Aira caryophyllea L.  Perusals of relevant literature were revealed that, the genus Aira L. has so far not reported from Andaman and Nicobar islands. Hence, it is reported in present communication for new record to the Andaman and Nicobar Islands. 

  12. Nature of ergastic substances in some Poaceae seeds

    African Journals Online (AJOL)

    ajl yemi

    2011-08-29

    Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011 ... grasses) contribute more food seeds than any other plant family; it contributes about 50% per capita energy ...

  13. Chloroplasts in anther endothecium of Zea mays (Poaceae).

    Science.gov (United States)

    Murphy, Katherine M; Egger, Rachel L; Walbot, Virginia

    2015-11-01

    Although anthers of Zea mays, Oryza sativa, and Arabidopsis thaliana have been studied intensively using genetic and biochemical analyses in the past 20 years, few updates to anther anatomical and ultrastructural descriptions have been reported. For example, no transmission electron microscopy (TEM) images of the premeiotic maize anther have been published. Here we report the presence of chloroplasts in maize anthers. TEM imaging, electron acceptor photosynthesis assay, in planta photon detection, microarray analysis, and light and fluorescence microscopy were used to investigate the presence of chloroplasts in the maize anther. Most cells of the maize subepidermal endothecium have starch-containing chloroplasts that do not conduct measurable photosynthesis in vitro. The maize anther contains chloroplasts in most subepidermal, endothecial cells. Although maize anthers receive sufficient light to photosynthesize in vivo and the maize anther transcribes >96% of photosynthesis-associated genes found in the maize leaf, no photosynthetic light reaction activity was detected in vitro. The endothecial cell layer should no longer be defined as a complete circle viewed transversely in anther lobes, because chloroplasts are observed only in cells directly beneath the epidermis and not those adjacent to the connective tissue. We propose that chloroplasts be a defining characteristic of differentiated endothecial cells and that nonsubepidermal endothecial cells that lack chloroplasts be defined as a separate cell type, the interendothecium. © 2015 Botanical Society of America.

  14. Micropropagation of Guadua angustifolia Kunth (Poaceae) using a ...

    African Journals Online (AJOL)

    Universidad del Quindio

    2016-07-13

    Jul 13, 2016 ... develop an application for RITA® for use in the commercial production of G. angustifolia. Key words: Giant .... Data were analyzed using a random block design with 20 replicates ..... Gray D (eds) Plant Tissue Culture Concepts and Laboratory ... A (eds) Current Issues in Plant Molecular and Cellular Biology,.

  15. 7 CFR 201.56-5 - Grass family, Poaceae (Gramineae).

    Science.gov (United States)

    2010-01-01

    ... ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.56-5 Grass.... During germination the scutellum remains inside the seed to absorb nutrients from the endosperm and... with the endosperm. During germination the scutellum remains inside the seed to absorb nutrients from...

  16. Nature of ergastic substances in some Poaceae seeds

    African Journals Online (AJOL)

    ajl yemi

    2011-08-29

    Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. ... Since seed is the storage organs of ergastic materials such as .... Ultrastructure and Development of Silica Bodies in Monocotyledons.

  17. Palynological studies in tribe Chlorideae (Poaceae) from salt range ...

    African Journals Online (AJOL)

    Jane

    2011-08-15

    Aug 15, 2011 ... To determine pollen fertility, acetocarmine and glycerin jelly was used by the modified techniques used by Khan and Stace (1999). Anthers were squashed .... World. Kew bulletin additional series 13, Royal Botanic gardens,. Kew. p. 389. Edeoga HO, Okoli BE (1996). Apomictic behaviour in Costus after C.

  18. LAS ESPECIES DE MUHLENBERGIA (POACEAE: CHLORIDOIDEAE DE ARGENTINA

    Directory of Open Access Journals (Sweden)

    Peterson Paul

    2011-06-01

    Full Text Available Se presenta un estudio taxonómico de las especies nativas argentinas del géneroMuhlenbergia, basado en el análisis de los especímenes depositados en 48 herbarios.Se analizan diversos aspectos relativos a la clasifi cación, la nomenclatura y lavariación morfológica de los caracteres. Muhlenbergia está representado enArgentina por 18 especies nativas. Se proporcionan claves para reconocer lasespecies presentes en el país, así como también descripciones de éstas, sinónimos,ilustraciones, distribución geográfica y algunos comentarios morfológicos yecológicos. Muhlenbergia breviaristata (Hack. Parodi y Muhlenbergia holwayorumHitchc., se reducen como sinónimos del híbrido Muhlenbergia angustata (J. PreslKunth × M. rigida (Kunth Kunth. Muhlenbergia diversiglumis Trin. se cita porprimera vez para la Argentina. Por otra parte, las especies Muhlenbergia tenella(Kunth Trin. y Muhlenbergia tenuissima (J. Presl Kunth se excluyen de la fl orade Argentina.

  19. Novedades nomenclaturales en Cenchrus s.l. (Poaceae: Panicoideae: Paniceae)

    OpenAIRE

    Gutiérrez, Hugo F; Morrone, Osvaldo

    2012-01-01

    Recientes estudios filogenéticos con datos morfológicos y moleculares aportaron evidencia sobre la monofilia de los géneros Cenchrus, Pennisetum y Odontelytrum y, por ello, se propuso su unificación y transferencia a Cenchrus, el cual tiene prioridad. Resultados preliminares de la revisión taxonómica del género Cenchrus s.l. para América (Gutiérrez, en preparación) permitieron detectar problemas nomenclaturales. Para resolver dichos inconvenientes, en el presente trabajo se presentan nueve le...

  20. What is Cynodon radiatus Roth ex R. & S. (Poaceae)?

    NARCIS (Netherlands)

    Nowack, R.

    1992-01-01

    Roemer and Schultes (1817) described Cynodon radiatus, basing themselves on a manuscript by A.W. Roth, copying Roth's brief diagnosis and comment. It was compared to Cynodon dactylon, differing by its larger habit, the number and direction of the spikes, and the glabrous blades and sheaths. This was

  1. Micropropagation of Guadua angustifolia Kunth (Poaceae) using a ...

    African Journals Online (AJOL)

    The micropropagation of Guadua angustifolia Kunth, commonly known as giant bamboo, using semisolid culture medium, is reported to have low multiplication rates. This study evaluated the multiplication index of G. angustifolia in a temporary immersion system (RITA®), comparing results with those obtained using a ...

  2. The Mediterranean: the cradle of Anthoxanthum (Poaceae) diploid diversity

    Czech Academy of Sciences Publication Activity Database

    Chumová, Zuzana; Záveská, E.; Mandáková, T.; Krak, Karol; Trávníček, Pavel

    2017-01-01

    Roč. 120, č. 2 (2017), s. 285-302 ISSN 0305-7364 Institutional support: RVO:67985939 Keywords : Antoxanthum * rDNA FISH * incomplete lineage sorting Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 4.041, year: 2016

  3. Número cromossômico em acessos de Pennisetum spp. (Poaceae, Poales = Chromosome number in Pennisetum spp. accessions (Poaceae, Poales

    Directory of Open Access Journals (Sweden)

    Vânia Helena Techio

    2008-07-01

    Full Text Available Avaliou-se o complemento cromossômico de 16 acessos de Pennisetum disponíveis na Coleção de Germoplasma da Embrapa Gado de Leite – Juiz de Fora, Estado de Minas Gerais. Para a avaliação citogenética, utilizou-se a técnica de esmagamento e coloração com Feulgen. Paraquatro acessos foram obtidas metáfases com 2n = 28 cromossomos, confirmando sua classificação como P. purpureum. A origem híbrida P. purpureum x P. glaucum foi constatada em oito acessos, os quais apresentaram 2n = 21. Em um acesso identificado como híbrido entre P.purpureum x P. glaucum, foram observadas metáfases com 2n = 54, permitindo inferir que não se trata de um híbrido interespecífico triplóide. Para outros três acessos avaliados, também foramobservadas células com 2n = 54, embora estivessem identificados como híbridos entre P. purpureum x espécie selvagem; P. glaucum policross x hexaplóide 200 e P. glaucum x [F92-161-01 (P. purpureum x P. glaucum].The chromosome complement of 16 Pennisetum accessions belonging to the Germplasm Collection of Embrapa Gado de Leite - Juiz de Fora, Minas Gerais State was evaluated. The cytogenetic analysis employed the smear technique and staining with Feulgen. In four accessions,metaphases with 2n = 28 chromosomes were obtained, confirming their classification as P. purpureum. The hybrid origin P. purpureum x P. glaucum was observed in eight accessions, which presented 2n = 21. In an accession identified as P. purpureum x P. glaucum hybrid, metaphases with 2n = 54 were observed, suggesting that it is not a triploid interspecific hybrid. For three other evaluated accessions, cells with 2n=54 were also observed, although they were identified ashybrids between P. purpureum x wild species; P. glaucum polycross x hexaploid 200 and P. glaucum x [F92-161-01 (P. purpureum x P. glaucum].

  4. Pollen sources in the Bojanów forest complex identified on honeybee pollen load by microscopic analysis

    Directory of Open Access Journals (Sweden)

    Ernest Stawiarz

    2017-11-01

    Full Text Available The aim of this study was to determine sources of pollen for the honeybee in the Bojanów forest complex, Nowa Dęba Forest District (southeastern Poland. Sampling of pollen loads from bees extended from the beginning of May until the end of September 2016 and was carried out at 7-day intervals using pollen traps mounted at the entrance of beehives. A total of 73 pollen load samples were collected from the study area. Fifty-nine taxa from 31 plant families were identified in the analyzed material. From 4 to 21 taxa (average 9.5 were recorded in one sample. The pollen of Brassicaceae (“others”, Taraxacum type, Solidago type, and Rumex had the highest frequency in the pollen loads examined. Apart from these four taxa, pollen grains of Rubus type, Poaceae (“others”, Calluna, Fagopyrum, Trifolium repens s. l., Phacelia, Aster type, Melampyrum, Quercus, Cornus, and Veronica were recorded in the dominant pollen group. The forest habitat taxa that provided pollen rewards to honeybees in the Bojanów forest complex were the following: Rubus, Calluna, Prunus, Tilia, Frangula alnus, Pinus, Quercus, Cornus, Robinia pseudoacacia, Salix, and Vaccinium. Apart from forest vegetation, the species from meadows and wastelands adjacent to this forest complex, represented by Taraxacum, Rumex, Plantago, Poaceae, Trifolium repens, and Solidago, proved to be an important source of pollen. The study indicates that forest communities are a valuable source of pollen for pollinating insects from early spring through to late fall.

  5. Stress-induced memory alters growth of clonal offspring of white clover (Trifolium repens)

    Czech Academy of Sciences Publication Activity Database

    González, Alejandra Pilar Rendina; Chrtek, Jindřich; Dobrev, Petre; Dumalasová, Veronika; Fehrer, Judith; Mráz, Patrik; Latzel, Vít

    2016-01-01

    Roč. 103, č. 9 (2016), s. 1567-1574 ISSN 0002-9122 R&D Projects: GA ČR(CZ) GA14-06802S Institutional support: RVO:67985939 ; RVO:61389030 Keywords : asexual reproduction * DNA methylation * epigenetic variation Subject RIV: EF - Botanics; EF - Botanics (UEB-Q) Impact factor: 3.050, year: 2016

  6. Fate in Soil of Flavonoids Released from White Clover (Trifolium repens L.)

    DEFF Research Database (Denmark)

    Carlsen, Sandra C. K.; Pedersen, Hans A.; Spliid, Niels H.

    2012-01-01

    the presence in soil of bioactive secondary metabolites from clover has received limited attention. In this paper we examine for the first time the release of flavonoids both from field-grown white clover and from soil-incorporated white clover plants of flavonoids, as analyzed by LC-MS/MS. The dominant...... flavonoid aglycones were formononetin, medicarpin, and kaempferol. Soil-incorporated white clover plants generated high concentrations of the glycosides kaempferol-Rha-Xyl-Gal and quercetin-Xyl-Gal. Substantial amounts of kaempferol persisted in the soil for days while the other compounds were degraded...

  7. Air-propelled abrasive grit can damage the perennial weed, quackgrass, Elytrigia repens (L.) Nevski

    Science.gov (United States)

    New techniques are needed to control quackgrass in organic crops. With greater than or equal to 2 applications of abrasive air-propelled (800 kPa) corncob grit to 15 cm tall quackgrass tillers, regrowth was minimal at 5 weeks after treatment. Abrasive grits may be effective tools to help manage pere...

  8. Subconjunctival Dirofilaria repens Infestation: A Light and Scanning Electron Microscopy Study

    DEFF Research Database (Denmark)

    Melsom, Henrik A; Kurtzhals, Jørgen A L; Qvortrup, Klaus

    2011-01-01

    injection, proptosis and diplopia. The patient underwent incisional extraction of a nine cm long worm, which was analysed histologically. Results: The worm was structureless, greyish-white in colour and measuring nine cm in length and 0.5 mm in diameter. Histopathological examination of the worm showed...

  9. Elytrigia repens population dynamics under different management schemes in organic cropping systems on coarse sand

    DEFF Research Database (Denmark)

    Rasmussen, Ilse A.; Melander, Bo; Askegaard, Margrethe

    2014-01-01

    -year crop rotations including various cash crops and grass-clover leys; two rotations running during the first two courses with the one replaced with another rotation during the last course. The rotations were combined with four combinations of the treatments; with and without animal manure (‘without...

  10. Antileishmanial activity of 12-methoxycarnosic acid from Salvia repens Burch. ex Benth. (Lamiaceae)

    CSIR Research Space (South Africa)

    Mokoka, TA

    2014-01-01

    Full Text Available .5 ml/min, and the injection volume was 35 µl (350 µg extract in DMSO). Thirty-five one-92 minute fractions were collected in 96 deep well plates during the run (Screenmates 96 well, 93 Matrix Technology, Hudson, USA) and dried in a GeneVac EZ-2 Plus...) at two different concentrations (5 µg/ml) and (0.8 102 6 µg/ml) against L. donovani amastigotes (MHOM/ET/67/L82) in 96-well microtiter plate. The 103 plate was read in a spectramax Gemini XS microplate fluorometer (Molecular Devices 104 Cooperation...

  11. Intoxicação por Sorhgum halepense (Poaceae em bovinos no semi-árido Poisoning by Sorghum halepense (Poaceae in cattle in the Brazilian semiarid

    Directory of Open Access Journals (Sweden)

    J. Escarião da Nóbrega Jr

    2006-12-01

    Full Text Available Descreve-se um surto de intoxicação por Sorghum halepense (L. Pers. no município de Santa Luzia, semi-árido da Paraíba. Nove bovinos foram colocados numa pastagem com S. halepense em fase de rebrota, com 25-30cm de altura, 15 dias após as primeiras chuvas. Sinais clínicos de dispnéia, ansiedade, tremores musculares e incoordenação apareceram 10-15 minutos após a ingestão. Dois animais morreram em um período aproximado de 3 horas. Na necropsia observaram-se congestão e cianose das mucosas, musculatura escura, pulmão com pontos hemorrágicos e edema, além de folhas da planta no rúmen. A planta foi positiva no teste do papel picrosódico. Mudas de S. halepense coletadas no Município de Currais Novos, Rio Grande do Norte, onde havia históricos de uma intoxicação semelhante, foram plantadas em vasos e realizado o teste de papel picrosódico a cada 15 dias. A planta foi positiva para HCN durante todos os estágios, sendo que nos primeiros 45 dias a reação ocorreu dentro de 1 minuto e, posteriormente, em até 3 minutos. Trinta dias após ter sido plantada, a planta de um dos vasos foi administrada a um caprino causando sinais característicos de intoxicação cianídrica na dose de 11,8g/kg de peso do animal. O caprino se recuperou após tratamento com uma solução de tiossulfato de sódio a 20% na dose de 5mL/10kg. No semi-árido, S. halepense é freqüentemente encontrado como invasora em beiras de açudes e culturas irrigadas, sendo utilizado como forrageira, na época seca, em áreas de vazante.An outbreak of poisoning by Sorghum halepense (L. Pers. in cattle in the Brazilian semiarid is reported. Nine cattle were introduced 15 days after the first rains into a paddock where the plant was sprouting and had 25-30cm high. Clinical signs of dyspnea, anxiety, muscular tremors and incoordination appeared 15 minutes after the animals began to graze. Two of them died within about 3 hours. The others recovered. Cyanotic mucosa, dark muscles, lung edema and hemorrhages, and leaves of the plant in the rumen were observed at necropsy. The plant was positive for the picrosodic paper test. S. halepense from another farm of occurrence of the poisoning was transplanted into two pots. The picrosodic paper test was performed fortnightly in the plants growing in one of them. The plant was positive for cyanide in all growth stages; during the first 45 days the test was positive within 1 minute, but after day 60 within 3 minutes. Thirty days after the plant had been transplanted into one of the pots, it was administered to a goat at a dose of 11.8g/kg, causing clinical signs of HCN poisoning. The animal recovered after the intravenous administration of 5mL/10kg body weight of a 20% sodium thiosulfate solution. In the Brazilian semiarid S. halepense is frequently found invading the border of ponds and irrigated crops, and is used as forage during the dry season.

  12. Особенности фитоценозов с участием Melica virgata Turcz. ex Trin. (Poaceae Восточного Забайкалья в сравнении с сопредельными территориями

    Directory of Open Access Journals (Sweden)

    E. A. Bondarevich

    2015-03-01

    Full Text Available В работе рассмотрены особенности видового состава редких растительных сообществ с участием Melica virgata Turcz. ex Trin. (Poaceae. При сравнении с ранее известными данными по фитоценозам Монголии с участием этого вида выяснилось, что состав их значительно отличается. Также для фитоценозов из Восточного Забайкалья характерен уникальный видовой состав (заросли трех видов рода Rhamnus: R. davurica, R. erythroxylon, R. pissjaukovae + Ulmus pumila, с высоким проективным покрытием Melica virgata и участием крайне редкого вида для региона – Artemisia rutifolia, представленный на крайне ограниченной территории в бассейне реки Чикой (у с. Усть-Урлук. Сохранение комплекса видов требует создание охраняемой территории и включение в её состав нескольких наиболее ценных участков.

  13. Local climate and cultivation, but not ploidy, predict functional trait variation in Bouteloua gracilis (Poaceae)

    Science.gov (United States)

    Butterfield, Bradley J.; Wood, Troy E.

    2015-01-01

    Efforts to improve the diversity of seed 18 resources for important restoration species has become a high priority for land managers in many parts of the world. Relationships between functional trait values and the environment from which seed sources are collected can provide important insights into patterns of local adaptation and guidelines for seed transfer. However, little is known about which functional traits exhibit genetic differentiation across populations of restoration species and thus may contribute to local adaptation. Here, we report the results of a common garden experiment aimed at assessing genetic (including ploidy level) and environmental regulation of several functional traits among populations of Bouteloua gracilis, a dominant C4 grass and the most highly utilized restoration species across much of the Colorado Plateau. We found that leaf size and specific leaf area (SLA) varied significantly among populations, and were strongly correlated with the source population environment from which seeds were collected. However, variation in ploidy level had no significant effect on functional traits. Leaves of plants grown from commercial seed releases were significantly larger and had lower SLA than those from natural populations, a result that is concordant with the overall relation between climate and these two functional traits. We suggest that the patterns of functional trait variation shown here may extend to other grass species in the western USA, and may serve as useful proxies for more extensive genecology research. Furthermore, we argue that care should be taken to develop commercial seed lines with functional trait values that match those of natural populations occupying climates similar to target restoration sites.

  14. Adaptive divergence with gene flow in incipient speciation of Miscanthus floridulus / sinensis complex (Poaceae)

    KAUST Repository

    Huang, Chao-Li; Ho, Chuan-Wen; Chiang, Yu-Chung; Shigemoto, Yasumasa; Hsu, Tsai-Wen; Hwang, Chi-Chuan; Ge, Xue-Jun; Chen, Charles; Wu, Tai-Han; Chou, Chang-Hung; Huang, Hao-Jen; Gojobori, Takashi; Osada, Naoki; Chiang, Tzen-Yuh

    2014-01-01

    Young incipient species provide ideal materials for untangling the process of ecological speciation in the presence of gene flow. The Miscanthus floridulus/sinensis complex exhibits diverse phenotypic and ecological differences despite recent divergence (approximately 1.59million years ago). To elucidate the process of genetic differentiation during early stages of ecological speciation, we analyzed genomic divergence in the Miscanthus complex using 72 randomly selected genes from a newly assembled transcriptome. In this study, rampant gene flow was detected between species, estimated as M=3.36x10(-9) to 1.20x10(-6), resulting in contradicting phylogenies across loci. Nevertheless, beast analyses revealed the species identity and the effects of extrinsic cohesive forces that counteracted the non-stop introgression. As expected, early in speciation with gene flow, only 3-13 loci were highly diverged; two to five outliers (approximately 2.78-6.94% of the genome) were characterized by strong linkage disequilibrium, and asymmetrically distributed among ecotypes, indicating footprints of diversifying selection. In conclusion, ecological speciation of incipient species of Miscanthus probably followed the parapatric model, whereas allopatric speciation cannot be completely ruled out, especially between the geographically isolated northern and southern M.sinensis, for which no significant gene flow across oceanic barriers was detected. Divergence between local ecotypes in early-stage speciation began at a few genomic regions under the influence of natural selection and divergence hitchhiking that overcame gene flow.

  15. Surface properties correlate to the digestibility of hydrothermally pretreated lignocellulosic Poaceae biomass feedstocks

    DEFF Research Database (Denmark)

    Tristan Djajadi, Demi; Hansen, Aleksander R.; Jensen, Anders

    2017-01-01

    physical and chemical features of the biomass surfaces, specifically contact angle measurements (wettability) and attenuated total reflectance-Fourier transform infrared (ATR-FTIR) spectroscopy (surfacebiopolymer composition) produced data correlating pretreatment severity and enzymatic digestibility......, and they also revealed differences that correlated to enzymatic glucose yield responses among the three different biomass types. Conclusion: The study revealed that to a large extent, factors related to physico-chemical surface properties, namely surface wettability as assessed by contact angle measurements...

  16. Leaf anatomy of the South African Danthonieae (Poaceae. XIII. Pentameris macrocalycina and P. obtusifolia

    Directory of Open Access Journals (Sweden)

    R. P. Ellis

    1984-12-01

    Full Text Available The leaf blade anatomy of Peniameris macrocalycina (Steud. Schweick. and P. obtusifolia (Hochst, Schweick. is described and illustrated. The leaf anatomy of these two species shows many similarities suggesting a close relationship between them. A slight problem appears to exist with the circumscription of P. obtusifolia and a minor taxonomic adjustment may result in a classification which agrees totally with that based on leaf anatomy. This would result in details of the leaf outline being diagnostic for these two taxa. The nomenclature of P. obtusifolia is also very confusing and clarification is needed by reference to the relevant type specimens. P. macrocalycina and P. obtusifolia together with  P. longiglumis (Nees Stapf, appear to form a distinct genus and do not bear close anatomical resemblances to either P. thuarri Beauv. or P. dregeana Stapf.

  17. Additions to the grasses (Poaceae of Telangana from Kawal Tiger Reserve, Adilabad District, India

    Directory of Open Access Journals (Sweden)

    Alok Chorghe

    2015-07-01

    Full Text Available Three species of grasses viz., Dimeria orissae, Iseilema holei and Spodiopogon rhizophorus are being reported for the first time as new distributional records to Telangana from the Kawal Tiger Reserve. Detailed description and illustrations are provided here.

  18. Development of chromosome-arm-specific microsatellite markers in Triticum aestivum (Poaceae) using NGS technology

    Czech Academy of Sciences Publication Activity Database

    Nie, X.; Li, B.; Wang, L.; Liu, P.; Biradar, S. S.; Li, T.; Doležel, Jaroslav; Edwards, D.; Luo, M.; Weining, S.

    2012-01-01

    Roč. 99, č. 9 (2012), e369-e371 ISSN 0002-9122 Institutional research plan: CEZ:AV0Z50380511 Keywords : chromosome-arm-specific DNA * flow-sorted chromosomes * next-generation sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.586, year: 2012

  19. Impact of Corn Earworm (Lepidoptera: Noctuidae) on Field Corn (Poales: Poaceae) Yield and Grain Quality.

    Science.gov (United States)

    Bibb, Jenny L; Cook, Donald; Catchot, Angus; Musser, Fred; Stewart, Scott D; Leonard, Billy Rogers; Buntin, G David; Kerns, David; Allen, Tom W; Gore, Jeffrey

    2018-05-28

    Corn earworm, Helicoverpa zea (Boddie), commonly infests field corn, Zea mays (L.). The combination of corn plant biology, corn earworm behavior in corn ecosystems, and field corn value renders corn earworm management with foliar insecticides noneconomical. Corn technologies containing Bacillus thuringiensis (Bt) Berliner (Bacillales: Bacillaceae) were introduced that exhibit substantial efficacy against corn earworm and may reduce mycotoxin contamination in grain. The first generation Bt traits in field corn demonstrated limited activity on corn earworm feeding on grain. The pyramided corn technologies have greater cumulative protein concentrations and higher expression throughout the plant, so these corn traits should provide effective management of this pest. Additionally, reduced kernel injury may affect physical grain quality. Experiments were conducted during 2011-2012 to investigate corn earworm impact on field corn yield and grain quality. Treatments included field corn hybrids expressing the Herculex, YieldGard, and Genuity VT Triple Pro technologies. Supplemental insecticide treatments were applied every 1-2 d from silk emergence until silk senescence to create a range of injured kernels for each technology. No significant relationship between the number of corn earworm damaged kernels and yield was observed for any technology/hybrid. In these studies, corn earworm larvae did not cause enough damage to impact yield. Additionally, no consistent relationship between corn earworm damage and aflatoxin contamination was observed. Based on these data, the economic value of pyramided Bt corn traits to corn producers, in the southern United States, appears to be from management of other lepidopteran insect pests including European and southwestern corn borer.

  20. Ultraestructura del bambú Guadua macclurei (Poaceae: Bambusoideae de Costa Rica

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Se evaluaron ultraestructuralmente secciones de la lámina de la hoja, vaina de la hoja y rama, de una planta adulta de Guadua macclurei. Las brácteas del culmo carecen de setas orales. En la superficie adaxial de la lámina foliar se observó un patrón celular diferente al de otras especies de este género. Además, hay tricomas tricelulares y bandas de estomas de alto domo muy ordenadas y evidentes, característica que la podría diferenciar de otras especies en el género. Esta es la primera descripción microscópica de esta especie.We studied the ultrastructure of sections of leaf lamina, leaf sheath and branches of an adult plant of Guadua macclurei. Culm sheaths lack fimbriae (oral setae. The adaxial section of the leaf lamina has a particular cellular pattern, previously unreported in this genus. The tricellular trichomes, and the evident and ordered bands of high dome stomata may be useful for taxonomic purposes. To the best of our knowledge, this is the first microscopic description of this species. Rev. Biol. Trop. 54(Suppl. 2: 35-42. Epub 2006 Dec. 01.

  1. Leaf anatomy of the genus Ehrharta (Poaceae in southern Africa: the Setacea group

    Directory of Open Access Journals (Sweden)

    R. P. Ellis

    1987-10-01

    Full Text Available The leaf blade anatomy of the taxa of the Setacea group of species of the genus Ehrharta is described and illustrated. This group includes E. rupestris Nees ex Trin. subsp.  rupestris, subsp.  tricostata (Stapf Gibbs Russell and subsp.  dodii (Stapf Gibbs Russell, as well as E. setacea Nees subsp.  setacea, subsp.  scabra (Stapf Gibbs Russell, subsp.  uniflora (Burch, ex Stapf Gibbs Russell and subsp.  disticha Gibbs Russell. All these taxa share a very characteristic leaf anatomy with inrolled or infolded leaves without keels and have adaxial ribs with interlocking prickles. The chlorenchyma is dense and compact with inwardly projecting invaginations visible in all taxa except  E. setacea subsp.  setacea. In E .  setacea subsp. scabra typical arm cells are present. Abaxial costal and intercostal zones are not differentiated and stomata are absent. The long cells are hexagonal or inflated with sinuous walls. Silica bodies are single or paired and rounded in shape. Small hook-like prickles with short barbs are common. Microhairs with a short, truncated distal cell occur. This leaf anatomical structure differs considerably from that of the other species groups recognized in African  Ehrharta and the Setacea group appears to be more distinct from the other groups than they are from each other.

  2. A new species of Otatea (Poaceae: Bambusoideae: Bambuseae) from Querétaro, Mexico

    OpenAIRE

    Ruiz-Sánchez, Eduardo

    2012-01-01

    Based on recent systematic studies of the genus Otatea, that included an extensive taxonomic investigation of herbaria specimens, and recent fieldwork in the Mexican state of Querétaro, a new Otatea species, O. ramirezii, is here described and illustrated. The new species is endemic to the Sierra Gorda in Querétaro, Mexico. It is compared with Otatea acuminata, O. carrilloi and O. glauca, from which it can be separated by the presence of only one (rarely two) branches per node, erect culm lea...

  3. Meiosis in elephant grass (Pennisetum purpureum, pearl millet (Pennisetum glaucum (Poaceae, Poales and their interspecific hybrids

    Directory of Open Access Journals (Sweden)

    Vânia Helena Techio

    2006-01-01

    Full Text Available The cultivated and sexually compatible species Pennisetum purpureum (elephant grass, 2n = 4x = 28 and Pennisetum glaucum (pearl millet, 2n = 2x = 14 can undergo hybridization which favors the amplification of their genetic background and the introgression of favorable alleles into breeding programs. The main problem with interspecific hybrids of these species is infertility due to triploidy (2n = 3x = 21. This study describes meiosis in elephant grass x pearl millet hybrids and their progenitors. Panicles were prepared according to the conventional protocol for meiotic studies and Alexander’s stain was used for assessing pollen viability. Pearl millet accessions presented regular meiosis with seven bivalents and high pollen viability. For elephant grass, 14 bivalents in diakinesis and metaphase I were observed. The BAG 63 elephant grass accession, derived from tissue culture, presented a high frequency of meiotic abnormalities. The three hybrid accessions presented a high frequency of abnormalities characterized by irregular chromosomal segregation which resulted in the formation of sterile pollen.

  4. Nota sobre el género Imperata (Poaceae, Panicoideae, Sacchareae) en Argentina

    OpenAIRE

    Peichoto, Myriam Carolina

    2017-01-01

    En este trabajo se confirma la presencia de Imperata tenuis en Argentina. Se presenta una ilustración, material de referencia y un mapa de su distribución geográfica en el sur de Sudamérica. Se incluye una clave para identificar las especies del género Imperata presentes en la Argentina. This work confirms the presence of Imperata tenuis in Argentina, and includes an illustration, reference material, a map showing its geographic distribution in southern South America, and a key to identi...

  5. Phylogeny and biogeography of North-American wild rice (Zizania L.Poaceae)

    Science.gov (United States)

    The wild-rice genus Zizania includes four species disjunctly distributed in eastern Asia and North America, with three species (Z. aquatica, Z. palustris, and Z. texana) in North America and one (Z. latifolia) in eastern Asia. The phylogeny and biogeography of Zizania were explored using sequences o...

  6. DNA barcoding of western North American taxa: Leymus (Poaceae) and Lepidium (Brassicaceae)

    Science.gov (United States)

    Catherine Mae Culumber

    2007-01-01

    My objective was to determine if polymorphic information from the 18S-5.8S-26S nuclear ribosomal DNA internal transcribed spacer regions and the trnK-psbA, trnK-rps16 chloroplast DNA spacer regions is sufficient 1) to identify a plant specimen to the species level, and 2) to establish the phylogenetic relationship between species. The first study examined the...

  7. Geographical distribution of present day Poaceae as evidence for the origin of African floras

    Directory of Open Access Journals (Sweden)

    W. D. Clayton

    1983-11-01

    Full Text Available The major tribes and sub-families of grasses occupy worldwide latitudinal belts, which can be related to an evolutionary sequence of climatic adaptations. However, genera tend to be confined to individual continents, suggesting that grasses do not easily cross the oceans, and that the worldwide distribution of the family may have been achieved when the continents were closer together. Species distributions are likewise strongly influenced by the effect of climatic adaptation and continental isolation, but they show a number of aberrations. These are probably a legacy of climatic disturbance during the Pleistocene.

  8. Phylogenetic relationships in the Festuca-Lolium complex (Loliinae; Poaceae: New insights from chloroplast sequences

    Directory of Open Access Journals (Sweden)

    Yajuan Cheng

    2016-07-01

    Full Text Available The species within the Lolium/Festuca grass complex have dispersed and colonized large areas of temperate global grasslands both naturally and by human intervention. The species within this grass complex represent some of the most important grass species both for amenity and agricultural use worldwide. There has been renewed interest by grass breeders in producing hybrid combinations between these species and several countries now market Festulolium varieties as a combination of genes from both genera. The two genera have been differentiated by their inflorescence structure, but controversy has surrounded the taxonomic classification of the Lolium-Festuca complex species for several decades. In order to better understand the complexities within the Lolium/Festuca complex and their genetic background, the phylogeny of important examplers from the Lolium-Festuca complex were reconstructed. In total 40 taxa representing the Festuca and Lolium species with Vulpia myuros and Brachypodium distachyon as outgroups were sampled, using two noncoding intergenic spacers (trnQ-rps16, trnH-psbA and one coding gene (rbcL. Maximum parsimony (MP, Bayesian inference (BI analyses based on each partition and combined plastid DNA dataset, and median-jointing network analysis were employed. The outcomes strongly suggested that the subgen. Schedonorus has a close relationship to Lolium, and it is also proposed to move the sect. Leucopoa from subgen. Leucopoa to Subgen. Schedonorus and to separate sect. Breviaristatae from the subgen. Leucopoa. We found that F. californica could be a lineage of hybrid origin because of its intermediate placement between the broad-leaved and fine-leaved clade.

  9. [Use of Leersia hexandra (Poaceae) for soil phytoremediation in soils contaminated with fresh and weathered oil].

    Science.gov (United States)

    Arias-Trinidad, Alfredo; Rivera-Cruz, María del Carmen; Roldán-Garrigós, Antonio; Aceves-Navarro, Lorenzo Armando; Quintero-Lizaola, Roberto; Hernández-Guzmán, Javier

    2017-03-01

    The oil industry has generated chronic oil spills and their accumulation in wetlands of the state of Tabasco, in Southeastern Mexico. Waterlogging is a factor that limits the use of remediation technologies because of its high cost and low levels of oil degradation. However, Leersia hexandra is a grass that grows in these contaminated areas with weathered oil. The aim of the study was to evaluate the bacteria density, plant biomass production and phytoremediation of L. hexandra in contaminated soil. For this, two experiments in plastic tunnel were performed with fresh (E1) and weathered petroleum (E2) under waterlogging experimental conditions. The E1 was based on eight doses: 6 000, 10 000, 30 000, 60 000, 90 000, 120 000, 150 000 and 180 000 mg.kg-1 dry basis (d. b.) of total petroleum hydrocarbons fresh (TPH-F), and the E2, that evaluated five doses: 14 173, 28 400, 50 598, 75 492 and 112 142 mg. kg-1 d. b. of total petroleum hydrocarbons weathered (TPH-W); a control treatment with 2 607 mg.kg-1 d. b. was used. Each experiment, with eight replicates per treatment, evaluated after three and six months: a) microbial density of total free-living nitrogen-fixing bacteria (NFB) of Azospirillum (AZP) and Azotobacter group (AZT), for viable count in serial plate; b) dry matter production (DMP), quantified gravimetrically as dry weight of L. hexandra; and c) the decontamination percentage of hydrocarbons (PDH) by Soxhlet extraction. In soil with TPH-F, the NFB, AZP y AZT populations were stimulated five times more than the control both at the three and six months; however, concentrations of 150 000 and 180 000 mg.kg-1 d. b. inhibited the bacterial density between 70 and 89 %. Likewise, in soil with TPH-W, the FNB, AZP and AZT inhibitions were 90 %, with the exception of the 14 173 mg.kg-1 d. b. treatment, which stimulated the NFB and AZT in 2 and 0.10 times more than the control, respectively. The DMP was continued at the six months in the experiments, with values of 63 and 89 g in fresh and weathered petroleum, respectively; had no significant differences with the control (p≤0.05). The PDH reached values of 66 to 87 % both TPH-F and TPH-W at six months, respectively. These results demonstrated the ability the L. hexandra rhizosphere to stimulate the high NFB density, vegetal biomass production and phytoremediation of contaminated soils (with fresh and weathered petroleum), in a tropical waterlogging environment.

  10. From schedonorus and micropyropsis to lolium (Poaceae: Loliinae): New combinations and typifications

    Czech Academy of Sciences Publication Activity Database

    Banfi, E.; Galasso, G.; Foggi, B.; Kopecký, David; Ardenghi, N.M.G.

    2017-01-01

    Roč. 66, č. 3 (2017), s. 708-717 ISSN 0040-0262 Institutional support: RVO:61389030 Keywords : Epitypification * Fescues * Grasses * Lectotypification * Nomenclature * Nothospecies * Taxonomy Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.447, year: 2016

  11. Seasonal responses of six Poaceae to differential levels of solar UV-B radiation

    International Nuclear Information System (INIS)

    Deckmyn, G.; Impens, I.

    1999-01-01

    The effects of changes in solar UV-B on the growth and pigmentation of six grass species from cold-temperate grasslands (Lolium perenne, Lolium multiflorum, Festuca arundinacea, Festuca rubra, Phleum pratense and Dactylis glomerata) in spring and summer were studied. The grasses were grown in greenhouses with different foils, resulting in three treatments: no UV-B, 80% of ambient and 90% of ambient UV-BBE (biologically effective UV-B). The results indicated important effects of ambient UV-B levels on grass, but the different species reacted in very different ways. Both morphology and biomass production were influenced by UV-B in some species. However, changes in biomass production did not necessarily occur within the same species as changes in morphology. The grasses were more sensitive in summer. Overall, only F. rubra was positively influenced by UV-B under all circumstances. The biomass of D. glomerata and L. perenne was reduced by UV-B in spring and summer. Morphological changes included reduced height and increased tillering. The sensitivity of the different species was partially explained by their ability to reduce their specific leaf area in response to UV-B. Only the more sensitive species showed increased production of protective pigments. Overall, there were important differences between the effect of a low level of UV-B, and the further increase in UV-B, indicating that several mechanisms are operating at different light levels. (author)

  12. Multiple homoplasious insertions and deletions of a Triticeae (Poaceae DNA transposon: a phylogenetic perspective

    Directory of Open Access Journals (Sweden)

    Mason-Gamer Roberta J

    2007-06-01

    Full Text Available Abstract Background Stowaway elements are short, non-autonomous DNA transposons categorized as miniature inverted-repeat transposable elements (MITEs. The high MITE copy number in grass genomes suggests an active history of amplification and insertion, but ongoing MITE activity has only rarely been seen, and ongoing Stowaway activity has never been observed. Thus, a phylogenetic perspective on presence vs. absence of elements in an aligned data set can provide valuable historical insights into the dynamics of MITE acquisition and loss. Results A Stowaway-like element resides within the fourth intron of a β-amylase gene in representatives of five genera in the wheat tribe, Triticeae. Its presence vs. absence was examined with reference to the β-amylase gene tree topology, and in light of sequence comparisons of the β-amylase elements to Triticeae Stowaway elements in the Entrez nucleotide database. Among the sequences lacking the element, there are five distinct putative excision footprints (one widespread and four restricted to unrelated lineages and two flanking deletions. The sequences that do contain elements are polyphyletic on the β-amylase tree, and their elements are divergent at the sequence level. The β-amylase elements do not form a monophyletic group relative to other Stowaway elements in Entrez; most are more similar to elements from other loci in other Triticeae genomes than they are to one another. Conclusion Combined, the phylogenetic distribution, sequence variation, and Entrez database comparisons indicate that a Stowaway-like element has undergone multiple deletions from and insertions into the same site in β-amylase intron 4 during the history of the tribe. The elements currently at the site represent multiple, distinct lineages that transcend generic boundaries. While patterns of Stowaway polymorphism across a phylogenetic data set do not allow evolutionary mechanisms to be inferred with certainty, they do provide insights into the dynamics of element evolution over an extended time scale. The historical perspective provided by a phylogenetic approach is complementary to the few studies in which ongoing MITE activity has been documented.

  13. Mechanisms of Oryza sativa (Poaceae resistance to Tagosodes orizicolus (Homoptera: Delphacidae under greenhouse condition in Venezuela

    Directory of Open Access Journals (Sweden)

    Alex González

    2012-03-01

    Full Text Available Tagosodes orizicolus is one of the main plagues of rice in tropical America causing two types of damages, the direct one, feeding and oviposition effect, and an indirect one, by the transmission of the “Rice hoja blanca virus”. During 2006-2007 we carried out research under greenhouse conditions at Fundación Danac, Venezuela, in order to determine the mechanisms of antixenosis, antibiosis and tolerance to T. orizicolus, which could be acting in commercial varieties and advanced lines of the rice genetic breeding programs of INIA and Fundación Danac. The method of free feeding was used for the antixenosis evaluation, whereas the method of forced feeding was used for antibiosis evaluation (effect on survival and oviposition. Additionally, we used the indirect method based on biomass depression to estimate the tolerance. Some of the evaluated traits included: grade of damage, number of insects settling on rice plants, percentage of sogata mortality at the mature state, number of eggs in the leaf midrib and an index of tolerance. The results showed that rice genotypes possess different combinations of resistance mechanisms, as well as different grades of reactions. The susceptible control ‘Bluebonnet 50’ was consistently susceptible across experiments and the resistant control ‘Makalioka’ had high antixenosis and high antibiosis based on survival and oviposition. The rest of the genotypes presented lower or higher degrees of antixenosis and antibiosis for survival and viposition. The genotype ‘FD0241-M-17-6-1-1-1-1’ was identified with possible tolerance to the direct damage of sogata.Tagosodes orizicolus es una de las principales plagas del cultivo del arroz en América tropical causando dos tipos de daños a la planta, el directo, por efecto de la alimentación y oviposición; el indirecto, por la transmisión del virus de la hoja blanca del arroz. Durante el período 2006-2007 se llevó a cabo una investigación bajo condiciones de umbráculo en la Fundación Danac, Venezuela, con el objeto de determinar los mecanismos de resistencia de antixenosis, antibiosis y tolerancia a T. orizicolus que pudieran estar actuando en líneas avanzadas y cultivares del programa de mejoramiento enético de arroz de las instituciones INIA y Fundación Danac. Para la evaluación de antixenosis se utilizó el método de libre elección, para antibiosis (efecto sobre sobrevivencia y oviposición de los insectos el de alimentación forzada, adicionalmente se usó un método indirecto para estimar la tolerancia. Dentro de los principales parámetros determinados se encontraban: grado de daño, número de insectos posados sobre plantas de arroz, porcentaje de mortalidad de sogata en estado adulto, número de huevos y se calculó un índice de tolerancia con base en la biomasa. Los resultados mostraron que los genotipos de arroz evaluados poseen diferentes combinaciones en cuanto a los mecanismos de resistencia, así como el grado de su efecto. El testigo ‘Bluebonnet 50’ se mantuvo consistentemente susceptible en las evaluaciones y el testigo resistente ‘Makalioka’ fue el único genotipo que presentó alta antixenosis y alta antibiosis para sobrevivencia y oviposición. El resto de los genotipos presentaron un menor o mayor grado de resistencia de tipo antixenosis y antibiosis para sobrevivencia y oviposición. Se identificó el genotipo ‘FD0241-M-17-6-1-1-1-1’ con posible tolerancia al daño directo de sogata.

  14. Effect of some adjuvants application on enhancing sulfosulfuron herbicide performance on Phalaris minor- Poaceae

    Directory of Open Access Journals (Sweden)

    Mohammad Mehdizadeh

    2015-02-01

    Full Text Available Nowadays environmental pollution by pesticides application is a major concern for health. Efficiency of many herbicides can be increased by adding adjuvants to the spray solution. Therefore greenhouse study was conducted during 2014 to determine the efficacy of three adjuvants (Citogate, Castor oil and Canola oil at concentrations of 0.1 and 0.2 (%v/v with 5, 10, 20, 30 and 40 g a.i\\ha of sulfosulfuron herbicide on littleseed canary grass. Results showed that the adjuvants enhanced the efficacy of sulfosulfuron in decreasing the dry weights of littleseed canary grass. Performance of herbicide was increased with enhancing its concentrations. Measured ED50 and ED90 concentrations of sulfosulfuron in control were 16.74 and 32.22 g a.i\\ha, respectively. Whereas the values for Citogate 0.2 (%v\\v, was 5.86 and 13.34 g a.i\\ha, respectively. The addition of Citogate and Castor oil had the highest and lowest effect on sulfosulfuron efficacy against Littleseed canary grass. In conclusion, the study revealed that Citogate concentrations had powerful effects on herbicide efficacy followed by Canola oil.

  15. Taxonomy and leaf anatomy of the genus Ehrharta (Poaceae in southern Africa: the Dura group

    Directory of Open Access Journals (Sweden)

    G. E. Gibbs Russel

    1988-10-01

    Full Text Available The Dura species group in the genus Ehrharta Thunb. is differentiated morphologically by the perennial habit and the very large, awned, subglabrous spikelets and anatomically by the occurrence of tanniniferous cells and wax platelets obscuring the stomatal pores. The Dura group consists of two species, E. dura Nees ex Trin. and E. microlaena Nees ex Trin., which occur only in Mountain Fynbos. The group shows no clear morphological or anatomical relationship with other species groups in the genus in southern Africa.

  16. Recent natural hybridization between two allopolyploid wheatgrasses (Elytrigia, Poaceae): Ecological and evolutionary implications

    Czech Academy of Sciences Publication Activity Database

    Mahelka, Václav; Fehrer, Judith; Krahulec, František; Jarolímová, Vlasta

    2007-01-01

    Roč. 100, - (2007), s. 249-260 ISSN 0305-7364 R&D Projects: GA ČR GA206/05/0778; GA ČR(CZ) GD206/03/H137 Institutional research plan: CEZ:AV0Z60050516 Keywords : Triticeae * polyploidy * gene flow Subject RIV: EF - Botanics Impact factor: 2.939, year: 2007

  17. Diversification of C(4) grasses (Poaceae) does not coincide with their ecological dominance.

    Science.gov (United States)

    Bouchenak-Khelladi, Yanis; Slingsby, Jasper A; Verboom, G Anthony; Bond, William J

    2014-02-01

    The radiation of a lineage and its rise to ecological dominance are distinct phenomena and driven by different processes. For example, paleoecological data has been used to show that the Cretaceous angiosperm radiation did not coincide with their rise to dominance. Using a phylogenetic approach, we here explored the evolution of C4 grasses and evaluated whether the diversification of this group and its rise to ecological dominance in the late Miocene were decoupled. We assembled a matrix including 675 grass species of the PACMAD clade and 2784 characters (ITS and ndhF) to run a molecular dating analysis using three fossils as reference calibrations. We coded species as C3 vs. C4 and reconstructed ancestral states under maximum likelihood. We used the program BiSSE to test whether rates of diversification are correlated with photosynthetic pathway and whether the radiation of C4 lineages preceded or coincided with their rise to ecological dominance from ∼10 Ma. C4 grass lineages first originated around 35 Ma at the time of the Eocene-Oligocene transition. Accelerated diversification of C4 lineages did not coincide with their rise to ecological dominance. C4-dominated grasslands have expanded only since the Late Miocene and Pliocene. The initial diversification of their biotic elements can be tracked back as far as the Eocene-Oligocene transition. We suggest that shifts in taxonomic diversification and ecological dominance were stimulated by different factors, as in the case of the early angiosperms in the Cretaceous.

  18. Genetic improvement and diversity in Snake River wheatgrass (Elymus wawawaiensis) (Poaceae: Triticeae)

    Science.gov (United States)

    With the increased emphasis to use native plant materials in range revegetation programs in the western US, it is critical to develop native grasses that are competitive with invasive weeds, easy to establish, persistent, and produce high seed yield. One such native grass species with appreciable d...

  19. Karyotype characterization and comparison of three hexaploid species of Bromus Linnaeus, 1753 (Poaceae

    Directory of Open Access Journals (Sweden)

    Leonardo Luís Artico

    2017-04-01

    Full Text Available Chromosome morphometry and nuclear DNA content are useful data for cytotaxonomy and to understand the evolutionary history of different taxa. For the genus Bromus Linnaeus, 1753, distinct ploidy levels have been reported, occurring from diploid to duodecaploid species. The geographic distribution of Bromus species has been correlated with chromosome number and ploidy level. In this study, the aims were to determine the nuclear genome size and characterize the karyotype of the South American Bromus species: Bromus auleticus Trinius ex Nees, 1829, Bromus brachyanthera Döll, 1878 and Bromus catharticus Vahl, 1791. The mean nuclear 2C value ranged from 2C = 12.64 pg for B. catharticus to 2C = 17.92 pg for B. auleticus, meaning a maximum variation of 2C = 5.28 pg, equivalent to 41.70%. Despite this significant difference in 2C value, the three species exhibit the same chromosome number, 2n = 6x = 42, which confirms their hexaploid origin. Corroborating the genome size, the chromosome morphometry (total, short- and long-arm length and, consequently, the class differed among the karyotypes of the species. Based on the first karyograms for these Bromus species, some morphologically similar and several distinct chromosome pairs were found. Therefore, the karyotype characterization confirmed the hexaploid origin of the studied Bromus species, which differ in relation to the karyogram and the nuclear 2C value. Considering this, cytogenetics and flow cytometry can be used to discriminate Bromus species, contributing to taxonomy and systematic studies and providing information on the evolutionary history of this taxa.

  20. Karyotype characterization and comparison of three hexaploid species of Bromus Linnaeus, 1753 (Poaceae).

    Science.gov (United States)

    Artico, Leonardo Luís; Mazzocato, Ana Cristina; Ferreira, Juliano Lino; Carvalho, Carlos Roberto; Clarindo, Wellington Ronildo

    2017-01-01

    Chromosome morphometry and nuclear DNA content are useful data for cytotaxonomy and to understand the evolutionary history of different taxa. For the genus Bromus Linnaeus, 1753, distinct ploidy levels have been reported, occurring from diploid to duodecaploid species. The geographic distribution of Bromus species has been correlated with chromosome number and ploidy level. In this study, the aims were to determine the nuclear genome size and characterize the karyotype of the South American Bromus species: Bromus auleticus Trinius ex Nees, 1829, Bromus brachyanthera Döll, 1878 and Bromus catharticus Vahl, 1791. The mean nuclear 2C value ranged from 2C = 12.64 pg for B. catharticus to 2C = 17.92 pg for B. auleticus , meaning a maximum variation of 2C = 5.28 pg, equivalent to 41.70%. Despite this significant difference in 2C value, the three species exhibit the same chromosome number, 2n = 6x = 42, which confirms their hexaploid origin. Corroborating the genome size, the chromosome morphometry (total, short- and long-arm length) and, consequently, the class differed among the karyotypes of the species. Based on the first karyograms for these Bromus species, some morphologically similar and several distinct chromosome pairs were found. Therefore, the karyotype characterization confirmed the hexaploid origin of the studied Bromus species, which differ in relation to the karyogram and the nuclear 2C value. Considering this, cytogenetics and flow cytometry can be used to discriminate Bromus species, contributing to taxonomy and systematic studies and providing information on the evolutionary history of this taxa.

  1. Grass pollen (Poaceae in the air of Sosnowiec (Poland, 1997 - 2006

    Directory of Open Access Journals (Sweden)

    Kazimiera Chłopek

    2012-12-01

    Full Text Available The article presents the analysis results of the grass pollen seasons from 1997 to 2006 in Sosnowiec. The research was carried out by means of the volumetric method with the use of a Burkard device. The duration of the pollen seasons was determined by means of the 98% method. The influence of meteorological conditions on the starting date and duration of the grass pollen seasons has been estimated in the article. The beginning of the pollen seasons was recorded between 23 April and 23 May. It has been demonstrated that the average duration of the pollen season amounted to 138 days. The period of maximum concentrations was recorded in June and the first half of July. The highest daily concentration was found in 2000 (495 grains in m3 and the highest annual sums in 2002 and 2000. The daily concentration distribution curve has shown three peaks. The highest values were recorded from 7 am until 11 am, from 13 pm until 17 pm and from 19 pm until 21 pm. It has been found that there is a significant influence of weather conditions (temperature, precipitation and relative humidity on the beginning and duration of the pollen seasons and the period of maximum concentrations.

  2. Chromosomal organization of repetitive DNAs in Hordeum bogdanii and H. brevisubulatum (Poaceae

    Directory of Open Access Journals (Sweden)

    Quanwen Dou

    2016-10-01

    Full Text Available Molecular karyotypes of H. bogdanii Wilensky, 1918 (2n = 14, and H. brevisubulatum Link, 1844 ssp. brevisubulatum (2n = 28, were characterized by physical mapping of several repetitive sequences. A total of 18 repeats, including all possible di- or trinucleotide SSR (simple sequence repeat motifs and satellite DNAs, such as pAs1, 5S rDNA, 45S rDNA, and pSc119.2, were used as probes for fluorescence in situ hybridization on root-tip metaphase chromosomes. Except for the SSR motifs AG, AT and GC, all the repeats we examined produced detectable hybridization signals on chromosomes of both species. A detailed molecular karyotype of the I genome of H. bogdanii is described for the first time, and each repetitive sequence is physically mapped. A high degree of chromosome variation, including aneuploidy and structural changes, was observed in H. brevisubulatum. Although the distribution of repeats in the chromosomes of H. brevisubulatum is different from that of H. bogdanii, similar patterns between the two species imply that the autopolyploid origin of H. brevisubulatum is from a Hordeum species with an I genome. A comparison of the I genome and the other Hordeum genomes, H, Xa and Xu, shows that colocalization of motifs AAC, ACT and CAT and colocalization of motifs AAG and AGG are characteristic of the I genome. In addition, we discuss the evolutionary significance of repeats in the genome during genome differentiation.

  3. Muhlenbergia monandra (Poaceae: Eragrostideae, nueva especie anual endémica del Perú

    Directory of Open Access Journals (Sweden)

    J. José Alegría Olivera

    2001-01-01

    Full Text Available Se describe e ilustra Muhlenbergia monandra, endémica de Perú. La nueva especie se caracteriza por sus glumas mayores que el antecio, por tener inflorescencias espiciformes y las flores cleistógamas con un estambre. La anatomía foliar se describe e ilustra y se detallan sus caracteres diferenciales. Se incluyen observaciones sobre la epidermis de la lemma y las glumas realizadas con el Microscopio Electrónico de Barrido. Se discute la posición taxonómica de la nueva entidad y las diferencias con las especies anuales relacionadas que habitan en América del Sur

  4. Una nueva especie de Axonopus (Poaceae: Panicoideae: Paniceae de la Guyana de Colombia y Venezuela

    Directory of Open Access Journals (Sweden)

    Giraldo Cañas Diego

    1999-11-01

    Full Text Available Axonopus piccae, a new species of the series Barbigeri G. A. Black, is described and illustrated. The new species is known only from two areas of Guayana Region: Guainía (Colombia and Bolívar (Venezuela. Its inflorescence is polytelic and truncate.Based on SEM microphotographs, the characters of its upper anthecium are presented. Its morphological and anatomical relationships are discussed, and a key to the nearest species is provided.Se describe e ilustra Axonopus piccae, una nueva especie perteneciente a la serie Barbigeri G. A. Black, conocida únicamente de dos áreas de la región Guayana en Guainía (Colombia y Bolívar (Venezuela. Su inflorescencia es politélica y truncada. Se comentan las características de su antecio superior sobre la base de microfotografías al microscopio electrónico de barrido. Se discuten sus relaciones morfológicas y anatómicas. Se presenta una clave para separar las especies afines.

  5. Higher level phylogenetic relationships within the bamboos (Poaceae: Bambusoideae) based on five plastid markers.

    Science.gov (United States)

    Kelchner, Scot A

    2013-05-01

    Bamboos are large perennial grasses of temperate and tropical forests worldwide. Two general growth forms exist: the economically and ecologically important woody bamboos (tribes Arundinarieae and Bambuseae), and the understory herbaceous bamboos (tribe Olyreae). Evolutionary relationships among the 1400+described species have been difficult to resolve with confidence. Comparative analysis of bamboo plastid (chloroplast) DNA has revealed three to five major lineages that show distinct biogeographic distributions. Taxon sampling across tribes and subtribes has been incomplete and most published data sets include a relatively small number of nucleotide characters. Branching order among lineages is often poorly supported, and in more than one study herbaceous bamboos form a clade within the woody bamboos. In this paper, the Bamboo Phylogeny Group presents the most complete phylogeny estimation to date of bamboo tribes and subtribes using 6.7 kb of coding and noncoding sequence data and 37 microstructural characters from the chloroplast genome. Quality of data is assessed, as is the possibility of long branch attraction, the degree of character conflict at key nodes in the tree, and the legitimacy of three alternative hypotheses of relationship. Four major plastid lineages are recognized: temperate woody, paleotropical woody, neotropical woody, and herbaceous bamboos. Woody bamboos are resolved as paraphyletic with respect to Olyreae but SH tests cannot reject monophyly of woody species (Arundinarieae+Bambuseae). Published by Elsevier Inc.

  6. Airborne grass (Poaceae) pollen in southern Spain. Results of a 10-year study (1987-96).

    Science.gov (United States)

    González Minero, F J; Candau, P; Tomás, C; Morales, J

    1998-03-01

    This work reports an exhaustive study of the aerobiology of the Gramineae in Seville, Spain, which is typical of coastal Mediterranean areas. Sampling was done with a Cour trap installed on the roof terrace of the School of Pharmacy, Seville, from 1987 to 1996, both inclusive. The climatic pattern of that period was characterized by two exceptionally wet years (1989 and 1996), between which were 5 consecutive years of drought (1990-5). This typically Mediterranean climate affects grass aerobiology. The annual amounts of total grass pollen are low, never exceeding 2500 grains/m3. The start, length, and intensity of the pollen season are significantly correlated with preseasonal meteorologic factors (precipitation and temperature), but intraseasonal meteorologic conditions have no effect on the three variables. The relationships are stated by three equations that, while further years of observations are anticipated, can be considered models to forecast the characteristics of the pollen season: the starting date depends on the mean temperatures of January and February, and the length and intensity of the season depend on the rainfall between the beginning of January and the starting date of the season. For the study period, the weekly concentrations (pollen curves) throughout the year showed no typical pattern of variation over the years, so that it was impossible to make mid- and long-term forecasts of the variation in weekly concentration. The most noteworthy aspects of grass pollen curves are a long pollen season, which starts in February or March and lasts until September or October; peaks of higher concentration (> 100 grains/m3) in May and June, associated with increases in temperature and absence of precipitation; and other peaks in the summer months that may be as high as the spring peaks.

  7. Intergeneric hybridization and C-banding patterns in Hordelymus (Triticeae, Poaceae)

    DEFF Research Database (Denmark)

    Bothmer, R. von; Lu, B.-R.; Linde-Laursen, I.

    1994-01-01

    Crosses of Hordelymus europaeus (2n = 4x = 28) with four genera in the Triticeae were attempted. Adult hybrids were obtained in combinations with Hordeum bogdanii (2x), Hordeum depressum (4x), and Secale cereale (2x). The meiotic pairing was very low in the hybrids with H. bogdanii and Secale...... cereale (0.12 and 0.30 chiasmata/cell, respectively), whereas high pairing (9.90 chiasmata/cell) was found in hybrids with H. depressum due to autosyndetic pairing of H. depressum chromosomes. The chromosome complement of Hordelymus europaeus comprised 16 metacentrics, 8 submetacentrics, and 4 SAT...

  8. Hybridization between invasive Spartina Densiflora (Poaceae) and native S. Foliosa in San Francisco Bay, California, USA

    Science.gov (United States)

    Rapid evolution in contemporary time can result when related species, brought together through human-aided introduction, hybridize. The evolutionary consequences of post introduction hybridization range from allopolyploid speciation to extinction of species through genetic amalg...

  9. Dated historical biogeography of the temperate Loliinae (Poaceae, Pooideae) grasses in the northern and southern hemispheres.

    Science.gov (United States)

    Inda, Luis A; Segarra-Moragues, José Gabriel; Müller, Jochen; Peterson, Paul M; Catalán, Pilar

    2008-03-01

    Divergence times and biogeographical analyses have been conducted within the Loliinae, one of the largest subtribes of temperate grasses. New sequence data from representatives of the almost unexplored New World, New Zealand, and Eastern Asian centres were added to those of the panMediterranean region and used to reconstruct the phylogeny of the group and to calculate the times of lineage-splitting using Bayesian approaches. The traditional separation between broad-leaved and fine-leaved Festuca species was still maintained, though several new broad-leaved lineages fell within the fine-leaved clade or were placed in an unsupported intermediate position. A strong biogeographical signal was detected for several Asian-American, American, Neozeylandic, and Macaronesian clades with different affinities to both the broad and the fine-leaved Festuca. Bayesian estimates of divergence and dispersal-vicariance analyses indicate that the broad-leaved and fine-leaved Loliinae likely originated in the Miocene (13My) in the panMediterranean-SW Asian region and then expanded towards C and E Asia from where they colonized the New World. Further expansions in America (10-3.8My) showed a predominant migratory route from North to South (N Americathe AndesPatagonia). This late Tertiary scenario of successive colonizations and secondary polyploid radiations in the southern hemisphere from the northern hemisphere was accompanied by occasional transcontinental long-distance dispersal events between South America and New Zealand. Multiple Pliocene dispersal events (3.6-2.5My) from the near SW European and NW African continents gave rise to the Macaronesian Loliinae flora, while a more recent Pleistocene origin (2-1My) is hypothesized for the high polyploid lineages that successfully colonized newly deglaciated areas in both hemispheres.

  10. Cytogenetic relationships within the Maghrebian clade of Festuca subgen. Schedonorus (Poaceae), using flow cytometry and FISH

    Czech Academy of Sciences Publication Activity Database

    Ezquerro-López, D.; Kopecký, David; Inda, L. A.

    2017-01-01

    Roč. 74, č. 1 (2017), č. článku e052. ISSN 0211-1322 Institutional support: RVO:61389030 Keywords : Broad-leaved fescues * Festuca subgen. Schedonorus * fish * Genome size * rdna Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 0.385, year: 2016

  11. Ultrastructure and histology of organogenesis induced from shoot tips of maize (Zea mays, Poaceae

    Directory of Open Access Journals (Sweden)

    Walter Marín-Méndez

    2009-11-01

    Full Text Available Shoot tips of maize (Zea mays L. were cultured on Murashige and Skoog medium supplemented with 2 mg/l BA +1 mg/l 2,4-D +40 mg/l, to investigate phases of ontogenetic development. The study used light microscopy as well as scanning and transmission electronic microscopy techniques. Shoot tips of maize are composed of small cells with a dense cytoplasm and a prominent nucleus. The process of organogenesis began with swelling of the shoot tip, as the first evidence of organogenic calli formation observed three weeks after culture get started. There were two morphologically different types of cells within the organogenic calli. The layer consisted of large cells with small nucleus, free-organelle cytosol, irregular plasmatic membrane, trichome-like structures, and thick cell walls. In the inner cell layer, small and isodiametric cells with a prominent nucleus, small vacuoles, endoplasmatic reticulum, Golgi, mitochondrias and chloroplasts were observed. The presence of trichomes in the more active morphogenic zones could indicate an organogenic potential. Rev. Biol. Trop. 57 (Suppl. 1: 129-139. Epub 2009 November 30.Los ápices de vástagos de maíz (Zea mays L. fueron cultivados con el medio Murashige y Skoog, utilizando como suplemento 2 mg/l BA +1 mg/l 2,4-D +40 mg/l, con el fin de investigar el proceso organogénico durante las diferentes fases del desarrollo ontogenético. El estudio utilizó tanto microscopía de luz, como técnicas de microscopía electrónica. Los análisis histológicos revelaron que los vástagos de maíz están compuestos de pequeñas células con citoplasma denso y núcleo prominente. El proceso de organogénesis inicia con el engrosamiento del ápice del vástago, como primera evidencia de la formación organogénica del calli observada tres semanas después del inicio del cultivo. El estudio ultraestructural muestra dos tipos de células morfológicamente diferentes en el calli organogénico. La capa externa consiste de células grandes con núcleo pequeño, citosol sin organelas, membrana plamática irregular, estructuras similares a tricomas y paredes celulares delgadas. Mientras que en la capa interna se observaron células pequeñas e isodiamétricas con un núcleo prominente, vacuolas pequeñas, retículo endoplasmático, Golgi, mitocondrias y cloroplastos. Observaciones de microscopía electrónica revelan la organización externa de la organogénesis del calli del maíz. Los resultados obtenidos en el presente estudio contribuyen con la comprensión del proceso de organogénesis en los ápices de los vástagos del maíz. Este estudio mejorará nuestro conocimiento acerca de los estados anatómicos óptimos para la integración estable de genes externos. Además, provee información de las condiciones apropiadas en el cultivo in vitro para la regeneración de plantas transgénicas. Este estudio sugiere que la presencia de tricomas en las zonas morfogénicas más activas podría indicar su potencial organogénico.

  12. A phylogenetic analysis of the monogenomic Triticeae (Poaceae) based on morphology

    DEFF Research Database (Denmark)

    Seberg, Ole; Frederiksen, Signe Elisabeth

    2001-01-01

    not traditionally included in Aegilops s.J. Most of the 33 characters used in the analysis are coded as binary. The only four multistate characters in the matrix are treated as unordered. Three diploid species of Bromus are used as outgroup. The number of equally parsimonious trees found is very large (approx....... 170000; length = 107, ci = 0.36, ri = 0.75) and the strict consensus tree has an expectedly low level of resolution. However, most of the equally parsimonious trees owe their existence to an unresolved Aegilops clade. If this clade is replaced by its hypothetical ancestor, the number of equally...... parsimonious trees drops dramatically (48; length = 78, ci = 0.45, ri = 0.76). When trees for which more highly resolved compatible trees exist are excluded, only two trees remain. Bremer support is used as a measure of branch support. The trees based on morphology and on molecular data are largely incongruent....

  13. Mechanisms of Oryza sativa (Poaceae) resistance to Tagosodes orizicolus (Homoptera: Delphacidae) under greenhouse condition in Venezuela.

    Science.gov (United States)

    González, Alex; Labrín, Natalia; Alvarez, Rosa M; Jayaro, Yorman; Gamboa, Carlos; Reyes, Edicta; Barrientos, Venancio

    2012-03-01

    Tagosodes orizicolus is one of the main plagues of rice in tropical America causing two types of damages, the direct one, feeding and oviposition effect, and an indirect one, by the transmission of the "Rice hoja blanca virus". During 2006-2007 we carried out research under greenhouse conditions at Fundaci6n Danac, Venezuela, in order to determine the mechanisms of antixenosis, antibiosis and tolerance to T. orizicolus, which could be acting in commercial varieties and advanced lines of the rice genetic breeding programs of INIA and Fundaci6n Danac. The method of free feeding was used for the antixenosis evaluation, whereas the method of forced feeding was used for antibiosis evaluation (effect on survival and oviposition). Additionally, we used the indirect method based on biomass depression to estimate the tolerance. Some of the evaluated traits included: grade of damage, number of insects settling on rice plants, percentage of sogata mortality at the mature state, number of eggs in the leaf midrib and an index of tolerance. The results showed that rice genotypes possess different combinations of resistance mechanisms, as well as different grades of reactions. The susceptible control 'Bluebonnet 50' was consistently susceptible across experiments and the resistant control 'Makalioka' had high antixenosis and high antibiosis based on survival and oviposition. The rest of the genotypes presented lower or higher degrees of antixenosis and antibiosis for survival and oviposition. The genotype 'FD0241-M-17-6-1-1-1-1' was identified with possible tolerance to the direct damage of sogata.

  14. Chromosome number, microsporogenesis, microgametogenesis, and pollen viability in the Brazilian native grass Mesosetum chaseae (Poaceae).

    Science.gov (United States)

    Silva, L A C; Pagliarini, M S; Santos, S A; Silva, N; Souza, V F

    2012-11-28

    The genus Mesosetum is a primarily South American genus with 42 species. Mesosetum chaseae, regionally known as 'grama-do-cerrado', is abundant in the Pantanal Matogrossense (Brazil); it is a valuable resource for livestock and for environmental conservation. We collected specimens from the Nhecolandia sub-region of the Brazilian Pantanal, located in Corumbá, Mato Grosso do Sul, Brazil. We examined chromosome number, ploidy level, meiotic behavior, microgametogenesis, and pollen viability of 10 accessions. All the accessions were diploid, derived from x = 8, presenting 2n = 2x = 16 chromosomes. Chromosomes paired as bivalents showing, predominantly, two terminal chiasmata. Interstitial chiasmata were rare. Meiosis was quite normal producing only a few abnormal tetrads in some accessions. Microgametogenesis, after two mitotic divisions, produced three-celled pollen grains. Pollen viability was variable among plant and accessions and was not correlated with meiotic abnormalities.

  15. Meiosis in elephant grass (Pennisetum purpureum), pearl millet (Pennisetum glaucum) (Poaceae, Poales) and their interspecific hybrids

    OpenAIRE

    Techio, Vânia Helena; Davide, Lisete Chamma; Pereira, Antônio Vander

    2006-01-01

    The cultivated and sexually compatible species Pennisetum purpureum (elephant grass, 2n = 4x = 28) and Pennisetum glaucum (pearl millet, 2n = 2x = 14) can undergo hybridization which favors the amplification of their genetic background and the introgression of favorable alleles into breeding programs. The main problem with interspecific hybrids of these species is infertility due to triploidy (2n = 3x = 21). This study describes meiosis in elephant grass x pearl millet hybrids and their proge...

  16. Variation in sequences containing microsatellite motifs in the perennial biomass and forage grass, Phalaris arundinacea (Poaceae).

    Science.gov (United States)

    Barth, Susanne; Jankowska, Marta Jolanta; Hodkinson, Trevor Roland; Vellani, Tia; Klaas, Manfred

    2016-03-22

    Forty three microsatellite markers were developed for further genetic characterisation of a forage and biomass grass crop, for which genomic resources are currently scarce. The microsatellite markers were developed from a normalized EST-SSR library. All of the 43 markers gave a clear banding pattern on 3% Metaphor agarose gels. Eight selected SSR markers were tested in detail for polymorphism across eleven DNA samples of large geographic distribution across Europe. The new set of 43 SSR markers will help future research to characterise the genetic structure and diversity of Phalaris arundinacea, with a potential to further understand its invasive character in North American wetlands, as well as aid in breeding work for desired biomass and forage traits. P. arundinacea is particularly valued in the northern latitude as a crop with high biomass potential, even more so on marginal lands.

  17. Development of 12 genic microsatellite loci for a biofuel grass, Miscanthus sinensis (Poaceae).

    Science.gov (United States)

    Ho, Chuan-Wen; Wu, Tai-Han; Hsu, Tsai-Wen; Huang, Jao-Ching; Huang, Chi-Chun; Chiang, Tzen-Yuh

    2011-08-01

    Miscanthus, a nonfood plant with high potential as a biofuel, has been used in Europe and the United States. The selection of a cultivar with high biomass, photosynthetic efficiency, and stress resistance from wild populations has become an important issue. New genic microsatellite markers will aid the assessment of genetic diversity for different strains. Twelve polymorphic microsatellite markers derived from the transcriptome of Miscanthus sinensis fo. glaber were identified and screened on 80 individuals of M. sinensis. The number of alleles per locus ranged from 6 to 12, and the mean expected heterozygosity was 0.75. Cross-taxa transferability revealed that all loci can be applied to all varieties of M. sinensis, as well as the closely related species M. floridulus. These new genic microsatellite markers are useful for characterizing different traits in breeding programs or to select genes useful for biofuel.

  18. Reproductive biology of the native forage grass Trichloris crinita (Poaceae, Chloridoideae).

    Science.gov (United States)

    Kozub, P C; Barboza, K; Galdeano, F; Quarin, C L; Cavagnaro, J B; Cavagnaro, P F

    2017-05-01

    Trichloris crinita is a perennial forage grass species native to arid regions of the American continent. Due to its extensive area of distribution, good forage quality and resistance to drought and grazing, this species is widely utilised as forage and for revegetation purposes in environments with low water availability. Despite its importance, genetic improvement of T. crinita has been very limited, partly as consequence of the lack of knowledge on its mode of reproduction. In the present work, we studied the reproductive biology of T. crinita by means of embryological analyses, flow cytometric seed screen (FCSS), self-compatibility tests and progeny testing with morphological and molecular markers. Cytological analyses revealed embryo sacs with eight nuclei and of Polygonum type for all T. crinita accessions analysed. FCSS histograms exhibited two clear peaks corresponding to 2C and 3C DNA content, indicating embryo sacs of sexual origin. Controlled pollination experiments designed to evaluate seed set (%) demonstrated that T. crinita is self-compatible, whereas results from morphological and simple sequence repeat (SSR) marker analysis of progeny revealed lack of outcrossing. Together, these results indicate that T. crinita reproduces sexually. It is a self-compatible and autogamous species. It is expected that these data will have a positive impact in the genetics and breeding of this species, and therefore contribute to its proper utilisation in arid regions. © 2017 German Botanical Society and The Royal Botanical Society of the Netherlands.

  19. Microsatellite markers for the native Texas perennial grass, Panicum hallii (Poaceae).

    Science.gov (United States)

    Lowry, David B; Purmal, Colin T; Meyer, Eli; Juenger, Thomas E

    2012-03-01

    We developed microsatellites for Panicum hallii for studies of gene flow, population structure, breeding experiments, and genetic mapping. Next-generation (454) genomic sequence data were used to design markers. Eighteen robust markers were discovered, 15 of which were polymorphic across six accessions of P. hallii var. hallii. Fourteen of the markers cross-amplified in a P. capillare accession. For the 15 polymorphic markers, the total number of alleles per locus ranged from two to 26 (mean: 11.0) across six populations (11-19 individuals per population). Observed heterozygosity (mean: 0.031) was 13.7 times lower than the expected heterozygosity (mean: 0.426). The deficit of heterozygous individuals is consistent with P. hallii having a high rate of self-fertilization. These markers will be useful for studies in P. hallii and related species.

  20. Ecological genetics of the Bromus tectorum (Poaceae) - Ustilago Bullata (Ustilaginaceae): A role for frequency dependent selection?

    Science.gov (United States)

    Susan E. Meyer; David L. Nelson; Suzette Clement; Alisa Ramakrishnan

    2010-01-01

    Evolutionary processes that maintain genetic diversity in plants are likely to include selection imposed by pathogens. Negative frequency-dependent selection is a mechanism for maintenance of resistance polymorphism in plant - pathogen interactions. We explored whether such selection operates in the Bromus tectorum - Ustilago bullata pathosystem. Gene-for-gene...

  1. Cercosporoid fungi (Mycosphaerellaceae) 2. Species on monocots (Acoraceae to Xyridaceae, excluding Poaceae)

    OpenAIRE

    Braun, Uwe; Crous, Pedro W.; Nakashima, Chiharu

    2014-01-01

    Cercosporoid fungi (formerly Cercospora s. lat.) represent one of the largest groups of hyphomycetes belonging to the Mycosphaerellaceae (Ascomycota). They include asexual morphs, asexual holomorphs, or species with mycosphaerella-like sexual morphs. Most of them are leaf-spotting plant pathogens with special phytopathological relevance. In the first part of a new monographic work, cercosporoid hyphomycetes occurring on other fungi (fungicolous species), on ferns (pteridophytes) and gymnosper...

  2. Adaptive divergence with gene flow in incipient speciation of Miscanthus floridulus / sinensis complex (Poaceae)

    KAUST Repository

    Huang, Chao-Li

    2014-11-11

    Young incipient species provide ideal materials for untangling the process of ecological speciation in the presence of gene flow. The Miscanthus floridulus/sinensis complex exhibits diverse phenotypic and ecological differences despite recent divergence (approximately 1.59million years ago). To elucidate the process of genetic differentiation during early stages of ecological speciation, we analyzed genomic divergence in the Miscanthus complex using 72 randomly selected genes from a newly assembled transcriptome. In this study, rampant gene flow was detected between species, estimated as M=3.36x10(-9) to 1.20x10(-6), resulting in contradicting phylogenies across loci. Nevertheless, beast analyses revealed the species identity and the effects of extrinsic cohesive forces that counteracted the non-stop introgression. As expected, early in speciation with gene flow, only 3-13 loci were highly diverged; two to five outliers (approximately 2.78-6.94% of the genome) were characterized by strong linkage disequilibrium, and asymmetrically distributed among ecotypes, indicating footprints of diversifying selection. In conclusion, ecological speciation of incipient species of Miscanthus probably followed the parapatric model, whereas allopatric speciation cannot be completely ruled out, especially between the geographically isolated northern and southern M.sinensis, for which no significant gene flow across oceanic barriers was detected. Divergence between local ecotypes in early-stage speciation began at a few genomic regions under the influence of natural selection and divergence hitchhiking that overcame gene flow.

  3. Nuevas especies de Axonopus (Poaceae: Panicoideae: Paniceae de la Amazonia Colombiana

    Directory of Open Access Journals (Sweden)

    Giraldo Cañas Diego

    1998-11-01

    Full Text Available Two new species of Axonopus, A. morronei (series Axonopus and A. zuloagae (series Barbigen are described. The new species are known only from the savannas and sandstone plateau of Colombian northwest Amazonia.Se describen dos nuevas especies de Axonopus, A. morronei y A. zuloagae, de las series Axonopus y Barbigeri, respectivamente. Las nuevas especies son conocidas únicamente de las sabanas y afloramientos rocosos de la Amazonia noroccidental colombiana.

  4. The phytoremediation potential of heavy metals from soil using Poaceae energy crops: A review

    Directory of Open Access Journals (Sweden)

    Melissa PRELAC

    2016-09-01

    Full Text Available Phytoremediation is a method that use plants which can remove or stabilize pollutants in the environment. The aim of the polluted area remediation is to return ecosystems into original condition. Phytoremediation is a green technology used for a wide range of pollutants as well as on various lands, low costs and reduced environment impacts. Energy crops are relatively new in this field of researches and insufficiently explored. However, the results so far show their potential in heavy metal removal. The aim of this research was to examine the available literature and determine the phytoremediation potential of cadmium, chromium, copper, lead, mercury, nickel and zinc from the soil using Arundo donax, Miscanthus x giganteus, Panicum virgatum, Pennisetum purpureum, Sida hermaphrodita and Sorghum x drummondii. According to the researches conditions, studied energy crops are reccomended in heavy metals phytoextraction, rhizofiltration, stabilization and accumulation. Still, those plants accumulate higher concentrations of heavy metals in the rhizosphere which makes them heavy metals excluders since heavy metals are not translocated into the plants' shoot system and favorable in the implementation of rhizofiltration as well.

  5. Early colonization pattern of maize (Zea mays L. Poales, Poaceae roots by Herbaspirillum seropedicae (Burkholderiales, Oxalobacteraceae

    Directory of Open Access Journals (Sweden)

    Rose A. Monteiro

    2008-12-01

    Full Text Available The bacterium Herbaspirillum seropedicae is an endophytic diazotroph found in several plants, including economically important poaceous species. However, the mechanisms involved in the interaction between H. seropedicae and these plants are not completely characterized. We investigated the attachment of Herbaspirillum to maize roots and the invasion of the roots by this bacterium using H. seropedicae strain SMR1 transformed with the suicide plasmid pUTKandsRed, which carries a mini-Tn5 transposon containing the gene for the Discosoma red fluorescent protein (Dsred constitutively expressed together with the kanamycin resistance gene. Integration of the mini-Tn5 into the bacterial chromosome yielded the mutant H. seropedicae strain RAM4 which was capable of expressing Dsred and could be observed on and inside fresh maize root samples. Confocal microscopy of maize roots inoculated with H. seropedicae three days after germination showed that H. seropedicae cell were attached to the root surface 30 min after inoculation, were visible in the internal tissues after twenty-four hours and in the endodermis, the central cylinder and xylem after three days.

  6. The utility of Bambusoideae (Poaceae, Poales leaf blade anatomy for identification and systematics

    Directory of Open Access Journals (Sweden)

    T. D. Leandro

    Full Text Available Abstract Bambusoideae is a diverse subfamily that includes herbaceous (Olyreae and woody (Arundinarieae and Bambuseae bamboos. Species within Bambusae are particularly difficult to identify due to their monocarpic lifecycle and the often long durations between mass flowering events; whereas the herbaceous bamboos are pluricarpic, but often are found with no reproductive structures. The leaf blade anatomy of 16 sympatric species of native Brazilian bamboos (Olyreae and Bambuseae from the Atlantic Rainforest was studied in order to detect useful features for their identification. All the studied species share the following features: epidermis with a single stratum of cells; adaxial bulliform cells; mesophyll with arm cells, rosette cells, and fusoid cells; and collateral vascular bundles. Herbaceous bamboos share two features: papillae scattered on the abaxial surface and parallel-sided arrays of bulliform cells; whereas woody bamboos share: centrally organized papillae and fan-shaped arrays of bulliform cells. Also within the woody bamboos, intercostal fibers and a midrib with only one vascular bundle (simple midrib characterize the subtribe Arthrostylidiinae; whereas a midrib with more than one vascular bundle (complex midrib and a stomatal apparatus with two pappilae per subsidiary cell characterize the subtribe Chusqueinae. There are also diagnostic features for the sampled species, such as: papillae shape, and the outline and structure of the midrib. An identification key for all the studied species is provided based on the anatomical features.

  7. Cytotaxonomy of some species and of interspecific hybrids of Pennisetum (Poaceae, Poales

    Directory of Open Access Journals (Sweden)

    Vânia Helena Techio

    2002-01-01

    Full Text Available Cytotaxonomic studies were carried out on 26 accessions of Pennisetum spp. originating from the Active Germplasm Bank of Embrapa Gado de Leite-Juiz de Fora, Minas Gerais, Brazil.This study presents cytogenetics and reproductive morphological data for each one of these accessions, which allowed groupings and suggest botanical identifications to be established. The metaphases of the accessions characterized as P. purpureum confirmed the presence of 2n = 28 chromosomes that have already been described for this species. For the hybrids between P. purpureum and P. glaucum and for the hexaploids, resulting from the chromosome duplication of these hybrids, 2n = 21 and 2n = 42 chromosomes were confirmed, respectively. The wild accession identified as P. setosum showed metaphases with 2n = 54 chromosomes, while those characterized as P. nervosum had cells with 2n = 36 chromosomes. The wild accession 15 was different from the others for the morphological characters, with 2n = 36 chromosomes, and was classified as P. orientale. Two statistical procedures were used (canonical variables and cluster analysis on the basis of the Mahalanobis distance, and the results confirmed the conclusions obtained from the cytogenetic and morphologic analysis.

  8. Thresholds, injury, and loss relationships for thrips in Phleum pratense (Poales: Poaceae).

    Science.gov (United States)

    Reisig, Dominic D; Godfrey, Larry D; Marcum, Daniel B

    2009-12-01

    Timothy (Phleum pratense L.) is an important forage crop in many Western U.S. states. Marketing of timothy hay is primarily based on esthetics, and green color is an important attribute. The objective of these studies was to determine a relationship between arthropod populations, yield, and esthetic injury in timothy. Economic injury levels (EILs) and economic thresholds were calculated based on these relationships. Thrips (Thripidae) numbers were manipulated with insecticides in small plot studies in 2006, 2007, and 2008, although tetranychid mite levels were incidentally flared by cyfluthrin in some experiments. Arthropod population densities were determined weekly, and yield and esthetic injury were measured at each harvest. Effects of arthropods on timothy were assessed using multilinear regression. Producers were also surveyed to relate economic loss from leaf color to the injury ratings for use in establishing EILs. Thrips population levels were significantly related to yield loss in only one of nine experiments. Thrips population levels were significantly related to injury once before the first annual harvest and twice before the second. Thrips were the most important pest in these experiments, and they were more often related to esthetic injury rather than yield loss. EILs and economic thresholds for thrips population levels were established using esthetic injury data. These results document the first example of a significant relationship between arthropod pest population levels and economic yield and quality losses in timothy.

  9. Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution

    OpenAIRE

    Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vania Helena

    2015-01-01

    Abstract Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapp...

  10. Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution

    Science.gov (United States)

    Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vânia Helena

    2015-01-01

    Abstract Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapping of morphological characteristics. Cytogenetic studies in Setaria can be useful for taxonomic and evolutionary studies as well as for applications in breeding. Thus, this study is aimed at locating 45S and 5S rDNA sites through fluorescent in situ hybridization (FISH) in Setaria italica, Setaria viridis and Setaria sphacelata (Schumacher, 1827) Stapf, Hubbard, Moss, 1929 cultivars (cvs.) Narok and Nandi. Setaria italica and Setaria viridis have 18 chromosomes with karyotype formulas 6m + 3sm and 9m, respectively. The location of 45S and 5S rDNA for these species was in different chromosome pairs among the evaluated species. Setaria viridis presented a more symmetrical karyotype, strengthening the ancestral relationship with Setaria italica. Setaria sphacelata cvs. Narok and Nandi have 36 chromosomes, and karyotype formulas 11m+7sm and 16m+2sm, respectively. The 45S rDNA signals for both cultivars were also observed in distinct chromosome pairs; however chromosomes bearing 5S rDNA are conserved. Karyotypic variations found among the studied species are evidence of chromosomal rearrangements. PMID:26753080

  11. Genetic control and comparative genomic analysis of flowering time in Setaria (Poaceae).

    Science.gov (United States)

    Mauro-Herrera, Margarita; Wang, Xuewen; Barbier, Hugues; Brutnell, Thomas P; Devos, Katrien M; Doust, Andrew N

    2013-02-01

    We report the first study on the genetic control of flowering in Setaria, a panicoid grass closely related to switchgrass, and in the same subfamily as maize and sorghum. A recombinant inbred line mapping population derived from a cross between domesticated Setaria italica (foxtail millet) and its wild relative Setaria viridis (green millet), was grown in eight trials with varying environmental conditions to identify a small number of quantitative trait loci (QTL) that control differences in flowering time. Many of the QTL across trials colocalize, suggesting that the genetic control of flowering in Setaria is robust across a range of photoperiod and other environmental factors. A detailed comparison of QTL for flowering in Setaria, sorghum, and maize indicates that several of the major QTL regions identified in maize and sorghum are syntenic orthologs with Setaria QTL, although the maize large effect QTL on chromosome 10 is not. Several Setaria QTL intervals had multiple LOD peaks and were composed of multiple syntenic blocks, suggesting that observed QTL represent multiple tightly linked loci. Candidate genes from flowering time pathways identified in rice and Arabidopsis were identified in Setaria QTL intervals, including those involved in the CONSTANS photoperiod pathway. However, only three of the approximately seven genes cloned for flowering time in maize colocalized with Setaria QTL. This suggests that variation in flowering time in separate grass lineages is controlled by a combination of conserved and lineage specific genes.

  12. Diazotrophic bacteria isolated from wild rice Oryza glumaepatula (Poaceae in the Brazilian Amazon

    Directory of Open Access Journals (Sweden)

    Paulo Ivan Fernandes Júnior

    2013-06-01

    Full Text Available The association of wild grasses with diazotrophic bacteria in Brazilian biomes is poorly understood. The isolation and characterization of bacteria associated with wild grasses can contribute to understand the diazotrophic ecology as well as to identify bacteria with biotechnological applications. In this study, we isolated and characterized diazotrophic bacterial isolates from Oryza glumaepatula collected in Cerrado and Forest areas of the Amazon in Roraima State, Brazil. Healthy O. glumepatula plants were collected at five sampling sites at Forest and seven at Cerrado, respectively. The plants were collected at the Cerrado areas in September 2008 while the Forest plants were collected in June/2008 and April/2009. The plants and the soil adhering to the roots were transferred to pots and grown for 35 days in greenhouse conditions. During the harvest, the shoots and the roots were crushed separately in a saline solution; the suspension was diluted serially and inoculated in Petri dishes containing Dyg’s medium. All distinct bacterial colonies were purified in the same medium. The diazotrophic capacity of each bacterium in microaerophilic conditions was assessed in semisolid BMGM medium. In addition, the pellicles forming bacterial isolates were also evaluated by PCR amplification for nifH gene. The diversity of nifH+ bacteria was analyzed by Box-PCR fingerprinting. For selected strains, the growth promoting capacity of O. sativa as a model plant was also evaluated. A total of 992 bacterial isolates were obtained. Fifty- one bacteria were able to form pellicles in the semisolid medium and 38 also positively amplified the 360bp nifH gene fragment. Among the 38 nifH+ isolates, 24 were obtained from the shoots, while 14 originated from the roots. The Box-PCR profiles showed that the bacterial isolates obtained in this study presented a low similarity with the reference strains belonging to the Herbaspirillum, Azospirillum and Burkholderia genus. The growth- promoting ability was confirmed for at least five isolates. For these bacteria, the root and shoot growing results showed higher increases when compared to those observed in plants inoculated with the evaluated reference strains. These results indicate that O. glumaepatula is colonized by a high diverse diazotrophic community in the Brazilian Amazon. Further investigations are now being carried out to determine the taxonomic positions of these isolates and their growth promoting mechanisms.

  13. Diazotrophic bacteria isolated from wild rice Oryza glumaepatula (Poaceae) in the Brazilian Amazon.

    Science.gov (United States)

    Júnior, Paulo Ivan Fernandes; Pereira, Gilmara Maria Duarte; Perin, Liamara; da Silva, Luana Mesquita; Baraúna, Alexandre Cardoso; Alvess, Francilene Muniz; Passos, Samuel Ribeiro; Zilli, Jerri Edson

    2013-06-01

    The association of wild grasses with diazotrophic bacteria in Brazilian biomes is poorly understood. The isolation and characterization of bacteria associated with wild grasses can contribute to understand the diazotrophic ecology as well as to identify bacteria with biotechnological applications. In this study, we isolated and characterized diazotrophic bacterial isolates from Oryza glumaepatula collected in Cerrado and Forest areas of the Amazon in Roraima State, Brazil. Healthy O. glumepatula plants were collected at five sampling sites at Forest and seven at Cerrado, respectively. The plants were collected at the Cerrado areas in September 2008 while the Forest plants were collected in June/2008 and April/2009. The plants and the soil adhering to the roots were transferred to pots and grown for 35 days in greenhouse conditions. During the harvest, the shoots and the roots were crushed separately in a saline solution; the suspension was diluted serially and inoculated in Petri dishes containing Dyg's medium. All distinct bacterial colonies were purified in the same medium. The diazotrophic capacity of each bacterium in microaerophilic conditions was assessed in semisolid BMGM medium. In addition, the pellicles forming bacterial isolates were also evaluated by PCR amplification for nifH gene. The diversity of nifH bacteria was analyzed by Box-PCR fingerprinting. For selected strains, the growth promoting capacity of O. sativa as a model plant was also evaluated. A total of 992 bacterial isolates were obtained. Fifty-one bacteria were able to form pellicles in the semisolid medium and 38 also positively amplified the 360 bp nifH gene fragment. Among the 38 nifH+ isolates, 24 were obtained from the shoots, while 14 originated from the roots. The Box-PCR profiles showed that the bacterial isolates obtained in this study presented a low similarity with the reference strains belonging to the Herbaspirillum, Azospirillum and Burkholderia genus. The growth-promoting ability was confirmed for at least five isolates. For these bacteria, the root and shoot growing results showed higher increases when compared to those observed in plants inoculated with the evaluated reference strains. These results indicate that O. glumaepatula is colonized by a high diverse diazotrophic community in the Brazilian Amazon. Further investigations are now being carried out to determine the taxonomic positions of these isolates and their growth promoting mechanisms.

  14. Ribosomal DNA variation in finger millet and wild species of Eleusine (Poaceae).

    Science.gov (United States)

    Hilu, K W; Johnson, J L

    1992-04-01

    Finger millet is an important cereal crop in the semi-arid regions of Africa and India. The crop belongs to the grass genus Eleusine, which includes nine annual and perennial species native to Africa except for the New World species E. tristachya. Ribosomal DNA (rDNA) variation in finger millet and related wild species was used to provide information on the origin of the genomes of this tetraploid crop and point out genetic relationships of the crop to other species in the genus. The restriction endonucleases used revealed a lack of variability in the rDNA spacer region in domesticated finger millet. All the rDNA variants of the crop were found in the proposed direct tetraploid ancestor, E. coracana subsp. africana. Wild and domesticated finger millet displayed the phenotypes found in diploid E. indica. Diploid Eleusine tristachya showed some similarity to the crop in some restriction sites. The remaining species were quite distinct in rDNA fragment patterns. The study supports the direct origin of finger millet from subspecies africana shows E. indica to be one of the genome donors of the crop, and demonstrates that none of the other species examined could have donated the second genome of the crop. The rDNA data raise the possibility that wild and domesticated finger millet could have originated as infraspecific polyploid hybrids from different varieties of E. indica.

  15. Basic chromosome numbers and polyploid levels in some South African and Australian grasses (Poaceae

    Directory of Open Access Journals (Sweden)

    J. J. Spies

    1991-10-01

    Full Text Available Chromosome numbers of 46 specimens of grasses, involving 24 taxa from South Africa and Australia, have been determined during the present study. For the first time chromosome numbers are given for Eragrostis sarmentosa (Thunb. Trin. (n = 20. Panicum aequinerve Nees (n = 18,  Digitaria argyrograpta (Nees Stapf (n = 9 and D. maitlandii Stapf & C.E. Hubb. (n = 9. Additional polyploid levels are described for Diplachne fusca (L. Beauv. ex Roem. & Schult. (n = 10 and Digitaria diagonalis (Nees Stapf var.  diagonalis (n = 9. B-chromosomes were observed in several different specimens. The presence of B-chromosomes often results in abnormal chromosomal behaviour during meiosis.

  16. Identification of putative orthologous genes for the phylogenetic reconstruction of temperate woody bamboos (Poaceae: Bambusoideae).

    Science.gov (United States)

    Zhang, Li-Na; Zhang, Xian-Zhi; Zhang, Yu-Xiao; Zeng, Chun-Xia; Ma, Peng-Fei; Zhao, Lei; Guo, Zhen-Hua; Li, De-Zhu

    2014-09-01

    The temperate woody bamboos (Arundinarieae) are highly diverse in morphology but lack a substantial amount of genetic variation. The taxonomy of this lineage is intractable, and the relationships within the tribe have not been well resolved. Recent studies indicated that this tribe could have a complex evolutionary history. Although phylogenetic studies of the tribe have been carried out, most of these phylogenetic reconstructions were based on plastid data, which provide lower phylogenetic resolution compared with nuclear data. In this study, we intended to identify a set of desirable nuclear genes for resolving the phylogeny of the temperate woody bamboos. Using two different methodologies, we identified 209 and 916 genes, respectively, as putative single copy orthologous genes. A total of 112 genes was successfully amplified and sequenced by next-generation sequencing technologies in five species sampled from the tribe. As most of the genes exhibited intra-individual allele heterozygotes, we investigated phylogenetic utility by reconstructing the phylogeny based on individual genes. Discordance among gene trees was observed and, to resolve the conflict, we performed a range of analyses using BUCKy and HybTree. While caution should be taken when inferring a phylogeny from multiple conflicting genes, our analysis indicated that 74 of the 112 investigated genes are potential markers for resolving the phylogeny of the temperate woody bamboos. © 2014 John Wiley & Sons Ltd.

  17. Regional variation in Argentinean populations of Bromus catharticus (Poaceae as measured by morphological

    Directory of Open Access Journals (Sweden)

    Arturi, Miguel J.

    2008-06-01

    Full Text Available Thirty-one populations of Bromus catharticus Vahl., collected from the Pampean Dominion (Argentina, were classified using twenty four highly heritable traits by numerical taxonomic methods. After implementing a stepwise discriminant analysis, 18 traits were chosen as classificatory variables. Eight population groups were classified in two main clusters. Different morphotypes, primarily associated with panicle architecture and micro floral traits, were found. The patterns in the morphological variation seem to correspond to a gradient of humidity and temperature that diminishes from the NE to the SW. This pattern of classification reflects the geographical origin for most of the sampled populations, although there was some noise. Our results fit the patchy variation model, where populations are genetically selected for macro and micro environmental conditions.Treinta y una poblaciones de Bromus catharticus Vahl., recolectadas en el dominio Pampeano (Argentina, fueron clasificadas utilizando 24 caracteres altamente heredables por métodos de taxonomía numérica. Tras implementar el análisis discriminante del paso a paso (Stepwise, 18 variables fueron seleccionadas como variables clasificatorias. Ocho grupos de poblaciones fueron clasificadas en dos clusters principales. Diferentes morfotipos, principalmente asociados a la arquitectura de las panojas y a variables microflorales, fueron encontrados. El patrón de variación morfológico parece responder a un gradiente de humedad y temperatura que disminuye desde el NE al SW. Además, dicho patrón de clasificación refleja un origen geográfico para la mayoría de las poblaciones, aunque hubo algo de ruido. Nuestros resultados se ajustan a un modelo de variación en parches, donde las poblaciones están genéticamente seleccionadas por condiciones micro y macro ambientales.

  18. Rapid and recent world-wide diversification of bluegrasses (Poa, Poaceae and related genera.

    Directory of Open Access Journals (Sweden)

    Matthias H Hoffmann

    Full Text Available Rapid species diversifications provide fascinating insight into the development of biodiversity in time and space. Most biological radiations studied to date, for example that of cichlid fishes or Andean lupines, are confined to isolated geographical areas like lakes, islands or island-like regions. Using DNA sequence data of the ribosomal internal transcribed spacer (ITS for many species of the Poa alliance, a group comprising about 775 C3 grass species, revealed rapid and parallel diversifications in various parts of the world. Some of these radiations are restricted to isolated areas like the Andes, whereas others are typical of the lowlands of mainly the northern hemisphere. These radiations thus are not restricted to island-like areas and are seemingly actively ongoing. The ages of the diversifying clades are estimated to be 2.5-0.23 million years (Myr. Conservative diversification rates in the Poa alliance amount to 0.89-3.14 species per Myr, thus are in the order of, or even exceeding, other instances of well-known radiations. The grass radiations of the mainly cold-adapted Poa alliance coincide with the Late Tertiary global cooling, which resulted in the retreat of forests and the subsequent formation of cold-adapted grasslands especially in the northern, but also in parts of the southern hemisphere. The cold tolerance, suggested to be one of the ecological key innovations, may have been acquired during the early diversification of the subfamily Pooideae, but became significant millions of years later during the Pliocene/Pleistocene radiation of the Poa alliance.

  19. Leaf anatomy of the South African Danthonieae (Poaceae. III. Merxmuellera stricta

    Directory of Open Access Journals (Sweden)

    R. P. Ellis

    1980-11-01

    Full Text Available The anatomical structure, of the leaf blade as seen in transverse section, and of the abaxial epidermis, of Merxmuellera stricta (Schrad. Conert is described and illustrated. In this variable species four distinct anatomical “forms” are recognized viz. the typical  M. stricta form, the Cathedral Peak form, the Drakensberg form and the alpine form. The alpine and Cathedral Peak forms have recently been described as M. guillarmodiae Conert (1975. The degree of anatomical differentiation of these “forms” resembles the situation described in M. disticha (Nees Conert (Ellis, 1980. Populations of both M. stricta and M. disticha from the Drakensberg mountains display extensive anatomical diversification which appears to be correlated with environmental factors. In addition, morphological differences are exhibited as well and the anatomical “forms” of M. stricta probably warrant taxonomic recognition.

  20. Leaf anatomy of the South African Danthonieae (Poaceae. XV. The genus Elytrophorus

    Directory of Open Access Journals (Sweden)

    R. P. Ellis

    1986-10-01

    Full Text Available The leaf anatomy of  Elytrophorus globularis Hack, and  E. spicatus (Willd. A. Camus is described and illustrated from freshly fixed material from SWA/Namibia and Botswana. It is shown that these two species are anatomically indistinguishable. It is suggested that they are conspecific. and that  E. spicatus possibly represents juvenile plants with immature inflorescences. The anatomical evidence strongly refutes a chloridoid relationship for Elytrophorus but appears to support arundinoid affinities for the genus. Striking anatomical and ecological similarities exist between  Elytrophorus and  Sacciolepis huillensis (Rendle Stapf. No significant leaf anatomical differences separate  Elytrophorus from S.  huillensis and some of the other C3 panicoid taxa and. consequently,  Elytro­phorus may represent a link between the Arundinoideae and the Panicoideae.

  1. Studies upon morhological and biological traits of Festuca rubra, subsp.fallax (Poaceae

    Directory of Open Access Journals (Sweden)

    Bogusław Sawicki

    2013-12-01

    Full Text Available Observation and measurements of some traits of Festuca rubra L., subsp. fallax (Thuill. Hack. ecotypes were made in 1995-1997 using samples selected from natural habitats and collected in Grassland Experimental Station in Sosnowica. High differentiation of traits under study and their correlations were found. Valorized ecotypes are good material for new varieties breeding.

  2. Nota sobre EL GÉNERO Imperata (Poaceae, Panicoideae, Sacchareae en Argentina

    Directory of Open Access Journals (Sweden)

    Myriam C. Peichoto

    2013-01-01

    Full Text Available En este trabajo se confirma la presencia de Imperata tenuis en Argentina. Se presenta una ilustración, material de referencia y un mapa de su distribución geográfica en el sur de Sudamérica. Se incluye una clave para identificar las especies del género Imperata presentes en la Argentina.

  3. Characterization of 21 microsatellite markers from cogongrass, Imperata cylindrica (Poaceae), a weed species distributed worldwide.

    Science.gov (United States)

    Chiang, Yu-Chung; Tsai, Chi-Chu; Hsu, Tsai-Wen; Chou, Chang-Hung

    2012-11-01

    Microsatellite loci were developed from Imperata cylindrica, a traditional medicinal herb in Asia and among the top 10 worst invasive weeds in the world, to aid in the identification of the limits of asexual clonal individuals. A total of 21 microsatellite markers, including 18 polymorphic and three monomorphic loci, were developed from I. cylindrica using a magnetic bead enrichment protocol. The primers amplified dinucleotide, trinucleotide, and complex repeats. The number of alleles ranged from one to 19 per locus, with an observed heterozygosity ranging from 0.09 to 1.00. Several loci deviated significantly from the within-population Hardy-Weinberg equilibrium as a result of asexual clonal reproduction. These polymorphic markers should be useful tools in further studies on the identification of the range of clonal reproduction units and the selection and classification of the medicinal cultivar.

  4. The effect of the external medium on the gravitropic curvature of rice (Oryza sativa, Poaceae) roots

    Science.gov (United States)

    Staves, M. P.; Wayne, R.; Leopold, A. C.

    1997-01-01

    The roots of rice seedlings, growing in artificial pond water, exhibit robust gravitropic curvature when placed perpendicular to the vector of gravity. To determine whether the statolith theory (in which intracellular sedimenting particles are responsible for gravity sensing) or the gravitational pressure theory (in which the entire protoplast acts as the gravity sensor) best accounts for gravity sensing in rice roots, we changed the physical properties of the external medium with impermeant solutes and examined the effect on gravitropism. As the density of the external medium is increased, the rate of gravitropic curvature decreases. The decrease in the rate of gravicurvature cannot be attributed to an inhibition of growth, since rice roots grown in 100 Osm/m3 (0.248 MPa) solutions of different densities all support the same root growth rate but inhibit gravicurvature increasingly with increasing density. By contrast, the sedimentation rate of amyloplasts in the columella cells is unaffected by the external density. These results are consistent with the gravitational pressure theory of gravity sensing, but cannot be explained by the statolith theory.

  5. Characterization and multiplexing of EST-SSR primers in Cynodon (Poaceae) species1.

    Science.gov (United States)

    Jewell, Margaret C; Frere, Celine H; Prentis, Peter J; Lambrides, Christopher J; Godwin, Ian D

    2010-10-01

    Cynodon species are multiple-use grasses that display varying levels of adaptation to biotic and abiotic stress. Previously identified EST-SSR primers were characterized and multiplexed to assess the level of genetic diversity present within a collection of almost 1200 Cynodon accessions from across Australia. • Two multiplex reactions were developed comprising a total of 16 EST-SSR markers. All SSR markers amplified across different Cynodon species and different levels of ploidy. The number of alleles ranged from one to eight per locus and the total number of alleles for the germplasm collection was 79. • The 16 markers show sufficient variation for the characterization of Cynodon core collections and analysis of population genetic diversity in Cynodon grasses.

  6. The grasses (Poaceae) of the Colombian guayana: analyses on their composition, richness, endemism, and invasion

    International Nuclear Information System (INIS)

    Canas, Diego Giraldo

    2010-01-01

    The checklist of grasses from Colombian Guayana is presented. In all, 152 species, 69 genera, and six subfamilies were recorded. Thus, in the Colombian Guayana is represented the 18.7 and 43.7% of the species and genera of Colombian grasses, respectively. The subfamilies with the highest number of species were Panicoideae (110 species/46 genera), Chloridoideae (21/9), and Bambusoideae (11/9). The most diverse genera were Paspalum (19 species), Panicum (16), Axonopus (14), Eragrostis (9), and Digitaria (8). Nineteen species are introduced and naturalized in the Colombian Guayana, which represent 12.5% of the agrostological flora for the Colombian Guayana. There were 8 endemic species (5.3% of Colombian Guayanan grasses). In addition, some species are reported for the first time for Colombian flora (belonging to Axonopus, Cyphonanthus, Gymnopogon, and Paspalum), and some species are new to science (belonging to Axonopus, Digitaria, Eragrostis, and Sacciolepis). On the other hand, some preliminary biogeographical aspect are analyzed Flora of Colombia,

  7. The grasses (Poaceae) of the Colombian Guyana: analyses on their composition, richness, endemism, and invasion

    International Nuclear Information System (INIS)

    Giraldo Canas, Diego

    2010-01-01

    The checklist of grasses from Colombian Guyana is presented. In all, 152 species, 69 genera, and six subfamilies were recorded. Thus, in the Colombian Guyana is represented the 18.7 and 43.7% of the species and genera of Colombian grasses, respectively. The subfamilies with the highest number of species were Panicoideae (110 species/46 genera), Chloridoideae (21/9), and Bambusoideae (11/9). The most diverse genera were Paspalum (19 species), Panicum (16), Axonopus (14), Eragrostis (9), and Digitaria (8). Nineteen species are introduced and naturalized in the Colombian Guyana, which represent 12.5% of the agrostological flora for the Colombian Guyana. There were 8 endemic species (5.3% of Colombian Guayanan grasses). In addition, some species are reported for the first time for Colombian flora (belonging to Axonopus, Cyphonanthus, Gymnopogon, and Paspalum), and some species are new to science (belonging to Axonopus, Digitaria, Eragrostis, and Sacciolepis). On the other hand, some preliminary biogeographical aspect are analyzed.

  8. Embryo sac development in some representatives of the tribe Cynodonteae (Poaceae

    Directory of Open Access Journals (Sweden)

    A. Strydom

    1994-10-01

    Full Text Available Chloris virgata Sw., Cynodon dactylon (L. Pers., Harpochloa falx (L. f. Kuntze, and Tragus berteronianus Schult. have a Polygonum type of embryo sac development. Unreduced embryo sacs were found in Eustachys paspaloides (Vahl Lanza & Mattei,  Harpochloa falx, and  Rendlia altera (Rendle Chiov. Both facultative and obligate apomixis were observed. The Hieracium type of embryo sac development was observed in the aposporic specimens.

  9. El género Chloris Sw. (Poaceae: Chloridoideae) en México

    OpenAIRE

    Cerros-Tlatilpa, Rosa; Siqueiros Delgado, María Elena; Skendzic, Elizabeth M.

    2015-01-01

    En este estudio se reconocen 12 especies de Chloris para el territorio de la República. Cinco son cosmopolitas, cinco americanas y dos de ellas se restringen a México y E.U.A., una está en América y en Australia, mientras que C. truncata se reporta por primera vez de nuestro país. Chloris barbata, C. gayana y C. virgata son consideradas invasoras para el país. Se incluye una clave para su identificación, descripciones y mapas de distribución. El género ocupa una variedad de hábitats, desde zo...

  10. Embryo sac development in some representatives of the tribe Cynodonteae (Poaceae)

    OpenAIRE

    A. Strydom; J. J. Spies

    1994-01-01

    Chloris virgata Sw., Cynodon dactylon (L.) Pers., Harpochloa falx (L. f.) Kuntze, and Tragus berteronianus Schult. have a Polygonum type of embryo sac development. Unreduced embryo sacs were found in Eustachys paspaloides (Vahl) Lanza & Mattei,  Harpochloa falx, and  Rendlia altera (Rendle) Chiov. Both facultative and obligate apomixis were observed. The Hieracium type of embryo sac development was observed in the aposporic specimens.

  11. Ultraestructura del bambú Guadua paniculata (Poaceae: Bambusoideae de Costa Rica

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Se evaluaron características ultraestructurales de la lámina y la bráctea de la hoja, así como de las ramas, de plantas adultas de Guadua paniculata recolectadas en Costa Rica. Sus características ultraestructurales diagnósticas incluyen el patrón celular de la zona adaxial de la lámina foliar, los largos tricomas unicelulares de la superficie abaxial, los más numerosos tricomas auriculares, agrupados en número de 17, el patrón de cera cuticular y las bandas de estomas rodeadas de papilas céricas.Sections of leaf lamina, leaf sheath and branches of adult Guadua paniculata collected in Costa Rica, were studied ultrastructurally. Diagnostic ultrastructural characteristics include the cellular pattern of the adaxial zone in the leaf blade; the large unicellular trichomes of the abaxial area, the more numerous auricular trichomes, grouped in number of 17, the pattern of cuticular wax and the bands of stomata surrounded by ceric papillae. Rev. Biol. Trop. 54(Suppl. 2: 29-34. Epub 2006 Dec. 01.

  12. Ultrastructural morphologic description of the wild rice species Oryza latifolia (Poaceae in Costa Rica

    Directory of Open Access Journals (Sweden)

    Ethel Sánchez

    2003-06-01

    Full Text Available The wild rice species Oryza latifolia is endemic to Tropical America, allotetraploid and has a CCDD genome type. It belongs to the officinalis group of the genus Oryza. This species is widely distributed through-out the lowlands of Costa Rica and it is found on different life zones, having great morphologic diversity. The purpose of this research is to perform a morphologic description of O. latifolia samples of three Costa Rican localities (Carara, Liberia and Cañas and to see if the phenotypic diversity of the species is reflected at the ultra-structure level. Structures such as the leaf blade, ligule, auricles and spikelet were analyzed. Leaf blade morphology of the specimens from the three localities is characterized by the presence of diamond-shaped stomata with papillae, zipper-like rows of silica cells; a variety of evenly distributed epicuticular wax papillae and bulky prickle trichomes. The central vein of the leaf blade from the Cañas populations is glabrous, while those from Carara and Liberia have abundant papillae. There are also differences among the borders of the leaf blade between these locations. Cañas and Liberia present alternating large and small prickle trichomes ca. 81 and 150 µm, while Carara exhibits even sized prickle trichomes of ca. 93 µm. Auricles from Cañas are rectangular and present long trichomes along the surface ca. 1.5 mm, while those of Liberia and Carara wrap the culm and exhibit trichomes only in the borders. The ligule from the plants of Carara has an acute distal tip, while that of Cañas and Liberia is blunt. The Liberia spikelet has large lignified spines while Cañas and Carara show flexible trichomes.La especie silvestre Oryza latifolia es endémica de América, tetraploide y de genoma CCDD. Pertenece a las especies del género Oryza del grupo officinalis. Presenta una amplia distribución en las tierras bajas de Costa Rica y se le encuentra en varias zonas de vida, mostrando una gran diversidad morfológica. El propósito de este trabajo fue realizar una descripción ultraestructural de plantas de O. latifolia provenientes de las localidades Carara, Liberia y Cañas con el fin de determinar si hay variación intrapo-blacional. Se analizó la lámina foliar, lígula, aurículas y espiguilla, con énfasis en las estructuras de valor taxonómico. La morfología de la lámina foliar de los especímenes de las tres localidades se caracteriza por la presencia de estomas romboidales con papilas, células de sílice de forma crenada, variedad de papilas de cera, distribuidas en forma regular y tricomas espinosos abultados de ca 53 µm. La vena central de la lámina foliar de O. latifolia, localidad Cañas, es lisa, mientras que en Carara y Liberia presenta papilas. Los bordes de la lámina foliar difieren entre localidades; Cañas y Liberia presentan tricomas ganchudos grandes de ca. 150 µm y pequeños de ca 81 µm que alternan, mientras que Carara tiene tricomas ganchudos pequeños de igual tamaño (ca. 93 µm. Las aurículas de Cañas son rectangulares y presentan tricomas atenuados largos de ca. 1.5mm en toda la superficie, mientras las de Liberia y Carara son envolventes y presentan dichos tricomas solamente en los bordes. La lígula de Carara tiene el extremo distal agudo, mientras que Cañas y Liberia lo tienen truncado. La espiguilla de Liberia presenta tricomas espinosos lignificados grandes, mientras que Cañas y Carara tienen tricomas flexibles.

  13. Ultraestructura del bambú Guadua angustifolia var. bicolor (Poaceae: Bambusoideae, presente en Costa Rica

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Se estudió la ultraestructura anatómica de la lámina y la vaina de la hoja, así como de la bráctea del culmo, de Guadua angustifolia var. bicolor, por medio del microscopio electrónico de barrido. Se encontraron similitudes con otras guaduas: estomas de alto domo, células largas con paredes sinuosas y células de sílice. Son propios de la var. bicolor el patrón estomático en la zona abaxial de la hoja cerca de la vaina, con la presencia de gran cantidad de tricomas ganchudos y sin papilas; las brácteas de color café dorado que cubren los culmos y tienen tricomas papilares que cubren el haz; y el abundante número de tricomas auriculares, en grupos de 12.The anatomy of several parts of Guadua angustifolia var. bicolor was analyzed and characterized under a scanning electron icroscope. any similarities ere observed with other Guadua species, particularly the presence of high dome stomata, of large cells with sinuous walls and of silica cells. Specific bicolor characteristics include (1 a different stomatal pattern in the adaxial zone of the leaf base (close to the sheath; (2 the abundance of hook-sshaped trichomes without papilla; (3 the distinctive golden brown color of the bract that covers the culm (caused by papillar trichomes that cover the adaxial sheath; and (4 the size of the groups of auricular trichomes (formed by 12 trichomes. Rev. Biol. Trop. 54(Suppl. 2: 13-19. Epub 2006 Dec. 01.

  14. LAS ESPECIES COLOMBIANAS DEL GÉNERO DIGITARIA (POACEAE: PANICOIDEAE: PANICEAE

    Directory of Open Access Journals (Sweden)

    GIRALDO-CAÑAS DIEGO

    2005-06-01

    Full Text Available Se presenta un estudio sistemático, macro y micromorfológico de las especies colombianas del género Digitaria. Se analizan diversos aspectos relativos a la clasificación, la nomenclatura, las afinidades genéricas y la variación macro y micromorfológica de los caracteres, así como algunos aspectos anatómicos de la espiguilla y el antecio superior. El género Digitaria está representado en Colombia por 18 especies distribuidas en cinco secciones: Digitaria sect. Calvulae (una especie, Digitaria sect. Digitaria (siete especies, Digitaria sect. Ischaemum (tres especies, Digitaria sect. Ternatae (cuatro especies y Digitaria sect. Trichachne (tres especies. Dos especies son endémicas de Colombia (Digitaria cardenasiana y Digitaria andicola. Las especies Digitaria argillacea, Digitaria neesiana y Digitaria fragilis se excluyen de la flora de Colombia. Se presentan las claves para reconocer las secciones y las especies presentes en Colombia, así como también las descripciones de éstas, la iconografía, los usos, los nombres vulgares, la distribución geográfica y se comentan algunas observaciones morfológicas y ecológicas. Se documenta la presencia de espiguillas trifloras en el género Digitaria, situación observada en las especies Digitaria dioica y Digitaria nuda.

  15. Saw palmetto (Serenoa repens) in men with lower urinary tract symptoms: effects on urodynamic parameters and voiding symptoms.

    Science.gov (United States)

    Gerber, G S; Zagaja, G P; Bales, G T; Chodak, G W; Contreras, B A

    1998-06-01

    To assess the effects of saw palmetto on voiding symptoms and urodynamic parameters in men with lower urinary tract symptoms (LUTS) presumed secondary to benign prostatic hyperplasia (BPH). Fifty men with previously untreated LUTS and a minimum International Prostate Symptom Score (IPSS) of 10 or greater were treated with a commercially available form of saw palmetto (160 mg twice per day) for 6 months. The initial evaluation included measurement of peak urinary flow rate, postvoid residual urine volume, pressure-flow study, and serum prostate-specific antigen (PSA) level. Patients completed an IPSS, serum PSA was determined, and flow rate was measured every 2 months during the course of the study. A urodynamic evaluation was repeated at the completion of the 6-month trial. The mean IPSS (+/-SD) improved from 19.5+/-5.5 to 12.5+/-7.0 (P saw palmetto for 2 months. An improvement in symptom score of 50% or greater after treatment with saw palmetto for 2, 4, and 6 months was noted in 21% (10 of 48), 30% (14 of 47), and 46% (21 of 46) of patients, respectively. There was no significant change in peak urinary flow rate, postvoid residual urine volume, or detrusor pressure at peak flow among patients completing the study. No significant change in mean serum PSA level was noted. Saw palmetto is a well-tolerated agent that may significantly improve lower urinary tract symptoms in men with BPH. However, we were unable to demonstrate any significant improvement in objective measures of bladder outlet obstruction. Placebo-controlled trials of saw palmetto are needed to evaluate the true effectiveness of this compound.

  16. Towards an optimal sampling strategy for assessing genetic variation within and among white clover (Trifolium repens L. cultivars using AFLP

    Directory of Open Access Journals (Sweden)

    Khosro Mehdi Khanlou

    2011-01-01

    Full Text Available Cost reduction in plant breeding and conservation programs depends largely on correctly defining the minimal sample size required for the trustworthy assessment of intra- and inter-cultivar genetic variation. White clover, an important pasture legume, was chosen for studying this aspect. In clonal plants, such as the aforementioned, an appropriate sampling scheme eliminates the redundant analysis of identical genotypes. The aim was to define an optimal sampling strategy, i.e., the minimum sample size and appropriate sampling scheme for white clover cultivars, by using AFLP data (283 loci from three popular types. A grid-based sampling scheme, with an interplant distance of at least 40 cm, was sufficient to avoid any excess in replicates. Simulations revealed that the number of samples substantially influenced genetic diversity parameters. When using less than 15 per cultivar, the expected heterozygosity (He and Shannon diversity index (I were greatly underestimated, whereas with 20, more than 95% of total intra-cultivar genetic variation was covered. Based on AMOVA, a 20-cultivar sample was apparently sufficient to accurately quantify individual genetic structuring. The recommended sampling strategy facilitates the efficient characterization of diversity in white clover, for both conservation and exploitation.

  17. Saprobic microfungi under Lolium perenne and Trifolium repens at different fertilization intensities and elevated atmospheric CO2 concentration

    Czech Academy of Sciences Publication Activity Database

    Řezáčová, Veronika; Blum, H.; Hršelová, Hana; Gamper, H.; Gryndler, Milan

    2005-01-01

    Roč. 11, - (2005), s. 224-230 ISSN 1354-1013 R&D Projects: GA ČR GA526/00/1276; GA ČR GA526/03/0188; GA ČR GD206/03/H137 Institutional research plan: CEZ:AV0Z5020903 Keywords : carbon cycle * elevated CO2 * concentration Subject RIV: EE - Microbiology, Virology Impact factor: 4.075, year: 2005

  18. The role of transgenerational effects in adaptation of clonal offspring of white clover (Trifolium repens) to drought and herbivory

    Czech Academy of Sciences Publication Activity Database

    González, Alejandra Pilar Rendina; Dumalasová, Veronika; Rosenthal, J.; Skuhrovec, J.; Latzel, Vít

    2017-01-01

    Roč. 31, č. 3 (2017), s. 345-361 ISSN 0269-7653 R&D Projects: GA ČR(CZ) GA14-06802S Institutional support: RVO:67985939 Keywords : jasmonic acid * epigenetics * plant behaviour Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 1.818, year: 2016

  19. A survey of the invertebrates feeding on living clover roots (Trifolium repens L.) using 32P as a radiotracer

    International Nuclear Information System (INIS)

    Baylis, J.P.; Cherrett, J.M.; Ford, J.B.

    1986-01-01

    Clover roots were labelled in the field with 32 P and the radioactive soil fauna were detected by autoradiography. The animals which consumed labelled clover roots were, in order of importance, earthworms (Aporrectodea longa, A. caliginosa and Lumbricus rubellus), weevil larvae, dipteran larvae (Bibio marci) and a few Collembola (family: Entomobryidae). (author)

  20. Diferenciação de espécies daninhas aquáticas pela análise multivariada de caracteres estruturais foliares Differentiation of aquatic weeds by multivariate analysis of foliar structural characters

    Directory of Open Access Journals (Sweden)

    N.V. Costa

    2006-01-01

    Full Text Available Algumas espécies de plantas aquáticas têm-se tornado problemáticas em reservatórios hidrelétricos no Brasil, devido a sua grande capacidade de reprodução. O objetivo destes trabalho foi diferenciar Brachiaria mutica, Brachiaria subquadripara, Panicum repens, Eichhornia crassipes, Heteranthera reniformis, Typha ubulata e Enhydra anagallis, utilizando-se 19 caracteres estruturais quantitativos do limbo foliar, que se relacionassem com a penetração e translocação de herbicidas. Amostras do terço médio do limbo foram fixadas em FAA 50, cortadas transversalmente em micrótomo com 8 mm de espessura e coradas com azul-de-toluidina. Foram quantificados (% os seguintes caracteres estruturais da nervura central (NC e da região internervural (IN: epidermes adaxial e abaxial, feixe vascular, bainha do feixe vascular, esclerênquima, parênquima e lacunas do aerênquima, além da espessura da folha, do número de estômatos e do número de tricomas nas faces adaxial e abaxial. Os 19 caracteres estruturais foram submetidos à Análise de Agrupamento e Análise de Componentes Principais. Houve a formação de três grupos principais: grupo 1 B. mutica, B. subquadripara e P. repens (Poaceae; grupo 2 E. crassipes e H. reniformis (Pontederiaceae e E. anagallis (Asteraceae; e grupo 3 apenas T. subulata (Typhaceae. Os caracteres com maior poder discriminatório foram: porcentagem de epiderme adaxial (IN; porcentagem de epiderme abaxial; feixe vascular; bainha do feixe vascular; esclerênquima e lacunas do aerênquima (NC e IN; espessura da folha e número de estômatos das faces adaxial e abaxial. Concluiu-se que os caracteres estruturais quantitativos permitiram diferenciar essas espécies daninhas aquáticas em fase vegetativa.Some aquatic plant species have caused great damage to hydroelectric power dams in Brazil, due to their great capacity of reproduction. Nineteen quantitative structural characters of leaf blades were used to differentiate

  1. Anatomia foliar como subsídio à taxonomia de espécies do Complexo Briza L. (Poaceae: Pooideae: Poeae Leaf anatomy as a taxonomic tool for Briza Complex species (Poaceae: Pooideae: Poeae

    Directory of Open Access Journals (Sweden)

    Carla Maria Garlet de Pelegrin

    2009-09-01

    Full Text Available O objetivo deste trabalho foi verificar a importância da anatomia foliar, visando a fornecer subsídios para a taxonomia do Complexo Briza, cuja circunscrição vem sendo objeto de discussão. Porções medianas da segunda folha abaixo da inflorescência de 21 táxons do Complexo Briza e um de Erianthecium Parodi foram coletadas, fixadas e processadas de acordo com a metodologia usual em microscopia óptica. Todas as espécies estudadas apresentam padrão anatômico festucóide, característico de gramíneas C3. Os resultados mostram que os caracteres da face abaxial da epiderme relativos à presença/ausência de células suberosas e à forma dos corpos silicosos são úteis para compreender as relações taxonômicas no Complexo Briza, distinguindo as espécies eurasiáticas das americanas. Da mesma forma, alguns caracteres da secção transversal da lâmina foliar como forma da lâmina, quantidade de esclerênquima e estrutura do mesofilo. Por outro lado, com relação às espécies americanas do Complexo Briza, os três agrupamentos aqui obtidos não correspondem a nenhuma proposta anterior de categorias taxonômicas genéricas ou infragenéricas.The aim of this study was to analyze leaf anatomy of selected taxa of the Briza Complex and also of a related genus, Erianthecium Parodi, to provide data for the taxonomy of the Complex, whose circumscription is being discussed. Middle portions of the second leaf below the inflorescence of 21 taxa of the Briza Complex and of Erianthecium bulbosum were collected, fixed and processed according to conventional methodology for light microscopy. All species present anatomical patterns typical of festucoid and C3 grasses. The results suggest that the characters of the abaxial surface of the epidermis such as presence/absence of cork cells and shape of silica bodies are useful for understanding the taxonomic relationships within the Briza Complex, distinguishing Eurasiatic species from American species. The same applies to several characters of the leaf blade in cross-section, e.g. blade shape, amount of sclerenchyma and structure of the mesophyll. On the other hand, in the American species of the "Briza Complex", the three groups obtained here do not agree with any previous proposal of generic or infrageneric taxonomic categories.

  2. An empirical test of the treatment of indels during optimization alignment based on the phylogeny of the genus Secale (Poaceae)

    DEFF Research Database (Denmark)

    Petersen, Gitte; Seberg, Ole; Aagesen, Lone

    2004-01-01

    The ability of the program POY, implementing optimization alignment, to deal with major indels is explored and discussed in connection with a phylogenetic analysis of the genus Secale based on partial Adhl sequences. The Adhl sequences used span exon 2-4. Nearly all variation is found in intron 2...... recovers both genera as monophyletic when knowledge of the duplication is incorporated in the analysis. The phylogenetic relationships within Secale are not clearly resolved. Subspecific taxa of Secale strictum have identical sequences and they are confined to a monophyletic group. However, the two...

  3. New additions to the Flora of Ethiopia and Eritrea in the families Euphorbiaceae, Fabaceae (Leguminosae), Lamiaceae, Campanulaceae, Eriocaulaceae and Poaceae

    DEFF Research Database (Denmark)

    Friis, Ib; Phillips, Sylvia M.; Gilbert, Michael G.

    2011-01-01

    During recent field work by Ib Friis and Sally Bidgood six collections were collected that did not represent taxa accounted for in the Flora of Ethiopia and Eritrea. These were Phyllanthus chevalieri, Indigofer bracteolata, Wahlenbergia paludicola, Clerodendrum triflorum, Tragus mongolorum and Hy...

  4. Autotetraploidia e número cromossómico em uma cultivar de Panicum maximum Jacq. (Gramineae / Poaceae

    Directory of Open Access Journals (Sweden)

    Caetano Creuci Maria

    2006-06-01

    Full Text Available

    O presente trabalho teve por objetivo avaliar o comportamento citológico e em especial o nível de ploidia de uma cultivar de P. maximum, denomi­nada Tanzânia, que, na realidade, é um ecótipo selvagem de origem africana. Foi empregada a metodologia convencional para estudos meióticos. As inflorescências foram fixadas em álcool acético 3:1 por 24 horas, transferidas para álcool a 70% e conservadas sob refrigeração. A técnica de esmaga­mento foi usada no preparo das lâminas. O corante foi o carmim propiônico a 1%. Foi considerado um mínimo de 200 células por planta. De forma geral, anormalidades meióticas ocorreram em 20% das células mães de pólen analisadas. Em todas as plantas avaliadas, o número de cromossomos observado nas diacineses foi 36. Entre 109 diacineses onde se realizou a contagem do número de cromossomos e se verificou os tipos de associações cromossômicas, 99 apresentaram multivalentes, com predomínio de tetravalentes. Tal ocorrência indica autotetraploidia, onde 2n=4x=36.

    Palavras-chave: associações cromossômicas multivalentes, autotetraplóide, cv. Tanzânia, número cromossômico.

  5. Retroelement insertional polymorphisms, diversity and phylogeography within diploid, D-genome Aegilops tauschii (Triticeae, Poaceae) sub-taxa in Iran.

    Science.gov (United States)

    Saeidi, Hojjatollah; Rahiminejad, Mohammad Reza; Heslop-Harrison, J S

    2008-04-01

    The diploid goat grass Aegilops tauschii (2n = 2x = 14) is native to the Middle East and is the D-genome donor to hexaploid bread wheat. The aim of this study was to measure the diversity of different subspecies and varieties of wild Ae. tauschii collected across the major areas where it grows in Iran and to examine patterns of diversity related to the taxa and geography. Inter-retroelement amplified polymorphism (IRAP) markers were used to analyse the biodiversity of DNA from 57 accessions of Ae. tauschii from northern and central Iran, and two hexaploid wheats. Key Results Eight IRAP primer combinations amplified a total of 171 distinct DNA fragments between 180 and 3200 bp long from the accessions, of which 169 were polymorphic. On average, about eight fragments were amplified with each primer combination, with more bands being amplified from accessions from the north-west of the country than from other accessions. The IRAP markers showed high levels of genetic diversity. Analysis of all accessions together did not allow the allocation of individuals to taxa based on morphology, but showed a tendency to put accessions from the north-west apart from others regions. It is speculated that this could be due to different activity of retroelements in the different regions. Within the two taxa with most accessions, there was a range of IRAP genotypes that could be correlated closely with geographical origin. This supports suggestions that the centre of origin of the species is towards the south-east of the Caspian Sea. IRAP is an appropriate marker system to evaluate genetic diversity and evolutionary relationships within the taxa, but it is too variable to define the taxa themselves, where more slowly evolving morphological, DNA sequence or chromosomal makers may be more appropriate.

  6. Taxonomy and leaf anatomy of the genus Ehrharta (Poaceae) in southern Africa: the Dura group

    OpenAIRE

    G. E. Gibbs Russel; R. P. Ellis

    1988-01-01

    The Dura species group in the genus Ehrharta Thunb. is differentiated morphologically by the perennial habit and the very large, awned, subglabrous spikelets and anatomically by the occurrence of tanniniferous cells and wax platelets obscuring the stomatal pores. The Dura group consists of two species, E. dura Nees ex Trin. and E. microlaena Nees ex Trin., which occur only in Mountain Fynbos. The group shows no clear morphological or anatomical relationship with other species groups in the ge...

  7. Calamagrostis nyingchiensis, a new combination for Deyeuxia nyingchiensis (Poaceae: Agrostidinae, and its first record from Yunnan Province, SW China

    Directory of Open Access Journals (Sweden)

    Paszko Beata

    2016-07-01

    Full Text Available Deyeuxia nyingchiensis is here recombined as Calamagrostis nyingchiensis comb. nov. as a result of recent studies of worldwide Agrostidinae. A new record of C. nyingchiensis is reported from Shangri-la (Zhongdian County in Yunnan Province, SW China. Previously, C. nyingchiensis was noted from eastern Xizang and southern Sichuan, SW China. It is compared with the morphologically similar species C. scabrescens. A map with all known geographic records of C. nyingchiensis is presented.

  8. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae cultivados en Costa Rica I: Dendrocalamus latiflorus

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Utilizando el microscopio electrónico de barrido, se evaluaron ultraestructuralmente, culmo joven (dos años de edad, brácteas del culmo, yemas, superficie abaxial de la lámina foliar y flores de Dendrocalamus latiflorus, un bambú susceptible a cambios bruscos de temperatura y precipitación, que lo hacen florecer con facilidad. Los rasgos más notables fueron la presencia de dos tipos de células operculadas en las glumas estériles de las flores, la abundancia de cera cuticular, la presencia de puntuaciones reticuladas en el xilema y los granos de polen especializados, por la presencia de discos o ventosas para su acople. Las células operculadas y los discos de acople son caracteres taxonómicos importantes.The bamboo Dendrocalamus latiflorus is easily affected by sudden changes in temperature and humidity, which cause it to bloom. We used a scanning electron microscope to describe the ultrastructure of young culm (2 years old, culm bracts, buds, abaxial surface of the leaf lamina and flowers. The most noticeable ultrastructural features were the presence of two types of operculated cells in the sterile flower glums, the abundant cuticular wax, the presence of reticulated punctuations in the xylem and pollen grains with interlocking disks or cups. The operculated cells and the interlocking disks are taxonomically important features. Rev. Biol. Trop. 54(Suppl. 2: 43-50. Epub 2006 Dec. 01.

  9. Clothianidin and Imidacloprid Residues in Poa annua (Poales: Poaceae) and Their Effects on Listronotus maculicollis (Coleoptera: Curculionidae).

    Science.gov (United States)

    Clavet, Christopher; Requintina, Matthew; Hampton, Emily; Cowles, Richard S; Byrne, Frank J; Alm, Steven R

    2014-12-01

    Competitive enzyme-linked immunosorbent assay was used to quantify the amounts of the neonicotinoids clothianidin and imidacloprid in Poa annua L. clippings from treated golf course fairways. Average clothianidin residues 7 d after application ranged from 674 to 1,550 ng/g tissue in 2012 and 455-2,220 ng/g tissue in 2013. Average clothianidin residues the day of application ranged from 17,100-38,800 ng/g tissue in 2014. Average imidacloprid residues 7 d after treatment ranged from 1,950-3,030 ng/g tissue in 2012 and 7,780-9,230 ng/g tissue in 2013. Average imidacloprid residues the day of application ranged from 31,500-40,400 ng/g tissue in 2014. Neonicotinoid or bifenthrin-neonicotinoid combination products applied in field plots in 2012 did not significantly reduce the numbers of larvae relative to the untreated control. However, in 2013, statistically significant reductions in the numbers of larvae recovered from treated field plots were associated with the presence of bifenthrin alone or when used in combination with neonicotinoid active ingredients. Listronotus maculicollis (Kirby) adults caged on neonicotinoid-, bifenthrin-, and bifenthrin-neonicotinoid-treated P. annua turf plugs fed on P. annua leaves, but mortality was only highly significantly different between treated and untreated foliage when weevils were placed on treated foliage the day after treatment and allowed to feed for 7 d. The modest degree of population suppression with bifenthrin in these experiments may not be adequate to justify the continued use of these products due to the increased risk of insecticide resistance and disruption of biological control. © 2014 Entomological Society of America.

  10. Evolutionary dynamics of the Pgk1 gene in the polyploid genus Kengyilia (Triticeae: Poaceae and its diploid relatives.

    Directory of Open Access Journals (Sweden)

    Xing Fan

    Full Text Available The level and pattern of nucleotide variation in duplicate gene provide important information on the evolutionary history of polyploids and divergent process between homoeologous loci within lineages. Kengyilia is a group of allohexaploid species with the StYP genomic constitutions in the wheat tribe. To investigate the evolutionary dynamics of the Pgk1 gene in Kengyilia and its diploid relatives, three copies of Pgk1 homoeologues were isolated from all sampled hexaploid Kengyilia species and analyzed with the Pgk1 sequences from 47 diploid taxa representing 18 basic genomes in Triticeae. Sequence diversity patterns and genealogical analysis suggested that (1 Kengyilia species from the Central Asia and the Qinghai-Tibetan plateau have independent origins with geographically differentiated P genome donors and diverged levels of nucleotide diversity at Pgk1 locus; (2 a relatively long-time sweep event has allowed the Pgk1 gene within Agropyron to adapt to cold climate triggered by the recent uplifts of the Qinghai-Tibetan Plateau; (3 sweep event and population expansion might result in the difference in the d(N/d(S value of the Pgk1 gene in allopatric Agropyron populations, and this difference may be genetically transmitted to Kengyilia lineages via independent polyploidization events; (4 an 83 bp MITE element insertion has shaped the Pgk1 loci in the P genome lineage with different geographical regions; (5 the St and P genomes in Kengyilia were donated by Pseudoroegneria and Agropyron, respectively, and the Y genome is closely related to the Xp genome of Peridictyon sanctum. The interplay of evolutionary forces involving diverged natural selection, population expansion, and transposable events in geographically differentiated P genome donors could attribute to geographical differentiation of Kengyilia species via independent origins.

  11. A phylogenetic analysis of the genus Psathyrostachys (Poaceae) based on one nuclear gene, three plastid genes, and morphology

    DEFF Research Database (Denmark)

    Petersen, Gitte; Seberg, Ole; Baden, Claus

    2004-01-01

    A phylogenetic analysis of the small, Central Asian genus Psathyrostachys Nevski is presented. The analysis is based on morphological characters and nucleotide sequence data from one nuclear gene, DMC1, and three plastid genes, rbcL, rpoA, and rpoC2. Separate analyses of the three data partitions...... (morphology, nuclear sequences, and plastid sequences) result in mostly congruent trees. The plastid and nuclear sequences produce completely congruent trees, and only the trees based on plastid sequences and morphological characters are incongruent. Combined analysis of all data results in a fairly well......-resolved strict consensus tree: Ps. rupestris is the sister to the remaining species, which are divided into two clades: one including Ps. fragilis and Ps. caduca, the other including Ps. juncea, Ps. huashanica, Ps. lanuginosa, Ps. stoloniformis, and Ps. kronenburgii. Pubescent culms and more than 20 mm long...

  12. High degree of genetic diversity among genotypes of the forage grass Brachiaria ruziziensis (Poaceae) detected with ISSR markers.

    Science.gov (United States)

    Azevedo, A L S; Costa, P P; Machado, M A; de Paula, C M P; Sobrinho, F S

    2011-11-17

    The grasses of the genus Brachiaria account for 80% of the cultivated pastures in Brazil. Despite its importance for livestock production, little information is available for breeding purposes. Embrapa has a population of B. ruziziensis from different regions of Brazil, representing most of existing variability. This population was used to initiate an improvement program based on recurrent selection. In order to assist the genetic improvement program, we estimated the molecular variability among 93 genotypes of Embrapa's collection using ISSR (inter-simple sequence repeat) markers. DNA was extracted from the leaves. Twelve ISSR primers generated 89 polymorphic bands in the 93 genotypes. The number of bands identified by each primer ranged from two to 13, with a mean of 7.41. Cluster analysis revealed a clearly distinct group, containing most of the B. ruziziensis genotypes apart from the outgroup genotypes. Genetic similarity coefficients ranged from 0.0 to 0.95, with a mean of 0.50 and analysis of molecular variance indicated higher variation within (73.43%) than among species (26.57%). We conclude that there is a high genetic diversity among these B. ruziziensis genotypes, which could be explored by breeding programs.

  13. Molecular diversity and population structure of the forage grass Hemarthria compressa (Poaceae) in south China based on SRAP markers.

    Science.gov (United States)

    Huang, L-K; Zhang, X-Q; Xie, W-G; Zhang, J; Cheng, L; Yan, H D

    2012-08-16

    Hemarthria compressa is one of the most important and widely utilized forage crops in south China, owing to its high forage yield and capability of adaptation to hot and humid conditions. We examined the population structure and genetic variation within and among 12 populations of H. compressa in south China using sequence-related amplified polymorphism (SRAP) markers. High genetic diversity was found in these samples [percentage polymorphic bands (PPB) = 82.21%, Shannon's diversity index (I) = 0.352]. However, there was relatively low level of genetic diversity at the population level (PPB = 29.17%, I = 0.155). A high degree of genetic differentiation among populations was detected based on other measures and molecular markers (Nei's genetic diversity analysis: G(ST) = 54.19%; AMOVA analysis: F(ST) = 53.35%). The SRAP markers were found to be more efficient than ISSR markers for evaluating population diversity. Based on these findings, we propose changes in sampling strategies for appraising and utilizing the genetic resources of this species.

  14. Linkage Maps of a Mediterranean x Continental Tall Fescue Population and their Comparative Analysis with Other Poaceae Species

    Czech Academy of Sciences Publication Activity Database

    Dierking, R.; Azhaguvel, P.; Kallenbach, R.; Saha, M.; Bouton, J.; Chekhovskiy, K.; Kopecký, David; Hopkins, A.

    2015-01-01

    Roč. 8, č. 1 (2015) ISSN 1940-3372 Institutional support: RVO:61389030 Keywords : FESTUCA-ARUNDINACEA SCHREB. * DIVERSITY ARRAYS TECHNOLOGY * SIMPLE SEQUENCE REPEATS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.509, year: 2015

  15. Genetic diversity analysis of the durum wheat Graziella Ra, Triticum turgidum L. subsp. durum (Desf. Husn. (Poales, Poaceae

    Directory of Open Access Journals (Sweden)

    M. Stella Colomba

    2011-06-01

    Full Text Available For the first time, the durum wheat Graziella Ra was compared to four Italian durum wheat varieties (Cappelli,Grazia, Flaminio and Svevo and to Kamut in order to preliminary characterize its genome and to investigategenetic diversity among and within the accessions by Amplified Fragment Length Polymorphisms (AFLPs,Simple Sequence Repeats (SSRs and α-gliadin gene sequence analysis. The main aim of the study was anattempt to determine the relationship between the historic accession Graziella Ra and Kamut which isconsidered an ancient relative of the durum subspecies. In addition, nutritional factors of Graziella Ra werereported. Obtained results showed that (i both AFLP and SSR molecular markers detected highly congruentpatterns of genetic diversity among the accessions showing nearly similar efficiency; (ii for AFLPs,percentage of polymorphic loci within accession ranged from 6.57% to 19.71% (mean 12.77% and, for SSRs,from 0% to 57.14% (mean 28.57%; (iii principal component analysis (PCA of genetic distance amongaccessions showed the first two axes accounting for 58.03% (for AFLPs and 61.60% (for SSRs of the totalvariability; (iv for AFLPs, molecular variance was partitioned into 80% (variance among accessions and 20%(within accession and, for SSRs, into 73% (variance among accessions and 27% (within accession; (vcluster analysis of AFLP and SSR datasets displayed Graziella Ra and Kamut into the same cluster; and (vimolecular comparison of α-gliadin gene sequences showed Graziella Ra and Kamut in separate clusters. Allthese findings indicate that Graziella Ra, although being very similar to Kamut, at least in the little part of thegenome herein investigated by molecular markers, may be considered a distinct accession showing appreciablelevels of genetic diversity and medium-high nutritional qualities.

  16. INSECTICIDAL ACTIVITIES OF ESSENTIAL OILS EXTRACTED FROM THREE SPECIES OF POACEAE ON ANOPHELES GAMBIAE SPP, MAJOR VECTOR OF MALARIA

    Directory of Open Access Journals (Sweden)

    Dominique C. K. Sohounhloué

    2010-12-01

    Full Text Available In this paper, the insecticidal activities on Anopheles gambiae spp of the essential oils (EO extracted from the dry leaves of some species collected in Benin were studied. The essential oil yields are 2.8, 1.7 and 1.4�0respectively for Cymbopogon schoanenthus (L. Spreng (CS, Cymbopogon citratus Stapf. (CC and Cymbopogon giganteus (Hochst. Chiov (CG. The GC/MS analysis showed that the EO of CS had a larger proportion in oxygenated monoterpenes (86.3�20whereas those of the sheets of CC and CG are relatively close proportions (85.5�0and 82.7�0respectively with. The piperitone (68.5�  2-carene (11.5� and -eudesmol (4.6�20are the major components of the EO of CS while trans para-mentha-1(7,8-dien-2-ol (31.9� trans para-mentha-2,8-dien-1-ol (19.6� cis para-mentha-2,8-dien-1-ol (7.2� trans piperitol (6.3�20and limonene (6.3�20prevailed in the EO of CG. The EO of CC revealed a rich composition in geranial (41.3� neral (33� myrcene (10.4� and geraniol (6.6� The biological tests have shown that these three EO induced 100�0mortality of Anopheles gambiae to 1.1, 586.58 and 1549 µg•cm-2 respectively for CC, CS and CG. These effects are also illustrated by weak lethal concentration for 50�0anopheles population (CC: 0.306; CS: 152.453 and CG: 568.327 µg•cm-2 in the same order of reactivity. The EO of CC appeared most active on two stocks (sensitive and resistant of Anopheles gambiae.

  17. Effect of genotype and environment on branching in weedy green millet (Setaria viridis) and domesticated foxtail millet (Setaria italica) (Poaceae).

    Science.gov (United States)

    Doust, Andrew N; Kellogg, Elizabeth A

    2006-04-01

    Many domesticated crops are derived from species whose life history includes weedy characteristics, such as the ability to vary branching patterns in response to environmental conditions. However, domesticated crop plants are characterized by less variable plant architecture, as well as by a general reduction in vegetative branching compared to their progenitor species. Here we examine weedy green millet and its domesticate foxtail millet that differ in the number of tillers (basal branches) and axillary branches along each tiller. Branch number in F(2:3) progeny of a cross between the two species varies with genotype, planting density, and other environmental variables, with significant genotype-environment interactions (GEI). This is shown by a complex pattern of reaction norms and by variation in the pattern of significant quantitative trait loci (QTL) amongst trials. Individual and joint analyses of high and low density trials indicate that most QTL have significant GEI. Dominance and epistasis also explain some variation in branching. Likely candidate genes underlying the QTL (based on map position and phenotypic effect) include teosinte branched1 and barren stalk1. Phytochrome B, which has been found to affect response to shading in other plants, explains little or no variation. Much variation in branching is explained by QTL that do not have obvious candidate genes from maize or rice.

  18. Cytogenetic evidence for genome elimination during microsporogenesis in interspecific hybrid between Brachiaria ruziziensis and B. brizantha (Poaceae

    Directory of Open Access Journals (Sweden)

    Andréa Beatriz Mendes-Bonato

    2006-01-01

    Full Text Available Microsporogenesis was analyzed in an interspecific hybrid between an artificially tetraploidized sexual accession of Brachiaria ruziziensis (R genome and a natural apomictic tetraploid accession of B. brizantha (B genome. Chromosomes associated predominantly as bivalents. From this phase to the end of meiosis, chromosomes presented irregular segregation and abnormal arrangement in the metaphase plate. During metaphase I, in 27.8% of meiocytes, bivalents were distributed in two metaphase plates. In anaphase I, two distinct and typical bipolar spindles were formed. In 29.7% of pollen mother cells, one genome did not divide synchronically, with chromosomes lagging behind or not segregating at all. The second division was very irregular, resulting in polyads. Based on previous results from analysis of a triploid hybrid between these species, where the R genome was eliminated by asynchrony during meiosis, it is suggested that the laggard genome in this hybrid also belongs to B. ruziziensis.

  19. Evidence for distinct roles of the SEPALLATA gene LEAFY HULL STERILE1 in Eleusine indica and Megathyrsus maximus (Poaceae).

    Science.gov (United States)

    Reinheimer, Renata; Malcomber, Simon T; Kellogg, Elizabeth A

    2006-01-01

    LEAFY HULL STERILE1 (LHS1) is an MIKC-type MADS-box gene in the SEPALLATA class. Expression patterns of LHS1 homologs vary among species of grasses, and may be involved in determining palea and lemma morphology, specifying the terminal floret of the spikelet, and sex determination. Here we present LHS1 expression data from Eleusine indica (subfamily Chloridoideae) and Megathyrsus maximus (subfamily Panicoideae) to provide further insights into the hypothesized roles of the gene. E. indica has spikelets with three to eight florets that mature acropetally; E. indica LHS1 (EiLHS1) is expressed in the palea and lemma of all florets. In contrast, M. maximus has spikelets with two florets that mature basipetally; M. maximus LHS1 (MmLHS1) is expressed in the palea and lemma of the distal floret only. These data are consistent with the hypothesis that LHS1 plays a role in determining palea and lemma morphology and specifies the terminal floret of basipetally maturing grass spikelets. However, LHS1 expression does not correlate with floret sex expression; MmLHS1 is restricted to the bisexual distal floret, whereas EiLHS1 is expressed in both sterile and bisexual floret meristems. Phylogenetic analyses reconstruct a complex pattern of LHS1 expression evolution in grasses. LHS1 expression within the gynoecium has apparently been lost twice, once before diversification of a major clade within tribe Paniceae, and once in subfamily Chloridoideae. These data suggest that LHS1 has multiple roles during spikelet development and may have played a role in the diversification of spikelet morphology.

  20. Inheritance of resistance to anti-microtubule dinitroaniline herbicides in an "intermediate" resistant biotype of Eleusine indica (Poaceae).

    Science.gov (United States)

    Zeng, L; Baird, W V

    1999-07-01

    Inheritance of resistance to the anti-microtubule dinitroaniline herbicides was investigated in a goosegrass biotype displaying an intermediate level of resistance (I). Reciprocal crosses were made between the I biotype and previously characterized susceptible (S) or resistant (R) biotypes. Eight F(1) hybrids were identified, and F(2) populations were produced by selfing. The dinitroaniline-herbicide response phenotype (DRP) of F(1) plants, and F(2) seedlings was determined using a root-growth bioassay. The DRP of F(1) plants of S × I was "susceptible" (i.e., identical to the S parental plants), and the DRP of F(1) plants of I × R was "intermediate" (i.e., identical to the I parental plants). Nonparental phenotypes were not observed in F(1) plants. Results indicated susceptibility to be dominant over intermediate resistance and intermediate resistance to be dominant over high resistance. Analysis of reciprocal crosses ruled out any role for cytoplasmic inheritance. When treated at the discriminating concentration (e.g., 0.28 ppm oryzalin), F(2) seedlings of S × I were classified as either S or I phenotype, and F(2) seedlings of I × R were classified as either I or R phenotype. Again, nonparental phenotypes were not observed. The 3:1 (S:I or I:R) segregation ratios in F(2) seedlings were consistent across all eight F(2) families. The results show that dinitroaniline herbicide resistance in the I biotype of goosegrass is inherited as a single, nuclear gene. Furthermore, it suggests that dinitroaniline resistance in goosegrass is controlled by three alleles at a single locus (i.e., Drp-S, Drp-i, and Drp-r).

  1. Genetic Variability and Population Structure of the Potential Bioenergy Crop Miscanthus sinensis (Poaceae in Southwest China Based on SRAP Markers

    Directory of Open Access Journals (Sweden)

    Gang Nie

    2014-08-01

    Full Text Available The genus Miscanthus has great potential as a biofuel feedstock because of its high biomass, good burning quality, environmental tolerance, and good adaptability to marginal land. In this study, the genetic diversity and the relationship of 24 different natural Miscanthus sinensis populations collected from Southwestern China were analyzed by using 33 pairs of Sequence Related Amplified Polymorphism (SRAP primers. A total of 688 bands were detected with 646 polymorphic bands, an average of 19.58 polymorphic bands per primer pair. The average percentage of polymorphic loci (P, gene diversity (H, and Shannon’s diversity index (I among the 24 populations are 70.59%, 0.2589, and 0.3836, respectively. The mean value of total gene diversity (HT was 0.3373 ± 0.0221, while the allelic diversity within populations (HS was 0.2589 ± 0.0136 and the allelic diversity among populations (DST was 0.0784. The mean genetic differentiation coefficient (Gst = 0.2326 estimated from the detected 688 loci indicated that there was 76.74% genetic differentiation within the populations, which is consistent with the results from Analysis of Molecular Variance (AMOVA analysis. Based upon population structure and phylogenetic analysis, five groups were formed and a special population with mixed ancestry was inferred indicating that human-mediated dispersal may have had a significant effect on population structure of M. sinensis. Evaluating the genetic structure and genetic diversity at morphological and molecular levels of the wild M. sinensis in Southwest China is critical to further utilize the wild M. sinensis germplasm in the breeding program. The results in this study will facilitate the biofuel feedstock breeding program and germplasm conservation.

  2. Interactive effects of aluminum, phosphorus and mycorrhizae on growth and nutrient uptake of Panicum virgatum L. (Poaceae).

    Science.gov (United States)

    Koslowsky, S D; Boener, R E

    1989-01-01

    The effects of Al on Panicum virgatum (switchgrass), a widespread perennial grass, were determined in relation to factors which might interact with Al in the soil. Plants were grown for 8 weeks in sand culture and were treated with 3 Al levels (0.5, 2.0, 5.0 mM), 2 P levels (0.065, 0.161 mM), 2 inoculum types (vesicular-arbuscular mycorrhizal (VAM) inoculum or VAM-free soil inoculum) and 2 inoculum sources (a high Al forest in NY or a low Al forest in Ohio) in a factorial design. Plant growth decreased with increasing Al and increased with increasing P, but the Al effect was less at high P than low P. VAM-inoculated plants outgrew non-VAM plants, especially at low and medium Al levels. Total P and Ca uptake decreased with increasing Al concentration, especially at low P levels. VAM inoculation did not result in increased P uptake at any Al level though VAM plants took up significantly more Ca than non-VAM plants at any Al level. VAM plants had lower tissue Al concentrations and took up less Al than non-VAM plants; Al uptake increased with increasing soil Al in non-VAM plants but not in VAM plants. Plants given inoculum from the high Al site had significantly lower tissue Al than plants given the low Al site inoculum, regardless of VAM status. We conclude that the presence of a VAM infection, moderate levels of soil P, and the source of the inoculum can reduce the effects of soluble Al. We discuss potential physiological and edaphic mechanisms by which Al may be immobilized and Ca availability increased in the presence of VAM fungi and other soil microflora.

  3. The karyotype of Festucopsis serpentini (Poaceae Triticeae) from Albania studied by banding techniques and in situ hybridization

    DEFF Research Database (Denmark)

    Linde-Laursen, I.; Seberg, O.; Frederiksen, S.

    1996-01-01

    -chromosomes, a metacentric and a submetacentric pair. SAT-chromosomes from one population carried exclusively minute satellites, whereas SAT-chromosomes from another population also carried larger polymorphic satellites, suggesting a geographical differentiation. The existence of four chromosomes with nucleolus forming...

  4. Comparison of the karyotypes ofPsathyrostachys juncea andP. huashanica (Poaceae) studied by banding techniques

    DEFF Research Database (Denmark)

    Linde-Laursen, Ib; Bothmer, R. von

    1986-01-01

    . The patterns of both taxa are polymorphic, supporting that both taxa are outbreeders. The karyotypic characters suggest that P. juncea is more closely related to P. fragilis than either is to P. huashanica. N-banding stains weakly. Silver nitrate staining demonstrates that nucleolus organizers of both species...... have different nucleolus forming capacities. The presence of micronucleoli suggests that both species have an extra unidentified chromosome with nucleolus forming capacity....

  5. Transient heat stress compromises the resistance of wheat (Poales: Poaceae) seedlings to Hessian fly (Diptera: Cecidomyiidae) infestation.

    Science.gov (United States)

    Currie, Yaleaka; Moch, John; Underwood, Joshua; Kharabsheh, Hamzah; Quesenberry, Amy; Miyagi, Risa; Thomas, Carolyn; Boney, Melanie; Woods, Samantha; Chen, Ming-Shun; Zhu, Lieceng

    2014-02-01

    Heat stress exerts a profound impact on the resistance of plants to parasites. In this research, we investigated the impact of an acute transient heat stress on the resistance of the wheat line 'Molly,' which contains the R gene H13, to an avirulent Hessian fly (Mayetiola destructor (Say)) population. We found that a significant portion of Molly seedlings stressed at 40 degrees C for 6 h during or after the initial Hessian fly larval attack became susceptible to otherwise avirulent insects, whereas unstressed control plants remained 100% resistant. Specifically, 77.8, 73.3, 83.3, and 46.7% of plants heat stressed at 0, 6,12, and 24 h, respectively, after the initial larval attack became susceptible. Biochemical analysis revealed that heat stress caused a transient decrease in 12-oxo-phytodienoic acid, but an increase in salicylic acid accumulation in Molly plants. The change in phytohormones after heat stress and Hessian fly infestation was not observed in 'Newton,' a near-isogenic but Hessian fly susceptible wheat line. Instead, heat stress caused a relatively prolonged reduction in palmitoleic acid. The role of phytohormones in heat-induced loss of wheat resistance was discussed.

  6. The effects of gap size and disturbance type on invasion of wet pine savanna by cogongrass, Imperata cylindrica (Poaceae)

    Science.gov (United States)

    King, S.E.; Grace, J.B.

    2000-01-01

    Cogongrass is a nonindigenous species perceived to threaten native communities of the southeastern United States through modification of species composition and alteration of community processes. To examine how gap size and disturbance type influence the invasion of wet pine savannas by cogongrass, we performed three field experiments to evaluate the response of cogongrass seeds and transplanted seedlings to four different gap sizes, four types of site disturbance, and recent burning of savanna vegetation. Cogongrass germinated, survived, and grew in all gap sizes, from 0 to 100 cm in diameter. Similarly, disturbance type had no effect on germination or seedling and transplant survival. Tilling, however, significantly enhanced transplanted seedling growth, resulting in a tenfold increase in biomass over the other disturbance types. Seedling survival to 1 and 2 mo was greater in burned savanna than unburned savanna, although transplant survival and growth were not affected by burning. Results of this study suggest that cogongrass can germinate, survive, and grow in wet pine savanna communities regardless of gap size or type of disturbance, including burning. Burning of savanna vegetation may enhance establishment by improving early seedling survival, and soil disturbance can facilitate invasion of cogongrass by enhancing plant growth.

  7. THE RESURRECTION PLANT TRIPOGON SPICATUS (POACEAE HARBORS A DIVERSITY OF PLANT GROWTH PROMOTING BACTERIA IN NORTHEASTERN BRAZILIAN CAATINGA

    Directory of Open Access Journals (Sweden)

    Paulo Ivan Fernandes-Júnior

    2015-08-01

    Full Text Available Plant species that naturally occur in the Brazilian Caatinga(xeric shrubland adapt in several ways to these harsh conditions, and that can be exploited to increase crop production. Among the strategic adaptations to confront low water availability, desiccation tolerance stands out. Up to now, the association of those species with beneficial soil microorganisms is not well understood. The aim of this study was to characterize Tripogon spicatusdiazotrophic bacterial isolates from the Caatingabiome and evaluate their ability to promote plant growth in rice. Sixteen bacterial isolates were studied in regard to their taxonomic position by partial sequencing of the 16S rRNA gene, putative diazotrophic capacity, in vitro indole-acetic acid (IAA production and calcium phosphate solubilization, metabolism of nine different C sources in semi-solid media, tolerance to different concentrations of NaCl to pHs and intrinsic resistance to nine antibiotics. Finally, the ability of the bacterial isolates to promote plant growth was evaluated using rice (Oryza sativa as a model plant. Among the 16 isolates evaluated, eight of them were classified as Enterobacteriaceae members, related to Enterobacter andPantoeagenera. Six other bacteria were related toBacillus, and the remaining two were related toRhizobiumand Stenotrophomonas.The evaluation of total N incorporation into the semi-solid medium indicated that all the bacteria studied have putative diazotrophic capacity. Two bacteria were able to produce more IAA than that observed for the strain BR 11175Tof Herbaspirillum seropedicae.Bacterial isolates were also able to form a microaerophilic pellicle in a semi-solid medium supplemented with different NaCl concentrations up to 1.27 mol L-1. Intrinsic resistance to antibiotics and the metabolism of different C sources indicated a great variation in physiological profile. Seven isolates were able to promote rice growth, and two bacteria were more efficient than the reference strainAzospirillum brasilense, Ab-V5. The results indicate the potential of T. spicatus as native plant source of plant growth promoting bacteria.

  8. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae) cultivados en Costa Rica III: Dendrocalamus giganteus

    OpenAIRE

    Mayra Montiel; Ethel Sánchez

    2006-01-01

    Dendrocalamus giganteus es una de las especies de bambú más grandes y fuertes, y es ampliamente utilizada con propósitos varios. Se llevó a cabo un análisis ultraestructural de una población costarricense, determinando tres formas de acumulación de la cera cuticular en forma de papilas céricas. En la zona abaxial de la lámina foliar se aprecian estructuras cuadradas, constituidas por dos células de sílice en los extremos y en las partes laterales papilas céricas dobles, en el centro hay papil...

  9. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae cultivados en Costa Rica III: Dendrocalamus giganteus

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Dendrocalamus giganteus es una de las especies de bambú más grandes y fuertes, y es ampliamente utilizada con propósitos varios. Se llevó a cabo un análisis ultraestructural de una población costarricense, determinando tres formas de acumulación de la cera cuticular en forma de papilas céricas. En la zona abaxial de la lámina foliar se aprecian estructuras cuadradas, constituidas por dos células de sílice en los extremos y en las partes laterales papilas céricas dobles, en el centro hay papilas céricas esféricas. Estas estructuras son únicas para este especie, por lo que tienen alto valor taxonómico.Dendrocalamus giganteus is one of the biggest, strongest and most used bamboos. An ultrastructural analysis of samples from a Costa Rican population showed that there are three forms of cuticular wax accumulations, shaped like ceric papillae. In the abaxial zone of the leaf lamina there are square structures composed by two silica cells in the boundaries and double ceric papillae in the lateral parts; in the center there are spherical papillae. These structures are unique for this species. Rev. Biol. Trop. 54(Suppl. 2: 59-63. Epub 2006 Dec. 01.

  10. Characterization of genome in tetraploid StY species of Elymus (Triticeae: Poaceae) using sequential FISH and GISH.

    Science.gov (United States)

    Liu, Ruijuan; Wang, Richard R-C; Yu, Feng; Lu, Xingwang; Dou, Quanwen

    2017-08-01

    Genomes of ten species of Elymus, either presumed or known as tetraploid StY, were characterized using fluorescence in situ hybridization (FISH) and genomic in situ hybridization (GISH). These tetraploid species could be grouped into three categories. Type I included StY genome reported species-Roegneria pendulina, R. nutans, R. glaberrima, R. ciliaris, and Elymus nevskii, and StY genome presumed species-R. sinica, R. breviglumis, and R. dura, whose genome could be separated into two sets based on different GISH intensities. Type I genome constitution was deemed as putative StY. The St genome were mainly characterized with intense hybridization with pAs1, fewer AAG sites, and linked distribution of 5S rDNA and 18S-26S rDNA, while the Y genome with less intense hybridization with pAs1, more varied AAG sites, and isolated distribution of 5S rDNA and 18S-26S rDNA. Nevertheless, further genomic variations were detected among the different StY species. Type II included E. alashanicus, whose genome could be easily separated based on GISH pattern. FISH and GISH patterns suggested that E. alashanicus comprised a modified St genome and an unknown genome. Type III included E. longearistatus, whose genome could not be separated by GISH and was designated as St l Y l . Notably, a close relationship between S l and Y l genomes was observed.

  11. Variation and geographical distribution of ploidy levels in Pennisetum section Brevivalvula (Poaceae) in Burkina Faso, Benin and southern Niger

    OpenAIRE

    Renno, Jean-François; Schmelzer, G.; De Jong, J.H.

    1995-01-01

    #Pennisetum$ sect. #Brevivalvula$ is a species complex characterized by polyploidy and apoximis. Ploidy level was assessed by DAPI-flow cytometry for 304 plants of the section, originating from Burkina Faso, Benin and southern Niger. The results were confirmed for 54 plants based on chromosome counts. The samples show four euploidy levels (with x = 9) distributed among five species : #P. hordeoides$ (2n = 36, 54), #P. pedicellatum$ (2n = 36, 45, 54), #P. polystachion$ (2n = 18, 36, 45, 54), #...

  12. Evolution and diversity of PAPhy_a phytase in the genepool of wheat (Triticum aestivum L., Poaceae)

    DEFF Research Database (Denmark)

    Madsen, Claus Krogh; Petersen, Gitte; Seberg, Ole

    2017-01-01

    Higher phytase activity in food and feedstuffs is desirable in order to counter the antinutritional effects of phytate. The most promising platform where this might be achieved through plant breeding is wheat and its Triticeae relatives. They already accumulate notable amounts of phytase...

  13. Population genetic analysis of Bromus tectorum (Poaceae) indicates recent range expansion may be facilitated by specialist genotypes

    Science.gov (United States)

    Keith R. Merrill; Susan E. Meyer; Craig E. Coleman

    2012-01-01

    The mechanisms for range expansion in invasive species depend on how genetic variation is structured in the introduced range. This study examined neutral genetic variation in the invasive annual grass Bromus tectorum in the Intermountain Western United States. Patterns of microsatellite (SSR) genotype distribution in this highly inbreeding species were used to make...

  14. The pollen spectrum of honeys of Lipnik Gmina (Świętokrzyskie Province

    Directory of Open Access Journals (Sweden)

    Ernest Stawiarz

    2012-12-01

    Full Text Available During 2003 and 2004 apicultural seasons, 25 samples of honeys were collected in 10 localities of Lipnik (świętokrzyskie Province countryside. Pollen analysis was made according to the requirements of the International Commission for Bee Botany IUSB (Louveaux et al., 1978. There were identified pollen of 85 taxa in the examined samples of honeys: pollen of 62 nectariferous and 23 non-nectariferous plants. Participation of non-nectariferous plant pollen in particular samples ranged between 0.3 and 28.4%. Among the nectariferous plant pollen, the highest pollen frequency (above 50% have been stated for Brassicaceae (with Brassica napus, Prunus type, Trifolium repens, Anthriscus type, Salix, Aesculus, Rubus type, Tilia, Taraxacum type, Galeopsis and Heracleum type, among non-nectariferous plans: Poaceae, Papaver and Fragaria. On average, a particular honey contained 16 pollen types of nectariferous plants (range 7-26 and 7 of non-nectariferous (range 1-13. Among the examined samples, there were 11 specific honeys: 7 compatible with the Polish Standard - 4 samples of Brassica napus honeys, 2 Robinia pseudacacia, 1 Tilia, and 4 samples of honeys out of his this standard. There were 3 Galeopsis honeys and 1 honey from Phacelia. The remaining 14 samples were classified as multifloral honeys compatible with the Polish Standard. The woods and scrubs as well as meadows and pastures supplied main sources of honeybee flow in the examined area.

  15. Ethnoveterinary medicines used to treat endoparasites and stomach problems in pigs and pets in British Columbia, Canada.

    Science.gov (United States)

    Lans, Cheryl; Turner, Nancy; Khan, Tonya; Brauer, Gerhard

    2007-09-30

    This paper documents the medicinal plants used to treat endoparasites and stomach problems in dogs, cats and pigs in British Columbia, Canada. Ethnoveterinary data was collected over a 6-month period in 2003. The majority of the information on pets came from 2 naturopaths, 10 herbalists, 5 dog trainers, breeders and pet shop owners, 9 holistic veterinarians and 6 of 27 organic farmers. Two pig farmers joined the study in the final stages. The following plants were used as anthelmintics: Artemisia cina O. Berg and C.F. Schmidt, Artemisia vulgaris L., Artemisia annua, Calendula officinalis L., Echinacea purpurea (L.) Moench (all Asteraceae), Mentha piperita L. and Salvia officinalis L. (Lamiaceae) (Allium sativum L. (Alliaceae), Cucurbita pepo L. (Cucurbitaceae), Eugenia caryophyllata Thunb (Myrtaceae), Gentiana lutea L. (Gentianaceae), Hydrastis canadensis L. (Ranunculaceae), Juglans nigra L. (Juglandaceae), Olea europaea L. (Oleaceae) and Ruta graveolens L. (Rutaceae)). Stomach problems were treated with: Achillea millefolium L. (Asteraceae), Aloe vera (L.) Burm. f. (Asphodelaceae), Elytrigia repens (L.) Desv. ex Nevski (Poaceae), Frangula purshiana (DC.) Cooper (Rhamnaceae), Juniperus communis L. (Cupressaceae), Melissa officinalis L. and M. piperita L. (Lamiaceae), Petroselinum crispum L. (Apiaceae), Plantago major L. and Plantago ovata Forssk. (Plantaginaceae) Rumex crispus L. and Rumex obtusifolius L. (Polygonaceae), Ulmus fulva Michx. (Ulmaceae) and Zingiber officinalis Roscoe (Zingiberaceae). There is insufficient information available to assess the anthelmintic efficacies of C. officinalis, Salvia officinalis, Eugenia caryophyllata and O. europaea; the other plants have mid- to high-level validity for their ethnoveterinary uses.

  16. Application of Aspergillus niger-treated agrowaste residue and Glomus mosseae for improving growth and nutrition of Trifolium repens in a Cd-contaminated soil.

    Science.gov (United States)

    Medina, A; Vassilev, N; Barea, J M; Azcón, R

    2005-04-06

    The microbial transformation of sugar beet (SB) agrowaste with or without rock-phosphate (RP) has utility for the improvement of plant growth in a Cd (5 microg g-1) artificially contaminated soil, particularly when the soil is co-inoculated with arbuscular mycorrhizal (AM) fungus Glomus mosseae isolated from a Cd-polluted area. Under such Cd-polluted conditions, the limited growth, mineral nutrition, symbiotic developments (nodulation and AM-colonization) and soil enzymatic activities were stimulated using SB or SB+RP as soil amendments and G. mosseae as inoculant. G. mosseae enhanced plant establishment in a higher extent in amended soil; it is probably due to the interactive effect increasing the potential fertility of such compounds and its ability for decreasing Cd transfer from soil to plant. The amount of Cd transferred from soil solution to biomass of AM-colonized plants ranged from 0.09 microg Cd g-1 (in SB+RP-amended soil) to 0.6 microg Cd g-1 (in non-amended soil). Nodule formation was more sensitive to Cd than AM-colonization, and both symbioses were stimulated in amended soils. Not only AM-colonization but also amendments were critical for plant growth and nutrition in Cd-polluted soil. The high effectiveness of AM inoculum increasing nutrients and decreasing Cd in amended soil indicated the positive interaction of these treatments in increasing plant tolerance to Cd contamination.

  17. Diversity of Penicillium section Citrina within the fynbos biome of South Africa, including a new species from a Protea repens infructescence.

    Science.gov (United States)

    Visagie, Cobus M; Seifert, Keith A; Houbraken, Jos; Samson, Robert A; Jacobs, Karin

    2014-01-01

    During a survey of the fynbos biome in the Western Cape of South Africa, 61 Penicillium species were isolated and nine belong to Penicillium section Citrina. Based on morphology and multigene phylogenies, section Citrina species were identified as P. cairnsense, P. citrinum, P. pancosmium, P. pasqualense, P. sanguifluum, P. sizovae, P. sumatrense and P. ubiquetum. One of the species displayed unique phenotypic characters and DNA sequences and is described here as P. sucrivorum. Multigene phylogenies consistently resolved the new species in a clade with P. aurantiacobrunneum, P. cairnsense, P. miczynksii, P. neomiczynskii and P. quebecense. However, ITS, β-tubulin and calmodulin gene sequences are unique for P. sucrivorum and growth rates on various media, the ability to grow at 30 C, a positive Ehrlich reaction and the absence of sclerotia on all media examined, distinguish P. sucrivorum from all of its close relatives. © 2014 by The Mycological Society of America.

  18. Environmental Impact Research Program: White Clover (Trifolium repens). Section 7.3.5, US Army Corps of Engineers Wildlife Resources Management Manual.

    Science.gov (United States)

    1986-07-01

    types where they are common (Kohn and Mooty 1971). Rumen analyses of white-tailed deer in Montana showed that forbs comprised 80% of summer samples...frequency of occurrence in deer rumens collected from January through March in the Northern Black Hills. Bluegrass- white clover meadows are also...CAUTIONS AND LIMITATIONS White clover, like most legumes, occasionally causes bloat in animals, particularly cattle and sheep that have overfilled

  19. Ploidy level variability in South American fescues (festuca L., poaceae): use of flow cytometry in up to 5 1/2-year-old caryopses and herbarium specimens.

    Science.gov (United States)

    Smarda, P; Stancík, D

    2006-01-01

    Ploidy levels and chromosome numbers for 24 species of Festuca L. from 29 sites in Bolivia, Colombia, Ecuador and Venezuela are given. The ploidy level of 22 species is reported for the first time. A higher proportion of tetraploids in northern South America and the high frequency of polyploids in the whole continent are documented. In combination with chromosome counts, ploidy level was determined using flow cytometry in 4- to 5 1/2 -year-old herbarium specimens and mature caryopses. Flow cytometric determination from seeds was more reliable than determination from herbarium specimens. In herbarium specimens, the youngest, fresh green leaves, still hidden in sheaths, seem to be most suitable for cytometric determination. In old, brownish leaves, or poorly preserved herbarium specimens, the degradation of DNA signal in flow histograms was documented. DNA content measured in seeds was always higher than that measured in herbarium specimens, which may be caused by the presence of different cytosolic compounds. Differences of about 15% in relative DNA content of F. sodiroana and F. vaginalis was found in simultaneous measurements in seeds.

  20. Comparison of the Giemsa C-banded and N-banded karyotypes of two Elymus species, E. dentatus and E. glaucescens (Poaceae; Triticeae)

    DEFF Research Database (Denmark)

    Linde-Laursen, I.; Seberg, O.; Salomon, B.

    1994-01-01

    The karyotypes of Elymus dentatus from Kashmir and E. glaucescens from Tierra del Fuego, both carrying genomes S and H, were investigated by C- and N-banding. Both taxa had 2n = 4x = 28. The karyotype of E. dentatus was symmetrical with large chromosomes. It had 18 metacentric, four submetacentric...

  1. Membrane Stabilization and Detoxification of Acetaminophen-Mediated Oxidative Onslaughts in the Kidneys of Wistar Rats by Standardized Fraction of Zea mays L. (Poaceae), Stigma maydis

    Science.gov (United States)

    Sabiu, S.; O'Neill, F. H.

    2016-01-01

    This study evaluated membrane stabilization and detoxification potential of ethyl acetate fraction of Zea mays L., Stigma maydis in acetaminophen-induced oxidative onslaughts in the kidneys of Wistar rats. Nephrotoxic rats were orally pre- and posttreated with the fraction and vitamin C for 14 days. Kidney function, antioxidative and histological analyses were thereafter evaluated. The acetaminophen-mediated significant elevations in the serum concentrations of creatinine, urea, uric acid, sodium, potassium, and tissue levels of oxidized glutathione, protein-oxidized products, lipid peroxidized products, and fragmented DNA were dose-dependently assuaged in the fraction-treated animals. The fraction also markedly improved creatinine clearance rate, glutathione, and calcium concentrations as well as activities of superoxide dismutase, catalase, glutathione reductase, and glutathione peroxidase in the nephrotoxic rats. These improvements may be attributed to the antioxidative and membrane stabilization activities of the fraction. The observed effects compared favorably with that of vitamin C and are informative of the fraction's ability to prevent progression of renal pathological conditions and preserve kidney functions as evidently supported by the histological analysis. Although the effects were prominently exhibited in the fraction-pretreated groups, the overall data from the present findings suggest that the fraction could prevent or extenuate acetaminophen-mediated oxidative renal damage via fortification of antioxidant defense mechanisms. PMID:27579048

  2. Kinetics of α-amylase and α-glucosidase inhibitory potential of Zea mays Linnaeus (Poaceae), Stigma maydis aqueous extract: An in vitro assessment.

    Science.gov (United States)

    Sabiu, S; O'Neill, F H; Ashafa, A O T

    2016-05-13

    Corn silk (Zea mays L., Stigma maydis) is an important herb used traditionally in many parts of the world to treat array of diseases including diabetes mellitus. Inhibitors of α-amylase and α-glucosidase offer an effective strategy to modulate levels of post prandial hyperglycaemia via control of starch metabolism. This study evaluated α-amylase and α-glucosidase inhibitory potentials of corn silk aqueous extract. Active principles and antioxidant attributes of the extract were also analysed. The α-amylase inhibitory potential of the extract was investigated by reacting its different concentrations with α-amylase and starch solution, while α-glucosidase inhibition was determined by pre-incubating α-glucosidase with different concentrations of the extract followed by addition of p-nitrophenylglucopyranoside. The mode(s) of inhibition of the enzymes were determined using Lineweaver-Burke plot. In vitro analysis of the extract showed that it exhibited potent and moderate inhibitory potential against α-amylase and α-glucosidase, respectively. The inhibition was concentration-dependent with respective half-maximal inhibitory concentration (IC50) values of 5.89 and 0.93mg/mL. Phytochemical analyses revealed the presence of alkaloids, flavonoids, phenols, saponins, tannins and phytosterols as probable inhibitory constituents. Furthermore, the extract remarkably scavenges reactive oxygen species like DPPH and nitric oxide radicals, elicited good reducing power and a significant metal chelating attributes. Overall, the non-competitive and uncompetitive mechanism of action of corn silk extract is due to its inhibitory effects on α-amylase and α-glucosidase, respectively. Consequently, this will reduce the rate of starch hydrolysis, enhance palliated glucose levels, and thus, lending credence to hypoglycaemic candidature of corn silk. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  3. Genetic and morphological differentiation between Melica ciliata L. and M. transsilvanica Schur (Poaceae in Europe reveals the non-presence of M. ciliata in the Polish flora

    Directory of Open Access Journals (Sweden)

    Magdalena Szczepaniak

    2011-12-01

    Full Text Available A good knowledge of species delimitation is crucial for the biodiversity protection and the conservation of wild species. We studied the efficiency of AFLP markers and morphological characters to assist species determination for Melica ciliata L. and M. transsilvanica Schur within European range of distribution, including isolated and range-limit populations of "M. ciliata" (i.e. M. cf. ciliata from the Polish Sudetes, where it is regarded as critically endangered. AFLP markers were found to be more effective then morphological characters (more or less continuous in distinguishing the both studied species. AMOVA revealed very low genetic diversity within populations and high differentiation among populations of M. ciliata and M. transsilvanica (FST = 0.89 and 0.95, respectively. The species-diagnostic AFLP markers of M. transsilvanica shared with "M. ciliata" from the Sudetes were detected. On the other hand, no species-diagnostic genetic markers of M. ciliata or hybrid-diagnostic markers of M. × thuringiaca were found within "M. ciliata". PCoA and NJ showed an overlapping genetic diversity of "M. ciliata" and M. transsilvanica. Hierar­chical AMOVA supported the absence of a significant genotypic distinction between "M. ciliata" and M. transsilvanica. ANOVA showed that the length ratio of lower to upper glumes was the best morphological character to discriminate between M. ciliata and M. transsilvanica. Combined morphological and genetic data show that M. ciliata is not currently present in Poland as its putative Polish populations represent M. transsilvanica. A significant decrease in genetic varia­bility that could influence viability was not observed the in Sudetian populations of M. transsilvanica. However, the population size changes significantly as a result of plant succession. Correction of the northern limit of the continuous distribution of M. ciliata L. in Central Europe is presented.

  4. Assessment of Functional EST-SSR Markers (Sugarcane in Cross-Species Transferability, Genetic Diversity among Poaceae Plants, and Bulk Segregation Analysis

    Directory of Open Access Journals (Sweden)

    Shamshad Ul Haq

    2016-01-01

    Full Text Available Expressed sequence tags (ESTs are important resource for gene discovery, gene expression and its regulation, molecular marker development, and comparative genomics. We procured 10000 ESTs and analyzed 267 EST-SSRs markers through computational approach. The average density was one SSR/10.45 kb or 6.4% frequency, wherein trinucleotide repeats (66.74% were the most abundant followed by di- (26.10%, tetra- (4.67%, penta- (1.5%, and hexanucleotide (1.2% repeats. Functional annotations were done and after-effect newly developed 63 EST-SSRs were used for cross transferability, genetic diversity, and bulk segregation analysis (BSA. Out of 63 EST-SSRs, 42 markers were identified owing to their expansion genetics across 20 different plants which amplified 519 alleles at 180 loci with an average of 2.88 alleles/locus and the polymorphic information content (PIC ranged from 0.51 to 0.93 with an average of 0.83. The cross transferability ranged from 25% for wheat to 97.22% for Schlerostachya, with an average of 55.86%, and genetic relationships were established based on diversification among them. Moreover, 10 EST-SSRs were recognized as important markers between bulks of pooled DNA of sugarcane cultivars through BSA. This study highlights the employability of the markers in transferability, genetic diversity in grass species, and distinguished sugarcane bulks.

  5. Relative efficiencies of the Burkard 7-Day, Rotorod and Burkard Personal samplers for Poaceae and Urticaceae pollen under field conditions

    DEFF Research Database (Denmark)

    Peel, Robert George; Kennedy, Roy; Smith, Matt

    2014-01-01

    Introduction: In aerobiological studies it is often necessary to compare concentration data recorded with different models of sampling instrument. Sampler efficiency typically varies from device to device, and depends on the target aerosol and local atmospheric conditions. To account for these di...

  6. Seed dormancy, seedling establishment and dynamics of the soil seed bank of Stipa bungeana (Poaceae on the Loess Plateau of northwestern China.

    Directory of Open Access Journals (Sweden)

    Xiao Wen Hu

    Full Text Available Studying seed dormancy and its consequent effect can provide important information for vegetation restoration and management. The present study investigated seed dormancy, seedling emergence and seed survival in the soil seed bank of Stipa bungeana, a grass species used in restoration of degraded land on the Loess Plateau in northwest China. Dormancy of fresh seeds was determined by incubation of seeds over a range of temperatures in both light and dark. Seed germination was evaluated after mechanical removal of palea and lemma (hulls, chemical scarification and dry storage. Fresh and one-year-stored seeds were sown in the field, and seedling emergence was monitored weekly for 8 weeks. Furthermore, seeds were buried at different soil depths, and then retrieved every 1 or 2 months to determine seed dormancy and seed viability in the laboratory. Fresh seeds (caryopses enclosed by palea and lemma had non-deep physiological dormancy. Removal of palea and lemma, chemical scarification, dry storage (afterripening, gibberellin (GA3 and potassium nitrate (KNO3 significantly improved germination. Dormancy was completely released by removal of the hulls, but seeds on which hulls were put back to their original position germinated to only 46%. Pretreatment of seeds with a 30% NaOH solution for 60 min increased germination from 25% to 82%. Speed of seedling emergence from fresh seeds was significantly lower than that of seeds stored for 1 year. However, final percentage of seedling emergence did not differ significantly for seeds sown at depths of 0 and 1 cm. Most fresh seeds of S. bungeana buried in the field in early July either had germinated or lost viability by September. All seeds buried at a depth of 5 cm had lost viability after 5 months, whereas 12% and 4% seeds of those sown on the soil surface were viable after 5 and 12 months, respectively.

  7. Membrane Stabilization and Detoxification of Acetaminophen-Mediated Oxidative Onslaughts in the Kidneys of Wistar Rats by Standardized Fraction of Zea mays L. (Poaceae, Stigma maydis

    Directory of Open Access Journals (Sweden)

    S. Sabiu

    2016-01-01

    Full Text Available This study evaluated membrane stabilization and detoxification potential of ethyl acetate fraction of Zea mays L., Stigma maydis in acetaminophen-induced oxidative onslaughts in the kidneys of Wistar rats. Nephrotoxic rats were orally pre- and posttreated with the fraction and vitamin C for 14 days. Kidney function, antioxidative and histological analyses were thereafter evaluated. The acetaminophen-mediated significant elevations in the serum concentrations of creatinine, urea, uric acid, sodium, potassium, and tissue levels of oxidized glutathione, protein-oxidized products, lipid peroxidized products, and fragmented DNA were dose-dependently assuaged in the fraction-treated animals. The fraction also markedly improved creatinine clearance rate, glutathione, and calcium concentrations as well as activities of superoxide dismutase, catalase, glutathione reductase, and glutathione peroxidase in the nephrotoxic rats. These improvements may be attributed to the antioxidative and membrane stabilization activities of the fraction. The observed effects compared favorably with that of vitamin C and are informative of the fraction’s ability to prevent progression of renal pathological conditions and preserve kidney functions as evidently supported by the histological analysis. Although the effects were prominently exhibited in the fraction-pretreated groups, the overall data from the present findings suggest that the fraction could prevent or extenuate acetaminophen-mediated oxidative renal damage via fortification of antioxidant defense mechanisms.

  8. A new species of Stenodiplosis (Diptera: Cecidomyiidae) on Spartina grasses (Poaceae) with notes on its biology and its parasitoid Tetrastichus bromi (Hymenoptera: Eulophidae).

    Science.gov (United States)

    López, J Manuel Perilla; Johnson, Paul J; Gagné, Raymond J; Boe, Arvid

    2015-12-09

    Stenodiplosis spartinae Gagné new species (Diptera: Cecidomyiidae) is described from eastern South Dakota and coastal North Carolina, and compared with other American congeners. The known host plants are Spartina alterniflora and S. pectinata. The larva is a seed predator of the ovule and immature caryopsis of the host plant. Adult activity is from the early emergence of the host inflorescence through anthesis. Oviposition occurs in the floret with eggs laid under the edges of the palea and lemma. The larva apparently overwinters in dehisced spikelets in the soil among rhizomes of S. pectinata, with pupation in late spring. Laboratory emergence and field activity of the adults suggest a potentialsecond or third generation developing on late emerging inflorescences. Larval feeding does not induce external color or shape changes in the spikelet. Apparently all three instars are ectoparasitized by Tetrastichus bromi Kostyukov (Hymenoptera: Eulophidae) that was probably introduced to North America in the late 1800's and is inculcated into parasitoid guilds of several Stenodiplosis species. Resource partitioning appears to occur between the gall midge and early instars of Aethes spartinana Barnes and McDunnough (Lepidoptera: Tortricidae) that feed on maturing caryopses. The feeding of this gall midge and the moth probably account for most of the reduced seed production in both natural and agronomic populations of S. pectinata.

  9. Extended distribution of endemic Travancore Murainagrass Ischaemum travancorense Stapf ex C.E.C. Fisch. (Poaceae to central India

    Directory of Open Access Journals (Sweden)

    Mandar N. Datar

    2014-12-01

    Full Text Available Ischaemum travancorense Stapf ex C.E.C. Fisch., an endemic species, earlier known only from the Western Ghats of Kerala, Maharashtra and Goa is reported here for the first time from central India. 

  10. Development of ent-kaurene Oxidase-Based Conserved Intron Spanning Primers for Species Identification in the Genus Poa (Poaceae; Bluegrass)

    OpenAIRE

    Jonathan M. LaMantia; Ambika Chandra; David R. Huff

    2018-01-01

    Interspecific hybridization has been attempted to combine the heat and drought of Poa arachnifera Torr. with the turf quality characteristics of several Poa species. Confirmation of an F1 hybrid through morphological analysis of vegetative and flowering characteristics is often time consuming and ambiguous. Ent-kaurene oxidase (KO) has been sequenced in rice, barley, and wheat. In rice, each of the five copies of KO gene has unique lengths for the first intron. Conserved intron spanning prime...

  11. Development of ent-kaurene Oxidase-Based Conserved Intron Spanning Primers for Species Identification in the Genus Poa (Poaceae; Bluegrass

    Directory of Open Access Journals (Sweden)

    Jonathan M. LaMantia

    2018-04-01

    Full Text Available Interspecific hybridization has been attempted to combine the heat and drought of Poa arachnifera Torr. with the turf quality characteristics of several Poa species. Confirmation of an F1 hybrid through morphological analysis of vegetative and flowering characteristics is often time consuming and ambiguous. Ent-kaurene oxidase (KO has been sequenced in rice, barley, and wheat. In rice, each of the five copies of KO gene has unique lengths for the first intron. Conserved intron spanning primers (CISP can be used as a DNA marker to exploit variations of intron lengths that flank conserved gene sequences. In the present study, we developed CISP to sequence partial genomic fragments of the KO gene from seven Poa species. Through sequence analysis, species-specific primers were also developed to produce co-dominant markers that can be used to identify interspecific hybrids between Texas bluegrass and six other Poa species used in the present study.

  12. Polyphyly, gene-duplication and extensive allopolyploidy framed the evolution of the ephemeral Vulpia grasses and other fine-leaved Loliinae (Poaceae).

    Science.gov (United States)

    Díaz-Pérez, A J; Sharifi-Tehrani, M; Inda, L A; Catalán, P

    2014-10-01

    The fine-leaved Loliinae is one of the temperate grass lineages that is richest in number of evolutionary switches from perennial to annual life-cycle, and also shows one of the most complex reticulate patterns involving distinct diploid and allopolyploid lineages. Eight distinct annual lineages, that have traditionally been placed in the genus Vulpia and in other fine-leaved ephemeral genera, have apparently emerged from different perennial Festuca ancestors. The phenotypically similar Vulpia taxa have been reconstructed as polyphyletic, with polyploid lineages showing unclear relationships to their purported diploid relatives. Interspecific and intergeneric hybridization is, however, rampant across different lineages. An evolutionary analysis based on cloned nuclear low-copy GBSSI (Granule-Bound Starch Synthase I) and multicopy ITS (Internal Transcribed Spacer) sequences has been conducted on representatives of most Vulpia species and other fine-leaved lineages, using Bayesian consensus and agreement trees, networking split graphs and species tree-based approaches, to disentangle their phylogenetic relationships and to identify the parental genome donors of the allopolyploids. Both data sets were able to reconstruct a congruent phylogeny in which Vulpia was resolved as polyphyletic from at least three main ancestral diploid lineages. These, in turn, participated in the origin of the derived allopolyploid Vulpia lineages together with other Festuca-like, Psilurus-like and some unknown genome donors. Long-distance dispersal events were inferred to explain the polytopic origin of the Mediterranean and American Vulpia lineages. Copyright © 2014 Elsevier Inc. All rights reserved.

  13. Phylogeny and evolutionary history of Leymus (Triticeae; Poaceae based on a single-copy nuclear gene encoding plastid acetyl-CoA carboxylase

    Directory of Open Access Journals (Sweden)

    Ding Cun-Bang

    2009-10-01

    Full Text Available Abstract Background Single- and low- copy genes are less likely subject to concerted evolution, thus making themselves ideal tools for studying the origin and evolution of polyploid taxa. Leymus is a polyploid genus with a diverse array of morphology, ecology and distribution in Triticeae. The genomic constitution of Leymus was assigned as NsXm, where Ns was presumed to be originated from Psathyrostachys, while Xm represented a genome of unknown origin. In addition, little is known about the evolutionary history of Leymus. Here, we investigate the phylogenetic relationship, genome donor, and evolutionary history of Leymus based on a single-copy nuclear Acc1 gene. Results Two homoeologues of the Acc1 gene were isolated from nearly all the sampled Leymus species using allele-specific primer and were analyzed with those from 35 diploid taxa representing 18 basic genomes in Triticeae. Sequence diversity patterns and genealogical analysis suggested that (1 Leymus is closely related to Psathyrostachys, Agropyron, and Eremopyrum; (2 Psathyrostachys juncea is an ancestral Ns-genome donor of Leymus species; (3 the Xm genome in Leymus may be originated from an ancestral lineage of Agropyron and Eremopyrum triticeum; (4 the Acc1 sequences of Leymus species from the Qinghai-Tibetan plateau are evolutionarily distinct; (5 North America Leymus species might originate from colonization via the Bering land bridge; (6 Leymus originated about 11-12MYA in Eurasia, and adaptive radiation might have occurred in Leymus during the period of 3.7-4.3 MYA and 1.7-2.1 MYA. Conclusion Leymus species have allopolyploid origin. It is hypothesized that the adaptive radiation of Leymus species might have been triggered by the recent upliftings of the Qinghai-Tibetan plateau and subsequent climatic oscillations. Adaptive radiation may have promoted the rapid speciation, as well as the fixation of unique morphological characters in Leymus. Our results shed new light on our understanding of the origin of Xm genome, the polyploidization events and evolutionary history of Leymus that could account for the rich diversity and ecological adaptation of Leymus species.

  14. Leaf transcriptome of two highly divergent genotypes of Urochloa humidicola (Poaceae), a tropical polyploid forage grass adapted to acidic soils and temporary flooding areas.

    Science.gov (United States)

    Vigna, Bianca Baccili Zanotto; de Oliveira, Fernanda Ancelmo; de Toledo-Silva, Guilherme; da Silva, Carla Cristina; do Valle, Cacilda Borges; de Souza, Anete Pereira

    2016-11-11

    Urochloa humidicola (Koronivia grass) is a polyploid (6x to 9x) species that is used as forage in the tropics. Facultative apospory apomixis is present in most of the genotypes of this species, although one individual has been described as sexual. Molecular studies have been restricted to molecular marker approaches for genetic diversity estimations and linkage map construction. The objectives of the present study were to describe and compare the leaf transcriptome of two important genotypes that are highly divergent in terms of their phenotypes and reproduction modes: the sexual BH031 and the aposporous apomictic cultivar BRS Tupi. We sequenced the leaf transcriptome of Koronivia grass using an Illumina GAIIx system, which produced 13.09 Gb of data that consisted of 163,575,526 paired-end reads between the two libraries. We de novo-assembled 76,196 transcripts with an average length of 1,152 bp and filtered 35,093 non-redundant unigenes. A similarity search against the non-redundant National Center of Biotechnology Information (NCBI) protein database returned 65 % hits. We annotated 24,133 unigenes in the Phytozome database and 14,082 unigenes in the UniProtKB/Swiss-Prot database, assigned 108,334 gene ontology terms to 17,255 unigenes and identified 5,324 unigenes in 327 known metabolic pathways. Comparisons with other grasses via a reciprocal BLAST search revealed a larger number of orthologous genes for the Panicum species. The unigenes were involved in C4 photosynthesis, lignocellulose biosynthesis and flooding stress responses. A search for functional molecular markers revealed 4,489 microsatellites and 560,298 single nucleotide polymorphisms (SNPs). A quantitative real-time PCR analysis validated the RNA-seq expression analysis and allowed for the identification of transcriptomic differences between the two evaluated genotypes. Moreover, 192 unannotated sequences were classified as containing complete open reading frames, suggesting that the new, potentially exclusive genes should be further investigated. The present study represents the first whole-transcriptome sequencing of U. humidicola leaves, providing an important public information source of transcripts and functional molecular markers. The qPCR analysis indicated that the expression of certain transcripts confirmed the differential expression observed in silico, which demonstrated that RNA-seq is useful for identifying differentially expressed and unique genes. These results corroborate the findings from previous studies and suggest a hybrid origin for BH031.

  15. Histopatología de Ustilaginales (carbones) en Poaceas de los géneros Sorghum, Bromus y Glyceria

    OpenAIRE

    Astiz Gassó, Marta Mónica

    2017-01-01

    Sporisorium cruentum (Kühn.), es el agente causal de enfermedades en el género Sorghum incluyendo Sorghum halepense (L.) Pers.. El presente trabajo tuvo por objeto analizar el desarrollo y la evolución del patógeno en los tejidos del hospedante, y evaluar las implicancias de la enfermedad en el crecimiento vegetativo de los rizomas del sorgo de alepo. Para determinar la presencia del hongo se realizaron cortes histológicos del hospedante que se observaron por medio de microscopía óptica (MO) ...

  16. Facilitative ecological interactions between invasive species: Arundo donax (Poaceae) stands as favorable habitat for cattle ticks (Acari: Ixodidae) along the U.S.-Mexico border

    Science.gov (United States)

    The southern cattle tick, Rhipicephalus (Boophilus) microplus (Canestrini), is a key vector of protozoa that causes bovine babesiosis. Largely eradicated from most of the U.S., the cattle tick continues to infest the Cattle Fever Tick Quarantine Zone in south Texas. Management areas of the souther...

  17. An updated checklist and key to the open-panicled species of Poa L. (Poaceae) in Peru including three new species, Poa ramoniana, Poa tayacajaensis, and Poa urubambensis

    Science.gov (United States)

    Sylvester, Steven P.; Soreng, Robert J.; Peterson, Paul M.; Sylvester, Mitsy D.P.V.

    2016-01-01

    Abstract We provide an updated checklist and key to the 30 Poa species with open panicles from Peru which includes previously circumscribed Dissanthelium and Aphanelytrum species, new taxon records, and three undescribed species. Poa compressa, Poa grisebachii, and Poa leioclada are recorded from Peru for the first time. A number of species are placed in synonymy: Poa carazensis, Poa ferreyrae and Poa tovarii are synonymized under the name Poa fibrifera; Poa adusta (tentatively) and Poa pilgeri are synonymized under Poa candamoana; Poa superata is synonymized under Poa grisebachii; and Poa paramoensis is synonymized under Poa huancavelicae. Included within this treatment are three new species, Poa ramoniana, Poa tayacajaensis and Poa urubambensis, which are described and illustrated. Poa ramoniana, found growing near lakes in high elevation Puna grasslands of Junín, is similar to a small form of Poa glaberrima, but differs in having rhizomes and growing to only 5 cm tall. Poa tayacajaensis, found from shrublands on Andean slopes of Huancavelica and Huánuco, bears similarities to Poa aequatoriensis but differs in having shorter lemmas which are pubescent between the veins, densely scabrous sheaths with smooth, glabrous throats, and shorter ligules. Poa urubambensis, a common element of the undisturbed Polylepis forest understory of the Cordillera Urubamba, Cusco, is distinct from all other members of open-panicled Poa’s by having glabrous lemmas with a smooth and glabrous callus, and notably small anthers. The type material for the name Poa adusta is discussed and a lectotype is selected. PMID:27489489

  18. REVISIÓN DEL GÉNERO AXONOPUS (POACEAE: PANICEAE: PRIMER REGISTRO DEL GÉNERO EN EUROPA Y NOVEDADES TAXONÓMICAS

    Directory of Open Access Journals (Sweden)

    GIRALDO-CAÑAS DIEGO

    2008-12-01

    Full Text Available Axonopus P. Beauv. es un género nativo del continente americano, del que se conocen unas 72 especies, principalmente concentradas en el norte de Sudamérica, con algunos representantes aparentemente introducidos en el Viejo Mundo. Se registra el género Axonopus por primera vez en Europa con la especie Axonopus fissifolius (Raddi Kuhlm. Por otra parte, cinco binomios se reducen a la sinonimia de Axonopus compressus (Sw. P. Beauv. y de Axonopus scoparius (Flüggé Kuhlm. Se presentan las descripciones de las tres especies tratadas, sus sinónimos, sus ilustraciones, su distribución geográfica y ecológica, y se comentan algunas particularidades

  19. Verification of the systematic position of California brome (Bromus carinatus Hook. and Arn., Poaceae, cv. 'Broma', on the basis of analysis of issr markers

    Directory of Open Access Journals (Sweden)

    Agnieszka Sutkowska

    2012-10-01

    Full Text Available ‘Broma’ is a grass cultivar belonging to the species Bromus carinatus. In the Lists of Agricultural Plant Varieties of the Research Centre for Cultivar Testing (COBORU, it is shown as Bromus willdenowii (= B. catharticus, B. unioloides (List of Agricultural Plant Varieties 1989-2009, whereas already in 1984 Mirek demonstrated on the basis of morphological analysis that this was a different closely related species – B. carinatus. The aim of the present study was to verify the species affiliation of cv. ‘Broma’. The conducted analysis of ISSR molecular markers included representatives of cv. ‘Broma” as well as of B. carinatus and B. willdenowii. The method used allowed the identification of molecular markers of the above-mentioned taxa. The numerical analysis of the obtained results suggests that cv. ‘Broma’ should be classified in the species B. carinatus, not B. willdenowii.

  20. Genetic structure and diversity of the selfing model grass Brachypodium stacei (Poaceae in Western Mediterranean: out of the Iberian Peninsula and into the islands

    Directory of Open Access Journals (Sweden)

    Valeriia Shiposha

    2016-09-01

    Full Text Available Annual Mediterranean species of the genus Brachypodium are promising model plants for energy crops since their selfing nature and short-life cycles are an advantage in breeding programs. The false brome, B. distachyon, has already been sequenced and new genomic initiatives have triggered the de-novo genome sequencing of its close relatives such as B. stacei, a species that was until recently mistaken for B. distachyon. However, the success of these initiatives hinges on detailed knowledge about the distribution of genetic variation within and among populations for the effective use of germplasm in a breeding program. Understanding population genetic diversity and genetic structure is also an important prerequisite for designing effective experimental populations for genomic wide studies. However, population genetic data are still limited in B. stacei. We therefore selected and amplified 10 nuclear microsatellite markers to depict patterns of population structure and genetic variation among 181 individuals from 19 populations of B. stacei occurring in its predominant range, the western Mediterranean area: mainland Iberian Peninsula, continental Balearic Islands and oceanic Canary Islands. Our genetic results support the occurrence of a predominant selfing system with extremely high levels of homozygosity across the analyzed populations. Despite the low level of genetic variation found, two different genetic clusters were retrieved, one clustering all SE Iberian mainland populations and the island of Minorca and another one grouping all S Iberian mainland populations, the Canary Islands and all Majorcan populations except one that clustered with the former group. These results, together with a high sharing of alleles (89% suggest different colonization routes from the mainland Iberian Peninsula into the islands. A recent colonization scenario could explain the relatively low levels of genetic diversity and low number of alleles found in the Canary Islands populations while older colonization events are hypothesized to explain the high genetic diversity values found in the Majorcan populations. Our study provides widely applicable information about geographical patterns of genetic variation in B. stacei. Among others, the genetic pattern and the existence of local alleles will need to be adequately reflected in the germplasm collection of B. stacei for efficient genome wide association studies.

  1. Genetic structure and diversity of the selfing model grass Brachypodium stacei (Poaceae) in Western Mediterranean: out of the Iberian Peninsula and into the islands.

    Science.gov (United States)

    Shiposha, Valeriia; Catalán, Pilar; Olonova, Marina; Marques, Isabel

    2016-01-01

    Annual Mediterranean species of the genus Brachypodium are promising model plants for energy crops since their selfing nature and short-life cycles are an advantage in breeding programs. The false brome, B. distachyon, has already been sequenced and new genomic initiatives have triggered the de-novo genome sequencing of its close relatives such as B. stacei, a species that was until recently mistaken for B. distachyon. However, the success of these initiatives hinges on detailed knowledge about the distribution of genetic variation within and among populations for the effective use of germplasm in a breeding program. Understanding population genetic diversity and genetic structure is also an important prerequisite for designing effective experimental populations for genomic wide studies. However, population genetic data are still limited in B. stacei. We therefore selected and amplified 10 nuclear microsatellite markers to depict patterns of population structure and genetic variation among 181 individuals from 19 populations of B. stacei occurring in its predominant range, the western Mediterranean area: mainland Iberian Peninsula, continental Balearic Islands and oceanic Canary Islands. Our genetic results support the occurrence of a predominant selfing system with extremely high levels of homozygosity across the analyzed populations. Despite the low level of genetic variation found, two different genetic clusters were retrieved, one clustering all SE Iberian mainland populations and the island of Minorca and another one grouping all S Iberian mainland populations, the Canary Islands and all Majorcan populations except one that clustered with the former group. These results, together with a high sharing of alleles (89%) suggest different colonization routes from the mainland Iberian Peninsula into the islands. A recent colonization scenario could explain the relatively low levels of genetic diversity and low number of alleles found in the Canary Islands populations while older colonization events are hypothesized to explain the high genetic diversity values found in the Majorcan populations. Our study provides widely applicable information about geographical patterns of genetic variation in B. stacei. Among others, the genetic pattern and the existence of local alleles will need to be adequately reflected in the germplasm collection of B. stacei for efficient genome wide association studies.

  2. DIVERSIDAD DE LA FAMILIA POACEAE (GRAMINEAE) EN LA REGIÓN DEL BÍO-BÍO, CHILE, BASADA EN COLECCIONES DE HERBARIO

    OpenAIRE

    Finot, Víctor L; Marticorena, Clodomiro; Barrera, Juan A; Muñoz-Schick, Mélica; Negritto, María A

    2009-01-01

    La Región del Bío-Bío se encuentra en la zona sur de Chile central, considerado un hotspot de biodiversidad. Aunque es una región fuertemente intervenida por el hombre, principalmente por la agricultura, la forestación, la industrialización y la urbanización, tiene un bajo porcentaje de superficie protegida por el Sistema Nacional de Áreas Silvestres Protegidas del Estado (SNASPE). Por ello, documentar la biodiversidad de la región es una tarea ineludible. Se analizó la diversidad de la famil...

  3. First record of Atherigona reversura Villeneuve (Diptera: Muscidae feeding on Bermudagrass (Cynodon dactylon cv. Jiggs, Poaceae in Brazil: morphological and molecular tools for identification

    Directory of Open Access Journals (Sweden)

    Leandro do Prado Ribeiro

    2016-07-01

    Full Text Available Bermudagrass (Cynodon dactylon cv. Jiggs is an important food source for dairy cattle in the semi-intensive milk production systems most often used in southern Brazil. Although many insect pests are associated with feed grasses, we report here the first occurrence of the fly Atherigona (Atherigona reversura Villeneuve, 1936 (Diptera: Muscidae feeding on bermudagrass in Brazil. This potential pest was observed in April 2015 in three localities (Abelardo Luz, Palmitos, and Videira in western Santa Catarina, in southern Brazil. The infested plants had senescent and necrotic terminal leaves that reduced plant growth. New growth had to sprout new tillers from basal nodes, which resulted in a reduced plant growth rate. We also provide a morphological identification key (with figures for A. (Atherigona reversura and A. (Acritochaeta orientalis Schiner, 1868. A molecular identification based on COI is also provided to better differentiate species. Keywords: COI gene, Insect pest, Pastures, Plant–insect interaction

  4. REVISIÓN DE LAS ESPECIES DEL GÉNERO SPOROBOLUS (POACEAE: CHLORIDOIDEAE: SPOROBOLINAE DEL NOROESTE DE SUDAMÉRICA: PERÚ, ECUADOR, COLOMBIA Y VENEZUELA

    Directory of Open Access Journals (Sweden)

    Giraldo-Cañas Diego

    2009-06-01

    Full Text Available Se presenta un estudio taxonómico de las especies de Sporobolus para el noroeste de Sudamérica. Se reconocen once especies para el área de estudio. Se incluyen las claves para determinar las especies así como las descripciones morfológicas y sus ilustraciones. Se discuten para cada una de las especies sus relaciones morfológicas, su distribución geográfica y sus preferencias ecológicas; adicionalmente, se relacionan sus usos y sus nombres comunes. Asimismo, se propone la lectotipificación para Sporobolus lasiophyllus Pilg. Por otra parte, se registran tres especies por primera vez para Colombia [Sporobolus pilifer (Trin. Kunth, Sporobolus tenuissimus (Mart. ex Schrank Kuntze y Sporobolus virginicus (L. Kunth]. Se excluyen de este tratamiento a Sporobolus brasiliensis (Raddi Hack. (=Eragrostis airoides Nees y Sporobolus domingensis (Trin. Kunth. Adicionalmente, se propone la adopción y la unificación de algunos términos morfológicos en agrostología, tales como caña, panoja, espiguilla, lema, antecio y cariopsis, en lugar de culmo, panícula, espícula, lemma, flósculo y cariopse-cariópside, respectivamente.

  5. Uso de Leersia hexandra (Poaceae) en la fitorremediación de suelos contaminados con petróleo fresco e intemperizado

    OpenAIRE

    Arias-Trinidad, Alfredo; Rivera-Cruz, María del Carmen; Roldán-Garrigós, Antonio; Aceves-Navarro, Lorenzo Armando; Quintero-Lizaola, Roberto; Hernández-Guzmán, Javier

    2017-01-01

    ResumenLa industria petrolera ha generado derrames crónicos de petróleo y su acumulación en Gleysoles en zonas anegadas en el estado de Tabasco, en el sureste de México. El anegamiento es un factor que limita el uso de tecnologías de remediación por el alto costo y los bajos niveles de degradación del petróleo, sin embargo, Leersia hexandra Sw. es un pasto que crece en estas zonas contaminadas con petróleo intemperizado. El objetivo del estudio fue evaluar la densidad de bacterias, producción...

  6. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae cultivados en Costa Rica II: Dendrocalamus latiflorus var. latiflorus

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available Mediante el microscopio electrónico de barrido se analizaron muestras de lámina foliar, culmo y rama, así como las brácteas del culmo y yemas de las ramas de Dendrocalamus latiflorus var. latiflorus. Se determinó la presencia en la epidermis abaxial de la lámina foliar de dos tipos de papilas céricas, esféricas y alargadas; éstas últimas rodeando los estomas de bajo domo. Sólo en la superficie adaxial de la nervadura central de la lámina foliar aparecen grandes tricomas en forma de gancho. En la zona abaxial de las brácteas del culmo, hay tricomas alargados y delgados similares a los de las brácteas de D. giganteus y las yemas de las ramas están cubiertas por tricomas bicelulares.We used a scanning electron microscope to observe leaf laminae, culms, branches, culm bracts and branch buds of Dendrocalamus latiflorus var. latiflorus grown in Costa Rica. In the abaxial epidermis of the leaf lamina we found two types of ceric papillae, rounded and elongated, the latter surrounding the low dome stomata. Only the adaxial surface of the central nervature (leaf lamina has big hook-sshaped trichomes. In the abaxial zone of the culm bract there are thin elongated trichomes, similar to those from the bract of Dendrocalamus giganteus. The branch buds are covered by bicelular trichomes. Rev. Biol. Trop. 54(Suppl. 2: 51-57. Epub 2006 Dec. 01.

  7. Ultraestructura de bambúes del género Dendrocalamus (Poaceae: Bambusoideae cultivados en Costa Rica IV: Dendrocalamus asper, clones Taiwán y Tailandia

    Directory of Open Access Journals (Sweden)

    Mayra Montiel

    2006-06-01

    Full Text Available El análisis ultraestructural de los clones taiwanés y tailandés de Dendrocalamus asper, realizado al microscopio electrónico de barrido, mostró que el clon de Taiwán tiene estomas de bajo domo en la lámina foliar, mientras que el de Tailandia tiene estomas de alto domo; las acumulaciones de cera cuticular en el clon de Taiwán son de dos formas (cuatro en el de Tailandia. La distribución de los tejidos vasculares es igual en ambos, así como los tejidos que los rodean. Sería difícil identificar estos clones por la observación macroscópica o microscópica de las brácteas del culmo, pues no presentan diferencias significativas: una identificación fiable requiere considerar la ultraestructura de los estomas y las acumulaciones de cera cuticular.An ultraestructural analysis of the Taiwan and Thailand clones of Dendrocalamus asper made with the scanning electron microscope showed that the Taiwan clone had low dome stomata while the Thailand clone has high dome stomata in the leaf lamina. Cuticular wax accumulations in the Taiwan clone has two shapes, against four in the Thailand clone. Both have the same distribution of vascular and surrounding tissues. Macroscopic or microscopic observation of culm bracts are not recommended to differentiate these clones: a reliable identification requires observation of the ultrastructure of stomata and cuticular wax accumulations. Rev. Biol. Trop. 54(Suppl. 2: 65-75. Epub 2006 Dec. 01.

  8. VARIABILIDAD MORFOLÓGICA DE LAS ESPECIES DEL COMPLEJO POA RESINULOSA (POACEAE Y SU RELACIÓN CON LAS ESPECIES DE LA SECCIÓN DIOICOPOA

    Directory of Open Access Journals (Sweden)

    M. Gabriela Fernández Pepi

    2008-01-01

    Full Text Available El complejo Poa resinulosa incluye un grupo de especies conformado por P. calchaquiensis, P. pedersenii y P. resinulosa, de difícil delimitación debido a que las entidades son afines en cuanto a su morfología, aunque presentan distribución disyunta. Para evaluar y analizar a las especies del complejo Poa resinulosa y especies afines al mismo complejo, se midieron 40 caracteres morfológicos y anatómicos en ejemplares de Poa calchaquiensis, P. lanigera, P. pilcomayensis y P. resinulosa. Esos datos se incorporaron a la matriz del conjunto de especies de Poa sección Dioicopoa confeccionada por Giussani (2000, incluyendo también a P. nubensis una nueva especie afín a P. calchaquiensis. Mediante el análisis de componentes principales y pruebas estadísticas, se circunscribió a las especies del complejo Poa resinulosa. Se describió a P. resinulosa como una variedad de P. ligularis, de la que se diferencia por poseer lígula corta, hojas y cañas de menor longitud, menor ancho de la lámina y estomas de menor tamaño. Se presenta una clave para la identificación de Poa ligularis var. resinulosa y taxones afines, y un mapa con la distribución geográfica de ambas variedades de P. ligularis.

  9. Species-Level Phylogeny and Polyploid Relationships in Hordeum (Poaceae) Inferred by Next-Generation Sequencing and In Silico Cloning of Multiple Nuclear Loci.

    Science.gov (United States)

    Brassac, Jonathan; Blattner, Frank R

    2015-09-01

    Polyploidization is an important speciation mechanism in the barley genus Hordeum. To analyze evolutionary changes after allopolyploidization, knowledge of parental relationships is essential. One chloroplast and 12 nuclear single-copy loci were amplified by polymerase chain reaction (PCR) in all Hordeum plus six out-group species. Amplicons from each of 96 individuals were pooled, sheared, labeled with individual-specific barcodes and sequenced in a single run on a 454 platform. Reference sequences were obtained by cloning and Sanger sequencing of all loci for nine supplementary individuals. The 454 reads were assembled into contigs representing the 13 loci and, for polyploids, also homoeologues. Phylogenetic analyses were conducted for all loci separately and for a concatenated data matrix of all loci. For diploid taxa, a Bayesian concordance analysis and a coalescent-based dated species tree was inferred from all gene trees. Chloroplast matK was used to determine the maternal parent in allopolyploid taxa. The relative performance of different multilocus analyses in the presence of incomplete lineage sorting and hybridization was also assessed. The resulting multilocus phylogeny reveals for the first time species phylogeny and progenitor-derivative relationships of all di- and polyploid Hordeum taxa within a single analysis. Our study proves that it is possible to obtain a multilocus species-level phylogeny for di- and polyploid taxa by combining PCR with next-generation sequencing, without cloning and without creating a heavy load of sequence data. © The Author(s) 2015. Published by Oxford University Press, on behalf of the Society of Systematic Biologists.

  10. FITODEPURACIÓN DE AGUAS RESIDUALES DOMESTICAS CON POACEAS: Brachiaria mutica, Pennisetum purpureum y Panicum maximunEN EL MUNICIPIO DE POPAYÁN, CAUCA

    Directory of Open Access Journals (Sweden)

    GIOVANI HERNÁN PALTA-PRADO

    2013-12-01

    Full Text Available El asentamiento Brisas de San Isidro del Municipio de Popayán no presenta sistema de colección de aguas servidas, las cuales son vertidas directamente sobre la Quebrada Lame, ocasionando contaminación por la carga orgánica y detergentes provenientes del uso doméstico. El objetivo fue evaluar diferentes especies de gramíneas, buscando una alternativa de manejo de las aguas residuales domésticas con plantas útiles en la alimentación animal. Para tal fin se establecieron humedales artificiales bajo un diseño de muestreo temporal y un arreglo factorial de bloques al azar. Se tomaron las muestras de agua residual (pH, oxígeno disuelto (OD, concentración de CO2, demanda biológica oxigeno (DBO, demanda química oxigeno (DQO, conductividad, amonio (NH4+, nitratos (NO3-, fosfatos (PO4 y nitritos (NO2- y Demanda Bioquímica de Oxigeno (DBO5 cada quince días durante seis meses. El análisis estadístico, se realizó por medio de una ANOVA comparando los tratamientos expuestos y una prueba posthoc de Tuckey. El análisis de varianza, mostro diferencias estadísticas significativas para los parámetros oxígeno disuelto (OD, demanda química oxigeno (DQO, amonio (NH4+, nitratos (NO3-, nitritos (NO2- y coliformes totales; evidenciando que los mejores tratamientos fueron B. mutica y P. maximun

  11. Diversity and biomass of native macrophytes are negatively related to dominance of an invasive Poaceae in Brazilian sub-tropical streams

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Gonçalves Fernandes

    2013-06-01

    Full Text Available Besides exacerbated exploitation, pollution, flow alteration and habitats degradation, freshwater biodiversity is also threatened by biological invasions. This paper addresses how native aquatic macrophyte communities are affected by the non-native species Urochloa arrecta, a current successful invader in Brazilian freshwater systems. We compared the native macrophytes colonizing patches dominated and non-dominated by this invader species. We surveyed eight streams in Northwest Paraná State (Brazil. In each stream, we recorded native macrophytes' richness and biomass in sites where U. arrecta was dominant and in sites where it was not dominant or absent. No native species were found in seven, out of the eight investigated sites where U. arrecta was dominant. Thus, we found higher native species richness, Shannon index and native biomass values in sites without dominance of U. arrecta than in sites dominated by this invader. Although difficult to conclude about causes of such differences, we infer that the elevated biomass production by this grass might be the primary reason for alterations in invaded environments and for the consequent impacts on macrophytes' native communities. However, biotic resistance offered by native richer sites could be an alternative explanation for our results. To mitigate potential impacts and to prevent future environmental perturbations, we propose mechanical removal of the invasive species and maintenance or restoration of riparian vegetation, for freshwater ecosystems have vital importance for the maintenance of ecological services and biodiversity and should be preserved.

  12. Progenitor-derivative relationships of Hordeum polyploids (Poaceae, Triticeae inferred from sequences of TOPO6, a nuclear low-copy gene region.

    Directory of Open Access Journals (Sweden)

    Jonathan Brassac

    Full Text Available Polyploidization is a major mechanism of speciation in plants. Within the barley genus Hordeum, approximately half of the taxa are polyploids. While for diploid species a good hypothesis of phylogenetic relationships exists, there is little information available for the polyploids (4×, 6× of Hordeum. Relationships among all 33 diploid and polyploid Hordeum species were analyzed with the low-copy nuclear marker region TOPO6 for 341 Hordeum individuals and eight outgroup species. PCR products were either directly sequenced or cloned and on average 12 clones per individual were included in phylogenetic analyses. In most diploid Hordeum species TOPO6 is probably a single-copy locus. Most sequences found in polyploid individuals phylogenetically cluster together with sequences derived from diploid species and thus allow the identification of parental taxa of polyploids. Four groups of sequences occurring only in polyploid taxa are interpreted as footprints of extinct diploid taxa, which contributed to allopolyploid evolution. Our analysis identifies three key species involved in the evolution of the American polyploids of the genus. (i All but one of the American tetraploids have a TOPO6 copy originating from the Central Asian diploid H. roshevitzii, the second copy clustering with different American diploid species. (ii All hexaploid species from the New World have a copy of an extinct close relative of H. californicum and (iii possess the TOPO6 sequence pattern of tetraploid H. jubatum, each with an additional copy derived from different American diploids. Tetraploid H. bulbosum is an autopolyploid, while the assumed autopolyploid H. brevisubulatum (4×, 6× was identified as allopolyploid throughout most of its distribution area. The use of a proof-reading DNA polymerase in PCR reduced the proportion of chimerical sequences in polyploids in comparison to Taq polymerase.

  13. histone H3 predominantly mark the pericentromeric chromatin

    Indian Academy of Sciences (India)

    SANTOSH KUMAR SHARMA

    pericentromeric chromatin during mitosis in monokinetic plants. J. Genet. .... bigger), cytological preparations (easy to difficult) as well as their habitat ... Poaceae. Monocot. Land. 14. Triticum aestivum. Common wheat. Poaceae. Monocot. Land.

  14. The Tr-cp 14 cysteine protease in white clover (Trifolium repens) is localized to the endoplasmic reticulum and is associated with programmed cell death during development of tracheary elements

    DEFF Research Database (Denmark)

    Mulisch, Maria; Asp, Torben; Krupinska, Karin

    2013-01-01

    family of cysteine proteases with homology to XCP1 and XCP2 from Arabidopsis thaliana and p48h-17 from Zinnia elegans, which previously have been reported to be associated with tracheary element differentiation. The proform as well as the processed form of the protein was detected in petioles, flowers....... Immunogold studies suggest that the protease prior to the burst of the vacuole was associated to the ER cisternae. After disruption of the tonoplast, it was found in the cytoplasm, and, in later stages, associated with disintegrating material dispersed throughout the cell....

  15. Productividad y análisis económico de una pastura consociada de Trifolium Repens l. y Dactylis Glomerata l. ante diferentes condiciones de transmisividad lumínica

    Directory of Open Access Journals (Sweden)

    Bárbara Camila Alvarez Oyarzo

    2014-06-01

    Full Text Available Con el objetivo de aportar información referida al rendimiento de una pastura, que creció bajo distintos niveles de sombra se realizó un ensayo comparativo de rendimiento, en el que se evaluó la productividad de materia seca y su distribución durante la temporada de crecimiento. Además se realizó un análisis económico de la práctica de siembra y de la confección de reservas forrajeras, utilizando datos del ensayo e información local referida al rendimiento de cultivos y empleo de maquinarias agrícola. El ensayo comparativo de rendimiento se instaló en el sudoeste de Santa Cruz y consistió en un diseño en bloques completos aleatorizados. En el análisis económico se calcularon los indicadores, margen bruto, rendimiento de indiferencia, retorno por peso invertido, valor actual neto y tasa interna de retorno. Se demostró que el máximo rendimiento se obtuvo con un 50% de cobertura en pasturas mixtas, la productividad se concentró hacia el primer corte. El análisis económico indica que la siembra de pasturas y confección de reservas forrajeras es una actividad con rentabilidad positiva, mayor que algunas opciones financieras que ofrece el mercado en la región.

  16. Ocorrência e controle de lesmas do gênero Omalonyx (Gastropoda, Succineidae, pragas de capim-elefante Pennisetum purpureum (Poaceae em Rio Preto da Eva, Amazonas Occurrence and control of Omalonyx slugs (Gastropoda, Succineidae, pests of the elephant-grass Pennisetum purpureum (Poaceae in Rio Preto da Eva, Amazonas

    Directory of Open Access Journals (Sweden)

    Marcos Vinicius Bastos Garcia

    2012-06-01

    Full Text Available Lesmas do gênero Omalonyx d'Orbigny, 1837 são hermafroditas, herbívoras, de distribuição neotropical e vivem em plantas aquáticas, nas demais vegetações adjacentes e em solo úmido próximo a ambientes de água doce. No presente trabalho reporta-se a ocorrência atípica de O. pattersonae Tillier, 1981 e de Omalonyx sp. em área de terra firme, distante de ambiente aquático. Estas espécies aqui reportadas são simpátricas e devido à alta densidade populacional e prejuízos causados às folhas do capim-elefante Pennisetum purpureum Schumach, são caracterizadas como pragas agrícolas. No período da noite as lesmas se alimentavam das folhas do capim elefante e durante o dia permaneciam escondidas na base do caule, próximo a superfície úmida do solo. A aplicação de cal hidratada sobre agregados de indivíduos de Omalonyx spp foi um método efetivo para o controle das populações. As alterações ambientais dos ecossistemas amazônicos para uso agrícola e/ou urbanização tem promovido o aumento populacional de espécies que se adaptam a novos habitats e geralmente se tornam pragas de difícil controle.Slugs of the genus Omalonyx d'Orbigny, 1837 are hermaphrodites, herbivorous, distributed on Neotropical regions, living on aquatic plants, moist soil and terrestrial vegetation close to freshwater systems. The present paper reports the atypical occurrence of O. pattersonae Tillier, 1981 and Omalonyx sp. in an upland area far from any aquatic environment. Both species reported here are sympatric and due to the high populations density and damages caused on leaves of elephant-grass Pennisetum purpureum Schumach, they are recognized as agricultural pests. During the night, the slugs feed on the grass leaves and at the daylight they stayed hidden in the base of stems, near the moist soil surface. The use of hydrated lime distributed over the aggregations of Omalonyx spp. showed to be an effective method to control the populations. The environmental changes in the Amazonian ecosystems for agricultural or urban purposes have promoted the increase of populations of native species that adapt in the new habitat and usually become pests that are difficult to control.

  17. Efeitos fitotóxicos do fluoreto na morfoanatomia foliar de Brachiaria brizantha (Hochst. ex A. Rich. Stapf e Brachiaria decumbens Stapf (Poaceae Phytotoxic effects of fluoride in leaf morpho-anatomy of Brachiaria brizantha (Hochst. Ex A. Rich. Stapf and Brachiaria decumbens Stapf (Poaceae

    Directory of Open Access Journals (Sweden)

    Alice Pita-Barbosa

    2009-12-01

    Full Text Available Visando avaliar os efeitos do fluoreto sobre capim-braquiária, plantas de Brachiaria brizantha e B. decumbens foram submetidas a nevoeiros simulados com fluoreto (10 µg ml-1. Amostras foliares de porções aparentemente sadias foram coletadas 24 horas após a última exposição para análises microscópicas. Folhas, raízes e rizomas foram submetidos à quantificação do teor de fluoreto. As folhas apresentaram necroses pequenas e esparsas. Somente as folhas acumularam fluoreto, apresentando teores 4,4 e 5,2 vezes maiores que no tratamento controle, em B. brizantha e B. decumbens, respectivamente, não havendo diferença no potencial acumulador das duas espécies. As principais alterações micromorfológicas observadas foram lesões próximas aos tricomas, sugerindo que estes sejam as vias preferenciais de entrada do poluente nas plantas. Porções foliares, visualmente sadias, de ambas as espécies apresentaram danos microscópicos antes do surgimento de sintomas, havendo perda da turgidez das células buliformes em B. brizantha e de todos os tecidos em B. decumbens. Alterações micromorfométricas foram observadas somente em B. decumbens, indicando sua maior sensibilidade ao fluoreto, em comparação com B. brizantha. A realização de experimentos de longa duração será fundamental para elucidar o potencial bioacumulador de B. brizantha.To assess the effects of fluoride on signal grass, plants of Brachiaria brizantha and B. decumbens were submitted to simulated fluoride fog (10 µg ml-1. Leaf fragments from apparently healthy portions were colleted 24 hours after the last exposure and used for microscopic analysis. Roots, leaves and rhizomes were submitted to fluoride content quantification. The leaves presented small, sparse necroses. The accumulation of fluoride was observed on the leaves only. B. brizantha and B. decumbens presented, respectively, 4.4 and 5.2 times more fluoride than the control treatment. No difference was observed concerning the accumulation potential of both species. The main micromorphological alterations observed were injuries near the trichomes, therefore, suggesting that these are the preferential routes by which pollutants enter the plants. Visually healthy leaf portions of the two species showed microscopic damages before symptoms appeared, presenting turgidity loss in the bulliform cells of B. brizantha and in all tissues of B. decumbens. Micromorphometric alterations were observed only in B. decumbens, indicating higher sensibility to fluoride in comparison to B. brizantha. Further studies of long duration will be essential to determine the bioaccumulation potential of B. brizantha.

  18. Número cromossômico em acessos de Pennisetum spp. (Poaceae, Poales - DOI: 10.4025/actascibiolsci.v30i3.5016 Chromosome number in Pennisetum spp. accessions (Poaceae, Poales - DOI: 10.4025/actascibiolsci.v30i3.5016

    Directory of Open Access Journals (Sweden)

    Antônio Vander Pereira

    2008-10-01

    Full Text Available Avaliou-se o complemento cromossômico de 16 acessos de Pennisetum disponíveis na Coleção de Germoplasma da Embrapa Gado de Leite – Juiz de Fora, Estado de Minas Gerais. Para a avaliação citogenética, utilizou-se a técnica de esmagamento e coloração com Feulgen. Para quatro acessos foram obtidas metáfases com 2n = 28 cromossomos, confirmando sua classificação como P. purpureum. A origem híbrida P. purpureum x P. glaucum foi constatada em oito acessos, os quais apresentaram 2n = 21. Em um acesso identificado como híbrido entre P. purpureum x P. glaucum, foram observadas metáfases com 2n = 54, permitindo inferir que não se trata de um híbrido interespecífico triplóide. Para outros três acessos avaliados, também foram observadas células com 2n = 54, embora estivessem identificados como híbridos entre P. purpureum x espécie selvagem; P. glaucum policross x hexaplóide 200 e P. glaucum x F92-161-01 ( P. purpureum x P. glaucum .The chromosome complement of 16 Pennisetum accessions belonging to the Germplasm Collection of Embrapa Gado de Leite - Juiz de Fora, Minas Gerais State was evaluated. The cytogenetic analysis employed the smear technique and staining with Feulgen. In four accessions, metaphases with 2n = 28 chromosomes were obtained, confirming their classification as P. purpureum. The hybrid origin P. purpureum x P. glaucum was observed in eight accessions, which presented 2n = 21. In an accession identified as P. purpureum x P. glaucum hybrid, metaphases with 2n = 54 were observed, suggesting that it is not a triploid interspecific hybrid. For three other evaluated accessions, cells with 2n=54 were also observed, although they were identified as hybrids between P. purpureum x wild species; P. glaucum polycross x hexaploid 200 and P. glaucum x [F92-161-01 (P. purpureum x P. glaucum].

  19. Regeneração de espécies arbóreas sob a influência de Merostachys multiramea Hack. (Poaceae em uma floresta subtropical Regeneration of tree species influenced by Merostachys multiramea Hack. (Poaceae in a subtropical forest

    Directory of Open Access Journals (Sweden)

    Suzana Cyrino dos Santos

    2012-03-01

    Full Text Available A ocorrência de bambúseas é comum em muitas fisionomias florestais, sendo que a elevada abundância destas espécies pode interagir com a regeneração de espécies arbóreas. Foi avaliada a regeneração de espécies arbóreas e de Merostachys multiramea Hack. em uma área de transição entre Floresta Ombrófila Mista e Floresta Estacional no Sul do Brasil e comparada a estrutura de regeneração da área entre dois e quatro anos após floração, frutificação e morte de M. multiramea. Foram alocadas 25 unidades amostrais de 100 m² dispostas de forma aleatória, onde foram amostrados todos os colmos vivos de M. multiramea e indivíduos regenerantes de espécies arbóreas > 30 cm de altura e com perímetro à altura do peito The occurrence of bamboo species is common in several forest physiognomies, and the high abundance of these species may affect the regeneration of other ones. We evaluated both tree species and Merostachys multiramea Hack. recruitment in a transition area between mixed Araucaria rain forest and seasonal semideciduous forests in southern Brazil. We compared the regeneration structure of the areas evaluated two and four years after flowering, fruiting and death of M. multiramea. We randomly distributed 25 100 m² sampling units, and surveyed all living culms of M. multiramea and tree saplings. We sampled 4,372 living bamboos and 2,918 tree saplings, belonging to 32 plant families and 75 species. Most species were classified as zoochorous and canopy light-demanding. On the other hand, plant abundance revealed a greater contribution of autochorous, understory and shade-tolerant trees. M. multiramea density was higher over the four years after the reproductive event (p<0.05, with taller culms (p<0.01, but with the same mean number of culms (p=0.46. A NPMANOVA revealed significant differences in composition and abundance between surveys, with higher similarity among samplings two years after the reproductive event of M. multiramea. We also detected higher species richness over the study period, which was found to be directly associated with the abundance of M. multiramea (p=0.002, but with lower evenness of abundance among regenerating species.

  20. 75 FR 74678 - Medicine Bow-Routt National Forests and Thunder Basin National Grassland; Colorado and Wyoming...

    Science.gov (United States)

    2010-12-01

    ... Carduus acanthoides......... 4 0 Purple loosestrife Lythrum salicaria 4 0 Quackgrass Elymus repens 4 0..., endangered, or sensitive species and their habitats. Economics, effectiveness, and potential impacts of...

  1. LA SUCESIÓN VEGETAL EN LOS LODOS FLUVIOVOLCÁNICOS DE ARMERO-TOLIMA-COLOMBIA 30 AÑOS DESPUÉS DE LA ERUPCIÓN DEL VOLCÁN ARENAS DEL NEVADO DEL RUIZ

    Directory of Open Access Journals (Sweden)

    Héctor Eduardo Esquivel

    2016-01-01

    Full Text Available Se estudió la dinámica sucesional y la evolución edafológica de una zona de bosque seco tropical afectada por lodos de la erupción volcánica del nevado del Ruiz el 13 de noviembre de 1985. La zona de estudio está ubicada en el municipio de Armero con una extensión de 3500 hectáreas a 450 msnm. Se levantaron 10 parcelas de muestreo de 10 x 20 m, acorde con las consociaciones establecidas por el IGAC. En total los cuatro estudios florísticos reportan 565 especies distribuidas en 72 familias, de las cuales sobresalen la familia Asteraceae, Malvaceae, Fabaceae, Euphorbiaceae y Poaceae. El número de especies ha variado significativamente, para el primer estudio 294 distribuidas en 66 familias, para el segundo 332 especies, para el tercer estudio 284 especies y para el cuarto estudio un total de 217. Al comienzo se confirma lo que Braun Blanquet planteó según la Fitosociología, que en áreas fuertemente disturbadas la vegetación inicialmente se establece en montículos; cinco años después el segundo estudio mostró la formación de asociaciones así: Rhynchelytretum, por estar dominada por el pasto Rhynchelytrum repens (Will Hubb., la asociación Indigoferetum por la alta presencia de Indigofera hirsuta Jacq., Panicetum, por el dominio de Panicum maximum Jacq. y la asociación Ficetum, por la presencia de varias especies de cauchos. La vegetación ha presentado un recambio constante y se reconoce actualmente una formación sucesional avanzada donde domina el hábito de crecimiento arbóreo, conformando relictos de bosque. El pH del suelo ha variado de 3.2 a 6.5, como también varios de los elementos evaluados.

  2. Unique antimicrobial spectrum of ophiobolin K produced by Aspergillus ustus.

    Science.gov (United States)

    Sohsomboon, Natthapat; Kanzaki, Hiroshi; Nitoda, Teruhiko

    2018-03-01

    A co-cultivation study of two fungal strains showed that Aspergillus ustus could inhibit Aspergillus repens growth. The bioactive compound responsible for the observed activity was purified and identified as a sesterterpene, ophiobolin K. Ophiobolin K exhibited marked inhibition against both fungi and bacteria, especially A. repens, A. glaucus and gram-positive bacteria including Bacillus subtilis, Staphylococcus aureus, and Micrococcus luteus.

  3. Fungal Planet description sheets: 558–624

    OpenAIRE

    Crous, P.W.; Wingfield, M.J.; Burgess, T.I.; Hardy, G.E.St.J.; Barber, P.A.; Alvarado, P.; Barnes, C.W.; Buchanan, P.K.; Heykoop, M.; Moreno, G.; Thangavel, R.; van der Spuy, S.; Barili, A.; Barrett, S.; Cacciola, S.O.

    2017-01-01

    Novel species of fungi described in this study include those from various countries as follows: Australia: Banksiophoma australiensis (incl. Banksiophoma gen. nov.) on Banksia coccinea, Davidiellomyces australiensis (incl. Davidiellomyces gen. nov.) on Cyperaceae, Didymocyrtis banksiae on Banksia sessilis var. cygnorum, Disculoides calophyllae on Corymbia calophylla, Harknessia banksiae on Banksia sessilis, Harknessia banksiae-repens on Banksia repens, Harknessia banksiigena on Banksia sessil...

  4. The Response of Arabidopsis to Co-cultivation with Clover

    DEFF Research Database (Denmark)

    Pedersen, Hans; Kudsk, Per; Fiehn, Oliver

    2013-01-01

    in terms of several metabolite groups including amino acids, phenolics, carbohydrates and lipids. 87 A. thaliana and 53 T. repens metabolites were significantly affected. In A. thaliana 34 metabolites increased relative to the control upon co-cultivation while 54 decreased; in T. repens 20 increased while...

  5. Pascagoula Harbor, Mississippi, Feasibility Report on Improvement of the Federal Deep-Draft Navigation Channel. Volume 1. Main Report and Environmental Impact Statement.

    Science.gov (United States)

    1985-03-01

    cerifera) and stands of Cogongrass, locally known as ’Jap Grass’ ( Imperata cylindrica) and torpedo grass (Panicum repens). The lower southeastern-most...dominated by wax myrtle and sea myrtle with stands of Cogongrass, locally known as ’Jap Grass’ ( Imperata cylindrica) and torpedo grass (Panicum repens

  6. Ação do flúor dissolvido em chuva simulada sobre a estrutura foliar de Panicum maximum jacq. (colonião e Chloris gayana kunth. (capim-rhodes - Poaceae

    Directory of Open Access Journals (Sweden)

    Chaves Alba Lucilvânia Fonseca

    2002-01-01

    Full Text Available Panicum maximum e Chloris gayana foram submetidas à chuvas simuladas com soluções de fluoreto de potássio (15mg ml-1 com objetivo de identificar as injúrias causadas pelo flúor (F-, como poluente atmosférico, na estrutura da lâmina foliar e fornecer subsídios para a seleção de características diagnósticas a serem utilizadas na bioindicação. Os principais sintomas foram clorose e necrose, principalmente no ápice e margens das lâminas. Nos cortes transversais, quatro tipos de alterações causadas pelo flúor são relacionadas: redução do número, tamanho e arranjo dos cloroplastos; necrose dos tecidos principalmente nas margens das folhas; erosões na superfície da folha e hipertrofia das células. Em C. gayana, no entanto, não foram observadas as alterações nos cloroplastos e os outros sintomas foram bem mais discretos que em P. maximum. A ocorrência de compostos fenólicos foi registrada pela coloração com fucsina em todas as regiões da lâmina onde foram observadas lesões. Ao microscópio eletrônico de varredura foi observado o achatamento e formação de concavidades nas paredes externas das células. Este experimento confirma a maior sensibilidade de P. maximum ao flúor e revela algumas características anatômicas de C. gayana que, entre outros fatores, podem estar contribuindo para a maior resistência desta espécie a este poluente.

  7. A Fronteira do Gado e a Melinis Minutiflora P. Beauv. (POACEAE: A História Ambiental e as Paisagens Campestres do Cerrado Goiano no Século XIX

    Directory of Open Access Journals (Sweden)

    Sandro Dutra Silva

    2015-08-01

    Full Text Available Este artigo objetiva apresentar uma revisão da bibliografia que informa sobre a introdução de gramíneas exóticas, sobretudo de origem africana, no Cerrado goiano. A pecuária foi a principal atividade econômica de Goiás no século XIX e na primeira metade do século XX. Os campos do Cerrado goiano favoreceram o assentamento de parte da sociedade rancheira com seus currais e boiadas. Neste artigo, pretendemos analisar, por meio da história ambiental das gramíneas e da pecuária, a relação entre sociedade e natureza nas savanas do Planalto Central do Brasil nesse período. Dialogamos com os estudos de botânica e a sua relação com a história ambiental, no que se refere às transformações das paisagens pelas ações antrópicas. O estudo destaca a introdução de gramíneas exóticas, especialmente os registros históricos sobre o capim-gordura na expansão da atividade pastoril em Goiás.

  8. Comparison of the Giemsa C-banded karyotypes of the three subspecies of Psathyrostachys fragilis, subspp. villosus (2x), secaliformis (2x, 4x), and fragilis (2x) (Poaceae), with notes on chromosome pairing

    DEFF Research Database (Denmark)

    Linde-Laursen, I.; Baden, C.

    1994-01-01

    . Only the presence of 12 nucleoli in interphases identified 6 SAT-chromosome pairs. In subsp. villosus one or two extra micronucleoli indicated a chromosome pair with very low nucleolus-forming activity, bringing the number of SAT-chromosome pairs to 4. This number may be a characteristic...... of a common genome, N. NORs had different nucleolus-forming activities. Meiotic analysis demonstrated a high level of bivalent pairing in the three taxa. A chromosomal rearrangement was suggested in subsp. villosus. The low multivalent frequency in subsp. secaliformis indicates the presence of a pairing...

  9. Detecting latitudinal and altitudinal expansion of invasive bamboo Phyllostachys edulis and Phyllostachys bambusoides (Poaceae) in Japan to project potential habitats under 1.5°C-4.0°C global warming.

    Science.gov (United States)

    Takano, Kohei Takenaka; Hibino, Kenshi; Numata, Ayaka; Oguro, Michio; Aiba, Masahiro; Shiogama, Hideo; Takayabu, Izuru; Nakashizuka, Tohru

    2017-12-01

    Rapid expansion of exotic bamboos has lowered species diversity in Japan's ecosystems by hampering native plant growth. The invasive potential of bamboo, facilitated by global warming, may also affect other countries with developing bamboo industries. We examined past (1975-1980) and recent (2012) distributions of major exotic bamboos ( Phyllostachys edulis and P. bambusoides ) in areas adjacent to 145 weather stations in central and northern Japan. Bamboo stands have been established at 17 sites along the latitudinal and altitudinal distributional limit during the last three decades. Ecological niche modeling indicated that temperature had a strong influence on bamboo distribution. Using mean annual temperature and sun radiation data, we reproduced bamboo distribution (accuracy = 0.93 and AUC (area under the receiver operating characteristic curve) = 0.92). These results infer that exotic bamboo distribution has shifted northward and upslope, in association with recent climate warming. Then, we simulated future climate data and projected the climate change impact on the potential habitat distribution of invasive bamboos under different temperature increases (i.e., 1.5°C, 2.0°C, 3.0°C, and 4.0°C) relative to the preindustrial period. Potential habitats in central and northern Japan were estimated to increase from 35% under the current climate (1980-2000) to 46%-48%, 51%-54%, 61%-67%, and 77%-83% under 1.5°C, 2.0°C, 3.0°C, and 4.0°C warming levels, respectively. These infer that the risk areas can increase by 1.3 times even under a 1.5°C scenario and expand by 2.3 times under a 4.0°C scenario. For sustainable ecosystem management, both mitigation and adaptation are necessary: bamboo planting must be carefully monitored in predicted potential habitats, which covers most of Japan.

  10. The influence of land use on soil organic carbon and nitrogen content and redox potential

    DEFF Research Database (Denmark)

    Kusliene, Gedrime

    2010-01-01

    different farming systems (conventional and organic) as well as abandoned lands. We choose the plants of two botanical species (Poaceae and Fabaceae) in organic and conventional farming systems as well as abandoned lands. Experimental results show that the best soil organic matter status according...... to the investigated indexes is in the soils of conventional and orgaic farming systems occupied with mixtures of Poaceae and Fabaceae and the worst - in the soils of abandoned Poaceae meadowa. In the abandoned lands, Fabaceae (galega) had better influence on soil organic matter status than Poaceae....

  11. Toxicity to Chicks of Aspergillus and Penicillium Species Isolated from Moldy Pecans 1

    Science.gov (United States)

    Doupnik, Ben; Bell, D. K.

    1971-01-01

    Isolates of Aspergillus chevalieri, A. flavus, A. ochraceus, A. repens, and Penicillium funiculosum and complexes of P. citrinum-P. implicatum isolated from moldy pecan meats were toxic to chicks. PMID:5564681

  12. A new Peperomia, collected by the Suriname expedition 1948/1949

    NARCIS (Netherlands)

    Yuncker, T.G.

    1957-01-01

    Herba parva delicata subcaespitosa repens, caule pergracili sat conferte piloso, pilis erectis; foliis alternis vel supremis oppositis elliptico-obovatis, apice rotundatis, basi acutis vel subobtusis, supra crispo-pubescentibus subtus glabris vel dissite pubescentibus ciliolatis palmatim

  13. Knowledge and prevalence of use of saw palmetto and other herbal ...

    African Journals Online (AJOL)

    S. Persaud

    2017-06-12

    Jun 12, 2017 ... men with prostate cancer or benign prostatic hyperplasia (BPH) and who were part of our outpatient clinics. ... plasia (BPH) and prostate cancer, of which saw palmetto (serenoa repens) may be the most .... receptor signaling.

  14. INVENTARISASI HIJAUAN PAKAN KUDA PACUAN DI NUSA TENGGARA BARAT

    Directory of Open Access Journals (Sweden)

    Sudirman Sudirman

    2014-12-01

    Full Text Available Pacuan kuda dilaksanakan setiap tahun di Provinsi Nusa Tenggara Barat yang diikuti oleh tidak kurang dari 700 ekor kuda pacuan dalam lima kelas lomba. Kegiatan ini umumnya berlangsung selama 1-2 minggu di Pulau Sumbawa dan senantiasa menjadi agenda hiburan rakyat serangkaian dengan acara perayaan hari-hari besar nasional maupun regional dan/atau lokal. Selama kurun waktu tersebut, semua kuda yang akan dilombakan diberikan pakan berupa hijauan dari jenis tumbuhan tertentu dan/atau spesifik. Tujuan penelitian ini adalah (1 menginventarisisr jenis-jenis tumbuhan yang dijadikan hijauan pakan kuda pacuan selama lomba berlangsung, dan (2 mengkaji komposisi nutrisi jenis hijauan pakan dimaksud. Metode yang digunakan untuk mengumpulkan data pada penelitian ini adalah metode observasi dan wawancara. Semua kuda pacuan yang berasal dari beberapa kabupaten di provinsi Nusa Tenggara Barat yangmengikuti lomba pacuan kuda di kabupaten Sumbawa tahun 2012 diamati pemberian pakannya, kemudian dilakukan identifikasi dan analisis komposisi nutrisi jenis hijauan yang diberikan. Untuk mengetahui jenis pakan yang diberikan, dilakukan pengamatan langsung dan wawancara dengan peternak kuda pacuan. Hasil penelitian menunjukkan bahwa tercatat 9 jenis tumbuhan (2 famili, 8 marga yang diberikan pada kuda pacuan selama lomba berlangsung, yaitu Alysicarpus vaginalis (Fabaceae, Desmodium dichotomum (Fabaceae, Cynodon dactylon (Poaceae, Cynodon sp. (Poaceae, Dactyloctenium aegyptium (Poaceae, Brachiaria sp. (Poaceae, Eleusine indica (Poaceae, Eulalia fimbriata (Poaceae dan Leersia hexandra (Poaceae. Hijauan pakan diberikan pada kuda pacuan dalam bentuk pakan tunggal maupun kombinasi diantara jenis-jenis tumbuhan tersebut dengan komposisi nutrisi yang berbeda.

  15. Screening for new accumulator plants in Andes Range mines

    Science.gov (United States)

    Bech, Jaume; Roca, Núria

    2016-04-01

    Toxic metal pollution of waters and soils is a major environmental problem, and most conventional remediation approaches do not provide acceptable solutions. The use of plants or plant products to restore or stabilize contaminated sites, collectively known as phytoremediation, takes advantage of the natural abilities of plants to take up, accumulate, store, or degrade organic and inorganic substances. Although not a new concept, phytoremediation is currently being re-examined as an environmentally friendly, cost-effective means of reducing metal contaminated soil. Plants growing on naturally metal-enriched soils are of particular interest in this regard, since they are genetically tolerant to high metal concentrations and have an excellent adaptation to this multi-stress environment. Processes include using plants that tolerate and accumulate metals at high levels (phytoextraction) and using plants that can grow under conditions that are toxic to other plants while preventing, for example, soil erosion (phytostabilization). Soil and plant samples were taken at polymetallic mines in Peru, Ecuador and Chile. It is suggested that Plantago orbignyana Steinheil is a Pb hyperaccumulator. Moreover, unusually elevated concentrations of Pb (over 1000 mg kg-1) and Translocation Factor (TF) greater than one were also detected in shoots of 6 different plants species (Ageratina sp., Achirodine alata, Cortaderia apalothica, Epilobium denticulatum, Taraxacum officinalis and Trifolium repens) of a Caroline mine in Perú. Among the grass species (Poaceae), the highest shoot As concentration were found in Paspalum sp. (>1000 μg g-1) and Eriochola ramose (460 μg g-1) from the Cu mine in Peru and in Holcus lanatus and Pennisetum clandestinum (>200 μg g-1) from the silver mine in Ecuador. The shoot accumulation of Zn was highest in Baccharis amdatensis (>1900 μg g-1) and in Rumex crispus (1300 μg g-1) from the Ag mine in Ecuador (Bech et al., 2002). Paspalum racemosum also

  16. Environ: E00167 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available PD:C01530], Benzoxazinones, Polysaccharide, Protein Coix lacryma-jobi [TAX:714458] Same as: D06798 Poaceae (grass family) Coicis semen Major component: Coixenolide [CPD:C17566] ...

  17. Mycosarcoma (Ustilaginaceae), a resurrected generic name for corn smut (Ustilago maydis) and its close relatives with hypertrophied, tubular sori

    NARCIS (Netherlands)

    McTaggart, Alistair R; Shivas, Roger G; Boekhout, Teun; Oberwinkler, Franz; Vánky, Kálmán; Pennycook, Shaun R; Begerow, Dominik

    2016-01-01

    Ustilago is a polyphyletic genus of smut fungi found mainly on Poaceae. The development of a taxonomy that reflects phylogeny requires subdivision of Ustilago into smaller monophyletic genera. Several separate systematic analyses have determined that Macalpinomyces mackinlayi, M. tubiformis,

  18. Population genetic structure analysis in endangered Hordeum ...

    African Journals Online (AJOL)

    Administrator

    2011-09-07

    Sep 7, 2011 ... populations are grown by few local farmers in low-input farming systems. Based on 117 random ... Triticeae of the Poaceae (Graminae) family found throughout the ... populations and phylogeography is made easy by the.

  19. Cloning and characterization of cDNA encoding xyloglucan ...

    African Journals Online (AJOL)

    Jane

    2011-08-22

    Aug 22, 2011 ... plays important role in growth and development of plants. XETs are a family of enzymes .... cloned into pGEM-T Easy vector (Promega Corporation, WI, USA). The recombinant ..... wall modification in the poaceae. Protein Sci.

  20. 2127-IJBCS-Article-Koffi Badou Jérémie

    African Journals Online (AJOL)

    hp

    Determination of critical period for weed control in intensive and non-intensive sugarcane (Saccharum officinarum L., Poaceae) production systems in center Côte d'Ivoire ... and chemical methods for effective and ...... Handbook Series No. 4.

  1. Drug: D10238 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ucris; Adlay ... Coix lacryma-jobi [TAX:714458] ... Same as: E00845 ... Poaceae (grass family) Adlay fruit and bract; Standards for non-pharmacopoeial crude drugs ... PubChem: 163312269 ...

  2. Commelinid Monocotyledon Lignins Are Acylated by p-Coumarate1[OPEN

    Science.gov (United States)

    Free, Heather C.A.; Smith, Bronwen G.

    2018-01-01

    Commelinid monocotyledons are a monophyletic clade differentiated from other monocotyledons by the presence of cell wall-bound ferulate and p-coumarate. The Poaceae, or grass family, is a member of this group, and most of the p-coumarate in the cell walls of this family acylates lignin. Here, we isolated and examined lignified cell wall preparations from 10 species of commelinid monocotyledons from nine families other than Poaceae, including species from all four commelinid monocotyledon orders (Poales, Zingiberales, Commelinales, and Arecales). We showed that, as in the Poaceae, lignin-linked p-coumarate occurs exclusively on the hydroxyl group on the γ-carbon of lignin unit side chains, mostly on syringyl units. Although the mechanism of acylation has not been studied directly in these species, it is likely to be similar to that in the Poaceae and involve BAHD acyl-coenzyme A:monolignol transferases. PMID:29724771

  3. Relationships between food quality and fitness in the desert locust, Schistocerca gregaria, and its distribution over habitats on the Red Sea coastal plain of Sudan

    NARCIS (Netherlands)

    Huis, van A.; Woldewahid, G.; Toleubayev, K.; Werf, van der W.

    2008-01-01

    The effect of millet, Pennisetum typhoideum Rich. (Poaceae), leaf nitrogen content on fitness parameters of the desert locust, Schistocerca gregaria Forsk. (Orthoptera: Acrididae), was studied under laboratory conditions. Locusts reared on high-nitrogen leaves were larger, developed faster, had

  4. Original Paper Weeds control through tree-crop associations in a ...

    African Journals Online (AJOL)

    these trees, two crops were grown: a shade tolerant crop (Colocasia esculenta, taro) ... The most represented weeds family in the open field was Poaceae while under both tree species, the ...... provided guide, corrections and supervision to.

  5. Haplotype Detection from Next-Generation Sequencing in High-Ploidy-Level Species: 45S rDNA Gene Copies in the Hexaploid Spartina maritima

    Czech Academy of Sciences Publication Activity Database

    Boutte, J.; Aliaga, B.; Lima, O.; de Carvalho, J.F.; Ainouche, A.; Macas, Jiří; Rousseau-Gueutin, M.; Coriton, O.; Ainouche, M.; Salmon, A.

    2016-01-01

    Roč. 6, č. 1 (2016), s. 29-40 ISSN 2160-1836 Institutional support: RVO:60077344 Keywords : poaceae * duplication * paralogy * bioinformatics * polyploidy Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.861, year: 2016

  6. Grass survey of the Itremo Massif records endemic central highland ...

    African Journals Online (AJOL)

    Grasses are members of the plant family Poaceae, and are primar- ily known for their ... Madagascar Conservation & Development is the journal of. Indian Ocean .... cording to the classification by Kellogg (2015). With 64 ..... Flowering plants.

  7. Comments on the variation of spike morphology in selected species of Elytrigia and Elymus (Triticeae

    Directory of Open Access Journals (Sweden)

    Romuald Kosina

    2014-01-01

    Full Text Available The structure of spikes of Elytrigia repens, E. intermedia and Elymus caninus was investigated. The number of spikelets per spike reveals the weakest correlations with other characters of the spike. The same concerns some character ratios. The correlations provide information about the segmented structure (metamers of the spike. There is a great difference between matrices of correlation coefficients for E. repens and E. intermedia related to the development and structure of spike. Characters important for the description of the spike were chosen - in five-character set these are among others: length of glume awn in median spikelet, length of lemma awn in the first floret of the median spikelet, number of spikelets per spike. Length of lemma awn and mean length of the rachis segment were recognized as the best discriminants for species. Ordination of forms along axes of canonical variates does not indicate the subunits within E. repens. Intermediate forms between E. repens and Elymus caninus have not been found. Between E. repens and E. intermedia there exists some proximity. Heteromorphic individuals were described by means of cluster analysis. They prove the mobility of the genome in ramets of a single genet.

  8. The floristic changes on excluded from agricultural production field after single Roundup spraying

    Directory of Open Access Journals (Sweden)

    Wojciech Jabłoński

    2013-12-01

    Full Text Available The purpose of experiment conducting on the field, weedy by Agropyron repens (L. P. B. was established what is the degree of elimination of Agropyron repens plants from experimental plots by single Roundup spraying. The changes of the species composition on the fields with different clover-grass mixtures or with Phacelia tanacaetifolia Benth. were studied as well. The stand tables have been made in the first year of the conducting experiment, to determination the density of weeds, after different agricultural practices. It has been found the great elimination of Agropyron repens (L. P. B. plants after Roundup spraying and the great density of Echinochloa crus-galli (L. P. B. plants. It has been found the great density of Chenopodium album L. at VII treatment and Galinsoga parviflora Cav. at III, V, VII and VIII treatments as well (Table I.

  9. Canine Dirofilaria infections in two uninvestigated areas of Serbia: epidemiological and genetic aspects.

    Science.gov (United States)

    Tasić, Aleksandar; Tasić-Otašević, Suzana; Gabrielli, Simona; Miladinović-Tasić, Nataša; Ignjatović, Aleksandra; Dorđević, Jovana; Dimitrijević, Sanda; Cancrini, Gabriella

    2012-12-01

    In 2009 canine filarial infections were investigated in two northern areas of Serbia (Pančevo and Veliko Gradište), applying morphometry, biochemical staining, and immunological kit to detect Dirofilaria immitis antigens, and two home-made ELISAs to detect antibodies to D. repens and D. immitis somatic/metabolic polyproteins. Moreover, molecular tools were applied to analyze the phylogenetic relationships of the isolates. The microfilariae detected in 21/122 dogs (17.2%) were identified as D. repens (n=21) and D. immitis (n=2). D. immitis antigens were found in another 13 animals with occult infection. All of the 15 heartworm-positive dogs also had antibodies to this parasite, which were detected in another 13 subjects, indicating an overall D. immitis seroprevalence rate of 22.9%. Serology for D. repens revealed evidence of antibodies in 42.6% of the dogs, but was negative for 4 microfilaremic dogs. As for the two different areas, the prevalence of microfilariae and/or D. immitis antigens, mainly due to D. repens microfilaremic animals, was not significantly higher in Veliko Gradište (33.3%) than in Pančevo (22%). However, serology showed a different epidemiological picture. Heartworm infection occurred more often in both areas, and antibodies to dirofilarial nematodes were detected in 72.9% of dogs living in Pančevo, a rate higher than in those living in Veliko Gradište (57.1%). No risk factors for infection were found, confirming the uselessness of prophylactic drugs against D. repens, and suggesting the presence in these areas of sunrise- or sunset-biting mosquitoes as important vectors. The results indicate the need for both appropriate entomological studies and further research on the intra-species variability shown by D. repens.

  10. Airborne study of grass allergen (Lol p 1) in different-sized particles.

    Science.gov (United States)

    De Linares, C; Díaz de la Guardia, C; Nieto Lugilde, D; Alba, F

    2010-01-01

    The Poaceae family is considered one of the main causes of pollen allergy in industrialized countries. The aim of this study is to establish the dynamics of the Poaceae allergens and determine their distribution in the different-sized particles in the atmosphere. The air of Granada (southern Spain) was sampled during the pollination period of Poaceae using a cascade impactor and a Hirst-type volumetric collector simultaneously. The sampled airborne allergens were analyzed by indirect ELISA and field emission scanning electron microscopy. Airborne pollen was evaluated with the Spanish Aerobiological Network methodology. Poaceae pollen and allergenic activity have parallel dynamics during the period of maximum pollination, which is reflected in the positive correlations between the 2 variables. In addition, the highest Lol p 1 concentrations were recorded in particle sizes lower than 3.3 mum (stage 4-F). The Spearman correlation test showed that airborne allergens are not dependent on meteorological factors, such as humidity, wind direction or sunshine, however, Lol p 1 allergen correlated positively with Poaceae pollen. The results of the present study confirm that the Lol p 1 allergen is detected more frequently with pollutants than with coarse particles with similar dynamics and a positive correlation between airborne pollen and aeroallergens. Moreover, Lol p 1 is released in stable weather conditions without large changes in humidity or temperature. Copyright 2009 S. Karger AG, Basel.

  11. Response of Saw Palmetto to Three Herbicides During the First Growing Season

    Science.gov (United States)

    J.L. Michael

    1980-01-01

    Trimec 881 and 823 (mixture of 2,4-D; MCPP and dicamba in 2:1:0.l and 1:1:0.25 ratio respectively) and trichlopyr ester were evaluated for effectiveness against saw palmetto, Serenoa repens (Bartram) Small, when they were applied at three rates in April, June, and August. Herbicides were most effective with April applicatiorr, least effective in...

  12. Response of Saw Palmetto to Three Herbicides

    Science.gov (United States)

    J.L. Michael; D.G. Neary

    1985-01-01

    Saw palmetto [Serona repens (Bartram) Small] can be controlled with herbicides. Garion® 4E1/2 and Brush Killer® 800 were evaluated for effectiveness againest saw palmetto when they were applied at three rates in April, June, and August. Oust® was tested at three rates in April only. Herbicides were not effective with April...

  13. Effect of moulding on the changes in chemical composition of tabacco leaves

    OpenAIRE

    Krystyna Florczak

    2014-01-01

    The process of moulding caused by the fungi: Aspergillus repens (Cda.) De Bart, Aspergillus flavus Link, Aspergillus ochraceus Wilhelm, Penicillium expansum (Link) Thom, VPenicillium commune Thom and Penicillum spinulosum Tom influenced the decrease in soluble carbohydrate content with the simulataneous increase in the percentage of specific protein. It had an effect on the deterioration of technological and taste values of raw tabacco.

  14. Khan et al., Afr J Tradit Complement Altern Med. (2013) 10(3):436 ...

    African Journals Online (AJOL)

    AJTCAM

    The effects of Duranta repens fruits were investigated on H2O2 induced .... Data were analyzed by one-way ANOVA and then post-hoc comparison (LSD test) by using ..... brain. J. Physiol. Pharmacol., 56: 23-36. 27. Shahat, A.A., Nazif, N.M., ...

  15. Host status of barley to Puccinia coronata from couch grass and P. striiformis from wheat and brome

    NARCIS (Netherlands)

    Niks, R.E.; Heyzen, van S.; Szabo, L.J.; Alemu, S.K.

    2013-01-01

    The pathogenicity and identity was studied of a field sample (PcE) of crown rust fungus Puccinia coronata collected in Hungary on wild couch grass (Elymus repens) and of a field sample (Psb) of stripe rust (P. striiformis) collected in the Netherlands on California brome (Bromus carinatus). We

  16. Author Details

    African Journals Online (AJOL)

    Ser.) var. glabellum and Trifolium repens (L.) cv. Ladino to lime and fertilizer. Abstract. ISSN: 1022-0119. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

  17. varlUS and M .

    African Journals Online (AJOL)

    reduction in mean annual temperature (Meester 1963). However, Myosorex is grouped with the crocidurines on account of its unpigmented teeth and continuous articular facets on the mandibular condyle (Repenning 1967). Baxter, Goulden & Meester (1979) have shown that subfamilial differences in metabolic rates of ...

  18. An interesting new Bulbophyllum

    NARCIS (Netherlands)

    Smith, J.J.

    1935-01-01

    Bulbophyllum (sect. Cirrhopetalum) Jacobsonii J. J. S. n. sp. — Rhizoma repens, teres. Pseudobulbi remoti, oblique ovoidei, manifesto quadranguli cum lateribus concavis, 1.8 cm longi, 0.75 et 0.95 cm diam., 1-folii. Folium lanceolatum, apice recurvulum, basi brevissime

  19. Radioactive elements found in plants contaminated by radioactive rain

    Energy Technology Data Exchange (ETDEWEB)

    Tanidazawa, M; Ishihara, T

    1954-01-01

    Ashes obtained from contaminated trifolium repens, astragalus sinicus, and rumex japonicus were studied. The precipitate obtained by treating the acidic solution of the ash with H/sub 2/S followed by Fe/sup + +/ in the presence of NH/sub 3/ and NH/sub 4/Cl contained Y, Sr, and the rare earth elements.

  20. Host status of barley to Puccinia coronata from couch grass and P. striiformis from wheat and brome

    Science.gov (United States)

    The pathogenicity and identity of a field sample (PcE) of crown rust fungus Puccinia coronata collected in Hungary on wild couch grass (Elytrigia repens) and of a field sample (Psb) of stripe rust (P. striiformis) collected in the Netherlands on California brome (Bromus carinatus) was studied. We fo...

  1. Effect of seed mixture composition and management on competitiveness of herbs in temporary grasslands

    DEFF Research Database (Denmark)

    Mortensen, Tine Bloch; Søegaard, Karen; Eriksen, Jørgen

    2012-01-01

    of perennial ryegrass (Lolium perenne) and white clover (Trifolium repens), 2) cutting frequency, and 3) slurry application. The experiment was carried out over three years. The herb mixture contained salad burnet (Sanguisorba minor), fenugreek (Trigonella foenum-graecum), chicory (Cichcorium intybus), caraway...

  2. Induced DNA damage measured by the Comet assay in 10 weed species

    Czech Academy of Sciences Publication Activity Database

    Gichner, Tomáš; Mühlfeldová, Zdeňka

    2002-01-01

    Roč. 45, č. 4 (2002), s. 509-516 ISSN 0006-3134 R&D Projects: GA ČR GA521/02/0400 Institutional research plan: CEZ:AV0Z5038910 Keywords : Arabidopsis thaliana * Agropyron repens * Bellis perennis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.583, year: 2002

  3. Toxic and feeding deterrent effects of native aquatic macrophytes on exotic grass carp (Ctenopharyngodon idella).

    Science.gov (United States)

    Murphy, Joseph E; Beckmen, Kimberlee B; Johnson, Julie K; Cope, Rhian B; Lawmaster, Todd; Beasley, Val R

    2002-08-01

    Declines of amphibians have been attributed to many factors including habitat degradation. The introduction of grass carp (Ctenopharyngodon idella) as a biological agent for aquatic plant control in ponds and lakes managed narrowly for human recreation has likely contributed to amphibian declines through massive plant removal and associated habitat simplification and thus degradation. This research examined the interactions among grass carp and three Midwestern aquatic plants (Jussiaea repens, Ranunculus longirostris, and R. flabellaris) that may be of value in rehabilitation of habitats needed by amphibians. The feeding preference study found that C. idella avoided eating both J. repens and R. longirostris. Ranunculus species studied to date contain a vesicant toxin called ranunculin that is released upon mastication. The study that compared the effects of R. flabellaris, J. repens and a control food administered by tube feeding to C. idella found significant lesions only in the mucosal epithelium of the individuals exposed to R.flabellaris. The avoidance by C. idella of J. repens and R. longirostris in the feeding preference study, and the significant toxicity of R. flabellaris demonstrated by the dosing study, indicate these plants warrant further examination as to their potential effectiveness in aquatic amphibian habitat rehabilitation.

  4. Modelling interactions in grass-clover mixtures

    NARCIS (Netherlands)

    Nassiri Mahallati, M.

    1998-01-01

    The study described in this thesis focuses on a quantitative understanding of the complex interactions in binary mixtures of perennial ryegrass (Lolium perenne L.) and white clover (Trifolium repens L.) under cutting. The first part of the study describes the dynamics of growth, production

  5. Biomass and leaf-level gas exchange characteristics of three African savanna C4 grass species under optimum growth conditions

    NARCIS (Netherlands)

    Mantlana, K.B.; Veenendaal, E.M.; Arneth, A.; Grispen, V.; Bonyongo, C.M.; Heitkönig, I.M.A.; Lloyd, J.

    2009-01-01

    C4 savanna grass species, Digitaria eriantha, Eragrostis lehmanniana and Panicum repens, were grown under optimum growth conditions with the aim of characterizing their above- and below-ground biomass allocation and the response of their gas exchange to changes in light intensity, CO2 concentration

  6. Seasonal and inter-annual photosynthetic response of representative C4 species to soil water content and leaf nitrogen concentration across a tropical seasonal floodplain

    NARCIS (Netherlands)

    Mantlana, K.B.; Arneth, A.; Veenendaal, E.M.; Wohland, P.; Wolski, P.; Kolle, O.; Lloyd, J.

    2008-01-01

    We examined the seasonal and inter-annual variation of leaf-level photosynthetic characteristics of three C4 perennial species, Cyperus articulatus, Panicum repens and Imperata cylindrica, and their response to environmental variables, to determine comparative physiological responses of plants

  7. Role of golden jackals (Canis aureus) as natural reservoirs of Dirofilaria spp. in Romania.

    Science.gov (United States)

    Ionică, Angela Monica; Matei, Ioana Adriana; D'Amico, Gianluca; Daskalaki, Aikaterini Alexandra; Juránková, Jana; Ionescu, Dan Traian; Mihalca, Andrei Daniel; Modrý, David; Gherman, Călin Mircea

    2016-04-28

    Dirofilaria immitis and Dirofilaria repens are mosquito-transmitted zoonotic nematodes, causing heartworm disease and skin lesions, respectively, in carnivores. In Europe, the domestic dog is apparently the main definitive host, but patent infections occur also in other species of carnivores. The rapid spread of the golden jackals (Canis aureus) throughout Europe opens a question of involvement of this species in the sylvatic cycle of pathogens in the colonised territories, including Dirofilaria spp. Between January 2014 and May 2015, 54 golden jackals from 18 localities in Romania were examined by full necropsy for the presence of adult filarioid nematodes and blood samples from all animals were screened for the presence of microfilariae of D. immitis, D. repens and Acanthocheilonema reconditum by multiplex PCR DNA amplification. Nematodes morphologically identified as D. immitis were found in 18.52% of the animals, originating from the southern part of Romania. No D. repens or A. reconditum were found at necropsy. The molecular prevalence in blood samples from the same animals was 9.26% for D. immitis and 1.85% for D. repens. All samples were negative by PCR for A. reconditum. The relatively high prevalence of Dirofilaria spp. infections in golden jackals from Romania together with the increasing density of the jackal populations highlight their potential role in the transmission of these zoonotic parasites and in the maintenance of natural disease foci.

  8. Nieuwe vondsten van zeldzame planten in 1999 en 2000

    NARCIS (Netherlands)

    Meijden, van der Ruud; Holverda, Wout J.; Slikke, van der Wout J.

    2001-01-01

    The best news is the discovery of a new inland locality of Apium repens, an endangered species included in both the Habitat Directive and the Berne Convention. The List has a striking number of new records of rare ferns: Asplenium adiantum-nigrum, A. septentrionalis, Botrychium lunaria, Ceterach

  9. Molecular cloning of a novel GSK3/shaggy-like gene from Triticum ...

    African Journals Online (AJOL)

    The deduced amino acid sequence showed a high homology with shaggy-like kinases from Triticum aestivum, Zea mays, Trifolium repens, Nicotine tabacum, Medicago sativa and Arabidopsis thaliana; therefore, the gene was named TmGSK1 (Triticum monococcum Glycogen Synthase Kinase 1,GenBank Accession No.

  10. Prognoses of plant community changes in the territories not used for agriculture after the accident at the Chernobyl nuclear power plant

    International Nuclear Information System (INIS)

    Timofeev, S.F.; Podolyak, A.G.; Avseenko, S.V.; Sapegin, L.M.; Dayneko, N.M.

    1997-01-01

    Science-research in the zones of eviction in the Bragin district of the Gomel region confirms interdependence between development of plants' communities and such factors as type of soil, kind of agricultural field, the term of nonuse. The study of vegetation change on the former fields, represented by turf-podsol soil, indicates that plant community has by now been formed on it, in which out of 100% projection cover prevail Artemisia absinthium L., - 40%, Artemisia campestris L. -20%, Artemisia vulgaris L. -5%, Elytrigia repens (L.) Nevski - 30%. On lower lots, represented by turf-podsol swampy soil, prevail Elytrigia repens - 60%, Artemisia absinthium -20%, Erigeron canadensis - 10%. So, on the unused arable land the tendency to form communities of Elytrigia repens is observed. In 10-15 years there may be a community here, consisting of bunch-grasses an densely turfed grasses. On the haymaking and pasture meadows, sowing plants are replaced by rhizome bunch-grasses (Poa pratensis L.) rhizome (Elytrigia repens) and diverse grasses (Artemisia absinthium, Achillea millefolium, Erigeron canadensis and others). On sowing meadows, situated on peat-swamp soil, Urtica dioica L. took root. It formed powerful herbage with 80-90% projection cover, which prevents the renewing of grasses. Only after gradual decrease of Urtica dioica there will appear different grasses, as well as rhisome grasses. In future this land can be used for haymaking. It is impossible to use this kind of soil without herbicides in large quantity, which may create additional problems of ecological character

  11. Spring foraging resources and the behaviour of pollinating insects in fixed dune ecosystems

    Directory of Open Access Journals (Sweden)

    Aoife T. O'Rourke

    2014-08-01

    Full Text Available In temperate climates, foraging resources for pollinating insects are especially important in early spring when animals emerge from hibernation and initiate annual life cycles. One habitat, protected under EU law, which provides resources for a range of pollinating insects, but has received little research attention, is fixed (grey dunes. Fixed dunes often contain creeping willow (Salix repens, Salicaceae, which may be an important early season resource for obligate flower visitors. We examined the springtime activity of flower visitors in fixed dune ecosystems in relation to sugar concentration and composition in nectar, composition of essential amino acids in pollen, and floral abundance. We also investigated whether the presence or absence of S. repens influenced the abundance and species richness of three obligate flower visiting guilds (solitary bees, bumblebees and hoverflies in eight sites along the eastern and southern coasts of Ireland. Higher insect visitation rates were observed to species whose nectar contained greater concentrations of glucose and fructose. Solitary bee visitation rates were related to % Essential Amino Acid (EAA in pollen and floral species richness. Ulex europeaus, and S. repens were the most abundant flowering species, but visitation rates were not related to floral abundance. Higher abundances of bumblebees and hoverflies were discovered at sites where S. repens was present. This study raises further questions about the nutritional requirements and preferences of obligate flower visitors in fixed dune ecosystems in spring time.

  12. Xenomonitoring of Mosquitoes (Diptera: Culicidae for the Presence of Filarioid Helminths in Eastern Austria

    Directory of Open Access Journals (Sweden)

    Sarah Susanne Übleis

    2018-01-01

    Full Text Available Information on mosquito-borne filarioid helminths in Austria is scarce, but recent discoveries of Dirofilaria repens indicate autochthonous distribution of this parasite in Eastern Austria. In the current xenomonitoring study, more than 48,000 mosquitoes were collected in Eastern Austria between 2013 and 2015, using different sampling techniques and storage conditions, and were analysed in pools with molecular tools for the presence of filarioid helminth DNA. Overall, DNA of D. repens, Setaria tundra, and two unknown filarioid helminths were documented in twenty mosquito pools within the mitochondrial cox1 gene (barcode region. These results indicate that S. tundra, with roe deer as definite hosts, is common in Eastern Austria, with most occurrences in floodplain mosquitoes (e.g., Aedes vexans. Moreover, DNA of D. repens was found in an Anopheles plumbeus mosquito close to the Slovakian border, indicating that D. repens is endemic in low prevalence in Eastern Austria. This study shows that xenomonitoring is an adequate tool to analyse the presence of filarioid helminths, but results are influenced by mosquito sampling techniques, storage conditions, and molecular protocols.

  13. Leaching of dissolved organic and inorganic nitrogen from legume-based grasslands

    DEFF Research Database (Denmark)

    Kusliene, Gedrime; Eriksen, Jørgen; Rasmussen, Jim

    2015-01-01

    Leaching of dissolved inorganic nitrogen (DIN) and dissolved organic nitrogen (DON) is a considerable loss pathway in grassland soils. We investigated the white clover (Trifolium repens) contribution to N transport and temporal N dynamics under a pure stand of white clover and white clover...

  14. On the stability of mixed grasslands

    NARCIS (Netherlands)

    Schulte, R.P.O.

    2001-01-01

    Recent years have seen a renewed interest in the use of white clover (Trifolium repens) in grasslands, as a more sustainable alternative to fertiliser nitrogen inputs. However, mixtures of grasses and white clover have frequently been associated with unstable and hence unreliable herbage

  15. Species of Concern (SOC) on Department of Defense Installations

    Science.gov (United States)

    2002-07-15

    ARISTIDA STRICTA; DRY, UPLAND FLAT, FILTERED LIGHT; WITH BAPTISIA CINEREA, VIOLA PEDATA, DALEA PINNATA.* SUBPOP A=PINE/SCRUB OAK SANDHILL; FEW SCATTERED...DIOSPYROS VIRG., GAYLUSSACIA DUMOSA, EPIGAEA REPENS, ANDROPOGON SP., BAPTISIA TINCT., TEPHROSIA VIRG., VACCINIUM CRASS., LESPEDEZA SP., DALEA PINNATA...ADENOCAULON BICOLOR , PHACELIA NEMORALIS, CAREX HENDERSONII. CIRSIUM VULGARE COMMON WHERE DISTURBED.* Cedar-hemlock forest on lower slopes of logged

  16. Environmental Assessment Addressing the Emerald Breeze Resort, Santa Rosa Island, Fort Walton Beach, Florida

    Science.gov (United States)

    2009-09-11

    Road construction and maintenance activities have introduced and spread cogon grass (Imperata cylindrical) and torpedo grass (Panicum repens) to...Chinese tallow, or popcorn tree (Triadica sebifera), cogon grass , Japanese climbing fern (Lygodium japonicum), Chinese privet/hedge (Ligustrum sinense...stormwater wetlands, wildlife habitat swales, grassed filter strips)  Runoff pretreatment practices (e.g., catch basins, in-line storage, manufactured

  17. Growth of bermudagrass with white clover or nitrogen fertilizer

    Science.gov (United States)

    White clover (Trifolium repens) var ‘Durana’ was oversown into established bermudagrass (Cynodon dactylon) in 2009. Soil analysis indicated potassium (K) was low and potash at 112 and 336 kg/ha was added as main plots. Nitrogen as ammonium nitrate or an ammonium sulfate/urea blend was added as 0, 34...

  18. Nieuwe vondsten van zeldzame planten in 2001 en 2002

    NARCIS (Netherlands)

    Holverda, Wout; Moorsel, van René C.M.J.; Slikke , van der Wout

    2003-01-01

    Two new localities of Luronium natans and a new locality of Apium repens is good news from a European perspective. Potamogeton filiformis is a new indigenous species, which has been recorded from the island of Texel. Valerianella rimosa has been rediscovered. As in previous years, the number of new

  19. Relationships between Nitrate and Oxygen Supply in Symbiotic Nitrogen Fixation by White Clover

    DEFF Research Database (Denmark)

    Minchin, F. R.; Ines Minguez, M.; Sheedy, J. E.

    1986-01-01

    Exposure of mature, nodulated plants of white clover (Trifolium repens) cv. Blanca to 330 mg dm−3 NO3-N for 8 d caused nitrogenase activity per plant to decrease by 80%. Total nodulated root respiration was not significantly affected but analysis of its components showed an 81% decrease in nitrog...

  20. Seasonal variation in the biochemical composition of red seaweed

    Indian Academy of Sciences (India)

    Abstract. The biochemical composition of red seaweeds,Catenella repens was investigated in this present study along with subsequent analysis of relevant physico-chemical variables.In this study, the relationship between the nutritive components of this species and the ambient environmental parameters was established.

  1. Nieuwe vondsten van zeldzame planten in 2003 en 2004

    NARCIS (Netherlands)

    Meijden, van der Ruud; Holverda, Wout J.

    2006-01-01

    Vanuit Europees gezichtspunt was de ontdekking van twee nieuwe vindplaatsen van Apium repens en drie van Liparis loeselii belangrijk nieuws. De ontdekking van Gagea minima was verbazend. Na meer dan een eeuw kon de melding van Peucedanum officinale bevestigd worden door zijn herontdekking. Nieuw is

  2. A Negative Finding from a Single Center Study Led to Re-Design of a Large-Scale Clinical Trial of Phytotherapy for Benign Prostatic Hyperplasia: the CAMUS study

    Science.gov (United States)

    Lee, Jeannette Y.; Andriole, Gerald; Avins, Andrew; Crawford, E. David; Foster, Harris; Kaplan, Steven; Kreder, Karl; Kusek, John W.; McCullough, Andrew; McVary, Kevin; Meleth, Sreelatha; Naslund, Michael; Nickel, J. Curtis; Nyberg, Leroy M.; Roehrborn, Claus; Williams, O. Dale; Barry, Michael J.

    2010-01-01

    Background Benign prostatic hyperplasia (BPH), a common condition among older men, confers its morbidity through potentially bothersome lower urinary tract symptoms. Treatments for BPH include drugs such as alpha adrenergic receptor blockers and 5-alpha reductase inhibitors, minimally invasive therapies that use heat to damage or destroy prostate tissue, and surgery including transurethral resection of the prostate. Complementary and alternative medicines are gaining popularity in the U.S. Two phytotherapies commonly used for BPH are extracts of the fruit of Serenoa repens, the Saw palmetto dwarf palm that grows in the Southeastern U.S., and extracts of the bark of Pygeum africanum, the African plum tree. Purpose The objective of the Complementary and Alternative Medicines for Urological Symptoms (CAMUS) clinical trial is to determine if phytotherapy is superior to placebo in the treatment of BPH. Methods CAMUS was originally designed as a 3300-participant, four-arm trial of Serenoa repens, Pygeum africanum, an alpha adrenergic blocking drug, and placebo with time to clinical progression of BPH, a measure of long-term efficacy, as the primary endpoint. Before enrollment started, a randomized, double-blind, placebo-controlled, single institution clinical trial showed that Serenoa repens at the usual dose did not demonstrate any benefit over placebo with respect to symptom relief at one year. Consequently, the focus of CAMUS shifted from evaluating long-term efficacy to determining if any short-term (6-18 month) symptom relief could be achieved with increasing doses of Serenoa repens, the phytotherapy most commonly used in the U.S. for BPH. Results Results are anticipated in 2011. Conclusions Trial design occurs in an environment of continually evolving information. In this case, emerging results from another trial suggested that a study of long-term efficacy was premature, and that an effective dose and preparation of Serenoa repens had to be established before

  3. Vector-borne pathogens in dogs and red foxes from the federal state of Brandenburg, Germany.

    Science.gov (United States)

    Liesner, Jana M; Krücken, Jürgen; Schaper, Roland; Pachnicke, Stefan; Kohn, Barbara; Müller, Elisabeth; Schulze, Christoph; von Samson-Himmelstjerna, Georg

    2016-07-15

    Dirofilaria repens is endemic in eastern and southern European regions but was recently found in Germany in dogs, mosquitoes and one human patient. Since some of the positive dog and mosquito samples were collected in Brandenburg, it was aimed to systematically assess the prevalence of D. repens and other canine vector-borne pathogens in Brandenburg. Dog owners also received a questionnaire and were asked to provide more information about the dogs including travel history. In total, 1023 dog blood samples as well as 195 fox spleen and 179 fox blood samples were collected. DNA was analysed by PCR for the presence of filariae, piroplasms, anaplasmataceae and Rickettsia spp. Filariae were detected in six dogs (0.6%), two were positive for DNA from D. repens, two from Dirofilaria immitis and two from Acanthocheilonema reconditum. One of the D. repens positive dogs originated from an animal shelter in Brandenburg, but the origin of the other one remained unknown. Interestingly, both D. repens ITS-1 sequences showed 100% identity to a D. repens sample obtained from a Japanese woman that travelled in Europe and were 97% identical to a newly proposed species Dirofilaria sp. 'hongkongensis' described from Hong Kong. However, identity to other D. repens sequences from Thailand was considerably lower (81%). Identity of 12S rRNA and cytochrome oxidase I to D. repens samples from southern Europe was 99%. Due to the low number of Dirofilaria spp. positive dogs and since the origin of these was unknown, endemic occurrence of Dirofilaria in Brandenburg could not be confirmed. Anaplasma phagocytophilum was found in 15 dogs (1.5%), Candidatus Neoehrlichia mikurensis in three dogs (0.3%) and E. canis in one dog (0.1%), which was co-infected with D. repens. Rickettsia spp. were detected in 8 dogs (0.8%), seven were Rickettsia raoultii and one was Rickettsia felis. To the author's knowledge, R. raoultii DNA was detected for the first time in dogs in Germany in this study and Candidatus

  4. Psárky Alopecurus aequalis a A. geniculatus v České republice: jejich určování a rozšíření

    Czech Academy of Sciences Publication Activity Database

    Bureš, P.; Danihelka, Jiří; Husáková, M.; Pařil, P.

    2008-01-01

    Roč. 23, - (2008), s. 3-61 ISSN 0862-2035 R&D Projects: GA MŠk(CZ) LC06073; GA ČR(CZ) GA206/07/0706 Institutional research plan: CEZ:AV0Z60050516 Keywords : phytogeography * Poaceae * Central Europe Subject RIV: EF - Botanics

  5. Ajikah et al (11).cdr

    African Journals Online (AJOL)

    Timothy Ademakinwa

    Faculty of Science, Senate Building and New Hall respectively. A total of 3,495 palynomorphs belonging to about 22 families were recovered in all. The Poaceae family dominates representing 13.67 % of the total palynomorph count, followed by Cyperaceae (12.72 %) Euphorbiaceae (5.34 %) Mimosaceae (8.89 %), Fern.

  6. Modern pollen rain in Canary Island ecosystems and its implications for the interpretation of fossil records

    DEFF Research Database (Denmark)

    de Nascimento, Lea; Nogué, Sandra; Fernández-Lugo, Silvia

    2015-01-01

    -represented (.Pinus, Morella and Ericaceae trees, Chenopodiaceae, Poaceae, Rumex and Urticaceae herbs and shrubs) or under-represented (Lauraceae trees, Fabaceae and Euphorbia shrubs). Results indicate that pollen composition is a good reflection of vegetation in Canarian ecosystems and can be used effectively...

  7. Take-all or nothing

    NARCIS (Netherlands)

    Hernández-Restrepo, M.; Groenewald, J.Z.; Elliott, M.L.; Canning, G.; McMillan, V.E.; Crous, P.W.

    2016-01-01

    Take-all disease of Poaceae is caused by Gaeumannomyces graminis (Magnaporthaceae). Four varieties are recognised in G. graminis based on ascospore size, hyphopodial morphology and host preference. The aim of the present study was to clarify boundaries among species and varieties in

  8. Take-all or nothing

    NARCIS (Netherlands)

    Hernández-Restrepo, M.; Groenewald, J.Z.; Elliott, M.L.; Canning, G.; McMillan, V.E.; Crous, P.W.

    2016-01-01

    Take-all disease of Poaceae is caused by Gaeumannomyces graminis (Magnaporthaceae). Four varieties are recognised in G. graminis based on ascospore size, hyphopodial morphology and host preference. The aim of the present study was to clarify boundaries among species and varieties in Gaeumannomyces

  9. Computational identification of putative cytochrome P450 genes in ...

    African Journals Online (AJOL)

    Chattha

    Economically, legumes represent the second most important family of crop plants after Poacea (grass family), accounting for ... further characterization of P450 genes with both known and unknown functions. MATERIALS AND METHODS ..... Cytochrome P450. In: Somerville CR, Meyerowitz EM (eds) .The Arabidopsis book,.

  10. Study of the chemical composition of essential oils and floral waters ...

    African Journals Online (AJOL)

    This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and. Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried.

  11. Study of the chemical composition of essential oils and floral waters ...

    African Journals Online (AJOL)

    This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried ...

  12. Chromosome numbers and meiotic analysis in the pre-breeding of ...

    Indian Academy of Sciences (India)

    2011-08-19

    Aug 19, 2011 ... of Brachiaria decumbens (Poaceae). GLÉIA CRISTINA LAVERDE ... widely used grass forage worldwide because it adapts to acid soils, is easy to man- ... individual plants growing in the field, fixed in a mixture of ethanol 95% ...

  13. Contribution of chloroplast DNA in the biodiversity of some Aegilops ...

    African Journals Online (AJOL)

    user

    2011-03-21

    Mar 21, 2011 ... caudata) belonging to the family Poaceae were used in this study. Nucleotides of 1651 ... terranean basin and grow well in the high rainy areas. Syria is ... ate and easy identification of Aegilops species is required. Molecular ...

  14. A field key to upload Kenya grasses | Agnew | Journal of East ...

    African Journals Online (AJOL)

    The species of Gramineae (Poaceae) that have been recorded in a delimited area of central and western Kenya are listed and keys are provided for their identification. The area is bounded by the 1000 m contour except in the southern Rift Valley where the Kenya/Tanzania boundary encorporates lower altitudes. For every ...

  15. Stress tolerant plant species spread in the road-ne

    Czech Academy of Sciences Publication Activity Database

    Šerá, Božena

    2011-01-01

    Roč. 14, Vol.14 (2011), s. 45-46 ISSN 1644-7298 R&D Projects: GA MŠk OC10032 Institutional research plan: CEZ:AV0Z60870520 Keywords : weed * invasive * road-ne * salinity * Poaceae Subject RIV: AP - Urban, Regional and Transport Planning

  16. Problems, control, and opportunity of starch in the large scale processing of sugarcane and sweet sorghum

    Science.gov (United States)

    Both sugarcane (Saccharum officinarum) and sweet sorghum (Sorghum bicolor) crops are members of the grass (Poaceae) family, and consist of stalks rich in soluble sugars. The extracted juice from both of these crops contains insoluble starch, with much greater quantities occurring in sweet sorghum. ...

  17. 10 - 18_Aworinde

    African Journals Online (AJOL)

    DR. AMINU

    From the data, Euphorbiaceae,. Solanaceae, Rutaceae, Malvaceae, Caesalpiniaceae, Poaceae and Apocynaceae (in order of decreasing number of species) were the most frequent Families. Taxa such as Musa species,. Vernonia amygdalina, Citrus species, Psidium guajava and Terminalia catappa were found to be the.

  18. Contribution of chloroplast DNA in the biodiversity of some Aegilops ...

    African Journals Online (AJOL)

    Four Aegilops species (Aegilops longissima, Aegilops speltoides, Aegilops searsii and Aegilops caudata) belonging to the family Poaceae were used in this study. Nucleotides of 1651 bp from 5.8 S rRNA gene and the intergenic spacers trnT-trnL and trnL-trnF from the chloroplast DNA were combined together in order to ...

  19. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. Kellen Regina Boldrini. Articles written in Journal of Genetics. Volume 85 Issue 3 December 2006 pp 225-228 Research Note. Abnormal timing of cytokinesis in microsporogenesis in Brachiaria humidicola (Poaceae: Paniceae) · Kellen Regina Boldrini Maria Suely Pagliarini Cacilda ...

  20. cas du cordon littoral Port-Bouët-Grand-Bassam

    African Journals Online (AJOL)

    Formations végétales. Espèces. Familles. Cocoteraie. Fourré littoral. Jachère. Saccharum officinarum L. Poaceae x. Salacia baumannii Loes. Celastraceae x. Sansevieria liberica Gérôme & Labroy. Agavaceae x. Sauvagesia erecta L. Ochnaceae x. Scoparia dulcis L. Scrophulariaceae x x. Sesamum radiatum Schumacher.