WorldWideScience

Sample records for remarkable bp star

  1. A refined analysis of the remarkable Bp star HR 6000

    CERN Document Server

    Castelli, F

    2007-01-01

    UVES spectra of the very young (~10^7 years) peculiar B-type star HR 6000 were analyzed in the near-UV and visual spectral regions (3050-9460 A) with the aim to extend to other spectral ranges the study made previously in the UV using IUE spectra. Stellar parameters Teff=12850K, logg=4.10, and xi=0km/s, as determined from H_beta, H_gamma, H_delta Balmer profiles and from the Fe I, Fe II ionization equilibrium, were used to compute an individual abundances ATLAS12 model. We identified spectral peculiarities and obtained final stellar abundances by comparing observed and computed equivalent widths and line profiles. The adopted model fails to reproduce the (b-y) and c color indices. The spectral analysis has revealed: the presence of emission lines for Mn II, Cr II, and Fe II; isotopic anomalies for Hg, Ca; the presence of interstellar lines of Na I at lambda lambda 3302.3, 3302.9, 5890, 5896 A, and of K I at 7665, 7699 A; the presence of a huge quantity of unidentified lines, which we presume to be mostly due ...

  2. Chandra Spectroscopy of a Remarkable Neutron Star

    Science.gov (United States)

    Miller, Jon

    2013-09-01

    IGR J17062-6143 is one of only 5 sources that have displayed a super-expansion burst. This requires a special mode of continuous low-level accretion that allows material to accumulate on the stellar surface, without triggering smaller bursts. Swift spectroscopy of a super-expansion burst in IGR J17062-6143 revealed the only strong detections of atomic emission and absorption lines in a burst observed at CCD or gratings resolution. Whereas atomic features from the stellar surface have not been detected in other neutron stars, the accretion mode in IGR J17062-6143 may provide the right conditions. To search for lines from the surface, and to better understand the nature of low-level accretion, we request a 100 ksec HETGS observation of IGR J17062-6143.

  3. Diffusion and Settling in Ap/Bp Stars

    CERN Document Server

    Turcotte, S

    2003-01-01

    Ap/Bp stars are magnetic chemically peculiar early A and late B type stars of the main sequence. They exhibit peculiar surface abundance anomalies that are thought to be the result of gravitational settling and radiative levitation. The physics of diffusion in these stars are reviewed briefly and some model predictions are discussed. While models reproduce some observations reasonably well, more work is needed before the behavior of diffusing elements in a complex magnetic field is fully understood.

  4. Diffusion and Settling in Ap/Bp Stars

    Energy Technology Data Exchange (ETDEWEB)

    Turcotte, S

    2003-04-09

    Ap/Bp stars are magnetic chemically peculiar early A and late B type stars of the main sequence. They exhibit peculiar surface abundance anomalies that are thought to be the result of gravitational settling and radiative levitation. The physics of diffusion in these stars are reviewed briefly and some model predictions are discussed. While models reproduce some observations reasonably well, more work is needed before the behavior of diffusing elements in a complex magnetic field is fully understood.

  5. Chandra X-ray Detection of the Enigmatic Field Star BP Psc

    CERN Document Server

    Kastner, Joel H; Rodriguez, David; Grosso, Nicolas; Zuckerman, B; Perrin, Marshall D; Forveille, Thierry; Graham, James R

    2010-01-01

    BP Psc is a remarkable emission-line field star that is orbited by a dusty disk and drives a parsec-scale system of jets. We report the detection by the Chandra X-ray Observatory of a weak X-ray point source coincident with the centroids of optical/IR and submillimeter continuum emission at BP Psc. As the star's photosphere is obscured throughout the visible and near-infrared, the Chandra X-ray source likely represents the first detection of BP Psc itself. The X-rays most likely originate with magnetic activity at BP Psc and hence can be attributed either to a stellar corona or to star-disk interactions. The log of the ratio of X-ray to bolometric luminosity (log(L_X/L_{bol}) lies in the range -5.8 to -4.2. This is smaller than log(L_X/L_{bol}) ratios typical of low-mass, pre-main sequence stars, but is well within the log(L_X/L_{bol}) range observed for rapidly-rotating (FK Com-type) G giant stars. Hence, the Chandra results favor an exotic model wherein the disk/jet system of BP Psc is the result of its ver...

  6. SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Wei; Johns-Krull, Christopher M., E-mail: wc2@rice.edu, E-mail: cmj@rice.edu [Department of Physics and Astronomy, Rice University, Houston, TX 77005 (United States)

    2013-10-20

    We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star.

  7. An Analysis of the Rapidly Rotating Bp star HD 133880

    Science.gov (United States)

    Bailey, J. D.; Grunhut, J.; Shultz, M.; Wade, G.; Landstreet, J. D.; Bohlender, D.; Lim, J.; Wong, K.; Drake, S.; Linsky, J.

    2012-01-01

    HD 133880 is a rapidly rotating chemically peculiar B-type (Bp) star (nu sin i approx = 103km/s) and is host to one of the strongest magnetic fields of any Ap/Bp star. A member of the Upper Centaurus Lupus association, it is a star with a well-determined age of 16 Myr. 12 new spectra, four of which are polarimetric, obtained from the FEROS, ESPaDOnS and HARPS instruments, provide sufficient material from which to re-evaluate the magnetic field and obtain a first approximation to the atmospheric abundance distributions of He, O, Mg, Si, Ti. Cr, Fe, Ni, Pr and Nd. An abundance analysis was carried out using ZEEMAN, a program which synthesizes spectral line profiles for stars with permeating magnetic fields. The magnetic field structure was characterized by a colinear multipole expansion from the observed variations of the longitudinal and surface fields with rotational phase. Both magnetic hemispheres are clearly visible during the stellar rotation, and thus a three-ring abundance distribution model encompassing both magnetic poles and magnetic equator with equal spans in colatitude was adopted. Using the new magnetic field measurements and optical photometry together with previously published data, we refine the period of HD 133880 to P = 0.877 476 +/- 0.000009 d. Our simple axisymmetric magnetic field model is based on a predominantly quadrupolar component that roughly describes the field variations. Using spectrum synthesis, we derived mean abundances for O, Mg, Si, Ti, Cr, Fe and Pr. All elements; except Mg, are overabundant compared to the Son. Mg appears to be approximately uniform over the stellar surface, while all other elements are more abundant in the negative magnetic hemisphere than in the positive magnetic hemisphere. In contrast to most Ap/Bp stars which show an underabundance in 0, in HD 133880 this element is clearly overabundant compared to the solar abundance ratio. In studying the Ha and Paschen lines in the optical spectra, we could not

  8. An Analysis of the Rapidly Rotating Bp Star HD 133880

    CERN Document Server

    Bailey, J D; Shultz, M; Wade, G; Landstreet, J D; Bohlender, D; Lim, J; Wong, K; Drake, S; Linsky, J

    2012-01-01

    HD 133880 is a rapidly rotating Bp star and host to one of the strongest magnetic fields of any Bp star. A member of the Upper Centaurus Lupus association, it is a star with a well-determined age of 16 Myr. Twelve new spectra obtained from the FEROS, ESPaDOnS, and HARPS instruments, provide sufficient material from which to re-evaluate the magnetic field and obtain a first approximation to the atmospheric abundance distributions of various elements. Using the new magnetic field measurements and optical photometry together with previously published data, we refine the period of HD 133880 to P = 0.877476 \\pm 0.000009 days. The magnetic field structure was characterised by a colinear multipole expansion from the observed variations of the longitudinal and surface fields with rotational phase. This simple axisymmetric magnetic field model is based on a predominantly quadrupolar component that roughly describes the field variations. Using spectrum synthesis, we derived mean abundances for O, Mg, Si, Ti, Cr, Fe, Nd...

  9. Ultraviolet and visual flux and line variations of one of the least variable Bp stars HD 64740

    CERN Document Server

    Krticka, J; Markova, H; Mikulasek, Z; Zverko, J; Prvak, M; Skarka, M

    2013-01-01

    The light variability of hot magnetic chemically peculiar stars is typically caused by the flux redistribution in spots with peculiar abundance. This raises the question why some stars with surface abundance spots show significant rotational light variability, while others do not. We study the Bp star HD 64740 to investigate how its remarkable inhomogeneities in the surface distribution of helium and silicon, and the corresponding strong variability of many spectral lines, can result in one of the faintest photometric variabilities among the Bp stars. We used model atmospheres and synthetic spectra calculated for the silicon and helium abundances from surface abundance maps to predict the ultraviolet and visual light and line variability of HD 64740. The predicted fluxes and line profiles were compared with the observed ones derived with the IUE, HST, and Hipparcos satellites and with spectra acquired using the FEROS spectrograph at the 2.2m MPG/ESO telescope. We are able to reproduce the observed visual ligh...

  10. An analysis of the rapidly rotating Bp star HD 133880

    Science.gov (United States)

    Bailey, J. D.; Grunhut, J.; Shultz, M.; Wade, G.; Landstreet, J. D.; Bohlender, D.; Lim, J.; Wong, K.; Drake, S.; Linsky, J.

    2012-06-01

    HD 133880 is a rapidly rotating chemically peculiar B-type (Bp) star (v sin i≃ 103 km s-1) and is host to one of the strongest magnetic fields of any Ap/Bp star. A member of the Upper Centaurus Lupus association, it is a star with a well-determined age of 16 Myr. 12 new spectra, four of which are polarimetric, obtained from the FEROS, ESPaDOnS and HARPS instruments, provide sufficient material from which to re-evaluate the magnetic field and obtain a first approximation to the atmospheric abundance distributions of He, O, Mg, Si, Ti, Cr, Fe, Ni, Pr and Nd. An abundance analysis was carried out using ZEEMAN, a program which synthesizes spectral line profiles for stars with permeating magnetic fields. The magnetic field structure was characterized by a colinear multipole expansion from the observed variations of the longitudinal and surface fields with rotational phase. Both magnetic hemispheres are clearly visible during the stellar rotation, and thus a three-ring abundance distribution model encompassing both magnetic poles and magnetic equator with equal spans in colatitude was adopted. Using the new magnetic field measurements and optical photometry together with previously published data, we refine the period of HD 133880 to P= 0.877 476 ± 0.000 009 d. Our simple axisymmetric magnetic field model is based on a predominantly quadrupolar component that roughly describes the field variations. Using spectrum synthesis, we derived mean abundances for O, Mg, Si, Ti, Cr, Fe and Pr. All elements, except Mg, are overabundant compared to the Sun. Mg appears to be approximately uniform over the stellar surface, while all other elements are more abundant in the negative magnetic hemisphere than in the positive magnetic hemisphere. In contrast to most Ap/Bp stars which show an underabundance in O, in HD 133880 this element is clearly overabundant compared to the solar abundance ratio. In studying the Hα and Paschen lines in the optical spectra, we could not unambiguously

  11. The remarkable properties of the symbiotic star AE Circinus

    CERN Document Server

    Mennickent, R E; Arenas, J; Tovmassian, T; Mason, E; Tappert, C; Papadaki, C

    2007-01-01

    We present new optical spectroscopy and photometry, 2MASS infrared observations and 24 years of combined AAVSO and AFOEV photometry of the symbiotic star candidate \\ae. The long-term light curve is characterized by outbursts lasting several years and having a slow decline of $\\sim 2 \\times 10^{-4}$ mag/day. The whole range of variability of the star in the $V$ band is about 4 magnitudes. The periodogram of the photometric data reveals strong signals at $\\sim$ 342 and 171 days. The presence of the emission feature at $\\lambda$ 6830 \\AA at minimum and the detection of absorption lines of a $\\sim$ K5 type star confirm the symbiotic classification and suggest that AE Cir is a new member of the small group of s-type yellow symbiotic stars. We estimate a distance of 9.4 kpc. Our spectrum taken at the high state shows a much flatter spectral energy distribution, the disappearance of the $\\lambda$ 6830 \\AA emission feature and the weakness of the He II 4686 emission relative to the Balmer emission lines. Our observat...

  12. [The Durkheim Test. Remarks on Susan Leigh Star's Boundary Objects].

    Science.gov (United States)

    Gießmann, Sebastian

    2015-09-01

    The article reconstructs Susan Leigh Star's conceptual work on the notion of 'boundary objects'. It traces the emergence of the concept, beginning with her PhD thesis and its publication as Regions of the Mind in 1989. 'Boundary objects' attempt to represent the distributed, multifold nature of scientific work and its mediations between different 'social worlds'. Being addressed to several 'communities of practice', the term responded to questions from Distributed Artificial Intelligence in Computer Science, Workplace Studies and Computer Supported Cooperative Work (CSCW), and microhistorical approaches inside the growing Science and Technology Studies. Yet the interdisciplinary character and interpretive flexibility of Star’s invention has rarely been noticed as a conceptual tool for media theory. I therefore propose to reconsider Star's 'Durkheim test' for sociotechnical media practices.

  13. The Remarkable Deaths of 9 - 11 Solar Mass Stars

    CERN Document Server

    Woosley, S E

    2015-01-01

    The post-helium burning evolution of stars from 7 to 11 solar masses is complicated by the lingering effects of degeneracy and off-center ignition. Here stars in this mass range are studied using a standard set of stellar physics. Two important aspects of the study are the direct coupling of a reaction network of roughly 220 nuclei to the structure calculation at all stages and the use of a sub grid model to describe the convective bounded flame that develops during neon and oxygen burning. Below 9.0 solar masses, degenerate oxygen-neon cores form that may become either white dwarfs or electron-capture supernovae. Above 10.3 solar masses the evolution proceeds "normally" to iron-core collapse, without composition inversions or degenerate flashes. Emphasis here is upon the stars in between which typically ignite oxygen burning off center. After oxygen burns in a convectively bounded flame, silicon burning ignites in a degenerate flash that commences closer to the stellar center and with increasing violence for...

  14. On the co-existence of chemically peculiar Bp stars, slowly pulsating B stars and constant B stars in the same part of the H-R diagram

    NARCIS (Netherlands)

    Briquet, M.; Hubrig, S.; Cat, P. de; Aerts, C.; North, P.; Schöller, M.

    2007-01-01

    Aims. In order to better model massive B-type stars, we need to understand the physical processes taking place in slowly pulsating B (SPB) stars, chemically peculiar Bp stars, and non-pulsating normal B stars co-existing in the same part of the H-R diagram. Methods: We carry out a comparative study

  15. The discovery of nonthermal radio emission from magnetic Bp-Ap stars

    Science.gov (United States)

    Drake, Stephen A.; Abbott, David C.; Bastian, T. S.; Bieging, J. H.; Churchwell, E.

    1987-01-01

    In a VLA survey of chemically peculiar B- and A-type stars with strong magnetic fields, five of the 34 stars observed have been identified as 6 cm continuum sources. Three of the detections are helium-strong early Bp stars (Sigma Ori E, HR 1890, and Delta Ori C), and two are helium weak, silicon-strong stars with spectral types near A0p (IQ Aur = HD 34452, Babcock's star = HD 215441). The 6 cm luminosities L6 (ergs/s Hz) range from log L6 = 16.2 to 17.9, somewhat less than the OB supergiants and W-R stars. Three-frequency observations indicate that the helium-strong Bp stars are variable nonthermal sources.

  16. On the co-existence of chemically peculiar Bp stars, slowly pulsating B stars and constant B stars in the same part of the H-R diagram

    CERN Document Server

    Briquet, M; De Cat, P; Aerts, C; North, P; Scholler, M; 10.1051/0004-6361:20066940

    2009-01-01

    Aims. In order to better model massive B-type stars, we need to understand the physical processes taking place in slowly pulsating B (SPB) stars, chemically peculiar Bp stars, and non-pulsating normal B stars co-existing in the same part of the H-R diagram. Methods. We carry out a comparative study between samples of confirmed and well-studied SPB stars and a sample of well-studied Bp stars with known periods and magnetic field strengths. We determine their evolutionary state using accurate HIPPARCOS parallaxes and Geneva photometry. We discuss the occurrence and strengths of magnetic fields as well as the occurrence of stellar pulsation among both groups. Further, we make a comparison of Geneva photometric variability for both kinds of stars. Results. The group of Bp stars is significantly younger than the group of SPB stars. Longitudinal magnetic fields in SPB stars are weaker than those of Bp stars, suggesting that the magnetic field strength is an important factor for B type stars to become chemically pec...

  17. Weak magnetic fields in Ap/Bp stars: Evidence for a dipole field lower limit and a tentative interpretation of the magnetic dichotomy

    CERN Document Server

    Aurière, M; Silvester, J; Lignières, F; Bagnulo, S; Bale, K; Dintrans, B; Donati, J F; Folsom, C P; Gruberbauer, M; Hoa, A Hui Bon; Jeffers, S; Johnson, N; Landstreet, J D; Lebre, A; Lüftinger, T; Marsden, S; Mouillet, D; Naseri, S; Paletou, F; Petit, P; Power, J; Rincon, F; Strasser, S; Toque, N

    2007-01-01

    We have investigated a sample of 28 well-known spectroscopically-identified magnetic Ap/Bp stars, with weak, poorly-determined or previously undetected magnetic fields, with the aim of exploring the weak part of the magnetic field distribution of Ap/Bp stars. Using the MuSiCoS and NARVAL spectropolarimeters we have obtained 282 LSD Stokes V signatures of our 28 sample stars. All stars were detected, showing clearly that when observed with sufficient precision, all firmly classified Ap/Bp stars show detectable surface magnetic fields. To better characterise the surface magnetic field intensities and geometries of the sample, we have inferred the dipolar field intensity and the magnetic obliquity. The distribution of derived dipole strengths for these stars exhibits a plateau at about 1 kG, falling off to larger and smaller field strengths. Remarkably, in this sample of stars selected for their presumably weak magnetic fields, we find only 2 stars for which the derived dipole strength is weaker than 300 G. We i...

  18. Abnormal lithium abundance in several Ap-Bp stars

    CERN Document Server

    Shavrina, A; Drake, N A; Kudryavtsev, D O; Gopka, V F; Yushchenko, V A; Yushchenko, A V

    2013-01-01

    Using observations of rapidly rotating roAp star HD 12098, obtained with 6m telescope of SAO RAS in 2005-2008 in nine rotational phases (0.001-0.817), and code V. Tsymbal ROTATE we identified 3 lithium spots on the surface of star, one of them coincided with the position of one magnetic pole and two others are located near the other pole, symmetrically with respect to it. Perhaps magnetic field of the star has a more complex structure than the dipole (Shavrina 2008). Lithium abundance in the spots is greater than cosmic one. It can be explained by diffusion of lithium in the presence of a magnetic field or by production of lithium in the reactions of "spallation" on the surface of star near the magnetic poles (see, for example, Goriely 2007). Enhanced lithium abundances was also determined for other two slowly rotating Ap stars HR 465 and HD 965. The analysis is performed using a synthetic spectrum method taking into account magnetic splitting of lines by the SYNTHM code of Khan (2004).

  19. Discovery of magnetic fields in three He variable Bp stars with He and Si spots

    CERN Document Server

    Briquet, M; Schöller, M; De Cat, P

    2006-01-01

    It is essential for the understanding of stellar structure models of high mass stars to explain why constant stars, non-pulsating chemically peculiar hot Bp stars and pulsating stars co-exist in the slowly pulsating B stars and beta Cephei instability strips. We have conducted a search for magnetic fields in the four Bp stars HD55522, HD105382, HD131120, and HD138769 which previously have been wrongly identified as slowly pulsating B stars. A recent study of these stars using the Doppler Imaging technique revealed that the elements He and Si are inhomogeneously distributed on the stellar surface, causing the periodic variability. Using FORS1 in spectropolarimetric mode at the VLT, we have acquired circular polarisation spectra to test the presence of a magnetic field in these stars. A variable magnetic field is clearly detected in HD55522 and HD105382, but no evidence for the existence of a magnetic field was found in HD131120. The presence of a magnetic field in HD138769 is suggested by one measurement at 3 ...

  20. X-rays from magnetic intermediate mass Ap/Bp stars

    Science.gov (United States)

    Robrade, Jan

    2016-09-01

    The X-ray emission of magnetic intermediate mass Ap/Bp stars is reviewed and put into context of intrinsic as well as extrinsic hypotheses for its origin. New X-ray observations of Ap/Bp stars are presented and combined with an updated analysis of the available datasets, providing the largest sample of its type that is currently available. In the studied stars the X-ray detections are found predominantly among the more massive, hotter and more luminous targets. Their X-ray properties are quite diverse and beside strong soft X-ray emission significant magnetic activity is frequently present. While a connection between more powerful winds and brighter X-ray emission is expected in intrinsic models, the scatter in X-ray luminosity at given bolometric luminosity is so far unexplained and several observational features like X-ray light curves and flaring, luminosity distributions and spectral properties are often similar to those of low-mass stars. It remains to be seen if these features can be fully reproduced by magnetospheres of intermediate mass stars. The article discusses implications for magnetically confined wind-shock models (MCWS) and stellar magnetospheres under the assumption that the intrinsic model is applicable, but also examines the role of possible companions. Further, related magnetospheric phenomena are presented and an outlook on future perspectives is given.

  1. Low-frequency GMRT observations of the magnetic Bp star HR Lup (HD 133880)

    Science.gov (United States)

    George, Samuel J.; Stevens, Ian R.

    2012-06-01

    We present radio observations of the magnetic chemically peculiar Bp star HR Lup (HD 133880) at 647 and 277 MHz with the GMRT. At both frequencies the source is not detected but we are able to determine upper limits to the emission. The 647 MHz limits are particularly useful, with a 5σ value of 0.45 mJy. Also, no large enhancements of the emission were seen. The non-detections, along with previously published higher frequency detections, provide evidence that an optically thick gyrosynchrotron model is the correct mechanism for the radio emission of HR Lup.

  2. Low-frequency GMRT observations of the magnetic Bp star HR Lup (HD 133880)

    CERN Document Server

    George, Samuel J

    2012-01-01

    We present radio observations of the magnetic chemically peculiar Bp star HR Lup (HD 133880) at 647 and 277 MHz with the GMRT. At both frequencies the source is not detected but we are able to determine upper limits to the emission. The 647 MHz limits are particularly useful, with a 5\\sigma\\ value of 0.45 mJy. Also, no large enhancements of the emission were seen. The non-detections, along with previously published higher frequency detections, provide evidence that an optically thick gyrosynchrotron model is the correct mechanism for the radio emission of HR Lup.

  3. Abundance distributions over the surfaces of magnetic ApBp stars: theoretical predictions

    CERN Document Server

    Alecian, G

    2015-01-01

    Recently published empirical abundance maps, obtained through (Zeeman) Doppler mapping (ZDM), do not currently agree with the abundance structures predicted by means of numerical models of atomic diffusion in magnetic atmospheres of ApBp stars. In a first step towards the resolution of these discrepancies, we present a state of the art grid of equilibrium abundance stratifications in the atmosphere of a magnetic Ap star with T_eff = 10000 K and log g = 4.0. A description of the behaviour of 16 chemical elements including predictions concerning the over- and/or under-abundances over the stellar surface is followed by a discussion of the possible influence of presently neglected physical processes.

  4. Spitzer and Magellan Observations of NGC 2264: A Remarkable Star Forming Core Near IRS-2

    CERN Document Server

    Young, E T; Lada, C J; Mainzer, A K; Marengo, M; Murphy, D C; Muzerolle, J; Persson, S E; Siegler, N; Teixeira, P S

    2006-01-01

    We analyze {\\it Spitzer} and Magellan observations of a star forming core near IRS-2 in the young cluster NGC 2264. The submillimeter source IRAS 12 S1, previously believed to be an intermediate mass Class 0 object is shown to be a dense collection of embedded, low mass stars. We argue that this group of stars represents the fragmenting collapse of a dense, turbulent core, based on a number of indicators of extreme youth. With reasonable estimates for the velocity dispersion in the group, we estimate a dynamical lifetime of only a few x 10$^{4}$ years. Spectral energy distributions of stars in the core are consistent with Class I or Class 0 assignments. We present observations of an extensive system of molecular hydrogen emission knots. The luminosity of the objects in the core region are consistent with roughly solar mass protostars.

  5. Spectroscopic and asteroseismic analysis of the remarkable main-sequence A star KIC 11145123

    DEFF Research Database (Denmark)

    Takada-Hidai, Masahide; Kurtz, Donald W.; Shibahashi, Hiromoto

    2017-01-01

    A spectroscopic analysis was carried out to clarify the properties of KIC 11145123 - the first main-sequence star with a directly measured core-to-surface rotation profile - based on spectra observed with the High Dispersion Spectrograph (HDS) of the Subaru telescope. The atmospheric parameters (T...... slow rotation. In particular, we show that there is no evidence of any secondary companion star, and we put stringent limits on the possible mass of any such purported companion through the phase modulation technique....

  6. Some remarks on the level of helium enhancement among M3's horizontal-branch stars

    CERN Document Server

    Valcarce, A A R; Alonso-García, J; Ramos, R Contreras; Alves, S

    2016-01-01

    (Abridged) The color and luminosity distribution of horizontal branch (HB) stars in globular clusters are sensitive probes of their original helium abundances. However, recent analyses based on visual and near-ultraviolet (UV) CMDs have provided conflicting results. To clarify the situation, we address the optimum ranges of applicability (in terms of the $T_{eff}$ range covered by the HB stars) for visual and near-UV CMDs, as far as application of this HB $Y$ test goes. We consider both Stromgren and Hubble Space Telescope (HST) bandpasses. Our results indicate that the distributions of HB stars in the y vs (b-y) plane can be a reliable indicator of the He content in cool blue HB (BHB) stars, particularly when a differential comparison between blue and red HB stars is carried out in the range $T_{eff}<8300$K. Conversely, we demonstrate that CMDs using the F336W filter have a much less straightforward interpretation at the cool end of the BHB, as the distributions of HB stars in the F336W vs (F336W-F555W) p...

  7. Two Remarkable Spectroscopic Categories of Young O Stars from the VLT-FLAMES Tarantula Survey

    CERN Document Server

    Walborn, Nolan R; Taylor, William D; Simon-Diaz, Sergio; Evans, Christopher J

    2011-01-01

    The spectral and spatial characteristics of two special categories of O stars found in the VFTS dataset are presented. One of them comprises very rapid rotators, including several more extreme than any previously known. These objects are distributed around the peripheries of the main 30 Doradus clusters, suggesting a runaway nature for which their radial velocities already provide preliminary supporting evidence. The other category consists of a large number of Vz stars, previously hypothesized on spectroscopic grounds to be on or very near the ZAMS. Their distribution is the inverse of that of the rapid rotators: the Vz are strongly concentrated to the ionizing clusters, plus a newly recognized band of recent and current star formation to the north, which provides strong circumstantial evidence for their extreme youth.

  8. Remarks on the star product of functions on finite and compact groups

    Energy Technology Data Exchange (ETDEWEB)

    Aniello, P. [Dipartimento di Scienze Fisiche dell' Universita di Napoli ' Federico II' and Istituto Nazionale di Fisica Nucleare (INFN) - Sezione di Napoli, Complesso Universitario di Monte S. Angelo, via Cintia, 80126 Napoli (Italy); Facolta di Scienze Biotecnologiche, Universita di Napoli ' Federico II' , Napoli (Italy)], E-mail: aniello@na.infn.it; Ibort, A. [Departamento de Matematicas, Universidad Carlos III de Madrid, 28911 Leganes, Madrid (Spain); Man' ko, V.I. [P.N. Lebedev Physical Institute, Leninskii Prospect 53, Moscow 119991 (Russian Federation); Marmo, G. [Dipartimento di Scienze Fisiche dell' Universita di Napoli ' Federico II' and Istituto Nazionale di Fisica Nucleare (INFN) - Sezione di Napoli, Complesso Universitario di Monte S. Angelo, via Cintia, 80126 Napoli (Italy)

    2009-01-19

    We show that the characters {chi}(g{sub 1}g{sub 2}g{sub 3}{sup -1}) of irreducible unitary representations of finite groups and compact Lie groups provide kernels of star-product on complex valued functions f(g) of the group elements g. Examples of permutation groups of two and three elements as well as SU(2) group are considered. The k-deformed star products of the functions of finite and compact Lie groups are presented. The explicit form of the quantizers and dequantizers as well as the duality symmetry of the considered star products of the functions on the finite and compact Lie groups are discussed.

  9. A remark concerning Chandrasekhar's derivation of the pulsation equation for relativistic stars

    Energy Technology Data Exchange (ETDEWEB)

    Knutsen, Henning; Pedersen, Janne [Stavanger University, 4036 Stavanger (Norway)

    2007-01-15

    It is shown that Chandrasekhar gives some misleading comments concerning his method to derive the pulsation equation for relativistic stars. Strictly following his procedure and approximations, we find that this equation should contain an extra term which destroys the beauty and simplicity of the pulsation equation. However, using a better approximation, we find that just this extra term cancels, and the nice original version of the pulsation equation is correct after all.

  10. Binary Star Orbits. III. In which we Revisit the Remarkable Case of Tweedledum and Tweedledee

    CERN Document Server

    Mason, Brian D; McAlister, Harold A

    2010-01-01

    Two of the most challenging objects for optical interferometry in the middle of the last century were the close components (FIN 332) of the wide visual binary STF2375 (= WDS 18455+0530 = HIP 92027 = ADS 11640). Each component of the wide pair was found to have subcomponents of approximately the same magnitude, position angle and separation and, hence, were designated by the tongue in cheek monikers "Tweedledum and Tweedledee" by the great visual interferometrist William S. Finsen in 1953. They were later included in a list of "Double Stars that Vex the Observer" by W.H. van den Bos (1958a). While speckle interferometry has reaped a rich harvest investigating the close inteferometric binaries of Finsen, the "Tweedles" have continued to both fascinate and exasperate due to both the great similarity of the close pairs as well as the inherent 180 degree ambiguity associated with interferometry. Detailed analysis of all published observations of the system have revealed several errors which are here corrected, all...

  11. Doppler imaging of chemical spots on magnetic Ap/Bp stars. Numerical tests and assessment of systematic errors

    CERN Document Server

    Kochukhov, O

    2016-01-01

    Doppler imaging (DI) is a powerful spectroscopic inversion technique that enables conversion of a line profile time series into a two-dimensional map of the stellar surface inhomogeneities. In this paper we investigate the accuracy of chemical abundance DI of Ap/Bp stars and assess the impact of several different systematic errors on the reconstructed spot maps. We simulate spectroscopic observational data for different spot distributions in the presence of a moderately strong dipolar magnetic field. We then reconstruct chemical maps using different sets of spectral lines and making different assumptions about line formation in the inversion calculations. Our numerical experiments demonstrate that a modern DI code successfully recovers the input chemical spot distributions comprised of multiple circular spots at different latitudes or an element overabundance belt at the magnetic equator. For the optimal reconstruction the average reconstruction errors do not exceed ~0.10 dex. The errors increase to about 0.1...

  12. Doppler imaging of chemical spots on magnetic Ap/Bp stars. Numerical tests and assessment of systematic errors

    Science.gov (United States)

    Kochukhov, O.

    2017-01-01

    Context. Doppler imaging (DI) is a powerful spectroscopic inversion technique that enables conversion of a line profile time series into a two-dimensional map of the stellar surface inhomogeneities. DI has been repeatedly applied to reconstruct chemical spot topologies of magnetic Ap/Bp stars with the goal of understanding variability of these objects and gaining an insight into the physical processes responsible for spot formation. Aims: In this paper we investigate the accuracy of chemical abundance DI and assess the impact of several different systematic errors on the reconstructed spot maps. Methods: We have simulated spectroscopic observational data for two different Fe spot distributions with a surface abundance contrast of 1.5 dex in the presence of a moderately strong dipolar magnetic field. We then reconstructed chemical maps using different sets of spectral lines and making different assumptions about line formation in the inversion calculations. Results: Our numerical experiments demonstrate that a modern DI code successfully recovers the input chemical spot distributions comprised of multiple circular spots at different latitudes or an element overabundance belt at the magnetic equator. For the optimal reconstruction based on half a dozen spectral intervals, the average reconstruction errors do not exceed 0.10 dex. The errors increase to about 0.15 dex when abundance distributions are recovered from a few and/or blended spectral lines. Ignoring a 2.5 kG dipolar magnetic field in chemical abundance DI leads to an average relative error of 0.2 dex and maximum errors of 0.3 dex. Similar errors are encountered if a DI inversion is carried out neglecting a non-uniform continuum brightness distribution and variation of the local atmospheric structure. None of the considered systematic effects lead to major spurious features in the recovered abundance maps. Conclusions: This series of numerical DI simulations proves that inversions based on one or two spectral

  13. Evolution of Intermediate-mass X-Ray Binaries Driven by the Magnetic Braking of AP/BP Stars. I. Ultracompact X-Ray Binaries

    Science.gov (United States)

    Chen, Wen-Cong; Podsiadlowski, Philipp

    2016-10-01

    It is generally believed that ultracompact X-ray binaries (UCXBs) evolved from binaries consisting of a neutron star accreting from a low-mass white dwarf (WD) or helium star where mass transfer is driven by gravitational radiation. However, the standard WD evolutionary channel cannot produce the relatively long-period (40-60 minutes) UCXBs with a high time-averaged mass-transfer rate. In this work, we explore an alternative evolutionary route toward UCXBs, where the companions evolve from intermediate-mass Ap/Bp stars with an anomalously strong magnetic field (100-10,000 G). Including the magnetic braking caused by the coupling between the magnetic field and an irradiation-driven wind induced by the X-ray flux from the accreting component, we show that intermediate-mass X-ray binaries (IMXBs) can evolve into UCXBs. Using the MESA code, we have calculated evolutionary sequences for a large number of IMXBs. The simulated results indicate that, for a small wind-driving efficiency f = 10-5, the anomalous magnetic braking can drive IMXBs to an ultra-short period of 11 minutes. Comparing our simulated results with the observed parameters of 15 identified UCXBs, the anomalous magnetic braking evolutionary channel can account for the formation of seven and eight sources with f = 10-3, and 10-5, respectively. In particular, a relatively large value of f can fit three of the long-period, persistent sources with a high mass-transfer rate. Though the proportion of Ap/Bp stars in intermediate-mass stars is only 5%, the lifetime of the UCXB phase is ≳2 Gyr, producing a relatively high number of observable systems, making this an alternative evolutionary channel for the formation of UCXBs.

  14. Investigation of the magnetic field characteristics of Herbig Ae/Be stars: Discovery of the pre-main sequence progenitors of the magnetic Ap/Bp stars

    CERN Document Server

    Wade, G A; Bagnulo, S; Landstreet, J D; Mason, E; Silvester, J; Alecian, E; Böhm, T; Bouret, J C; Catala, C; Donati, J F; Folsom, C; Bale, K

    2006-01-01

    We are investigating the magnetic characteristics of pre-main sequence Herbig Ae/Be stars, with the aim of (1) understanding the origin and evolution of magnetism in intermediate-mass stars, and (2) exploring the influence of magnetic fields on accretion, rotation and mass-loss at the early stages of evolution of A, B and O stars. We have begun by conducting 2 large surveys of Herbig Ae/Be stars, searching for direct evidence of photospheric magnetic fields via the longitudinal Zeeman effect. From observations obtained using FORS1 at the ESO-VLT and ESPaDOnS at the Canada-France-Hawaii Telescope, we report the confirmed detection of magnetic fields in 4 pre-main sequence A- and B-type stars, and the apparent (but as yet unconfirmed) detection of fields in 2 other such stars. We do not confirm the detection of magnetic fields in several stars reported by other authors to be magnetic: HD 139614, HD 144432 or HD 31649. One of the most evolved stars in the detected sample, HD 72106A, shows clear evidence of stron...

  15. Evolution of intermediate-mass X-ray binaries driven by magnetic braking of Ap/Bp stars: I. ultracompact X-ray binaries

    CERN Document Server

    Chen, Wen-Cong

    2016-01-01

    It is generally believed that Ultracompact X-ray binaries (UCXBs) evolved from binaries consisting of a neutron star accreting from a low-mass white dwarf or helium star where mass transfer is driven by gravitational radiation. However, the standard white-dwarf evolutionary channel cannot produce the relatively long-period ($40 - 60$\\,min) UCXBs with high time-averaged mass-transfer rate. In this work, we explore an alternative evolutionary route toward UCXBs where the companions evolve from intermediate-mass Ap/Bp stars with an anomalously strong magnetic field ($100 - 10000$\\,G). Including the magnetic braking caused by the coupling between the magnetic field and an irradiation-driven wind induced by the X-ray flux from the accreting component, we show that intermediate-mass X-ray binaries (IMXBs) can evolve into UCXBs. Using the \\emph{MESA} code, we have calculated evolutionary sequences for a large number of IMXBs. The simulated results indicate that, for a small wind-driving efficiency $f=10^{-5}$, the a...

  16. Concluding remarks

    Energy Technology Data Exchange (ETDEWEB)

    Patrick, W.C.

    1996-04-01

    This section contains the concluding remarks of the workshop on rock mechanics issues in repository design and performance assessment. Technical issues such as spatial variability of rock properties, rock mass strength, measurement of loads, evaluation of long-term seal performance, and integration of data into design were discussed. Programmatic issues such as development of a coherent and consistent design methodology and implementation of that methodology were also reiterated.

  17. Triangulation and PSO-BP Neural Network Used in Star Pattern Recognition%三角形剖分以及PSO-BP神经网络在星图识别中的应用

    Institute of Scientific and Technical Information of China (English)

    张少迪; 王延杰; 孙宏海

    2011-01-01

    In order to realize accurate measurement of aircraft's current attitude, how to improve real time and robustness of star pattern recognition is the key of star sensor. The algorithms for star pattern abstraction, training sample set creation and network training improvement are proposed. First, a method of triangulation based on the character of star image is designed to combine all the stars of current field of view, which is used to extract star pattern and create complete training samples. The character of star pattern extracted has the advantages of translation and rotation invariance. Then BP Neural Network serves to recognize the star pattern with the weight matrix instead of navigation library. It is very fast to acquire current star information when the network has finished training. Particle Swarm Optimization (PSO) serves to train BP Neural Network, which helps BP network converge to the most optimum value. The experimental results show that the success rate of accurate recognition is 100%.%为了实现星敏感器对航天器当前姿态的准确测量,如何提高星图识别算法的实时性和鲁棒性成为星敏感器的关键技术.对星图识别过程中应用的模式提取、训练样本集的建立以及神经网络训练方式的改进等算法进行研究.首先,设计一种基于星图特征的三角形剖分方法,将视场内的恒星以三角形的方式组合起来,提取星图模式,建立完备的训练样本集,使星图特征具有平移和旋转不变性.然后,采用BP神经网络识别星图特征,以权值矩阵代替导航星库,一旦网络训练完成,可以很快获得当前星图信息,实现星敏感器星图识别算法的实时性和鲁棒性;为了优化BP神经网络改进其自身缺点,采用PSO(粒子群算法)训练BP神经网络,获取使BP神经网络趋近全局最优的初始权值和阈值,使其加快收敛至全局最优.由实验结果表明,该星图识别算法识别率达100%.

  18. The remarkable Dr Robertson

    OpenAIRE

    Hammarton, Tansy C.

    2016-01-01

    Muriel Robertson (1883–1973) was a pioneering protozoologist who made a staggering number of important contributions to the fields of parasitology, bacteriology and immunology during her career, which spanned nearly 60 years. These contributions were all the more remarkable given the scientific and social times in which she worked. While Muriel is perhaps best known for her work on the life cycle and transmission of the African trypanosome, Trypanosoma brucei, which she carried out in Uganda ...

  19. Seven remarkable days

    CERN Multimedia

    This has been a truly remarkable seven days for CERN. Things have moved so fast that it has sometimes been hard to separate fact from fiction – all the more so since facts have often seemed too good to be true. It’s been a week of many firsts. Monday was the first time we’ve had two captured beams in the LHC. It’s the first time the LHC has functioned as a particle accelerator, boosting particles to the highest beam energy so far achieved at CERN. And it’s been a week in which we’ve seen the highest energy proton-proton collisions ever produced at CERN: our last hadron collider, the SPS was a proton-antiproton collider, a technically simpler machine than the LHC. This week’s successes are all the more remarkable precisely because of the complexity of the LHC. Unlike the SPS collider, it is two accelerators not one, making the job of commissioning nearly twice as difficult. I’d like to express my heartfelt thanks and congra...

  20. X-ray Diagnostics of Grain Depletion in Matter Accreting onto T Tauri Stars

    CERN Document Server

    Hartmann, J J D P T L

    2005-01-01

    Recent analysis of high resolution Chandra X-ray spectra has shown that the Ne/O abundance ratio is remarkably constant in stellar coronae. Based on this result, we point out the utility of the Ne/O ratio as a discriminant for accretion-related X-rays from T Tauri stars, and for probing the measure of grain-depletion of the accreting material in the inner disk. We apply the Ne/O diagnostic to the classical T Tauri stars BP Tau and TW Hya--the two stars found to date whose X-ray emission appears to originate, at least in part, from accretion activity. We show that TW Hya appears to be accreting material which is significantly depleted in O relative to Ne. In constrast, BP Tau has an Ne/O abundance ratio consistent with that observed for post-T Tauri stars. We interpret this result in terms of the different ages and evolutionary states of the circumstellar disks of these stars. In the young BP Tau disk (age 0.6 Myr) dust is still present near the disk corotation radius and can be ionized and accreted, re-releas...

  1. Planets around Low-mass Stars (PALMS). VI. Discovery of a Remarkably Red Planetary-mass Companion to the AB Dor Moving Group Candidate 2MASS J22362452+4751425*

    Science.gov (United States)

    Bowler, Brendan P.; Liu, Michael C.; Mawet, Dimitri; Ngo, Henry; Malo, Lison; Mace, Gregory N.; McLane, Jacob N.; Lu, Jessica R.; Tristan, Isaiah I.; Hinkley, Sasha; Hillenbrand, Lynne A.; Shkolnik, Evgenya L.; Benneke, Björn; Best, William M. J.

    2017-01-01

    We report the discovery of an extremely red planetary-mass companion to 2MASS J22362452+4751425, a ≈0.6 M⊙ late-K dwarf likely belonging to the ∼120 Myr AB Doradus moving group. 2M2236+4751 b was identified in multi-epoch NIRC2 adaptive optics imaging at Keck Observatory at a separation of 3\\buildrel{\\prime\\prime}\\over{.} 7, or 230 ± 20 AU in projection at the kinematic distance of 63 ± 5 pc to its host star. Assuming membership in the AB Dor group, as suggested from its kinematics, the inferred mass of 2M2236+4751 b is 11–14 MJup. Follow-up Keck/OSIRIS K-band spectroscopy of the companion reveals strong CO absorption similar to other faint red L dwarfs and lacks signs of methane absorption, despite having an effective temperature of ≈900–1200 K. With a (J–K)MKO color of 2.69 ± 0.12 mag, the near-infrared slope of 2M2236+4751 b is redder than all of the HR 8799 planets and instead resembles the ≈23 Myr isolated planetary-mass object PSO J318.5–22, implying that similarly thick photospheric clouds can persist in the atmospheres of giant planets at ages beyond 100 Myr. In near-infrared color–magnitude diagrams, 2M2236+4751 b is located at the tip of the red L dwarf sequence and appears to define the “elbow” of the AB Dor substellar isochrone separating low-gravity L dwarfs from the cooler young T dwarf track. 2M2236+4751 b is the reddest substellar companion to a star and will be a valuable benchmark to study the shared atmospheric properties of young low-mass brown dwarfs and extrasolar giant planets. Some of the data presented herein were obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W.M. Keck Foundation.

  2. Planets Around Low-Mass Stars (PALMS). VI. Discovery of a Remarkably Red Planetary-Mass Companion to the AB Dor Moving Group Candidate 2MASS J22362452+4751425

    CERN Document Server

    Bowler, Brendan; Mawet, Dimitri; Ngo, Henry; Malo, Lison; Mace, Gregory; McLane, Jacob; Lu, Jessica; Tristan, Isaiah; Hinkley, Sasha; Hillenbrand, Lynne; Shkolnik, Evgenya; Benneke, Bjorn; Best, William

    2016-01-01

    We report the discovery of an extremely red planetary-mass companion to 2MASS J22362452+4751425, a $\\approx$0.6 $M_{\\odot}$ late-K dwarf likely belonging to the $\\sim$120 Myr AB Doradus moving group. 2M2236+4751 b was identified in multi-epoch NIRC2 adaptive optics imaging at Keck Observatory at a separation of 3.7$"$, or 230 $\\pm$ 20 AU in projection at the kinematic distance of 63 $\\pm$ 5 pc to its host star. Assuming membership in the AB Dor group, as suggested from its kinematics, the inferred mass of 2M2236+4751 b is 11-14 $M_\\mathrm{Jup}$. Follow-up Keck/OSIRIS $K$-band spectroscopy of the companion reveals strong CO absorption similar to other faint red L dwarfs and lacks signs of methane absorption despite having an effective temperature of $\\approx$900-1200 K. With a ($J$-$K$)$_\\mathrm{MKO}$ color of 2.69 $\\pm$ 0.12 mag, the near-infrared slope of 2M2236+4751 b is redder than all of the HR 8799 planets and instead resembles the $\\approx$23 Myr isolated planetary-mass object PSO J318.5-22, implying th...

  3. Remarks on generalized Fedosov algebras

    CERN Document Server

    Dobrski, Michal

    2014-01-01

    The variant of Fedosov construction based on fairly general fiberwise product in the Weyl bundle is studied. Here, we analyze generalized star products of functions, of sections of endomorphisms bundle, and those generating deformed bimodule structure as introduced previously by Waldmann. Isomorphisms of generalized Fedosov algebras are considered and their relevance for deriving Seiberg-Witten map is described. The existence of the trace functional is established. For star products and for the trace functional explicit expressions, up to second power of deformation parameter, are given. As an example, we discuss the case of symmetric part of non-commutativity tensor.

  4. Remarks on the clump theory

    Energy Technology Data Exchange (ETDEWEB)

    Krommes, J.A.

    1986-07-01

    Further details are provided of a soon-to-be published dialog (Phys. Fluids 29 (July, 1986)) which discussed the role of the small scales in fluid clump theory. It is argued that the approximation of the clump lifetime which is compatible with exponentially rapid separation of adjacent orbits is inappropriate for the description of the dynamically important large scales. Various other remarks are made relating to the analytic treatment of strong drift-wave-like turbulence.

  5. Possible enhancement of BP180 autoantibody production by herpes zoster.

    Science.gov (United States)

    Kamiya, Koji; Aoyama, Yumi; Suzuki, Takahiro; Niwa, Haruo; Horio, Ai; Nishio, Eiichi; Tokura, Yoshiki

    2016-02-01

    Bullous pemphigoid (BP) is an autoimmune blistering disease caused by autoantibodies against type XVII collagen/BP180 (BP180). Although the mechanisms of autoantibody production remain to be elucidated, herpes virus infections have been identified as a possible triggering factor for pemphigus. We report a case of herpes zoster (HZ) having anti-BP180 serum antibodies. The patient developed sudden-onset, tense blisters and edematous erythema on the right anterior chest, shoulder and upper back. Histopathology showed remarkable degeneration of keratinocytes, acantholysis and blister formation with ballooning cells, indicating herpes virus infection. A polymerase chain reaction analysis of varicella zoster virus (VZV) was positive in crusts and effusions from the skin lesions, confirming the definitive diagnosis of HZ. Notably, we found that the patient had anti-BP180 serum antibodies in association with the occurrence of HZ. After successful treatment with valacyclovir hydrochloride for 7 days, the serum levels of anti-BP180 antibodies decreased in accordance with the improvement of skin lesions. These findings suggest that the production of anti-BP180 antibodies could be triggered by the reactivation of VZV.

  6. BP Piscium: its flaring disk imaged with SPHERE/ZIMPOL

    CERN Document Server

    de Boer, J; Canovas, H; Min, M; Sitko, M; Ginski, C; Jeffers, S V; Mawet, D; Milli, J; Rodenhuis, M; Snik, F; Keller, C U

    2016-01-01

    Whether BP Piscium (BP Psc) is either a pre-main sequence T Tauri star at d ~ 80 pc, or a post-main sequence G giant at d ~ 300 pc is still not clear. As a first-ascent giant, it is the first to be observed with a molecular and dust disk. Alternatively, BP Psc would be among the nearest T Tauri stars with a protoplanetary disk (PPD). We investigate whether the disk geometry resembles typical PPDs, by comparing polarimetric images with radiative transfer models. Our VLT/SPHERE/ZIMPOL observations allow us to perform Polarimetric Differential Imaging; Reference Star Differential Imaging; and Richardson-Lucy deconvolution. We present the first visible light polarization and intensity images of the disk of BP Psc. Our deconvolution confirms the disk shape as detected before, mainly showing the southern side of the disk. In polarized intensity the disk is imaged at larger detail and also shows the northern side, giving it the typical shape of high inclination flared disks. We explain the observed disk features by ...

  7. A Remark on Polar Noncommutativity

    CERN Document Server

    Iskauskas, Andrew

    2015-01-01

    Noncommutative space has been found to be of use in a number of different contexts. In particular, one may use noncommutative spacetime to generate quantised gravity theories. Via an identification between the Moyal $\\star$-product on function space and commutators on a Hilbert space, one may use the Seiberg-Witten map to generate corrections to such gravity theories. However, care must be taken with the derivation of commutation relations. We examine conditions for the validity of such an approach, and determine the correct form for polar noncommutativity in $\\mathbb{R}^{2}$. Such an approach lends itself readily to extension to more complicated spacetime parametrisations.

  8. Magnetic fields in beta Cep, SPB, and Be stars

    CERN Document Server

    Schoeller, M; Briquet, M; Ilyin, I

    2013-01-01

    Recent observational and theoretical results emphasize the potential significance of magnetic fields for structure, evolution, and environment of massive stars. Depending on their spectral and photometric behavior, the upper main-sequence B-type stars are assigned to different groups, such as beta Cep stars and slowly pulsating B (SPB) stars, He-rich and He-deficient Bp stars, Be stars, BpSi stars, HgMn stars, or normal B-type stars. All these groups are characterized by different magnetic field geometry and strength, from fields below the detection limit of a few Gauss up to tens of kG. Our collaboration was the first to systematically study the magnetic fields in representative samples of different types of main-sequence B stars. In this article, we give an overview about what we have learned during the last years about magnetic fields in beta Cep, SPB, and Be stars.

  9. Star Clusters

    OpenAIRE

    Gieles, M.

    1993-01-01

    Star clusters are observed in almost every galaxy. In this thesis we address several fundamental problems concerning the formation, evolution and disruption of star clusters. From observations of (young) star clusters in the interacting galaxy M51, we found that clusters are formed in complexes of stars and star clusters. These complexes share similar properties with giant molecular clouds, from which they are formed. Many (70%) of the young clusters will not survive the fist 10 Myr, due to t...

  10. Stars and Star Myths.

    Science.gov (United States)

    Eason, Oliver

    Myths and tales from around the world about constellations and facts about stars in the constellations are presented. Most of the stories are from Greek and Roman mythology; however, a few Chinese, Japanese, Polynesian, Arabian, Jewish, and American Indian tales are also included. Following an introduction, myths are presented for the following 32…

  11. Stars and Star Myths.

    Science.gov (United States)

    Eason, Oliver

    Myths and tales from around the world about constellations and facts about stars in the constellations are presented. Most of the stories are from Greek and Roman mythology; however, a few Chinese, Japanese, Polynesian, Arabian, Jewish, and American Indian tales are also included. Following an introduction, myths are presented for the following 32…

  12. Introductory Remarks to the "Edward Teller Lectures"

    Science.gov (United States)

    Hora, Heinrich; Miley, George H.

    2016-10-01

    The following sections are included: * Overview * Big Laser Solution * Physics of the Fast Igniter * Fast Igniter for Electron Beam Fusion * Block Igniter for Producing Ion Beam Ignition * Concluding Remarks * References

  13. Research use of patented inventions: opening remarks

    OpenAIRE

    Fernández de Labastida, José M.

    2006-01-01

    Opening remarks for the 2006 conference in Madrid on the research use of patented inventions. The conference, which was held at CSIC on 18-19 May 2006, was jointly organised by the Spanish National Research Council (CSIC), the Spanish Patent and Trademark Office (OEPM) and the OECD, with support from the European Patent Office (EPO) through its European Patent Academy. The conference brochure is also included as an attachment to the Opening remarks file.

  14. Star centroiding error compensation for intensified star sensors.

    Science.gov (United States)

    Jiang, Jie; Xiong, Kun; Yu, Wenbo; Yan, Jinyun; Zhang, Guangjun

    2016-12-26

    A star sensor provides high-precision attitude information by capturing a stellar image; however, the traditional star sensor has poor dynamic performance, which is attributed to its low sensitivity. Regarding the intensified star sensor, the image intensifier is utilized to improve the sensitivity, thereby further improving the dynamic performance of the star sensor. However, the introduction of image intensifier results in star centroiding accuracy decrease, further influencing the attitude measurement precision of the star sensor. A star centroiding error compensation method for intensified star sensors is proposed in this paper to reduce the influences. First, the imaging model of the intensified detector, which includes the deformation parameter of the optical fiber panel, is established based on the orthographic projection through the analysis of errors introduced by the image intensifier. Thereafter, the position errors at the target points based on the model are obtained by using the Levenberg-Marquardt (LM) optimization method. Last, the nearest trigonometric interpolation method is presented to compensate for the arbitrary centroiding error of the image plane. Laboratory calibration result and night sky experiment result show that the compensation method effectively eliminates the error introduced by the image intensifier, thus remarkably improving the precision of the intensified star sensors.

  15. Grand Unification in Neutron Stars

    CERN Document Server

    Kaspi, Victoria M

    2010-01-01

    The last decade has shown us that the observational properties of neutron stars are remarkably diverse. From magnetars to rotating radio transients, from radio pulsars to `isolated neutron stars,' from central compact objects to millisecond pulsars, observational manifestations of neutron stars are surprisingly varied, with most properties totally unpredicted. The challenge is to establish an overarching physical theory of neutron stars and their birth properties that can explain this great diversity. Here I survey the disparate neutron stars classes, describe their properties, and highlight results made possible by the Chandra X-ray Observatory, in celebration of its tenth anniversary. Finally, I describe the current status of efforts at physical `grand unification' of this wealth of observational phenomena, and comment on possibilities for Chandra's next decade in this field.

  16. The Cambridge double star atlas

    CERN Document Server

    MacEvoy, Bruce; Mullaney, James; Tirion, Wil; Mullaney, James

    2015-01-01

    The Cambridge Double Star Atlas is back! It is the first and only atlas of physical double stars that can be viewed with amateur astronomical instruments. Completely rewritten, this new edition explains the latest research into double stars, and looks at the equipment, techniques and opportunities that will enable you to discover, observe and measure them. The target list has been completely revised and extended to 2500 binary or multiple systems. Each system is described with the most recent and accurate data from the authoritative Washington Double Star Catalog, including the HD and SAO numbers that are most useful in our digital age. Hundreds of remarks explain the attributes of local, rapidly changing, often measured or known orbital systems. The color atlas charts by Wil Tirion have been updated to help you easily find and identify the target systems, as well as other deep-sky objects. This is an essential reference for double star observers..

  17. Grand unification of neutron stars.

    Science.gov (United States)

    Kaspi, Victoria M

    2010-04-20

    The last decade has shown us that the observational properties of neutron stars are remarkably diverse. From magnetars to rotating radio transients, from radio pulsars to isolated neutron stars, from central compact objects to millisecond pulsars, observational manifestations of neutron stars are surprisingly varied, with most properties totally unpredicted. The challenge is to establish an overarching physical theory of neutron stars and their birth properties that can explain this great diversity. Here I survey the disparate neutron stars classes, describe their properties, and highlight results made possible by the Chandra X-Ray Observatory, in celebration of its 10th anniversary. Finally, I describe the current status of efforts at physical "grand unification" of this wealth of observational phenomena, and comment on possibilities for Chandra's next decade in this field.

  18. Grand unification of neutron stars

    Science.gov (United States)

    Kaspi, Victoria M.

    2010-01-01

    The last decade has shown us that the observational properties of neutron stars are remarkably diverse. From magnetars to rotating radio transients, from radio pulsars to isolated neutron stars, from central compact objects to millisecond pulsars, observational manifestations of neutron stars are surprisingly varied, with most properties totally unpredicted. The challenge is to establish an overarching physical theory of neutron stars and their birth properties that can explain this great diversity. Here I survey the disparate neutron stars classes, describe their properties, and highlight results made possible by the Chandra X-Ray Observatory, in celebration of its 10th anniversary. Finally, I describe the current status of efforts at physical “grand unification” of this wealth of observational phenomena, and comment on possibilities for Chandra’s next decade in this field. PMID:20404205

  19. External measurements on BP Solar 7180 Saturn modules in Australia and Germany; Externe Messungen an BP Solar 7180 Saturn Modulen in Australien und Deutschland

    Energy Technology Data Exchange (ETDEWEB)

    Ransome, S.; Mason, N. [BP Solar, Sunbury on Thames (United Kingdom); Deponte, K. [BP Solar, Hamburg (Germany); Fernandez, J.; Russell, R. [BP Solar, Poligono Industrial, Zona Oeste, Madrid (Spain)

    2005-07-01

    The BP 7180 module produced by BP Solar was tested in Sydney, Australia, and Kassel, Germany in open fields in realistic operating conditions. Empirical adaptations were used for achieving optimal module performance in PTC conditions. The results were compared with flash test results and with rated capacities. The modules achieved efficiencies up to 86 percent, even with low radiation densities of 200 W/m{sup 2} and a remarkable good light yeald in weak light of less than 50 W/m{sup 2}. (orig.)

  20. Application of genetic BP network to discriminating earthquakes and explosions

    Institute of Scientific and Technical Information of China (English)

    边银菊

    2002-01-01

    In this paper, we develop GA-BP algorithm by combining genetic algorithm (GA) with back propagation (BP) algorithm and establish genetic BP neural network. We also applied BP neural network based on BP algorithm and genetic BP neural network based on GA-BP algorithm to discriminate earthquakes and explosions. The obtained result shows that the discriminating performance of genetic BP network is slightly better than that of BP network.

  1. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star.......Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star....

  2. Double Neutron Stars: Evidence For Two Different Neutron-Star Formation Mechanisms

    OpenAIRE

    Heuvel, E. P. J. van den

    2007-01-01

    Six of the eight double neutron stars known in the Galactic disk have low orbital eccentricities (< 0.27) indicating that their second-born neutron stars received only very small velocity kicks at birth. This is similar to the case of the B-emission X-ray binaries, where a sizable fraction of the neutron stars received hardly any velocity kick at birth (Pfahl et al. 2002). The masses of the second-born neutron stars in five of the six low-eccentricity double neutron stars are remarkably low (...

  3. Massive Stars

    Science.gov (United States)

    Livio, Mario; Villaver, Eva

    2009-11-01

    Participants; Preface Mario Livio and Eva Villaver; 1. High-mass star formation by gravitational collapse of massive cores M. R. Krumholz; 2. Observations of massive star formation N. A. Patel; 3. Massive star formation in the Galactic center D. F. Figer; 4. An X-ray tour of massive star-forming regions with Chandra L. K. Townsley; 5. Massive stars: feedback effects in the local universe M. S. Oey and C. J. Clarke; 6. The initial mass function in clusters B. G. Elmegreen; 7. Massive stars and star clusters in the Antennae galaxies B. C. Whitmore; 8. On the binarity of Eta Carinae T. R. Gull; 9. Parameters and winds of hot massive stars R. P. Kudritzki and M. A. Urbaneja; 10. Unraveling the Galaxy to find the first stars J. Tumlinson; 11. Optically observable zero-age main-sequence O stars N. R. Walborn; 12. Metallicity-dependent Wolf-Raynet winds P. A. Crowther; 13. Eruptive mass loss in very massive stars and Population III stars N. Smith; 14. From progenitor to afterlife R. A. Chevalier; 15. Pair-production supernovae: theory and observation E. Scannapieco; 16. Cosmic infrared background and Population III: an overview A. Kashlinsky.

  4. Remarks on the system of the Spermatophytes

    NARCIS (Netherlands)

    Pulle, A.

    1938-01-01

    For the group of plants treated in the “Compendium” I have used the name Spermatophyta. WETTSTEIN in his “Handbuch” remarks that this name is incorrect because in botany the word “sperma” is used for spermatozoids, and from the name Spermatophyta it might be concluded that by it “plants with spermat

  5. Concluding remarks: from match to flamethrower.

    Science.gov (United States)

    Poliakoff, Martyn

    2011-01-01

    These remarks give some impressions of Faraday Discussion 152 from the point of view of an outsider and suggest a number of actions which might help bind the Gold Catalysis Community more strongly and increase the long term impact of their science.

  6. Hadron star models. [neutron stars

    Science.gov (United States)

    Cohen, J. M.; Boerner, G.

    1974-01-01

    The properties of fully relativistic rotating hadron star models are discussed using models based on recently developed equations of state. All of these stable neutron star models are bound with binding energies as high as about 25%. During hadron star formation, much of this energy will be released. The consequences, resulting from the release of this energy, are examined.

  7. Magnetic field measurements and wind-line variability of OB-type stars

    NARCIS (Netherlands)

    Schnerr, R.S.; Henrichs, H.F.; Neiner, C.; Verdugo, E.; de Jong, J.; Geers, V.C.; Wiersema, K.; van Dalen, B.; Tijani, A.; Plaggenborg, B.; Rygl, K.L.J.

    2008-01-01

    Context. The first magnetic fields in O- and B-type stars that do not belong to the Bp-star class, have been discovered. The cyclic UV wind-line variability, which has been observed in a significant fraction of early-type stars, is likely to be related to such magnetic fields. Aims. We attempt to

  8. Star Wreck

    OpenAIRE

    Kusenko, Alexander; Shaposhnikov, Mikhail E.; Tinyakov, P. G.; Tkachev, Igor I.

    1998-01-01

    Electroweak models with low-energy supersymmetry breaking predict the existence of stable non-topological solitons, Q-balls, that can be produced in the early universe. The relic Q-balls can accumulate inside a neutron star and gradually absorb the baryons into the scalar condensate. This causes a slow reduction in the mass of the star. When the mass reaches a critical value, the neutron star becomes unstable and explodes. The cataclysmic destruction of the distant neutron stars may be the or...

  9. Star polygons

    OpenAIRE

    Riosa, Blažka

    2014-01-01

    In mathematics we often encounter polygons, such us triangle, square, hexagon, etc., but we hardly encounter star polygons. Despite the fact that we do not meet them so often in mathematics, in nature they can be traced almost on every step. In this paper the emphasis is on the geometric meaning of regular star polygons. Star polygon is a generalization of the concept of regular polygons. In star polygons also non-adjacent sides intersect. Up to similarity they are determined by Schläfli symb...

  10. BP - bisnis põhjas? / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2010-01-01

    Seoses Mehhiko lahe naftareostusega ootab BP-d kuni 21 mld. dollari suurune trahv, kahjude hüvitamiseks peab BP müüma osa oma varast. Ekspertide hinnangul tähendavad Mehhiko lahe sündmused suuri muutusi kogu naftaäris

  11. Pulsating Star Mystery Solved

    Science.gov (United States)

    2010-11-01

    By discovering the first double star where a pulsating Cepheid variable and another star pass in front of one another, an international team of astronomers has solved a decades-old mystery. The rare alignment of the orbits of the two stars in the double star system has allowed a measurement of the Cepheid mass with unprecedented accuracy. Up to now astronomers had two incompatible theoretical predictions of Cepheid masses. The new result shows that the prediction from stellar pulsation theory is spot on, while the prediction from stellar evolution theory is at odds with the new observations. The new results, from a team led by Grzegorz Pietrzyński (Universidad de Concepción, Chile, Obserwatorium Astronomiczne Uniwersytetu Warszawskiego, Poland), appear in the 25 November 2010 edition of the journal Nature. Grzegorz Pietrzyński introduces this remarkable result: "By using the HARPS instrument on the 3.6-metre telescope at ESO's La Silla Observatory in Chile, along with other telescopes, we have measured the mass of a Cepheid with an accuracy far greater than any earlier estimates. This new result allows us to immediately see which of the two competing theories predicting the masses of Cepheids is correct." Classical Cepheid Variables, usually called just Cepheids, are unstable stars that are larger and much brighter than the Sun [1]. They expand and contract in a regular way, taking anything from a few days to months to complete the cycle. The time taken to brighten and grow fainter again is longer for stars that are more luminous and shorter for the dimmer ones. This remarkably precise relationship makes the study of Cepheids one of the most effective ways to measure the distances to nearby galaxies and from there to map out the scale of the whole Universe [2]. Unfortunately, despite their importance, Cepheids are not fully understood. Predictions of their masses derived from the theory of pulsating stars are 20-30% less than predictions from the theory of the

  12. Some remarks on word formation in Danish

    DEFF Research Database (Denmark)

    Götzsche, Hans

    , there are some patterns for these Danish compounds concerning their internal semantics, in that the same lexical items may be used for different purposes depending on whether they are formed as a straightforward linear sequence (a word formation) or a reversed sequence (a phrase). The problem is (i) how the two......Abstract for the 25th Scandinavian Conference of Linguistics Some remarks on wordformation in Danish Some Danish word formation phenomena pose a problem for the linguist, being a predicament for analysis. In Danish a train leaves the station when it afgår ‘leaves’, while a minister may gå af...

  13. A remarkable representation of the Clifford group

    CERN Document Server

    Bengtsson, Ingemar

    2012-01-01

    The finite Heisenberg group knows when the dimension of Hilbert space is a square number. Remarkably, it then admits a representation such that the entire Clifford group --- the automorphism group of the Heisenberg group --- is represented by monomial phase-permutation matrices. This has a beneficial influence on the amount of calculation that must be done to find Symmetric Informationally Complete POVMs. I make some comments on the equations obeyed by the absolute values of the components of the SIC vectors, and on the fact that the representation partly suggests a preferred tensor product structure.

  14. Remarks on scale separation in flux vacua

    CERN Document Server

    Gautason, F F; Van Riet, T; Williams, M

    2015-01-01

    We argue that the Maldacena-Nunez no-go theorem excluding Minkowski and de Sitter vacua in flux compactifications can be extended to exclude anti-de Sitter (AdS) vacua for which the Kaluza-Klein scale is parametrically smaller than the AdS length scale. As a practical application of this observation we demonstrate that the mechanism to resolve O6 singularities in massive type IIA at the classical level is likely not to occur in AdS compactifications with scale separation. We furthermore remark that a compactification to four observable dimensions implies a large cosmological hierarchy.

  15. STAR Calorimetry

    Energy Technology Data Exchange (ETDEWEB)

    Jacobs, W W, E-mail: jacobsw@indiana.ed [Indiana University Cyclotron Facility and Department of Physics, 2401 Milo B. Sampson Lane, Bloomington IN 47408 (United States)

    2009-04-01

    The main STAR calorimeters comprise a full Barrel EMC and single Endcap EMC plus a Forward Meson Spectrometer. Together they give a nearly complete coverage over the range -1 < pseudorapidity < 4 and provide EM readout and triggering that help drive STAR physics capabilities. Their description, status, performance and operations (and a few physics anecdotes) are briefly presented and discussed.

  16. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Nærværende rapport beskriver numeriske beregninger af den hydrodynamiske interaktion mellem 5 flydere i bølgeenergianlægget Wave Star.......Nærværende rapport beskriver numeriske beregninger af den hydrodynamiske interaktion mellem 5 flydere i bølgeenergianlægget Wave Star....

  17. Star Imager

    DEFF Research Database (Denmark)

    Madsen, Peter Buch; Jørgensen, John Leif; Thuesen, Gøsta;

    1997-01-01

    The version of the star imager developed for Astrid II is described. All functions and features are described as well as the operations and the software protocol.......The version of the star imager developed for Astrid II is described. All functions and features are described as well as the operations and the software protocol....

  18. Structural plasticity of methyllysine recognition by the tandem Tudor domain of 53BP1

    Science.gov (United States)

    Tong, Qiong; Cui, Gaofeng; Botuyan, Maria Victoria; Rothbart, Scott B.; Hayashi, Ryo; Musselman, Catherine A.; Singh, Namit; Appella, Ettore; Strahl, Brian D.; Mer, Georges; Kutateladze, Tatiana G.

    2014-01-01

    SUMMARY p53 is dynamically regulated through various posttranslational modifications (PTMs), which differentially modulate its function and stability. The dimethylated marks p53K370me2 and p53K382me2 are associated with p53 activation or stabilization and both are recognized by the tandem Tudor domain (TTD) of 53BP1, a p53 co-factor. Here we detail the molecular mechanisms for the recognition of p53K370me2 and p53K382me2 by 53BP1. The solution structures of TTD in complex with the p53K370me2 and p53K382me2 peptides show a remarkable plasticity of 53BP1 in accommodating these diverse dimethyllysine-containing sequences. We demonstrate that dimeric TTDs are capable of interacting with the two PTMs on a single p53K370me2K382me2 peptide, greatly strengthening the 53BP1-p53 interaction. Analysis of binding affinities of TTD toward methylated p53 and histones reveals strong preference of 53BP1 for p53K382me2, H4K20me2, and H3K36me2 and suggests a possible role of multivalent contacts of 53BP1 in p53 targeting to and accumulation at the sites of DNA damage. PMID:25579814

  19. Radio emission from the high-mass X-ray binary BP Cru: first detection

    CERN Document Server

    Pestalozzi, M; Hobbs, G; Lopez-Sanchez, A R

    2009-01-01

    BP Cru is a well known high-mass X-ray binary composed of a late B hypergiant (Wray 977) and a neutron star, also observed as the X-ray pulsar GX 301-2. No information about emission from BP Cru in other bands than X-rays and optical has been reported to date in the literature, though massive X-ray binaries containing black holes can have radio emission from a jet. In order to assess the presence of a radio jet, we searched for radio emission towards BP Cru using the Australia Compact Array Telescope during a survey for radio emission from Be/X-ray transients. We probed the 41.5d orbit of BP Cru with the Australia Telescope Compact Array not only close to periastron but also close to apastron. BP Cru was clearly detected in our data on 4, possibly 6, of 12 occasions at 4.8 and 8.6 GHz. Our data suggest that the spectral index of the radio emission is modulated either by the X-ray flux or the orbital phase of the system. We propose that the radio emission of BP Cru probably arises from two components: a persis...

  20. Hierarchical Star Formation Across Galactic Disks

    Science.gov (United States)

    Gouliermis, Dimitrios

    2016-09-01

    Most stars form in clusters. This fact has emerged from the finding that "embedded clusters account for the 70 - 90% fraction of all stars formed in Giant Molecular Clouds (GMCs)." While this is the case at scales of few 10 parsecs, typical for GMCs, a look at star-forming galaxies in the Local Group (LG) shows significant populations of enormous loose complexes of early-type stars extending at scales from few 100 to few 1000 parsecs. The fact that these stellar complexes host extremely large numbers of loosely distributed massive blue stars implies either that stars form also in an unbound fashion or they are immediately dislocated from their original compact birthplaces or both. The Legacy Extra-Galactic UV Survey (LEGUS) has produced remarkable collections of resolved early-type stars in 50 star-forming LG galaxies, suited for testing ideas about recent star formation. I will present results from our ongoing project on star formation across LEGUS disk galaxies. We characterize the global clustering behavior of the massive young stars in order to understand the morphology of star formation over galactic scales. This morphology appears to be self-similar with fractal dimensions comparable to those of the molecular interstellar medium, apparently driven by large-scale turbulence. Our clustering analysis reveals compact stellar systems nested in larger looser concentrations, which themselves are the dense parts of unbound complexes and super-structures, giving evidence of hierarchical star formation up to galactic scales. We investigate the structural and star formation parameters demographics of the star-forming complexes revealed at various levels of compactness. I will discuss the outcome of our correlation and regression analyses on these parameters in an attempt to understand the link between galactic disk dynamics and morphological structure in spiral and ring galaxies of the local universe.

  1. Interoperability of wearable cuffless BP measuring devices.

    Science.gov (United States)

    Liu, Jing; Zhang, Yuan-Ting

    2014-01-01

    While a traditional cuff-based Blood Pressure (BP) measuring device can only take a snap shot of BP, real-time and continuous measurement of BP without an occluding cuff is preferred which usually use the pulse transit time (PTT) in combination with other physiological parameters to estimate or track BP over a certain period of time after an initial calibration. This article discusses some perspectives of interoperability of wearable medical devices, based on IEEE P1708 draft standard that focuses on the objective performance evaluation of wearable cuffless BP measuring devices. The ISO/IEEE 11073 family of standards, supporting the plug-and play feature, is intended to enable medical devices to interconnect and interoperate with other medical devices and with computerized healthcare information systems in a manner suitable for the clinical environment. In this paper, the possible adoption of ISO/IEEE 11073 for the interoperability of wearable cuffless BP devices is proposed. In the consideration of the difference of the continuous and cuffless BP measuring methods from the conventional ones, the existing device specialization standards of ISO/IEEE 11073 cannot be directly followed when designing the cuffless BP device. Specifically, this paper discusses how the domain information model (DIM), in which vital sign information is abstracted as objects, is used to structure the information about the device and that generated from the device. Though attention should also be paid to adopt the communication standards for other parts for the communication system, applying communication standards that enable plug-and-play feature allows achieving the interoperability of different cuffless BP measuring devices with possible different configurations.

  2. Constraining neutron star matter with Quantum Chromodynamics

    CERN Document Server

    Kurkela, Aleksi; Schaffner-Bielich, Jurgen; Vuorinen, Aleksi

    2014-01-01

    In recent years, there have been several successful attempts to constrain the equation of state of neutron star matter using input from low-energy nuclear physics and observational data. We demonstrate that significant further restrictions can be placed by additionally requiring the pressure to approach that of deconfined quark matter at high densities. Remarkably, the new constraints turn out to be highly insensitive to the amount --- or even presence --- of quark matter inside the stars.

  3. Constraining neutron star matter with quantum chromodynamics

    Energy Technology Data Exchange (ETDEWEB)

    Kurkela, Aleksi [Physics Department, Theory Unit, CERN, CH-1211 Genève 23 (Switzerland); Fraga, Eduardo S.; Schaffner-Bielich, Jürgen [Institute for Theoretical Physics, Goethe University, D-60438 Frankfurt am Main (Germany); Vuorinen, Aleksi [Department of Physics and Helsinki Institute of Physics, P.O. Box 64, FI-00014 University of Helsinki (Finland)

    2014-07-10

    In recent years, there have been several successful attempts to constrain the equation of state of neutron star matter using input from low-energy nuclear physics and observational data. We demonstrate that significant further restrictions can be placed by additionally requiring the pressure to approach that of deconfined quark matter at high densities. Remarkably, the new constraints turn out to be highly insensitive to the amount—or even presence—of quark matter inside the stars.

  4. Constraining Neutron Star Matter with Quantum Chromodynamics

    Science.gov (United States)

    Kurkela, Aleksi; Fraga, Eduardo S.; Schaffner-Bielich, Jürgen; Vuorinen, Aleksi

    2014-07-01

    In recent years, there have been several successful attempts to constrain the equation of state of neutron star matter using input from low-energy nuclear physics and observational data. We demonstrate that significant further restrictions can be placed by additionally requiring the pressure to approach that of deconfined quark matter at high densities. Remarkably, the new constraints turn out to be highly insensitive to the amount—or even presence—of quark matter inside the stars.

  5. The remarkable Red Rectangle: A Stairway to Heaven?

    Science.gov (United States)

    2004-05-01

    responsible for the striking red colour of the Rectangle is not yet clear, but it is likely that they are some kind of hydrocarbon formed in the cool outflows from the central star. Another remarkable feature of the Red Rectangle, visible only with the superb resolution of the Hubble telescope, is the dark band passing across the central star. This is the shadow of a dense disc of dust that surrounds the star and obscures it from direct view. The light we see streams out along the axis of the disc, and is scattered towards us by dust particles. Astronomers have found that the central star is actually a close pair of stars orbiting each other with a period of about 10.5 months. Interactions between these stars have probably caused the ejection of the thick dust disc that obscures our view of the binary. The disc then funnels subsequent dust and gas outflows out along its axis, forming the bizarre bi-conical structure we see as the rung of the Red Rectangle. The reasons for these fresh periodic ejections of more gas and dust remain unknown. The Red Rectangle was first discovered during a rocket flight in the early 1970s, in which astronomers were searching for strong sources of infrared radiation. This infrared source lies about 2300 light-years from Earth in the direction of the constellation Monoceros. Stars surrounded by clouds of dust are often strong infrared sources because the dust is heated by the starlight and then re-radiates long-wavelength red light. Studies of HD 44179 with ground-based telescopes revealed a rectangular shape in the dust surrounding the star at the centre, leading to the name 'Red Rectangle', coined in 1973 by astronomers Martin Cohen and Mike Merrill. This image was made from observations taken on 17-18 March 1999 with Hubble’s Wide Field Planetary Camera 2.

  6. Remarks on scale separation in flux vacua

    Science.gov (United States)

    Gautason, F. F.; Schillo, M.; Van Riet, T.; Williams, M.

    2016-03-01

    We argue that the Maldacena-Nuñez no-go theorem excluding Minkowski and de Sitter vacua in flux compactifications can be extended to anti-de Sitter (AdS) vacua for which the Kaluza-Klein scale is parametrically smaller than the AdS length scale. In the absence of negative tension sources, scale-separated AdS vacua are ruled out in 11-dimensional supergravity; in 10-dimensional supergravity, we show that such vacua can only arise in conjunction with large dilaton gradients. As a practical application of this observation we demonstrate that the mechanism to resolve O6 singularities in massive type IIA at the classical level is likely not to occur in AdS compactifications with scale separation. We furthermore remark that a compactification to four observable dimensions implies a large cosmological hierarchy.

  7. Rising Star

    OpenAIRE

    Worley, Christiana

    2012-01-01

    Rising Star is a novel about appearances. Thailand Allen is a girl who thinks she understands what she sees. But when what she sees are cracks in her perfect world, maturation and new sight are not far off. Before growth can occur, Thailand must undergo a painful process of learning that carries with it embarrassment, sorrow, anger and confusion. Thailand lives with her mother in a small Texas town called Rising Star. Rising Star is like every other small town with its community gather...

  8. No detection of large-scale magnetic fields at the surfaces of Am and HgMn stars

    CERN Document Server

    Auriere, M; Lignieres, F; Hui-Bon-Hoa, A; Landstreet, J D; Iliev, I; Donati, J -F; Petit, P; Roudier, T; Theado, S

    2010-01-01

    We investigate the magnetic dichotomy between Ap/Bp and other A-type stars by carrying out a deep spectropolarimetric study of Am and HgMn stars. Using the NARVAL spectropolarimeter at the Telescope Bernard Lyot (Observatoire du Pic du Midi, France), we obtained high-resolution circular polarisation spectroscopy of 12 Am stars and 3 HgMn stars. Using Least Squares Deconvolution (LSD), no magnetic field is detected in any of the 15 observed stars. Uncertaintiies as low as 0.3 G (respectively 1 G) have been reached for surface-averaged longitudinal magnetic field measurements for Am (respectively HgMn) stars. Associated with the results obtained previously for Ap/Bp stars, our study confirms the existence of a magnetic dichotomy among A-type stars. Our data demonstrate that there is at least one order of magnitude difference in field strength between Zeeman detected stars (Ap/Bp stars) and non Zeeman detected stars (Am and HgMn stars). This result confirms that the spectroscopically-defined Ap/Bp stars are the ...

  9. KEPLER RAPIDLY ROTATING GIANT STARS

    Energy Technology Data Exchange (ETDEWEB)

    Costa, A. D.; Martins, B. L. Canto; Bravo, J. P.; Paz-Chinchón, F.; Chagas, M. L. das; Leão, I. C.; Oliveira, G. Pereira de; Silva, R. Rodrigues da; Roque, S.; Oliveira, L. L. A. de; Silva, D. Freire da; De Medeiros, J. R., E-mail: renan@dfte.ufrn.br [Departamento de Física Teórica e Experimental, Universidade Federal do Rio Grande do Norte, Campus Universitário, Natal RN (Brazil)

    2015-07-10

    Rapidly rotating giant stars are relatively rare and may represent important stages of stellar evolution, resulting from stellar coalescence of close binary systems or accretion of substellar companions by their hosting stars. In the present Letter, we report 17 giant stars observed in the scope of the Kepler space mission exhibiting rapid rotation behavior. For the first time, the abnormal rotational behavior for this puzzling family of stars is revealed by direct measurements of rotation, namely from photometric rotation period, exhibiting a very short rotation period with values ranging from 13 to 55 days. This finding points to remarkable surface rotation rates, up to 18 times the rotation of the Sun. These giants are combined with six others recently listed in the literature for mid-infrared (IR) diagnostics based on Wide-field Infrared Survey Explorer information, from which a trend for an IR excess is revealed for at least one-half of the stars, but at a level far lower than the dust excess emission shown by planet-bearing main-sequence stars.

  10. Kepler rapidly rotating giant stars

    CERN Document Server

    Costa, A D; Bravo, J P; Paz-Chinchón, F; Chagas, M L das; Leão, I C; de Oliveira, G Pereira; da Silva, R Rodrigues; Roque, S; de Oliveira, L L A; da Silva, D Freire; De Medeiros, J R

    2015-01-01

    Rapidly rotating giant stars are relatively rare and may represent important stages of stellar evolution, resulting from stellar coalescence of close binary systems or accretion of sub-stellar companions by their hosting stars. In the present letter we report 17 giant stars observed in the scope of the Kepler space mission exhibiting rapid rotation behavior. For the first time the abnormal rotational behavior for this puzzling family of stars is revealed by direct measurements of rotation, namely from photometric rotation period, exhibiting very short rotation period with values ranging from 13 to 55 days. This finding points for remarkable surface rotation rates, up to 18 times the Sun rotation. These giants are combined with 6 other recently listed in the literature for mid-IR diagnostic based on WISE information, from which a trend for an infrared excess is revealed for at least a half of the stars, but at a level far lower than the dust excess emission shown by planet-bearing main-sequence stars.

  11. BP Investment Exceeds $4 Bln in china

    Institute of Scientific and Technical Information of China (English)

    Wang Ping

    2008-01-01

    @@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.

  12. The millimetre spectrum of BP Cru

    Science.gov (United States)

    Pestalozzi, Michele; Hobbs, George; Torkelsson, Ulf

    2010-04-01

    In this experiment we attempt to detect the millimetre emission from the high-mass X-ray binary BP Cru. This object is composed of a hypergiant (Wray 977) and a slow spinning X-ray pulsar (GX301-2). The recent ATCA observations of centimeter emission (Pestalozzi et al. 2009, this was the first detection of radio emission towards BP Cru) suggested that radio emission consists of two components, a transient non-thermal one and a persistent thermal one, probably arising from the large stellar wind of Wray 977. As stellar winds often show a positive spectral index, we ask to observe BP Cru at 13 and 7 mm, where we expect fluxes of around 1 mJy. Any detection will allow us to probe the inner parts of the wind and characterise the structure of the stellar wind of BP Cru. For this detection experiment we require 11 hours of observations with ATCA.

  13. VizieR Online Data Catalog: New photometrically variable magnetic CP stars (Hummerich+, 2016)

    Science.gov (United States)

    Hummerich, S.; Paunzen, E.; Bernhard, K.

    2016-10-01

    The All Sky Automated Survey (ASAS) constantly monitored the entire southern sky and part of the northern sky to about δCP2 stars or CP2 star (the magnetic Bp/Ap stars) candidates and He-weak (CP4)/He-strong objects from the most recent version of the Catalog of Ap, HgMn, and Am stars (Renson & Manfroid 2009, Cat. III/260). (2 data files).

  14. Rock Stars

    Institute of Scientific and Technical Information of China (English)

    张国平

    2000-01-01

    Around the world young people are spending unbelievable sums of money to listen to rock music. Forbes Magazine reports that at least fifty rock stars have incomes between two million and six million dollars per year.

  15. Carbon Stars

    Indian Academy of Sciences (India)

    T. Lloyd Evans

    2010-12-01

    In this paper, the present state of knowledge of the carbon stars is discussed. Particular attention is given to issues of classification, evolution, variability, populations in our own and other galaxies, and circumstellar material.

  16. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Frigaard, Peter

    Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Byggeri og Anlæg med bølgeenergianlæget Wave Star.......Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Byggeri og Anlæg med bølgeenergianlæget Wave Star....

  17. STAR POLYMERS

    OpenAIRE

    Ch. von Ferber; Yu.Holovatch

    2002-01-01

    It is our great pleasure to present a collection of papers devoted to theoretical, numerical, and experimental studies in the field of star polymers. Since its introduction in the early 80-ies, this field has attracted increasing interest and has become an important part of contemporary polymer physics. While research papers in this field appear regularly in different physical and chemical journals, the present collection is an attempt to join together the studies of star polymers showing the...

  18. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Andersen, Thomas Lykke

    Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star.......Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star....

  19. Equipment Design for Oxidation of 1BP/2BP Using NO_x

    Institute of Scientific and Technical Information of China (English)

    ZHOU; Xian-ming; CHANG; Shang-wen; LI; Gao-liang; LAN; Tian; LIU; Jin-ping; TANG; Hong-bin; HE; Hui

    2013-01-01

    NOx can Oxidize the reductants in 1BP and 2BP feed of Purex process,and can adjust the oxidation state of plutonium as Pu(Ⅳ)to meet the need of 2AF feed.Using NOx in Purex process can reduce the volumn of solid waste effectively,and attract more and more interest of researchers.In this work the oxidation of reductants in 1BP/2BP feed were investigated in glass column as the same-current mode,in

  20. Precision age indicators that exploit chemically peculiar stars

    CERN Document Server

    Worthey, Guy

    2015-01-01

    We would like to find a way to improve the determination of galaxy star formation history from integrated light spectroscopy. To this end, several classes of chemically peculiar (CP) stars arise during the course of normal evolution in single stars and noninteracting binary stars. An aging stellar population has periods of time in which CP stars contribute to the integrated light, and others in which the contributions fade. The HgMn stars, for example, occupy a narrow temperature range of 10500 to 16000 K, which maps to a narrow range of ages. Wolf-Rayet stars, He-poor stars, Bp-Ap stars, Am-Fm stars, and C stars all become very common in a normal stellar population at various ages between zero and several Gyr, fading in and out in a way that is analogous to features used in stellar spectral classification. We examine population fractions and light fractions in order to assess the feasibility of using CP stars as age tracers. We find that, even though CP stars do not usually dominate in number, there are enou...

  1. Star pattern recognition method based on neural network

    Institute of Scientific and Technical Information of China (English)

    LI Chunyan; LI Ke; ZHANG Longyun; JIN Shengzhen; ZU Jifeng

    2003-01-01

    Star sensor is an avionics instrument used to provide the absolute 3-axis attitude of a spacecraft by utilizing star observations. The key function is to recognize the observed stars by comparing them with the reference catalogue. Autonomous star pattern recognition requires that similar patterns can be distinguished from each other with a small training set. Therefore, a new method based on neural network technology is proposed and a recognition system containing parallel backpropagation (BP) multi-subnets is designed. The simulation results show that the method performs much better than traditional algorithms and the proposed system can achieve both higher recognition accuracy and faster recognition speed.

  2. Remarkable selective constraints on exonic dinucleotide repeats.

    Science.gov (United States)

    Haasl, Ryan J; Payseur, Bret A

    2014-09-01

    Long dinucleotide repeats found in exons present a substantial mutational hazard: mutations at these loci occur often and generate frameshifts. Here, we provide clear and compelling evidence that exonic dinucleotides experience strong selective constraint. In humans, only 18 exonic dinucleotides have repeat lengths greater than six, which contrasts sharply with the genome-wide distribution of dinucleotides. We genotyped each of these dinucleotides in 200 humans from eight 1000 Genomes Project populations and found a near-absence of polymorphism. More remarkably, divergence data demonstrate that repeat lengths have been conserved across the primate phylogeny in spite of what is likely considerable mutational pressure. Coalescent simulations show that even a very low mutation rate at these loci fails to explain the anomalous patterns of polymorphism and divergence. Our data support two related selective constraints on the evolution of exonic dinucleotides: a short-term intolerance for any change to repeat length and a long-term prevention of increases to repeat length. In general, our results implicate purifying selection as the force that eliminates new, deleterious mutants at exonic dinucleotides. We briefly discuss the evolution of the longest exonic dinucleotide in the human genome--a 10 x CA repeat in fibroblast growth factor receptor-like 1 (FGFRL1)--that should possess a considerably greater mutation rate than any other exonic dinucleotide and therefore generate a large number of deleterious variants. © 2014 The Author(s). Evolution © 2014 The Society for the Study of Evolution.

  3. Remarkable evolutionary conservation of SOX14 orthologues

    Indian Academy of Sciences (India)

    Jelena Popovic; Milena Stevanovic

    2009-04-01

    SOX proteins constitute a large family of diverse, well-conserved transcription factors present in vertebrates and invertebrates, and also implicated in control of many developmental processes. Our objectives have been to identify Sox14 gene of goat (Capra hircus), cow (Bos taurus) and rat (Rattus norvegicus), and to perform comparative analyses and mapping of SOX14 orthologues from numerous vertebrate species. PCR based approach was used to identify Sox14 of goat, cow and rat, while nucleotide and amino acid sequence alignments and mapping were performed using information currently available in public database. Comparative sequence analysis revealed remarkable identity among Sox14 orthologues and helped us to identify highly conserved motifs that represent molecular signatures of SOX14 protein that might have structural or functional significance. Further, we determined chromosomal locations of numerous predicted group B Sox genes and their neighbouring genes using currently available genome database. In conclusion, our study has not only supported the proposed model of group B Sox genes evolution in chicken and mammals, but has also revealed that additional evolutionary events split Sox B genes into different chromosomes in some mammals. Mapping data presented in this study could help in refining the understanding of the evolution of group B Sox genes in vertebrates.

  4. The end of a remarkable era

    CERN Multimedia

    2011-01-01

    An important era in particle physics is coming to an end: the US Department of Energy announced on Monday that it will not fund an extension to Tevatron running beyond 2011. It is a poignant moment for particle physics as we prepare to bid farewell to a machine that has changed our view of the Universe, and played a significant role in paving the way for the new era that is opening up with the LHC.   The Tevatron has been at the high-energy frontier of particle physics for over a quarter of a century. That’s a remarkable achievement by any account, and the physics results are there to prove it. As well as bringing us the discovery of the top quark in 1995, the Tevatron’s experiments have provided vitally important precision measurements covering the full spectrum of Standard Model physics, not to mention hints of what may lie beyond. With several months of running still to come, it would be a foolish gambler who bet against further new physics emerging before the Teva...

  5. The star formation activity in cosmic voids

    CERN Document Server

    Ricciardelli, Elena; Varela, Jesus; Quilis, Vicent

    2014-01-01

    Using a sample of cosmic voids identified in the Sloan Digital Sky Survey Data Release 7, we study the star formation activity of void galaxies. The properties of galaxies living in voids are compared with those of galaxies living in the void shells and with a control sample, representing the general galaxy population. Void galaxies appear to form stars more efficiently than shell galaxies and the control sample. This result can not be interpreted as a consequence of the bias towards low masses in underdense regions, as void galaxy subsamples with the same mass distribution as the control sample also show statistically different specific star formation rates. This highlights the fact that galaxy evolution in voids is slower with respect to the evolution of the general population. Nevertheless, when only the star forming galaxies are considered, we find that the star formation rate is insensitive to the environment, as the main sequence is remarkably constant in the three samples under consideration. This fact...

  6. Star clusters as simple stellar populations

    CERN Document Server

    Bruzual, A Gustavo

    2009-01-01

    In this paper, I review to what extent we can understand the photometric properties of star clusters, and of low-mass, unresolved galaxies, in terms of population synthesis models designed to describe `simple stellar populations' (SSPs), i.e., groups of stars born at the same time, in the same volume of space, and from a gas cloud of homogeneous chemical composition. The photometric properties predicted by these models do not readily match the observations of most star clusters, unless we properly take into account the expected variation in the number of stars occupying sparsely populated evolutionary stages, due to stochastic fluctuations in the stellar initial mass function. In this case, population synthesis models reproduce remarkably well the full ranges of observed integrated colours and absolute magnitudes of star clusters of various ages and metallicities. The disagreement between the model predictions and observations of cluster colours and magnitudes may indicate problems with or deficiencies in the...

  7. Remarkable analytic relations among greybody parameters

    Science.gov (United States)

    Elia, Davide; Pezzuto, S.

    2016-09-01

    In this paper we derive and discuss several implications of the analytic form of a modified blackbody, also called greybody, which is widely used in Astrophysics, and in particular in the study of star formation in the far-infrared/submillimetre domain. The research in this area has been greatly improved thanks to recent observations taken with the Herschel satellite, so that it became important to clarify the sense of the greybody approximation, to suggest possible further uses, and to delimit its intervals of validity. First, we discuss the position of the greybody peak, making difference between the optically thin and thick regimes. Second, we analyse the behaviour of bolometric quantities as a function of the different greybody parameters. The ratio between the bolometric luminosity and the mass of a source, the ratio between the so-called `submillimetre luminosity' and the bolometric one, and the bolometric temperature are observables used to characterize the evolutionary stage of a source, and it is of primary importance to have analytic equations describing the dependence of such quantities on the greybody parameters. Here we discuss all these aspects, providing analytic relations, illustrating particular cases, and providing graphical examples. Some equations reported here are well known in Astrophysics, but are often spread over different publications. Some of them, instead, are brand new and represent a novelty in Astrophysics literature. Finally, we indicate an alternative way to obtain, under some conditions, the greybody temperature and dust emissivity index directly from an observing spectral energy distribution, avoiding a best-fitting procedure.

  8. Remarkable analytic relations among greybody parameters

    CERN Document Server

    Elia, Davide

    2016-01-01

    In this paper we derive and discuss several implications of the analytic form of a modified blackbody, also called greybody, which is widely used in Astrophysics, and in particular in the study of star formation in the far-infrared/sub-millimeter domain. The research in this area has been greatly improved thanks to recent observations taken with the Herschel satellite, so that it became important to clarify the sense of the greybody approximation, to suggest possible further uses, and to delimi its intervals of validity. First, we discuss the position of the greybody peak, making difference between the optically thin and thick regimes. Second, we analyze the behavior of bolometric quantities as a function of the different greybody parameters. The ratio between the bolometric luminosity and the mass of a source, the ratio between the so-called "sub-millimeter luminosity" and the bolometric one, and the bolometric temperature are observables used to characterize the evolutionary stage of a source, and it is of ...

  9. Stable semiconductor black phosphorus (BP)@titanium dioxide (TiO2) hybrid photocatalysts.

    Science.gov (United States)

    Lee, Hyun Uk; Lee, Soon Chang; Won, Jonghan; Son, Byung-Chul; Choi, Saehae; Kim, Yooseok; Park, So Young; Kim, Hee-Sik; Lee, Young-Chul; Lee, Jouhahn

    2015-03-03

    Over the past few decades, two-dimensional (2D) and layered materials have emerged as new fields. Due to the zero-band-gap nature of graphene and the low photocatalytic performance of MoS2, more advanced semiconducting 2D materials have been prompted. As a result, semiconductor black phosphorus (BP) is a derived cutting-edge post-graphene contender for nanoelectrical application, because of its direct-band-gap nature. For the first time, we report on robust BP@TiO2 hybrid photocatalysts offering enhanced photocatalytic performance under light irradiation in environmental and biomedical fields, with negligible affected on temperature and pH conditions, as compared with MoS2@TiO2 prepared by the identical synthesis method. Remarkably, in contrast to pure few layered BP, which, due to its intrinsic sensitivity to oxygen and humidity was readily dissolved after just several uses, the BP@TiO2 hybrid photocatalysts showed a ~92% photocatalytic activity after 15 runs. Thus, metal-oxide-stabilized BP photocatalysts can be practically applied as a promising alternative to graphene and MoS2.

  10. Life and death of the stars

    CERN Document Server

    Srinivasan, Ganesan

    2014-01-01

    This volume is devoted to one of the fascinating things about stars: how they evolve as they age. This evolution is different for stars of different masses. How stars end their lives when their supply of energy is exhausted also depends on their masses. Interestingly, astronomers conjectured about the ultimate fate of the stars even before the details of their evolution became clear. Part I of this book gives an account of the remarkable predictions made during the 1920s and 1930s concerning the ultimate fate of stars. Since much of this development hinged on quantum physics that emerged during this time, a detailed introduction to the relevant physics is included in the book. Part II is a summary of the life history of stars. This discussion is divided into three parts: low-mass stars, like our Sun, intermediate-mass stars, and massive stars. Many of the concepts of contemporary astrophysics were built on the foundation erected by Subrahmanyan Chandrasekhar in the 1930s. This book, written during his birth c...

  11. Carbon Capture and Storage: concluding remarks.

    Science.gov (United States)

    Maitland, G C

    2016-10-20

    This paper aims to pull together the main points, messages and underlying themes to emerge from the Discussion. It sets these remarks in the context of where Carbon Capture and Storage (CCS) fits into the spectrum of carbon mitigation solutions required to meet the challenging greenhouse gas (GHG) emissions reduction targets set by the COP21 climate change conference. The Discussion focused almost entirely on carbon capture (21 out of 23 papers) and covered all the main technology contenders for this except biological processes. It included (chemical) scientists and engineers in equal measure and the Discussion was enriched by the broad content and perspectives this brought. The major underlying theme to emerge was the essential need for closer integration of materials and process design - the use of isolated materials performance criteria in the absence of holistic process modelling for design and optimisation can be misleading. Indeed, combining process and materials simulation for reverse materials molecular engineering to achieve the required process performance and cost constraints is now within reach and is beginning to make a significant impact on optimising CCS and CCU (CO2 utilisation) processes in particular, as it is on materials science and engineering generally. Examples from the Discussion papers are used to illustrate this potential. The take-home messages from a range of other underpinning research themes key to CCUS are also summarised: new capture materials, materials characterisation and screening, process innovation, membranes, industrial processes, net negative emissions processes, the effect of GHG impurities, data requirements, environment sustainability and resource management, and policy. Some key points to emerge concerning carbon transport, utilisation and storage are also included, together with some overarching conclusions on how to develop more energy- and cost-effective CCS processes through improved integration of approach across the

  12. BP to Increase Production Capacity of PTA at BP Zhuhai Chemical

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    BP has announced a strategic plan for its substantial development in China. It is actively proceeding with its project to increase its production capacity of purified terephthalic acid, or PTA, at the BP Zhuhai Chemical Company Limited facility i n Guangdong, China.

  13. Morning Star

    OpenAIRE

    Harris, Mark

    2010-01-01

    Morning Star comprises a group of paintings and drawings whose imagery derives from photographs of 1960s American hippie communes. The paintings are made using oil paint on linen. Their dimensions vary between 180 x 120, and 228 x 217 centimetres. The drawings are in pencil on watercolour paper and are all 56 x 76 centimetres. The work has been exhibited in conventional form, hanging on gallery walls. For Morning Star I made pencil drawings and oil paintings derived from images in Dick Fa...

  14. Pulsating stars

    CERN Document Server

    Catelan, M?rcio

    2014-01-01

    The most recent and comprehensive book on pulsating stars which ties the observations to our present understanding of stellar pulsation and evolution theory.  Written by experienced researchers and authors in the field, this book includes the latest observational results and is valuable reading for astronomers, graduate students, nuclear physicists and high energy physicists.

  15. Stars Underground

    CERN Multimedia

    Jean Leyder

    1996-01-01

    An imaginary voyage in time where we were witness of the birth of the universe itself, the time of the Big-Bang 15 billion years ago. Particules from the very first moments of time : protons, neutrons and electrons, and also much more energetic one. These particules are preparing to interact collider and generating others which will be the birth to the stars ........

  16. STAR Highlights

    OpenAIRE

    Masui, Hiroshi; collaboration, for the STAR

    2011-01-01

    We report selected results from STAR collaboration at RHIC, focusing on jet-hadron and jet-like correlations, quarkonium suppression and collectivity, di-electron spectrum in both p+p and Au+Au, and higher moments of net-protons as well as azimuthal anisotropy from RHIC Beam Energy Scan program.

  17. 2000 Johnston Site 3B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  18. 2000 Johnston Site 1B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  19. 2000 Johnston Site 2B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  20. AcEST: BP919856 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A02 514 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A02. BP919856 - Show BP91985...is mRNA. clone: YMU001_000130_A02. Accession BP919856 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91985... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919856|Adiantum c

  1. AcEST: BP919841 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G06 496 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G06. BP919841 - Show BP91984...is mRNA. clone: YMU001_000129_G06. Accession BP919841 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum ca...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum capi

  2. AcEST: BP919150 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_G08 485 Adiantum capillus-veneris mRNA. clone: YMU001_000121_G08. BP919150 - Show BP91915...is mRNA. clone: YMU001_000121_G08. Accession BP919150 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91915... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91915

  3. AcEST: BP920131 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D06 495 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D06. BP920131 - Show BP92013...is mRNA. clone: YMU001_000133_D06. Accession BP920131 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920131|Adiantum capillus-veneris mRNA...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920131|Adiantum c

  4. AcEST: BP919887 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C10 511 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C10. BP919887 - Show BP91988...is mRNA. clone: YMU001_000130_C10. Accession BP919887 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91988...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91988

  5. AcEST: BP920154 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F09 487 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F09. BP920154 - Show BP92015...is mRNA. clone: YMU001_000133_F09. Accession BP920154 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920154|Adia...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920154|Adiantum

  6. AcEST: BP921101 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000145_F04 489 Adiantum capillus-veneris mRNA. clone: YMU001_000145_F04. BP921101 - Show BP921101...is mRNA. clone: YMU001_000145_F04. Accession BP921101 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921101|Adiantum cap... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921101

  7. AcEST: BP914001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G04 493 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G04. BP914001 - Show BP91400...is mRNA. clone: YMU001_000038_G04. Accession BP914001 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914001|...ic Acids Res. 25:3389-3402. Query= BP914001|Adiantum capillus-veneris mRNA, clone

  8. AcEST: BP919212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E05 508 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E05. BP919212 - Show BP91921...is mRNA. clone: YMU001_000122_E05. Accession BP919212 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919212|Adiantum capillus-ven...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919212|Adiantum capillus-

  9. AcEST: BP920173 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H07 454 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H07. BP920173 - Show BP92017...is mRNA. clone: YMU001_000133_H07. Accession BP920173 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP920173|Adiantum capillus-veneris mRNA, clone: YMU001_...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920173|Adiantum capillus

  10. Stars with Extended Atmospheres

    Science.gov (United States)

    Sterken, C.

    2002-12-01

    This Workshop consisted of a full-day meeting of the Working Group "Sterren met Uitgebreide Atmosferen" (SUA, Working Group Stars with Extended Atmospheres), a discussion group founded in 1979 by Kees de Jager, Karel van der Hucht and Pik Sin The. This loose association of astronomers and astronomy students working in the Dutch-speaking part of the Low Countries (The Netherlands and Flanders) organised at regular intervals one-day meetings at the Universities of Utrecht, Leiden, Amsterdam and Brussels. These meetings consisted of the presentation of scientific results by junior as well as senior members of the group, and by discussions between the participants. As such, the SUA meetings became a forum for the exchange of ideas, and for asking questions and advice in an informal atmosphere. Kees de Jager has been chairman of the WG SUA from the beginning in 1979 till today, as the leading source of inspiration. At the occasion of Prof. Kees de Jager's 80th birthday, we decided to collect the presented talks in written form as a Festschrift in honour of this well-respected and much beloved scientist, teacher and friend. The first three papers deal with the personality of Kees de Jager, more specifically with his role as a supervisor and mentor of young researchers and as a catalyst in the research work of his colleagues. And also about his remarkable role in the establishment of astronomy education and research at the University of Brussels. The next presentation is a very detailed review of solar research, a field in which Cees was prominently active for many years. Then follow several papers dealing with stars about which Kees is a true expert: massive stars and extended atmospheres.

  11. Really Hot Stars

    Science.gov (United States)

    2003-04-01

    of BAT99-2, the strong UV-radiation from their WR-star has created HeII nebulae around them, well visible in the photos by their blue colour. AB7 is particularly remarkable: the associated huge nebula and HeII region indicate that this star is one of the, if not THE, hottest WR-star known so far, with a surface temperature in excess of 120,000 degrees! Just outside this nebula, a small network of green filaments is visible - they are the remains of another supernova explosion. The new VLT images, complemented with VLT spectra, demonstrate that these stars are indeed the source of the observed ionization. These very first maps of the HeII emission unveil the as yet undiscovered complex structure of those highly excited nebulae. Moreover, the new observations provide the first accurate determination of the true ionizing power of these exceptional stars. They allow a direct measurement of the otherwise unobservable intensity of the far-UV emission of WR stars. The new observations have clearly identified the ultraviolet emission of very massive stars as the energy source in these three nebulae. Using the latest theoretical models to interpret these unique data, the Belgian astronomers and their American collaborator were also able to show that all of these stars are hotter than 90,000 degrees! The N44C nebula The fourth photo, PR Photo 09d/03, shows the very peculiar nebula N44C in the LMC. There is a beautiful (blue) HeII nebula near the two central stars. It is very different from the larger, "normal" HII region that is delimited by the light from atomic hydrogen (red) and doubly-ionized oxygen (green): this hot central region of N44C rather appears to "enshroud" the stars like a veil. There is a mystery, though. With a temperature of "only" a few tens of thousand degrees, even the hottest of the two stars, an O-type star (the upper one), cannot possibly be responsible for this inner high excitation nebula [3]. Moreover, no fast motions have so far been detected in

  12. Shocks and a Giant Planet in the Disk Orbiting BP Piscium?

    CERN Document Server

    Melis, C; Chen, C H; Rhee, Joseph H; Song, Inseok; Zuckerman, B

    2010-01-01

    Spitzer IRS spectroscopy supports the interpretation that BP Piscium, a gas and dust enshrouded star residing at high Galactic latitude, is a first-ascent giant rather than a classical T Tauri star. Our analysis suggests that BP Piscium's spectral energy distribution can be modeled as a disk with a gap that is opened by a giant planet. Modeling the rich mid-infrared emission line spectrum indicates that the solid-state emitting grains orbiting BP Piscium are primarily composed of ~75 K crystalline, magnesium-rich olivine; ~75 K crystalline, magnesium-rich pyroxene; ~200 K amorphous, magnesium-rich pyroxene; and ~200 K annealed silica ('cristobalite'). These dust grains are all sub-micron sized. The giant planet and gap model also naturally explains the location and mineralogy of the small dust grains in the disk. Disk shocks that result from disk-planet interaction generate the highly crystalline dust which is subsequently blown out of the disk mid-plane and into the disk atmosphere.

  13. Binary Star Orbits. 3. Revisiting the Remarkable Case of Tweedledum and Tweedledee

    Science.gov (United States)

    2010-06-11

    Observation Date 0.00 0.05 0.10 0.15 0.20 S ep ar at io n D iff er en ce FIN 332 Aa,Ab Unresolved Aa,Ab bB,aBdevlosernU bB,aB 233 NIF 1960 1970 1980 1990...2000 2010 Observation Date 0 50 100 150 200 P os iti on A ng le D iff er en ce FIN 332 Aa,Ab Unresolved Aa,Ab bB,aBdevlosernU bB,aB 233 NIF Figure

  14. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Frigaard, Peter; Brorsen, Michael

    Nærværende rapport beskriver foreløbige hovedkonklusioner på modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star i perioden 13/9 2004 til 12/11 2004.......Nærværende rapport beskriver foreløbige hovedkonklusioner på modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star i perioden 13/9 2004 til 12/11 2004....

  15. Land surface temperature changes in Northern Iberia since 4000 yr BP, based on δ13C of speleothems

    Science.gov (United States)

    Martín-Chivelet, Javier; Muñoz-García, M. Belén; Edwards, R. Lawrence; Turrero, María J.; Ortega, Ana I.

    2011-05-01

    The surface temperature changes for the last 4000 years in northern inland Iberia (an area particularly sensitive to climate change) are determined by a high resolution study of carbon stable isotope records of stalagmites from three caves (Kaite, Cueva del Cobre, and Cueva Mayor) separated several tens of kilometers away in N Spain. Despite the local conditions of each cave, the isotopic series show a good overall coherence, and resulted to be strongly sensitive to surface temperature changes. The record reflects alternating warmer and colder intervals, always within a temperature range of 1.6 °C. The timing and duration of the intervals were provided by 43 230Th- 234U (ICP-MS) ages. Main climatic recognized periods are: (1) 3950-3000 yr BP: warm period punctuated by cool events around ~ 3950, 3550 and 3250 yr BP; (2) 2850-2500 yr BP cold interval (Iron Age Cold Period); (3) 2500-1650 yr BP moderate warm period (Roman Warm Period), with maximum temperatures between 2150 and 1750 yr BP; (4) 1650-1350 yr BP cold interval (Dark Ages Cold Period), with a thermal minimum at ~ 1500 yr BP; (5) 1350-750 yr BP warm period (Medieval Warm Period) punctuated by two cooler events at ~ 1250 and ~ 850 yr BP; (6) 750-100 yr BP cold period (Little Ice Age) with extremes occurring at 600-500 yr BP, 350-300 yr BP, and 150-100 yr BP; and (7) the last 150 years, characterized by rapid but no linear warming (Modern Warming). Remarkably, the presented records allow direct comparison of recent warming with former warm intervals such as the Roman or the Medieval periods. That comparison reveals the 20th century as the time with highest surface temperatures of the last 4000 years for the studied area. Spectral analysis of the time series shows consistent climatic cycles of ~ 400, ~ 900 and ~ 1300 yr, comparable with those recognized in the North Atlantic marine record, the Greenland ice cores, and other terrestrial records for the middle-late Holocene, suggesting common climate forcing

  16. Planck stars

    CERN Document Server

    Rovelli, Carlo

    2014-01-01

    A star that collapses gravitationally can reach a further stage of its life, where quantum-gravitational pressure counteracts weight. The duration of this stage is very short in the star proper time, yielding a bounce, but extremely long seen from the outside, because of the huge gravitational time dilation. Since the onset of quantum-gravitational effects is governed by energy density --not by size-- the star can be much larger than planckian in this phase. The object emerging at the end of the Hawking evaporation of a black hole can can then be larger than planckian by a factor $(m/m_{\\scriptscriptstyle P})^n$, where $m$ is the mass fallen into the hole, $m_{\\scriptscriptstyle P}$ is the Planck mass, and $n$ is positive. The existence of these objects alleviates the black-hole information paradox. More interestingly, these objects could have astrophysical and cosmological interest: they produce a detectable signal, of quantum gravitational origin, around the $10^{-14} cm$ wavelength.

  17. The 15q11.2 BP1–BP2 Microdeletion Syndrome: A Review

    Directory of Open Access Journals (Sweden)

    Devin M. Cox

    2015-02-01

    Full Text Available Patients with the 15q11.2 BP1–BP2 microdeletion can present with developmental and language delay, neurobehavioral disturbances and psychiatric problems. Autism, seizures, schizophrenia and mild dysmorphic features are less commonly seen. The 15q11.2 BP1–BP2 microdeletion involving four genes (i.e., TUBGCP5, CYFIP1, NIPA1, NIPA2 is emerging as a recognized syndrome with a prevalence ranging from 0.57%–1.27% of patients presenting for microarray analysis which is a two to four fold increase compared with controls. Review of clinical features from about 200 individuals were grouped into five categories and included developmental (73% and speech (67% delays; dysmorphic ears (46% and palatal anomalies (46%; writing (60% and reading (57% difficulties, memory problems (60% and verbal IQ scores ≤75 (50%; general behavioral problems, unspecified (55% and abnormal brain imaging (43%. Other clinical features noted but not considered as common were seizures/epilepsy (26%, autism spectrum disorder (27%, attention deficit disorder (ADD/attention deficit hyperactivity disorder (ADHD (35%, schizophrenia/paranoid psychosis (20% and motor delay (42%. Not all individuals with the deletion are clinically affected, yet the collection of findings appear to share biological pathways and presumed genetic mechanisms. Neuropsychiatric and behavior disturbances and mild dysmorphic features are associated with genomic imbalances of the 15q11.2 BP1–BP2 region, including microdeletions, but with an apparent incomplete penetrance and variable expressivity.

  18. Grain-size cycles in Salawusu River valley since 150 ka BP

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The palaeo-mobile dune sands and fluvio-lacustrine facies with palaeosols in Milanggouwan stratigraphic section of the Salawusu River valley situated at the southeast of the Mu Us Desert experienced abundant remarkable alternative changes of coarse and fine rhythms in grainsize since 150 ka BP, and the grain-size parameters - Mz, σ, Sk, Kg and SC/I also respond to the situation of multi-fluctuational alternations between peak and valley values. Simultaneity the grainsize eigenvalues - Ф5, Ф16, P25, Ф50, Ф75, Ф84 and Ф95 are respondingly manifested as greatly cadent jumpiness. Hereby, the Milanggouwan section can be divided into 27 grain-size coarse and fine sedimentary cycles, which can be regarded as a real and integreted record of climate-geological process of desert vicissitude resulted from the alternative evolvement of the ancient winter and summer monsoons of East Asia since 150 ka BP.

  19. Measure of the stars

    Energy Technology Data Exchange (ETDEWEB)

    Henbest, N.

    1984-12-13

    The paper concerns the Hertzsprung-Russel (H-R) diagram, which is graph relating the brightness to the surface temperature of the stars. The diagram provides a deep insight into the fundamental properties of the stars. Evolution of the stars; the death of a star; distances; and dating star clusters, are all briefly discussed with reference to the H-R diagram.

  20. When stars collide

    NARCIS (Netherlands)

    Glebbeek, E.; Pols, O.R.

    2007-01-01

    When two stars collide and merge they form a new star that can stand out against the background population in a star cluster as a blue straggler. In so called collision runaways many stars can merge and may form a very massive star that eventually forms an intermediate mass blackhole. We have perfor

  1. Air Monitoring Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  2. Air Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  3. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  4. Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  5. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  6. Surface Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  7. AcEST: BP917073 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E10 67 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E10. BP917073 - Show BP91707... mRNA. clone: YMU001_000095_E10. Accession BP917073 Tissue type prothallium Developmental stage - Contig ID

  8. AcEST: BP919848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H02 84 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H02. BP919848 - Show BP91984... mRNA. clone: YMU001_000129_H02. Accession BP919848 Tissue type prothallium Developmental stage - Contig ID

  9. AcEST: BP912001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H05 68 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H05. BP912001 - Show BP9120... mRNA. clone: YMU001_000011_H05. Accession BP912001 Tissue type prothallium Developmental stage - Contig ID

  10. AcEST: BP920096 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_H11 24 Adiantum capillus-veneris mRNA. clone: YMU001_000132_H11. BP920096 - Show BP9200... mRNA. clone: YMU001_000132_H11. Accession BP920096 Tissue type prothallium Developmental stage - Contig ID

  11. AcEST: BP915983 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_D10 68 Adiantum capillus-veneris mRNA. clone: YMU001_000081_D10. BP915983 - Show BP9159... mRNA. clone: YMU001_000081_D10. Accession BP915983 Tissue type prothallium Developmental stage - Contig ID

  12. AcEST: BP915976 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_C10 41 Adiantum capillus-veneris mRNA. clone: YMU001_000081_C10. BP915976 - Show BP9159... mRNA. clone: YMU001_000081_C10. Accession BP915976 Tissue type prothallium Developmental stage - Contig ID

  13. AcEST: BP915990 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_E12 98 Adiantum capillus-veneris mRNA. clone: YMU001_000081_E12. BP915990 - Show BP9159... mRNA. clone: YMU001_000081_E12. Accession BP915990 Tissue type prothallium Developmental stage - Contig ID

  14. AcEST: BP915963 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_B02 67 Adiantum capillus-veneris mRNA. clone: YMU001_000081_B02. BP915963 - Show BP9159... mRNA. clone: YMU001_000081_B02. Accession BP915963 Tissue type prothallium Developmental stage - Contig ID

  15. AcEST: BP915998 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_F12 46 Adiantum capillus-veneris mRNA. clone: YMU001_000081_F12. BP915998 - Show BP9159... mRNA. clone: YMU001_000081_F12. Accession BP915998 Tissue type prothallium Developmental stage - Contig ID

  16. AcEST: BP915935 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_F11 64 Adiantum capillus-veneris mRNA. clone: YMU001_000079_F11. BP915935 - Show BP9159... mRNA. clone: YMU001_000079_F11. Accession BP915935 Tissue type prothallium Developmental stage - Contig ID

  17. AcEST: BP911835 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G02 27 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G02. BP911835 - Show BP91183... mRNA. clone: YMU001_000009_G02. Accession BP911835 Tissue type prothallium Developmental stage - Contig ID

  18. AcEST: BP911839 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G06 76 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G06. BP911839 - Show BP91183... mRNA. clone: YMU001_000009_G06. Accession BP911839 Tissue type prothallium Developmental stage - Contig ID

  19. AcEST: BP919947 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A11 35 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A11. BP919947 - Show BP91994... mRNA. clone: YMU001_000131_A11. Accession BP919947 Tissue type prothallium Developmental stage - Contig ID

  20. AcEST: BP915006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D07 96 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D07. BP915006 - Show BP91500... mRNA. clone: YMU001_000065_D07. Accession BP915006 Tissue type prothallium Developmental stage - Contig ID

  1. AcEST: BP920020 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_B05 91 Adiantum capillus-veneris mRNA. clone: YMU001_000132_B05. BP920020 - Show BP920020... mRNA. clone: YMU001_000132_B05. Accession BP920020 Tissue type prothallium Developmental stage - Contig ID

  2. AcEST: BP915916 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D12 73 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D12. BP915916 - Show BP91591... mRNA. clone: YMU001_000079_D12. Accession BP915916 Tissue type prothallium Developmental stage - Contig ID

  3. Catalog of averaged magnetic phase curves of stars

    CERN Document Server

    Bychkov, V D; Madej, J

    2016-01-01

    The second version of the catalog contains information about 275 stars of different types. During the time that has elapsed since the creation of the first catalog, situation fundamentally changed primarily due to the significant increase of accuracy of magnetic fields (MF) measurements. Up to now global magnetic field were discoverd and measured in stars of many types and their behavior partially was studied. Magnetic behavior of Ap Bp stars is the most thoroughly studied. The catalog contains information about 182 such objects. The main goals for the construction of the catalog are: 1. Review and summarize our kowledge about magnetic behavior of different types of stars. 2. The whole data are uniformly presented and processed which will allow one to perform statistical analysis of the variability of the (longitudinal) magnetic fields of stars. 3. The informations are presented in the most convenient form for testing different theoretical models of different kind. 4. The catalog will be useful for the develo...

  4. Deficiency in Either 4E-BP1 or 4E-BP2 Augments Innate Antiviral Immune Responses

    Science.gov (United States)

    Nehdi, Atef; Sean, Polen; Linares, Izzar; Colina, Rodney; Jaramillo, Maritza; Alain, Tommy

    2014-01-01

    Genetic deletion of both 4E-BP1 and 4E-BP2 was found to protect cells against viral infections. Here we demonstrate that the individual loss of either 4E-BP1 or 4E-BP2 in mouse embryonic fibroblasts (MEFs) is sufficient to confer viral resistance. shRNA-mediated silencing of 4E-BP1 or 4E-BP2 renders MEFs resistant to viruses, and compared to wild type cells, MEFs knockout for either 4E-BP1 or 4E-BP2 exhibit enhanced translation of Irf-7 and consequently increased innate immune response to viruses. Accordingly, the replication of vesicular stomatitis virus, encephalomyocarditis virus, influenza virus and Sindbis virus is markedly suppressed in these cells. Importantly, expression of either 4E-BP1 or 4E-BP2 in double knockout or respective single knockout cells diminishes their resistance to viral infection. Our data show that loss of 4E-BP1 or 4E-BP2 potentiates innate antiviral immunity. These results provide further evidence for translational control of innate immunity and support targeting translational effectors as an antiviral strategy. PMID:25531441

  5. AcEST: BP912479 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_H10 595 Adiantum capillus-veneris mRNA. clone: YMU001_000019_H10. BP912479 - Show BP91247...is mRNA. clone: YMU001_000019_H10. Accession BP912479 Tissue type prothallium Developmental stage - Contig I...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91247...PSVNQRCLGG 325 + + + E+ KVPSV + G Sbjct: 2452 STTFVSD---RSLEKHPKVPSVEAVTVNG 2477 ...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP912479|Adiantum capillus-veneris mRNA, clone: YMU001_0

  6. AcEST: BP912472 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_H03 369 Adiantum capillus-veneris mRNA. clone: YMU001_000019_H03. BP912472 - Show BP91247...is mRNA. clone: YMU001_000019_H03. Accession BP912472 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912472|Adiantum capillus-veneris mRNA, clon...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912472|Adiantum capillus-veneris mRNA, clone: YMU001_000019_H

  7. AcEST: BP912470 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_H01 466 Adiantum capillus-veneris mRNA. clone: YMU001_000019_H01. BP91247...0 CL266Contig1 Show BP912470 Clone id YMU001_000019_H01 Library YMU01 Length 466 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000019_H01. Accession BP912470 Tissue type prothallium Developmental stage...programs, Nucleic Acids Res. 25:3389-3402. Query= BP912470|Adiantum capillus-vene... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91247

  8. AcEST: BP921247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_D10 328 Adiantum capillus-veneris mRNA. clone: YMU001_000147_D10. BP921247... CL2844Contig1 Show BP921247 Clone id YMU001_000147_D10 Library YMU01 Length 328 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000147_D10. Accession BP921247 Tissue type prothallium Developmental stag...25:3389-3402. Query= BP921247|Adiantum capillus-veneris mRNA, clone: YMU001_000147_D10. (311 letters) Databa...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921247|Adiantum ca

  9. AcEST: BP912471 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_H02 517 Adiantum capillus-veneris mRNA. clone: YMU001_000019_H02. BP912471 - Show BP91247...is mRNA. clone: YMU001_000019_H02. Accession BP912471 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91247...(34%), Positives = 38/78 (48%), Gaps = 6/78 (7%) Frame = -1 Query: 247 KDNAITDDSLKRFESQQKN-IFDWFRKKGAPEA---V...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912471|Adiantum ca

  10. AcEST: BP913247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_B06 567 Adiantum capillus-veneris mRNA. clone: YMU001_000028_B06. BP913247 - Show BP913247...is mRNA. clone: YMU001_000028_B06. Accession BP913247 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913247|Adiantum capillus-veneris mRNA, clone: ...ucleic Acids Res. 25:3389-3402. Query= BP913247|Adiantum capillus-veneris mRNA, c

  11. AcEST: BP912474 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_H05 367 Adiantum capillus-veneris mRNA. clone: YMU001_000019_H05. BP91247...4 CL2087Contig1 Show BP912474 Clone id YMU001_000019_H05 Library YMU01 Length 367 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000019_H05. Accession BP912474 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912474|Adiantum c...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912474|Adiantum capil

  12. AcEST: BP920247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_G05 431 Adiantum capillus-veneris mRNA. clone: YMU001_000134_G05. BP920247 - Show BP920247...is mRNA. clone: YMU001_000134_G05. Accession BP920247 Tissue type prothallium Developmental stage - Contig I...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920247...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920247

  13. AcEST: BP918247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_C03 349 Adiantum capillus-veneris mRNA. clone: YMU001_000111_C03. BP918247 - Show BP918247...is mRNA. clone: YMU001_000111_C03. Accession BP918247 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP918247|Adiantum capillus-veneris mRNA, clone: YMU001_000111_C03. ...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918247

  14. AcEST: BP912247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_G11 467 Adiantum capillus-veneris mRNA. clone: YMU001_000016_G11. BP912247 - Show BP912247...is mRNA. clone: YMU001_000016_G11. Accession BP912247 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912247...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912247|Adiantum capillus-veneris mRN

  15. AcEST: BP915247 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000069_C06 538 Adiantum capillus-veneris mRNA. clone: YMU001_000069_C06. BP915247... CL4212Contig1 Show BP915247 Clone id YMU001_000069_C06 Library YMU01 Length 538 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000069_C06. Accession BP915247 Tissue type prothallium Developmental stag...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915247|Adiantum capillus-veneris m... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915247

  16. AcEST: BP919684 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H09 516 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H09. BP919684 - Show BP91968...is mRNA. clone: YMU001_000127_H09. Accession BP919684 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919684...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91968

  17. AcEST: BP919685 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H10 544 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H10. BP919685 - Show BP91968...is mRNA. clone: YMU001_000127_H10. Accession BP919685 Tissue type prothallium Developmental stage - Contig I... Res. 25:3389-3402. Query= BP919685|Adiantum capillus-veneris mRNA, clone: YMU001_000127_H10. (544 letters) ...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91968

  18. AcEST: BP919687 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_A01 517 Adiantum capillus-veneris mRNA. clone: YMU001_000128_A01. BP919687 - Show BP91968...is mRNA. clone: YMU001_000128_A01. Accession BP919687 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91968...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91968

  19. AcEST: BP919681 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H06 556 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H06. BP919681 - Show BP91968...is mRNA. clone: YMU001_000127_H06. Accession BP919681 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919681|Adiantum capillus-veneris m...ucleic Acids Res. 25:3389-3402. Query= BP919681|Adiantum capillus-veneris mRNA, clone: YMU001_000127_H06. (5

  20. AcEST: BP919683 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H08 545 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H08. BP919683 - Show BP91968...is mRNA. clone: YMU001_000127_H08. Accession BP919683 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP919683|Adiantum capillus-veneris mRNA, clone: YMU001_000127_H08. (545 lett... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919683|Adiantum capillus-veneri

  1. AcEST: BP912209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D06 540 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D06. BP912209 - Show BP91220...is mRNA. clone: YMU001_000016_D06. Accession BP912209 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912209|Adiantum capillus-veneris... programs, Nucleic Acids Res. 25:3389-3402. Query= BP912209|Adiantum capillus-veneris mRNA, clone: YMU001_00

  2. AcEST: BP919858 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A04 328 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A04. BP919858 - Show BP91985...is mRNA. clone: YMU001_000130_A04. Accession BP919858 Tissue type prothallium Developmental stage - Contig I...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91985...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919858|Adiantum capillu

  3. AcEST: BP919857 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A03. BP91985...7 CL3173Contig1 Show BP919857 Clone id YMU001_000130_A03 Library YMU01 Length 501 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000130_A03. Accession BP919857 Tissue type prothallium Developmental stag...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91985...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919857|Ad

  4. AcEST: BP919852 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H07 499 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H07. BP919852 - Show BP91985...is mRNA. clone: YMU001_000129_H07. Accession BP919852 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP919852|Adiantum capillus-veneris mRNA...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919852|Adiantum capillus-veneris mRNA, clo

  5. AcEST: BP911985 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F08 421 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F08. BP911985 - Show BP911985...is mRNA. clone: YMU001_000011_F08. Accession BP911985 Tissue type prothallium Developmental stage - Contig I...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91198...rams, Nucleic Acids Res. 25:3389-3402. Query= BP911985|Adiantum capillus-veneris

  6. AcEST: BP917474 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_C07 287 Adiantum capillus-veneris mRNA. clone: YMU001_000101_C07. BP917474... CL2332Contig1 Show BP917474 Clone id YMU001_000101_C07 Library YMU01 Length 287 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000101_C07. Accession BP917474 Tissue type prothallium Developmental stag...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917474|Adiantum capil...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917474|Adiantum capillus-veneris mRNA, clone: YMU001_

  7. AcEST: BP921003 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D08 457 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D08. BP92100...3 CL1992Contig1 Show BP921003 Clone id YMU001_000144_D08 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D08. Accession BP921003 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP921003|Adiantum capillus-veneris mRNA, clone: YMU0...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921003|Adiantum capillus-vener

  8. AcEST: BP921008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E02 477 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E02. BP921008 - Show BP92100...is mRNA. clone: YMU001_000144_E02. Accession BP921008 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP921008|Adiantum capillus-veneris mRNA, clone:...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921008|Adiantum capillus-

  9. AcEST: BP921007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E01 460 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E01. BP92100...7 CL57Contig1 Show BP921007 Clone id YMU001_000144_E01 Library YMU01 Length 460 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_E01. Accession BP921007 Tissue type prothallium Developmental stage ...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921007|Adiantum capill... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921007|Adiantum capillus-veneri

  10. AcEST: BP916167 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_A11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000084_A11. BP916167 - Show BP91616...is mRNA. clone: YMU001_000084_A11. Accession BP916167 Tissue type prothallium Developmental stage - Contig I... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916167|Adiantum capillus-veneris mRNA, ...ds Res. 25:3389-3402. Query= BP916167|Adiantum capillus-veneris mRNA, clone: YMU001_000084_A11. (253 letters

  11. AcEST: BP911616 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000007_B05 303 Adiantum capillus-veneris mRNA. clone: YMU001_000007_B05. BP911616 - Show BP911616...is mRNA. clone: YMU001_000007_B05. Accession BP911616 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911616|Adiantum capillus-... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911616...132 PE=4 SV=1 Length = 278 Score = 69.7 bits (169), Expect = 7e-11 Identities = 2

  12. AcEST: BP920305 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000135_E03 413 Adiantum capillus-veneris mRNA. clone: YMU001_000135_E03. BP920305 - Show BP92030...is mRNA. clone: YMU001_000135_E03. Accession BP920305 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920305|Adiantum capillus-veneris ... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920305|Adiant

  13. AcEST: BP920306 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000135_E04 480 Adiantum capillus-veneris mRNA. clone: YMU001_000135_E04. BP920306 - Show BP92030...is mRNA. clone: YMU001_000135_E04. Accession BP920306 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92030...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92030

  14. AcEST: BP920303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000135_E01 493 Adiantum capillus-veneris mRNA. clone: YMU001_000135_E01. BP920303 - Show BP92030...is mRNA. clone: YMU001_000135_E01. Accession BP920303 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92030...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920303|Adiantum capillus-

  15. AcEST: BP920307 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000135_E05 493 Adiantum capillus-veneris mRNA. clone: YMU001_000135_E05. BP920307 - Show BP92030...is mRNA. clone: YMU001_000135_E05. Accession BP920307 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920307|Adiantum capillus...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92030

  16. AcEST: BP920309 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000135_E07 488 Adiantum capillus-veneris mRNA. clone: YMU001_000135_E07. BP920309 - Show BP92030...is mRNA. clone: YMU001_000135_E07. Accession BP920309 Tissue type prothallium Developmental stage - Contig I...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920309|Adiantum... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920309|Adia

  17. AcEST: BP914147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D12 534 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D12. BP914147 - Show BP91414...is mRNA. clone: YMU001_000042_D12. Accession BP914147 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91414...niprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching......................................ids Res. 25:3389-3402. Query= BP914147|Adiantum capillus-veneris mRNA, clone: YMU001_000042_D12. (534 letter

  18. AcEST: BP917072 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E09 516 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E09. BP917072 - Show BP91707...is mRNA. clone: YMU001_000095_E09. Accession BP917072 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP917072|Adiantum capillus-veneris mRNA, clone: YMU001_000095_E09. (516 let...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707

  19. AcEST: BP917078 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_F03 438 Adiantum capillus-veneris mRNA. clone: YMU001_000095_F03. BP91707...8 CL4266Contig1 Show BP917078 Clone id YMU001_000095_F03 Library YMU01 Length 438 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000095_F03. Accession BP917078 Tissue type prothallium Developmental stag...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707...programs, Nucleic Acids Res. 25:3389-3402. Query= BP917078|Adiantum capillus-vene

  20. AcEST: BP917071 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E08 525 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E08. BP917071 - Show BP91707...is mRNA. clone: YMU001_000095_E08. Accession BP917071 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917071|Adiantum capillus-veneris mRNA, clone: YMU0

  1. AcEST: BP917077 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_F02 487 Adiantum capillus-veneris mRNA. clone: YMU001_000095_F02. BP91707...7 CL10Contig1 Show BP917077 Clone id YMU001_000095_F02 Library YMU01 Length 487 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000095_F02. Accession BP917077 Tissue type prothallium Developmental stage ... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917077|

  2. AcEST: BP917074 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E11 418 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E11. BP91707...4 CL413Contig1 Show BP917074 Clone id YMU001_000095_E11 Library YMU01 Length 418 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000095_E11. Accession BP917074 Tissue type prothallium Developmental stage...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917074|Adiantum ...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP917074|Adiantum capillus-veneri

  3. AcEST: BP917070 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E07 451 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E07. BP917070 - Show BP91707...is mRNA. clone: YMU001_000095_E07. Accession BP917070 Tissue type prothallium Developmental stage - Contig I...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707...s. 25:3389-3402. Query= BP917070|Adiantum capillus-veneris mRNA, clone: YMU001_000095_E07. (451 letters) Dat

  4. AcEST: BP920002 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G12 513 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G12. BP92000...2 CL642Contig1 Show BP920002 Clone id YMU001_000131_G12 Library YMU01 Length 513 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_G12. Accession BP920002 Tissue type prothallium Developmental stage...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92000...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920002|Adiantu

  5. AcEST: BP920008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H10 566 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H10. BP920008 - Show BP92000...is mRNA. clone: YMU001_000131_H10. Accession BP920008 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920008|Adiantum capillus-veneris mRNA,...Acids Res. 25:3389-3402. Query= BP920008|Adiantum capillus-veneris mRNA, clone: YMU001_000131_H10. (566 lett

  6. AcEST: BP920006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H08 454 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H08. BP92000...6 CL749Contig1 Show BP920006 Clone id YMU001_000131_H08 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_H08. Accession BP920006 Tissue type prothallium Developmental stage...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920006|Adiantum capillus-...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920006|Adiantum capillus-ve

  7. AcEST: BP920004 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H06 151 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H06. BP920004 - Show BP92000...is mRNA. clone: YMU001_000131_H06. Accession BP920004 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP920004|Adiantum capillus-veneris mRNA, clone: YMU0...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920004|

  8. AcEST: BP920000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G10 490 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G10. BP920000 - Show BP92000...is mRNA. clone: YMU001_000131_G10. Accession BP920000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92000...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920000|Adiantum capil

  9. AcEST: BP913220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_G12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000027_G12. BP913220 - Show BP913220...is mRNA. clone: YMU001_000027_G12. Accession BP913220 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP913220|Adiantum capillus-veneris...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913220

  10. AcEST: BP917220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_G09 125 Adiantum capillus-veneris mRNA. clone: YMU001_000097_G09. BP917220 - Show BP917220...is mRNA. clone: YMU001_000097_G09. Accession BP917220 Tissue type prothallium Developmental stage - Contig I...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917220...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917220|Adiantum capillus-veneris

  11. AcEST: BP912220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E08 357 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E08. BP912220 - Show BP912220...is mRNA. clone: YMU001_000016_E08. Accession BP912220 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912220...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912220

  12. AcEST: BP912200 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_C08 572 Adiantum capillus-veneris mRNA. clone: YMU001_000016_C08. BP91220...0 CL3270Contig1 Show BP912200 Clone id YMU001_000016_C08 Library YMU01 Length 572 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_C08. Accession BP912200 Tissue type prothallium Developmental stag...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912200|Adiantum capillus-veneris mRNA, clo...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP912200|Adiantum capillus-vener

  13. AcEST: BP921220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B06 550 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B06. BP921220 - Show BP921220...is mRNA. clone: YMU001_000147_B06. Accession BP921220 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921220|Adiantum capillus-veneris mRNA, clone...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921220|Adiantum capillus-veneris mRNA, c

  14. AcEST: BP912207 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D04 249 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D04. BP912207 - Show BP91220...is mRNA. clone: YMU001_000016_D04. Accession BP912207 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220

  15. AcEST: BP912206 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D03 484 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D03. BP912206 - Show BP91220...is mRNA. clone: YMU001_000016_D03. Accession BP912206 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912206|Adiantum capi...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220

  16. AcEST: BP915220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_H10 510 Adiantum capillus-veneris mRNA. clone: YMU001_000067_H10. BP915220 - Show BP915220...is mRNA. clone: YMU001_000067_H10. Accession BP915220 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915220...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915220|Adiantum capillus-veneris mRNA, clone: YMU

  17. AcEST: BP920168 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H02 390 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H02. BP920168 - Show BP92016...is mRNA. clone: YMU001_000133_H02. Accession BP920168 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA,...c Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA, clone: YMU001_000133_H02. (390 le

  18. AcEST: BP920169 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H03. BP920169 - Show BP92016...is mRNA. clone: YMU001_000133_H03. Accession BP920169 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920169|Adiantum cap

  19. AcEST: BP920167 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H01 152 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H01. BP920167 - Show BP92016...is mRNA. clone: YMU001_000133_H01. Accession BP920167 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP920167|Adiantum capillus-veneris mRNA, clone: YMU...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920167

  20. AcEST: BP920161 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G06. BP920161 - Show BP92016...is mRNA. clone: YMU001_000133_G06. Accession BP920161 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  1. AcEST: BP920166 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G12 149 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G12. BP920166 - Show BP92016...is mRNA. clone: YMU001_000133_G12. Accession BP920166 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920166|Adiantum capillus-veneris

  2. AcEST: BP920164 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G09 447 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G09. BP920164 - Show BP92016...is mRNA. clone: YMU001_000133_G09. Accession BP920164 Tissue type prothallium Developmental stage - Contig I...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|A...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|Adiantum cap

  3. AcEST: BP920163 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G08 372 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G08. BP92016...3 CL2472Contig1 Show BP920163 Clone id YMU001_000133_G08 Library YMU01 Length 372 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_G08. Accession BP920163 Tissue type prothallium Developmental stag...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum cap... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum capillus-veneris mRNA, clone: YM

  4. AcEST: BP920165 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G11 301 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G11. BP920165 - Show BP92016...is mRNA. clone: YMU001_000133_G11. Accession BP920165 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920165...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  5. AcEST: BP917075 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E12 529 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E12. BP917075 - Show BP917075...is mRNA. clone: YMU001_000095_E12. Accession BP917075 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917075...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917075|Adiantum capillus-veneris mRNA

  6. AcEST: BP919847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H01 512 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H01. BP919847 - Show BP91984...is mRNA. clone: YMU001_000129_H01. Accession BP919847 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91984...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919847|Adiantum capillus-veneris mRNA, clone: YMU0

  7. AcEST: BP919842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G07. BP919842 - Show BP91984...is mRNA. clone: YMU001_000129_G07. Accession BP919842 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris m...c Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G07. (567 le

  8. AcEST: BP919840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G05 476 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G05. BP919840 - Show BP91984...is mRNA. clone: YMU001_000129_G05. Accession BP919840 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_...es. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_0

  9. AcEST: BP919843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G09 473 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G09. BP91984...3 CL2697Contig1 Show BP919843 Clone id YMU001_000129_G09 Library YMU01 Length 473 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_G09. Accession BP919843 Tissue type prothallium Developmental stag...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Ad...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Adiantum capillus-veneris

  10. AcEST: BP911984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F07 566 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F07. BP911984... CL2332Contig1 Show BP911984 Clone id YMU001_000011_F07 Library YMU01 Length 566 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_F07. Accession BP911984 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984|Adiantum capillus-veneris mR...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984

  11. AcEST: BP919845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G11 376 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G11. BP919845 - Show BP91984...is mRNA. clone: YMU001_000129_G11. Accession BP919845 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G1...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus

  12. AcEST: BP919849 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H04 454 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H04. BP919849 - Show BP91984...is mRNA. clone: YMU001_000129_H04. Accession BP919849 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_00...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  13. AcEST: BP918650 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000116_A01 560 Adiantum capillus-veneris mRNA. clone: YMU001_000116_A01. BP918650... CL552Contig1 Show BP918650 Clone id YMU001_000116_A01 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000116_A01. Accession BP918650 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918650|Adiantum capillus-ve...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918650|Adiant

  14. AcEST: BP916000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_G02 533 Adiantum capillus-veneris mRNA. clone: YMU001_000081_G02. BP916000 - Show BP916000...is mRNA. clone: YMU001_000081_G02. Accession BP916000 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916000...s Res. 25:3389-3402. Query= BP916000|Adiantum capillus-veneris mRNA, clone: YMU001_000081_G02. (533 letters)

  15. AcEST: BP912094 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_A09 564 Adiantum capillus-veneris mRNA. clone: YMU001_000015_A09. BP9120...94 CL2967Contig1 Show BP912094 Clone id YMU001_000015_A09 Library YMU01 Length 564 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_A09. Accession BP912094 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912094|Adiantum c...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  16. AcEST: BP912057 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E09 528 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E09. BP9120...57 CL1892Contig1 Show BP912057 Clone id YMU001_000012_E09 Library YMU01 Length 528 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_E09. Accession BP912057 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP912057|Adiantum capillus-veneris mRNA, clone: YMU001_000012_E09. (528 lett... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  17. AcEST: BP921209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A04 535 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A04. BP921209 - Show BP92120...is mRNA. clone: YMU001_000147_A04. Accession BP921209 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92120...grams, Nucleic Acids Res. 25:3389-3402. Query= BP921209|Adiantum capillus-veneris mRNA, clone: YMU001_000147

  18. AcEST: BP912061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_F01 532 Adiantum capillus-veneris mRNA. clone: YMU001_000012_F01. BP912061 - Show BP9120...is mRNA. clone: YMU001_000012_F01. Accession BP912061 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  19. AcEST: BP912036 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_C09 555 Adiantum capillus-veneris mRNA. clone: YMU001_000012_C09. BP912036 - Show BP9120...is mRNA. clone: YMU001_000012_C09. Accession BP912036 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP912036|Adiantum capillus-veneris mRNA, clone: YMU001_000012_C0... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912036|Adiantum capillus-ven

  20. AcEST: BP912025 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_B09 484 Adiantum capillus-veneris mRNA. clone: YMU001_000012_B09. BP9120...25 CL1441Contig1 Show BP912025 Clone id YMU001_000012_B09 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_B09. Accession BP912025 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  1. AcEST: BP912042 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_D05 541 Adiantum capillus-veneris mRNA. clone: YMU001_000012_D05. BP912042 - Show BP9120...is mRNA. clone: YMU001_000012_D05. Accession BP912042 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP912042|Adiantum capillus-veneris mRNA, clone: YMU001_000012_D05. (541 le...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912042|Adiantum capil

  2. AcEST: BP921208 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A03 436 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A03. BP921208 - Show BP92120...is mRNA. clone: YMU001_000147_A03. Accession BP921208 Tissue type prothallium Developmental stage - Contig I..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92120... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921208|Adiantum c

  3. AcEST: BP912056 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E08 538 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E08. BP912056 - Show BP9120...is mRNA. clone: YMU001_000012_E08. Accession BP912056 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912056|Adiantum capillus-veneris mRNA, clone... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  4. AcEST: BP921120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_A02 427 Adiantum capillus-veneris mRNA. clone: YMU001_000146_A02. BP921120 - Show BP921120...is mRNA. clone: YMU001_000146_A02. Accession BP921120 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP921120|Adiantum capillus-veneris mRNA, clone: ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921120|Adian

  5. AcEST: BP912009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A03 561 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A03. BP912009 - Show BP9120...is mRNA. clone: YMU001_000012_A03. Accession BP912009 Tissue type prothallium Developmental stage - Contig I...s, Nucleic Acids Res. 25:3389-3402. Query= BP912009|Adiantum capillus-veneris mRNA, clone: YMU001_000012_A03... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912009|Adian

  6. AcEST: BP912030 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_C03 525 Adiantum capillus-veneris mRNA. clone: YMU001_000012_C03. BP912030 - Show BP9120...is mRNA. clone: YMU001_000012_C03. Accession BP912030 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912030|Ad...cids Res. 25:3389-3402. Query= BP912030|Adiantum capillus-veneris mRNA, clone: YMU001_000012_C03. (513 lette

  7. AcEST: BP912050 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E01 544 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E01. BP912050 - Show BP9120...is mRNA. clone: YMU001_000012_E01. Accession BP912050 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912050|Adiantum capillus-veneris mRNA, c.... 25:3389-3402. Query= BP912050|Adiantum capillus-veneris mRNA, clone: YMU001_000

  8. AcEST: BP919570 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_F05 404 Adiantum capillus-veneris mRNA. clone: YMU001_000126_F05. BP91957...0 CL2080Contig1 Show BP919570 Clone id YMU001_000126_F05 Library YMU01 Length 404 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000126_F05. Accession BP919570 Tissue type prothallium Developmental stag...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919570|A... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919570|Adiantum c

  9. AcEST: BP919578 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_G03 472 Adiantum capillus-veneris mRNA. clone: YMU001_000126_G03. BP919578 - Show BP91957...is mRNA. clone: YMU001_000126_G03. Accession BP919578 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP919578|Adiantum capillus-veneris...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919578|Adiantum capillus-veneris mRNA, clone: Y

  10. AcEST: BP919577 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_G02 494 Adiantum capillus-veneris mRNA. clone: YMU001_000126_G02. BP91957...7 CL2728Contig1 Show BP919577 Clone id YMU001_000126_G02 Library YMU01 Length 494 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000126_G02. Accession BP919577 Tissue type prothallium Developmental stag...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919577|Adiantum capill...Acids Res. 25:3389-3402. Query= BP919577|Adiantum capillus-veneris mRNA, clone: YMU001_000126_G02. (494 lett

  11. AcEST: BP911957 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_C07 599 Adiantum capillus-veneris mRNA. clone: YMU001_000011_C07. BP911957... CL144Contig1 Show BP911957 Clone id YMU001_000011_C07 Library YMU01 Length 599 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000011_C07. Accession BP911957 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911957|Adiantum capillus-ve... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911957|Adiant

  12. AcEST: BP919158 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_H06 381 Adiantum capillus-veneris mRNA. clone: YMU001_000121_H06. BP919158 - Show BP91915...is mRNA. clone: YMU001_000121_H06. Accession BP919158 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919158|Adiantum capillus-veneris mRNA, clone: YMU001_00...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91915

  13. AcEST: BP919153 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_G11 445 Adiantum capillus-veneris mRNA. clone: YMU001_000121_G11. BP919153 - Show BP91915...is mRNA. clone: YMU001_000121_G11. Accession BP919153 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP919153|Adiantum capillus-veneris mRNA, clone: YMU001_000...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919153|Adiantum capillus-veneris mRNA, clone

  14. AcEST: BP919159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_H07 370 Adiantum capillus-veneris mRNA. clone: YMU001_000121_H07. BP919159 - Show BP91915...is mRNA. clone: YMU001_000121_H07. Accession BP919159 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP919159|Adiantum capillus-veneris mRNA, clone: YMU001_000121_H07. (370 le...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919159|Adiantum capillus

  15. AcEST: BP919157 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_H05 491 Adiantum capillus-veneris mRNA. clone: YMU001_000121_H05. BP919157 - Show BP91915...is mRNA. clone: YMU001_000121_H05. Accession BP919157 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919157|Adiantum capillu.... 25:3389-3402. Query= BP919157|Adiantum capillus-veneris mRNA, clone: YMU001_000

  16. AcEST: BP911915 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000010_B01 450 Adiantum capillus-veneris mRNA. clone: YMU001_000010_B01. BP911915 - Show BP911915...is mRNA. clone: YMU001_000010_B01. Accession BP911915 Tissue type prothallium Developmental stage - Contig I...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911915...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91191

  17. AcEST: BP919156 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_H04 416 Adiantum capillus-veneris mRNA. clone: YMU001_000121_H04. BP919156 - Show BP91915...is mRNA. clone: YMU001_000121_H04. Accession BP919156 Tissue type prothallium Developmental stage - Contig I...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919156|Adiantum capillus-veneris mRNA, cl...ids Res. 25:3389-3402. Query= BP919156|Adiantum capillus-veneris mRNA, clone: YMU001_000121_H04. (416 letter

  18. AcEST: BP919154 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_H01 347 Adiantum capillus-veneris mRNA. clone: YMU001_000121_H01. BP919154 - Show BP91915...is mRNA. clone: YMU001_000121_H01. Accession BP919154 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP919154|Adiantum capillus-veneris mRNA, clone: YMU001_000121_H01. (34...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919154|Adiantum capi

  19. AcEST: BP921593 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000151_H04 435 Adiantum capillus-veneris mRNA. clone: YMU001_000151_H04. BP921593 - Show BP92159...is mRNA. clone: YMU001_000151_H04. Accession BP921593 Tissue type prothallium Developmental stage - Contig I...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921593|Adiantu...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921593|Adiantum capillus-ve

  20. AcEST: BP915953 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_H11 379 Adiantum capillus-veneris mRNA. clone: YMU001_000079_H11. BP915953 - Show BP9159...is mRNA. clone: YMU001_000079_H11. Accession BP915953 Tissue type prothallium Developmental stage - Contig I...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915953|Adiantum capillus-veneris mRNA, cl...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP915953|Adiantum capillus-veneris mRNA, clone: YMU001_00007

  1. AcEST: BP911596 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000006_H03 483 Adiantum capillus-veneris mRNA. clone: YMU001_000006_H03. BP91159...6 CL3750Contig1 Show BP911596 Clone id YMU001_000006_H03 Library YMU01 Length 483 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000006_H03. Accession BP911596 Tissue type prothallium Developmental stag...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91159...cleic Acids Res. 25:3389-3402. Query= BP911596|Adiantum capillus-veneris mRNA, cl

  2. AcEST: BP921596 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000151_H07 266 Adiantum capillus-veneris mRNA. clone: YMU001_000151_H07. BP921596 - Show BP92159...is mRNA. clone: YMU001_000151_H07. Accession BP921596 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP921596|Adiantum capillus-veneris mRNA, clone: YMU001_000151_H07. (266 letters) D...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92159

  3. AcEST: BP921595 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000151_H06 534 Adiantum capillus-veneris mRNA. clone: YMU001_000151_H06. BP921595 - Show BP92159...is mRNA. clone: YMU001_000151_H06. Accession BP921595 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921595|Adiantum capillus-veneris mRNA, clone...YTMTSVLKAASSLPEGLSLSKQVHVHAIKINNVSDSF 453 Query: 159 VGSSLVYSYAKCGLLADAKDVLRALPME...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921595|Adiantum capillus-veneris

  4. AcEST: BP915989 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_E06 446 Adiantum capillus-veneris mRNA. clone: YMU001_000081_E06. BP915989 - Show BP9159...is mRNA. clone: YMU001_000081_E06. Accession BP915989 Tissue type prothallium Developmental stage - Contig I...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915989|Adiantu... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915989|Adiant

  5. AcEST: BP915993 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_F03 459 Adiantum capillus-veneris mRNA. clone: YMU001_000081_F03. BP9159...93 CL3815Contig1 Show BP915993 Clone id YMU001_000081_F03 Library YMU01 Length 459 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000081_F03. Accession BP915993 Tissue type prothallium Developmental stag...grams, Nucleic Acids Res. 25:3389-3402. Query= BP915993|Adiantum capillus-veneris...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915993|Ad

  6. AcEST: BP915967 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_B08 257 Adiantum capillus-veneris mRNA. clone: YMU001_000081_B08. BP915967 - Show BP9159...is mRNA. clone: YMU001_000081_B08. Accession BP915967 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP915967|Adiantum capillus-veneris mRNA, clone: YMU001_000081_B08. (257 let...leic Acids Res. 25:3389-3402. Query= BP915967|Adiantum capillus-veneris mRNA, clone: YMU001_000081_B08. (257

  7. AcEST: BP915943 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_G09 414 Adiantum capillus-veneris mRNA. clone: YMU001_000079_G09. BP9159...43 CL2212Contig1 Show BP915943 Clone id YMU001_000079_G09 Library YMU01 Length 414 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000079_G09. Accession BP915943 Tissue type prothallium Developmental stag... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9159... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915943|Adiantum capil

  8. AcEST: BP914159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_F04 523 Adiantum capillus-veneris mRNA. clone: YMU001_000042_F04. BP914159 - Show BP914159...is mRNA. clone: YMU001_000042_F04. Accession BP914159 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914159|Ad... Nucleic Acids Res. 25:3389-3402. Query= BP914159|Adiantum capillus-veneris mRNA, clone: YMU001_000042_F04. ...ccus ... 164 3e-39 tr|Q2SL81|Q2SL81_HAHCH Predicted oxidoreductase (Related to aryl... 159

  9. AcEST: BP921159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_D08 139 Adiantum capillus-veneris mRNA. clone: YMU001_000146_D08. BP921159 - Show BP921159...is mRNA. clone: YMU001_000146_D08. Accession BP921159 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921159...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921159|Adiantum cap

  10. AcEST: BP915987 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_E04 561 Adiantum capillus-veneris mRNA. clone: YMU001_000081_E04. BP9159...87 CL3121Contig1 Show BP915987 Clone id YMU001_000081_E04 Library YMU01 Length 561 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000081_E04. Accession BP915987 Tissue type prothallium Developmental stag...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915987|Adiantum capillus-veneris m...cids Res. 25:3389-3402. Query= BP915987|Adiantum capillus-veneris mRNA, clone: YM

  11. AcEST: BP921599 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000151_H10 118 Adiantum capillus-veneris mRNA. clone: YMU001_000151_H10. BP921599 - Show BP92159...is mRNA. clone: YMU001_000151_H10. Accession BP921599 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92159...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921599|Adiantum capillus-veneris mRNA, cl

  12. AcEST: BP915936 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_F12 539 Adiantum capillus-veneris mRNA. clone: YMU001_000079_F12. BP915936 - Show BP9159...is mRNA. clone: YMU001_000079_F12. Accession BP915936 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP915936|Adiantum capillus-veneris mRNA, clone: YMU001_000...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915936|Adiantum capillus-veneris mRNA, clone

  13. AcEST: BP911592 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000006_G08 335 Adiantum capillus-veneris mRNA. clone: YMU001_000006_G08. BP911592 - Show BP91159...is mRNA. clone: YMU001_000006_G08. Accession BP911592 Tissue type prothallium Developmental stage - Contig I...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91159...leic Acids Res. 25:3389-3402. Query= BP911592|Adiantum capillus-veneris mRNA, clo

  14. AcEST: BP915940 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_G05 434 Adiantum capillus-veneris mRNA. clone: YMU001_000079_G05. BP915940 - Show BP9159...is mRNA. clone: YMU001_000079_G05. Accession BP915940 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9159...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9159

  15. AcEST: BP915950 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_H07 391 Adiantum capillus-veneris mRNA. clone: YMU001_000079_H07. BP9159...50 CL180Contig1 Show BP915950 Clone id YMU001_000079_H07 Library YMU01 Length 391 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000079_H07. Accession BP915950 Tissue type prothallium Developmental stage...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915950|Adiantum ...ds Res. 25:3389-3402. Query= BP915950|Adiantum capillus-veneris mRNA, clone: YMU0

  16. AcEST: BP915903 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_C09 388 Adiantum capillus-veneris mRNA. clone: YMU001_000079_C09. BP915903 - Show BP9159...is mRNA. clone: YMU001_000079_C09. Accession BP915903 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915903|Adiantum capillus-...Acids Res. 25:3389-3402. Query= BP915903|Adiantum capillus-veneris mRNA, clone: Y

  17. AcEST: BP915923 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_E07 554 Adiantum capillus-veneris mRNA. clone: YMU001_000079_E07. BP915923 - Show BP9159...is mRNA. clone: YMU001_000079_E07. Accession BP915923 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP915923|Adiantum capillus-veneris mRNA, clone: YMU001_000...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915923|Adiantum capillus-veneris

  18. AcEST: BP915973 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_C06 192 Adiantum capillus-veneris mRNA. clone: YMU001_000081_C06. BP915973 - Show BP9159...is mRNA. clone: YMU001_000081_C06. Accession BP915973 Tissue type prothallium Developmental stage - Contig I...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915973|Adiantum capi... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915973|Adiantum capillus-veneris mRNA,

  19. AcEST: BP921597 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000151_H08 523 Adiantum capillus-veneris mRNA. clone: YMU001_000151_H08. BP921597 - Show BP92159...is mRNA. clone: YMU001_000151_H08. Accession BP921597 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP921597|Adiantum capillus-veneris mRNA, clone: YMU001_000151_H08. (523 le...s. 25:3389-3402. Query= BP921597|Adiantum capillus-veneris mRNA, clone: YMU001_000151_H08. (523 letters) Dat

  20. AcEST: BP915934 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_F09 314 Adiantum capillus-veneris mRNA. clone: YMU001_000079_F09. BP9159...34 CL780Contig1 Show BP915934 Clone id YMU001_000079_F09 Library YMU01 Length 314 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000079_F09. Accession BP915934 Tissue type prothallium Developmental stage... 25:3389-3402. Query= BP915934|Adiantum capillus-veneris mRNA, clone: YMU001_000079_F09. (314 letters) Datab..., Nucleic Acids Res. 25:3389-3402. Query= BP915934|Adiantum capillus-veneris mRNA

  1. AcEST: BP911590 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000006_G05 493 Adiantum capillus-veneris mRNA. clone: YMU001_000006_G05. BP911590 - Show BP91159...is mRNA. clone: YMU001_000006_G05. Accession BP911590 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP911590|Adiantum capillus-veneris ...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91159

  2. AcEST: BP915997 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_F11 339 Adiantum capillus-veneris mRNA. clone: YMU001_000081_F11. BP915997 - Show BP9159...is mRNA. clone: YMU001_000081_F11. Accession BP915997 Tissue type prothallium Developmental stage - Contig I...es. 25:3389-3402. Query= BP915997|Adiantum capillus-veneris mRNA, clone: YMU001_000081_F11. (339 letters) Da...ic Acids Res. 25:3389-3402. Query= BP915997|Adiantum capillus-veneris mRNA, clone

  3. AcEST: BP915974 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_C07 482 Adiantum capillus-veneris mRNA. clone: YMU001_000081_C07. BP915974 - Show BP9159...is mRNA. clone: YMU001_000081_C07. Accession BP915974 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915974|Adiantum capillus-veneris mRNA, clone: Y...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915974|A

  4. AcEST: BP915977 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_D01 114 Adiantum capillus-veneris mRNA. clone: YMU001_000081_D01. BP9159...77 CL784Contig1 Show BP915977 Clone id YMU001_000081_D01 Library YMU01 Length 114 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000081_D01. Accession BP915977 Tissue type prothallium Developmental stage... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9159...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP915977|Adiantum capillus

  5. AcEST: BP915994 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_F04 459 Adiantum capillus-veneris mRNA. clone: YMU001_000081_F04. BP9159...94 CL758Contig1 Show BP915994 Clone id YMU001_000081_F04 Library YMU01 Length 459 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000081_F04. Accession BP915994 Tissue type prothallium Developmental stage... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915994|Adian...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9159

  6. AcEST: BP915920 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_E04 504 Adiantum capillus-veneris mRNA. clone: YMU001_000079_E04. BP9159...20 CL1388Contig1 Show BP915920 Clone id YMU001_000079_E04 Library YMU01 Length 504 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000079_E04. Accession BP915920 Tissue type prothallium Developmental stag...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9159...ids Res. 25:3389-3402. Query= BP915920|Adiantum capillus-veneris mRNA, clone: YMU

  7. AcEST: BP915958 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_A06 197 Adiantum capillus-veneris mRNA. clone: YMU001_000081_A06. BP915958 - Show BP9159...is mRNA. clone: YMU001_000081_A06. Accession BP915958 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9159...VEHEDSEEAIELYREM 48 Y+ GK+E+AR D ++ RD+ W+ ++ Y + ++ + L++ M Sbjct: 159 YARCGKMEE...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915958|Adiantum capillus-veneris mRNA, cl

  8. AcEST: BP915981 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_D06 333 Adiantum capillus-veneris mRNA. clone: YMU001_000081_D06. BP915981 - Show BP9159...is mRNA. clone: YMU001_000081_D06. Accession BP915981 Tissue type prothallium Developmental stage - Contig I...es. 25:3389-3402. Query= BP915981|Adiantum capillus-veneris mRNA, clone: YMU001_000081_D06. (333 letters) Da...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915981|Adi

  9. AcEST: BP915900 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_C05 595 Adiantum capillus-veneris mRNA. clone: YMU001_000079_C05. BP9159...00 CL1444Contig1 Show BP915900 Clone id YMU001_000079_C05 Library YMU01 Length 595 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000079_C05. Accession BP915900 Tissue type prothallium Developmental stag...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915900|Adiantum ... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9159

  10. AcEST: BP915909 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D04 507 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D04. BP915909 - Show BP9159...is mRNA. clone: YMU001_000079_D04. Accession BP915909 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP915909|Adiantum capillus-veneris m... Res. 25:3389-3402. Query= BP915909|Adiantum capillus-veneris mRNA, clone: YMU001_000079_D04. (507 letters)

  11. AcEST: BP915979 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_D03 267 Adiantum capillus-veneris mRNA. clone: YMU001_000081_D03. BP915979 - Show BP9159...is mRNA. clone: YMU001_000081_D03. Accession BP915979 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915979|Adiantum capillus-veneris...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9159

  12. AcEST: BP915959 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_A07 490 Adiantum capillus-veneris mRNA. clone: YMU001_000081_A07. BP915959 - Show BP9159...is mRNA. clone: YMU001_000081_A07. Accession BP915959 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP915959|Adiantum capillus-ven...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9159

  13. AcEST: BP921590 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000151_G12 506 Adiantum capillus-veneris mRNA. clone: YMU001_000151_G12. BP921590 - Show BP92159...is mRNA. clone: YMU001_000151_G12. Accession BP921590 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92159...ids Res. 25:3389-3402. Query= BP921590|Adiantum capillus-veneris mRNA, clone: YMU

  14. AcEST: BP921594 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000151_H05 354 Adiantum capillus-veneris mRNA. clone: YMU001_000151_H05. BP92159...4 CL410Contig1 Show BP921594 Clone id YMU001_000151_H05 Library YMU01 Length 354 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000151_H05. Accession BP921594 Tissue type prothallium Developmental stage... Nucleic Acids Res. 25:3389-3402. Query= BP921594|Adiantum capillus-veneris mRNA, clone: YMU001_000151_H05. ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92159

  15. AcEST: BP918306 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A03 562 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A03. BP918306 - Show BP91830...is mRNA. clone: YMU001_000112_A03. Accession BP918306 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918306|Adiantum capillus-veneris mRNA, clone: YMU001_000112_...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918306|Adiantum capillus-veneris mRNA, clone: YMU001_000112

  16. AcEST: BP918302 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_H03 457 Adiantum capillus-veneris mRNA. clone: YMU001_000111_H03. BP918302 - Show BP91830...is mRNA. clone: YMU001_000111_H03. Accession BP918302 Tissue type prothallium Developmental stage - Contig I...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91830...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918302|Adiantum ca

  17. AcEST: BP915830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_E09 601 Adiantum capillus-veneris mRNA. clone: YMU001_000077_E09. BP915830 - Show BP915830...is mRNA. clone: YMU001_000077_E09. Accession BP915830 Tissue type prothallium Developmental stage - Contig I...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915830|Adiantu...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915830|Adiantum capillus-veneris m

  18. AcEST: BP918830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000118_A03 482 Adiantum capillus-veneris mRNA. clone: YMU001_000118_A03. BP918830... CL578Contig1 Show BP918830 Clone id YMU001_000118_A03 Library YMU01 Length 482 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000118_A03. Accession BP918830 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918830...s, Nucleic Acids Res. 25:3389-3402. Query= BP918830|Adiantum capillus-veneris mRNA, clone: YMU001_000118_A03

  19. AcEST: BP919830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_F05 476 Adiantum capillus-veneris mRNA. clone: YMU001_000129_F05. BP919830... CL2022Contig1 Show BP919830 Clone id YMU001_000129_F05 Library YMU01 Length 476 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_F05. Accession BP919830 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919830...leic Acids Res. 25:3389-3402. Query= BP919830|Adiantum capillus-veneris mRNA, clone: YMU001_000129_F05. (458

  20. AcEST: BP917830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000106_A10 487 Adiantum capillus-veneris mRNA. clone: YMU001_000106_A10. BP917830 - Show BP917830...is mRNA. clone: YMU001_000106_A10. Accession BP917830 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917830|Adiantum ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917830|A

  1. AcEST: BP914830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_D03 538 Adiantum capillus-veneris mRNA. clone: YMU001_000063_D03. BP914830 - Show BP914830...is mRNA. clone: YMU001_000063_D03. Accession BP914830 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP914830|Adiantum capillus-veneris mRNA, clone: YMU001_000063_...programs, Nucleic Acids Res. 25:3389-3402. Query= BP914830|Adiantum capillus-vene

  2. AcEST: BP918309 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A06 512 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A06. BP91830...9 CL856Contig1 Show BP918309 Clone id YMU001_000112_A06 Library YMU01 Length 512 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000112_A06. Accession BP918309 Tissue type prothallium Developmental stage...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP918309|Adiantum capillus-veneris mRNA, clone: YMU001_00011... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91830

  3. AcEST: BP918814 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_G04 548 Adiantum capillus-veneris mRNA. clone: YMU001_000117_G04. BP918814 - Show BP918814...is mRNA. clone: YMU001_000117_G04. Accession BP918814 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP918814|Adiantum capillus-veneris mRNA, clone: YMU001_000117_G04. (548 letters) Dat... Res. 25:3389-3402. Query= BP918814|Adiantum capillus-veneris mRNA, clone: YMU001_000117_G04. (548 letters)

  4. AcEST: BP920856 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000142_E09 470 Adiantum capillus-veneris mRNA. clone: YMU001_000142_E09. BP920856... CL4215Contig1 Show BP920856 Clone id YMU001_000142_E09 Library YMU01 Length 470 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000142_E09. Accession BP920856 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920856|Adiantum capillus-... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920856|Adiantum capil

  5. AcEST: BP920144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  6. AcEST: BP920141 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52

  7. AcEST: BP920148 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  8. AcEST: BP920140 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  9. AcEST: BP920142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  10. AcEST: BP920147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201

  11. AcEST: BP920145 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian

  12. AcEST: BP920143 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum

  13. AcEST: BP915615 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000073_F08 475 Adiantum capillus-veneris mRNA. clone: YMU001_000073_F08. BP915615... CL3512Contig1 Show BP915615 Clone id YMU001_000073_F08 Library YMU01 Length 475 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000073_F08. Accession BP915615 Tissue type prothallium Developmental stag...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915615|Adiantum capill...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915615|Adiantum capillus-veneris mRNA, clon

  14. AcEST: BP915815 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_C11 552 Adiantum capillus-veneris mRNA. clone: YMU001_000077_C11. BP915815... CL3742Contig1 Show BP915815 Clone id YMU001_000077_C11 Library YMU01 Length 552 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000077_C11. Accession BP915815 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP915815|Adiantum capillus-veneris mRNA, clone: YMU001... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915815|Adiant

  15. AcEST: BP915155 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_B08 468 Adiantum capillus-veneris mRNA. clone: YMU001_000067_B08. BP91515...5 CL2592Contig1 Show BP915155 Clone id YMU001_000067_B08 Library YMU01 Length 468 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000067_B08. Accession BP915155 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915155|Adiantum capillus-ven...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915

  16. AcEST: BP918377 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_G07 508 Adiantum capillus-veneris mRNA. clone: YMU001_000112_G07. BP9183...77 CL44Contig1 Show BP918377 Clone id YMU001_000112_G07 Library YMU01 Length 508 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000112_G07. Accession BP918377 Tissue type prothallium Developmental stage ...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918377|Adi

  17. AcEST: BP918324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B09 441 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B09. BP918324 - Show BP9183...is mRNA. clone: YMU001_000112_B09. Accession BP918324 Tissue type prothallium Developmental stage - Contig I... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918324|Adiantum capillus-veneris

  18. AcEST: BP915183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_E04 303 Adiantum capillus-veneris mRNA. clone: YMU001_000067_E04. BP915183 - Show BP915183...is mRNA. clone: YMU001_000067_E04. Accession BP915183 Tissue type prothallium Developmental stage - Contig I...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915183...es. 25:3389-3402. Query= BP915183|Adiantum capillus-veneris mRNA, clone: YMU001_0

  19. AcEST: BP918359 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_E12 553 Adiantum capillus-veneris mRNA. clone: YMU001_000112_E12. BP9183...59 CL3958Contig1 Show BP918359 Clone id YMU001_000112_E12 Library YMU01 Length 553 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_E12. Accession BP918359 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918359|Adiantum capillus-veneri...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918359|Adiantum capillus-veneris mRNA, clone: Y

  20. AcEST: BP921832 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_F10 448 Adiantum capillus-veneris mRNA. clone: YMU001_000154_F10. BP921832 - Show BP92183...is mRNA. clone: YMU001_000154_F10. Accession BP921832 Tissue type prothallium Developmental stage - Contig I..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183...s, Nucleic Acids Res. 25:3389-3402. Query= BP921832|Adiantum capillus-veneris mRNA, clone: YMU001_000154_F10

  1. AcEST: BP918353 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_E05 498 Adiantum capillus-veneris mRNA. clone: YMU001_000112_E05. BP9183...53 CL2530Contig1 Show BP918353 Clone id YMU001_000112_E05 Library YMU01 Length 498 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_E05. Accession BP918353 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918353|Adiantum capillus-veneris mRNA, clone: YMU00

  2. AcEST: BP918311 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A08 458 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A08. BP918311 - Show BP9183...is mRNA. clone: YMU001_000112_A08. Accession BP918311 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP918311|Adiantum capillus-veneris mRNA, clone...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918311|Adiantum capillus-veneris m

  3. AcEST: BP919183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_B10 484 Adiantum capillus-veneris mRNA. clone: YMU001_000122_B10. BP919183 - Show BP919183...is mRNA. clone: YMU001_000122_B10. Accession BP919183 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP919183|Adiantum capillus-veneris m..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919183

  4. AcEST: BP921836 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_G02 401 Adiantum capillus-veneris mRNA. clone: YMU001_000154_G02. BP921836 - Show BP92183...is mRNA. clone: YMU001_000154_G02. Accession BP921836 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921836|Adiantum capillus-vener...s. 25:3389-3402. Query= BP921836|Adiantum capillus-veneris mRNA, clone: YMU001_000154_G02. (401 letters) Dat...GWEDVTRNSIGLIHSLEEDGDVGIAFCFRSKPFRCSVTDVEKVPPFEVG 1183 Score = 45.4 bits (106), Expect(2) = 9e-05 Identities

  5. AcEST: BP921837 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_G03 210 Adiantum capillus-veneris mRNA. clone: YMU001_000154_G03. BP921837 - Show BP92183...is mRNA. clone: YMU001_000154_G03. Accession BP921837 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP921837|Adiantum capillus-veneris mRNA, clone: YMU0

  6. AcEST: BP918348 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D12 438 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D12. BP9183...48 CL3952Contig1 Show BP918348 Clone id YMU001_000112_D12 Library YMU01 Length 438 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_D12. Accession BP918348 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP918348|Adiantum capillus-veneris mRNA, clone: YMU0...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  7. AcEST: BP918328 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C02 530 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C02. BP918328 - Show BP9183...is mRNA. clone: YMU001_000112_C02. Accession BP918328 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918328|Adiantum capillus-veneris...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918328|Adian

  8. AcEST: BP918368 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_F10 559 Adiantum capillus-veneris mRNA. clone: YMU001_000112_F10. BP918368 - Show BP9183...is mRNA. clone: YMU001_000112_F10. Accession BP918368 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918368|Adiantum capillus-veneris mRNA, clone: YMU001_000112_...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918368

  9. AcEST: BP918339 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D02 499 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D02. BP918339 - Show BP9183...is mRNA. clone: YMU001_000112_D02. Accession BP918339 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918339|Adiantum capillus-veneris mRNA, c

  10. AcEST: BP918316 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B01 479 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B01. BP9183...16 CL1887Contig1 Show BP918316 Clone id YMU001_000112_B01 Library YMU01 Length 479 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_B01. Accession BP918316 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918316|Adia...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  11. AcEST: BP918333 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C07 551 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C07. BP918333 - Show BP9183...is mRNA. clone: YMU001_000112_C07. Accession BP918333 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP918333|Adiantum capillus-veneris mRNA, clone: YMU001_000112_C07. (5... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  12. AcEST: BP921830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_F08 494 Adiantum capillus-veneris mRNA. clone: YMU001_000154_F08. BP92183...0 CL1991Contig1 Show BP921830 Clone id YMU001_000154_F08 Library YMU01 Length 494 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000154_F08. Accession BP921830 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183

  13. AcEST: BP918392 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A02 381 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A02. BP918392 - Show BP9183...is mRNA. clone: YMU001_000113_A02. Accession BP918392 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918392|Adiantum capillus-veneris ...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918392|...TAKLGPNVSISANARIGPGVRLVGCIILDDVEIKEN 355 Query: 183 KCCDNALYHWMEVL-HWKMRQ---EYRESAIMLPNWE*QYLVKMFLCEDEVVVTSC

  14. AcEST: BP918372 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_G02 505 Adiantum capillus-veneris mRNA. clone: YMU001_000112_G02. BP918372 - Show BP9183...is mRNA. clone: YMU001_000112_G02. Accession BP918372 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918372... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918372|Adia

  15. AcEST: BP921833 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_F11 469 Adiantum capillus-veneris mRNA. clone: YMU001_000154_F11. BP921833 - Show BP92183...is mRNA. clone: YMU001_000154_F11. Accession BP921833 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP921833|Adiantum capillus-veneris mRNA, clone: YMU00...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183

  16. AcEST: BP918300 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_H01 559 Adiantum capillus-veneris mRNA. clone: YMU001_000111_H01. BP918300 - Show BP9183...is mRNA. clone: YMU001_000111_H01. Accession BP918300 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP918300|Adiantum capillus-veneris mRNA, c...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  17. AcEST: BP913183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_D11 553 Adiantum capillus-veneris mRNA. clone: YMU001_000027_D11. BP913183 - Show BP913183...is mRNA. clone: YMU001_000027_D11. Accession BP913183 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913183|Adiantum capillus-veneris ...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913183

  18. AcEST: BP917183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_D01 417 Adiantum capillus-veneris mRNA. clone: YMU001_000097_D01. BP917183 - Show BP917183...is mRNA. clone: YMU001_000097_D01. Accession BP917183 Tissue type prothallium Developmental stage - Contig I... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917183...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917183|Adiantum capillus-veneris m

  19. AcEST: BP918321 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B06 529 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B06. BP9183...21 CL638Contig1 Show BP918321 Clone id YMU001_000112_B06 Library YMU01 Length 529 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000112_B06. Accession BP918321 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918321|Adiantum capillus-veneris mRNA, clo... Acids Res. 25:3389-3402. Query= BP918321|Adiantum capillus-veneris mRNA, clone:

  20. AcEST: BP918357 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_E09 576 Adiantum capillus-veneris mRNA. clone: YMU001_000112_E09. BP918357 - Show BP9183...is mRNA. clone: YMU001_000112_E09. Accession BP918357 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918357|Adiantum capillus-veneris mRNA, c...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918357|Adiantum capillus

  1. AcEST: BP918319 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B04 586 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B04. BP918319 - Show BP9183...is mRNA. clone: YMU001_000112_B04. Accession BP918319 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918319|Adiantum...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918319|Adiantu

  2. AcEST: BP918340 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D03 538 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D03. BP918340 - Show BP9183...is mRNA. clone: YMU001_000112_D03. Accession BP918340 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP918340|Adiantum capillus-veneris mRNA, clone: YMU001_000112_D03. (524 lett... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  3. AcEST: BP918308 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A05 514 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A05. BP918308 - Show BP9183...is mRNA. clone: YMU001_000112_A05. Accession BP918308 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  4. AcEST: BP918332 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C06 222 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C06. BP918332 - Show BP9183...is mRNA. clone: YMU001_000112_C06. Accession BP918332 Tissue type prothallium Developmental stage - Contig I...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918332|Adiantum capillus-veneris mRNA, clo

  5. AcEST: BP918364 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_F06 521 Adiantum capillus-veneris mRNA. clone: YMU001_000112_F06. BP918364 - Show BP9183...is mRNA. clone: YMU001_000112_F06. Accession BP918364 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...ENAPVEDNVSHFSQ--------LKDQQPATLCYAPPLSTDDTAEILFTSG 183 Query: 372 TTSDPKGVVSSHRGAYIASLTACPVWGLKEGCIYLWTLPLFH...c Acids Res. 25:3389-3402. Query= BP918364|Adiantum capillus-veneris mRNA, clone:

  6. AcEST: BP918397 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A08 462 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A08. BP918397 - Show BP9183...is mRNA. clone: YMU001_000113_A08. Accession BP918397 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918397|Adiantum capillus-veneris mRNA, clone: YM...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918397

  7. AcEST: BP918345 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D08 477 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D08. BP918345 - Show BP9183...is mRNA. clone: YMU001_000112_D08. Accession BP918345 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP918345|Adiantum capillus-veneris mRNA, c... 25:3389-3402. Query= BP918345|Adiantum capillus-veneris mRNA, clone: YMU001_000112_D08. (477 letters) Datab

  8. AcEST: BP918331 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C05 460 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C05. BP918331 - Show BP9183...is mRNA. clone: YMU001_000112_C05. Accession BP918331 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP918331|Adiantum capillus-veneris mRNA, clone...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  9. AcEST: BP918396 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A07 400 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A07. BP918396 - Show BP9183...is mRNA. clone: YMU001_000113_A07. Accession BP918396 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918396|Adiantum capillus-veneris mRNA, clon... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918396|Adiantum c

  10. AcEST: BP918307 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A04 589 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A04. BP9183...07 CL4210Contig1 Show BP918307 Clone id YMU001_000112_A04 Library YMU01 Length 589 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_A04. Accession BP918307 Tissue type prothallium Developmental stag...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918307|Adiantum capi...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918307|Adiantum capillus-veneris

  11. AcEST: BP918375 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_G05 494 Adiantum capillus-veneris mRNA. clone: YMU001_000112_G05. BP918375 - Show BP9183...is mRNA. clone: YMU001_000112_G05. Accession BP918375 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918375|Adiantum capillus-...s, Nucleic Acids Res. 25:3389-3402. Query= BP918375|Adiantum capillus-veneris mRN

  12. AcEST: BP918344 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D07. BP918344 - Show BP9183...is mRNA. clone: YMU001_000112_D07. Accession BP918344 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918344|Adiantum capillus-v

  13. AcEST: BP918373 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_G03 522 Adiantum capillus-veneris mRNA. clone: YMU001_000112_G03. BP918373 - Show BP9183...is mRNA. clone: YMU001_000112_G03. Accession BP918373 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  14. AcEST: BP918388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_H09 552 Adiantum capillus-veneris mRNA. clone: YMU001_000112_H09. BP918388 - Show BP9183...is mRNA. clone: YMU001_000112_H09. Accession BP918388 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP918388|Adiantum capillus-veneris mRNA, clone: YMU001_000112_H09. (552 let...eic Acids Res. 25:3389-3402. Query= BP918388|Adiantum capillus-veneris mRNA, clone: YMU001_000112_H09. (552

  15. AcEST: BP920183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A07 427 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A07. BP920183 - Show BP920183...is mRNA. clone: YMU001_000134_A07. Accession BP920183 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920183...programs, Nucleic Acids Res. 25:3389-3402. Query= BP920183|Adiantum capillus-veneris mRNA, clone: YMU001_000

  16. AcEST: BP918315 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A12 550 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A12. BP918315 - Show BP9183...is mRNA. clone: YMU001_000112_A12. Accession BP918315 Tissue type prothallium Developmental stage - Contig I...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP918315|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  17. AcEST: BP920137 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D12 588 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D12. BP920137 - Show BP92013...is mRNA. clone: YMU001_000133_D12. Accession BP920137 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920137|Adiantum c... 25:3389-3402. Query= BP920137|Adiantum capillus-veneris mRNA, clone: YMU001_000133_D12. (588 letters) Datab

  18. AcEST: BP920138 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E01 423 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E01. BP92013...8 CL144Contig1 Show BP920138 Clone id YMU001_000133_E01 Library YMU01 Length 423 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_E01. Accession BP920138 Tissue type prothallium Developmental stage...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920138|Adiantum ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920138|Adiantum capillus-vener

  19. AcEST: BP912013 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A07 478 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A07. BP912013 - Show BP912013...is mRNA. clone: YMU001_000012_A07. Accession BP912013 Tissue type prothallium Developmental stage - Contig I... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912013|Adian...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912013|Adiantum capillus-veneris mRNA, clone

  20. AcEST: BP920132 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D07 483 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D07. BP92013...2 CL10Contig1 Show BP920132 Clone id YMU001_000133_D07 Library YMU01 Length 483 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000133_D07. Accession BP920132 Tissue type prothallium Developmental stage ...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920132|A...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920132|Adiantum capillus-veneris mRNA, c

  1. AcEST: BP920133 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D08 407 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D08. BP92013...3 CL8Contig1 Show BP920133 Clone id YMU001_000133_D08 Library YMU01 Length 407 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000133_D08. Accession BP920133 Tissue type prothallium Developmental stage -...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92013...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920133|Adiantum capillus-vener

  2. AcEST: BP920139 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E02 535 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E02. BP920139 - Show BP92013...is mRNA. clone: YMU001_000133_E02. Accession BP920139 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP920139|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E02. (535 letters) D...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920139|Adiantum

  3. AcEST: BP919946 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A10 457 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A10. BP919946 - Show BP91994...is mRNA. clone: YMU001_000131_A10. Accession BP919946 Tissue type prothallium Developmental stage - Contig I...s Res. 25:3389-3402. Query= BP919946|Adiantum capillus-veneris mRNA, clone: YMU00...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919946|A

  4. AcEST: BP911994 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_G08 559 Adiantum capillus-veneris mRNA. clone: YMU001_000011_G08. BP911994... CL4209Contig1 Show BP911994 Clone id YMU001_000011_G08 Library YMU01 Length 559 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_G08. Accession BP911994 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911994|Adiantum ... programs, Nucleic Acids Res. 25:3389-3402. Query= BP911994|Adiantum capillus-veneris mRNA, clone: YMU001_00

  5. AcEST: BP919948 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A12. BP919948 - Show BP91994...is mRNA. clone: YMU001_000131_A12. Accession BP919948 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919948|Adia...leic Acids Res. 25:3389-3402. Query= BP919948|Adiantum capillus-veneris mRNA, clone: YMU001_000131_A12. (489

  6. AcEST: BP919943 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_H11 517 Adiantum capillus-veneris mRNA. clone: YMU001_000130_H11. BP919943 - Show BP91994...is mRNA. clone: YMU001_000130_H11. Accession BP919943 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP919943|Adiantum capillus-veneris mRNA, clone: YMU001_000130_H11. (493 le... Res. 25:3389-3402. Query= BP919943|Adiantum capillus-veneris mRNA, clone: YMU001

  7. AcEST: BP919949 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_B01 318 Adiantum capillus-veneris mRNA. clone: YMU001_000131_B01. BP91994...9 CL2311Contig1 Show BP919949 Clone id YMU001_000131_B01 Library YMU01 Length 318 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_B01. Accession BP919949 Tissue type prothallium Developmental stag...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994

  8. AcEST: BP919883 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C06 445 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C06. BP91988...3 CL74Contig1 Show BP919883 Clone id YMU001_000130_C06 Library YMU01 Length 445 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000130_C06. Accession BP919883 Tissue type prothallium Developmental stage ...s Res. 25:3389-3402. Query= BP919883|Adiantum capillus-veneris mRNA, clone: YMU00...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919883|Adiantum capillus-veneris mRNA, clo

  9. AcEST: BP919888 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C11 410 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C11. BP919888 - Show BP91988...is mRNA. clone: YMU001_000130_C11. Accession BP919888 Tissue type prothallium Developmental stage - Contig I...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919888|Adiantum capillu...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919888|Adiantum capillus-

  10. AcEST: BP919885 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C08 326 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C08. BP91988...5 CL2Contig2 Show BP919885 Clone id YMU001_000130_C08 Library YMU01 Length 326 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000130_C08. Accession BP919885 Tissue type prothallium Developmental stage -...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919885|Adiantum capillus-veneris mRNA, clone: YMU001_0001... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91988

  11. AcEST: BP911988 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F12 484 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F12. BP911988 - Show BP911988...is mRNA. clone: YMU001_000011_F12. Accession BP911988 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911988|Adiantum capillus...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911988|Adiantum capillus-veneris mRNA, clone: YMU0

  12. AcEST: BP919881 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C04. BP919881 - Show BP91988...is mRNA. clone: YMU001_000130_C04. Accession BP919881 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919881|Adiantum capillus-veneris mRNA, clone: YMU001_000130_..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91988

  13. AcEST: BP919882 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C05. BP919882 - Show BP91988...is mRNA. clone: YMU001_000130_C05. Accession BP919882 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919882|Adiantum capillus-veneris m... Nucleic Acids Res. 25:3389-3402. Query= BP919882|Adiantum capillus-veneris mRNA, clone: YMU001_000130_C05.

  14. AcEST: BP919886 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C09 570 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C09. BP919886 - Show BP91988...is mRNA. clone: YMU001_000130_C09. Accession BP919886 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919886|Adiantum capillus-vener... Res. 25:3389-3402. Query= BP919886|Adiantum capillus-veneris mRNA, clone: YMU001_000130_C09. (570 letters)

  15. AcEST: BP915555 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000073_A05 516 Adiantum capillus-veneris mRNA. clone: YMU001_000073_A05. BP915555 - Show BP915555...is mRNA. clone: YMU001_000073_A05. Accession BP915555 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915555... Acids Res. 25:3389-3402. Query= BP915555|Adiantum capillus-veneris mRNA, clone: YMU001_000073_A05. (516 let

  16. AcEST: BP921403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000149_D11 544 Adiantum capillus-veneris mRNA. clone: YMU001_000149_D11. BP921403... CL10Contig1 Show BP921403 Clone id YMU001_000149_D11 Library YMU01 Length 544 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000149_D11. Accession BP921403 Tissue type prothallium Developmental stage ...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP921403|Adiantum capillus-veneris mRNA, clone: YMU001_0...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921403

  17. AcEST: BP914032 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B03 607 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B03. BP914032 - Show BP91403...is mRNA. clone: YMU001_000039_B03. Accession BP914032 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914032|Adiantum...programs, Nucleic Acids Res. 25:3389-3402. Query= BP914032|Adiantum capillus-veneris mRNA, clone: YMU001_000

  18. AcEST: BP914403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E06 616 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E06. BP914403 - Show BP914403...is mRNA. clone: YMU001_000058_E06. Accession BP914403 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914403... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914403|Adiantum capillus-veneris mRNA, clone: YM...VEENATMHLPSLILILMKTCLD--PSISGKVTE 219 L D+ W + R +N TMHL ++ LM+ CLD P I+ V E Sbjct: 403

  19. AcEST: BP914034 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B05 392 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B05. BP91403...4 CL1150Contig1 Show BP914034 Clone id YMU001_000039_B05 Library YMU01 Length 392 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_B05. Accession BP914034 Tissue type prothallium Developmental stag...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914034|Adiantum capillus...s Res. 25:3389-3402. Query= BP914034|Adiantum capillus-veneris mRNA, clone: YMU00

  20. AcEST: BP914035 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B07 572 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B07. BP914035 - Show BP91403...is mRNA. clone: YMU001_000039_B07. Accession BP914035 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP914035|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP914035|Adiantum capillus-veneris mRNA, clone: YMU001_000039_B07.

  1. AcEST: BP914037 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B09 437 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B09. BP914037 - Show BP91403...is mRNA. clone: YMU001_000039_B09. Accession BP914037 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914037|Adia... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914037|Adia

  2. AcEST: BP914039 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B11 577 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B11. BP91403...9 CL791Contig1 Show BP914039 Clone id YMU001_000039_B11 Library YMU01 Length 577 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_B11. Accession BP914039 Tissue type prothallium Developmental stage... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914039|Adiantum capillus-ven...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91403

  3. AcEST: BP914030 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_A12 427 Adiantum capillus-veneris mRNA. clone: YMU001_000039_A12. BP914030 - Show BP91403...is mRNA. clone: YMU001_000039_A12. Accession BP914030 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP914030|Adiantum capillus-veneris mRNA, clone: YMU0...WNALISGFTVHLHGDGALQCYEQMRQEGF 403 VSWN +ISG++++ A++ + +M++ Sbjct: 211 WNVMIDGYMRL...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914030|Adiantum capillus-v

  4. AcEST: BP916403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_C10 523 Adiantum capillus-veneris mRNA. clone: YMU001_000087_C10. BP916403... CL144Contig1 Show BP916403 Clone id YMU001_000087_C10 Library YMU01 Length 523 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000087_C10. Accession BP916403 Tissue type prothallium Developmental stage...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916403... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916403|Adiantum c

  5. AcEST: BP919403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G01 499 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G01. BP919403 - Show BP919403...is mRNA. clone: YMU001_000124_G01. Accession BP919403 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919403|Adiantum capillus-veneris mRNA, clone: YMU001_000124_G01. (499 letters) Dat...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919403

  6. AcEST: BP912403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F06 462 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F06. BP912403 - Show BP912403...is mRNA. clone: YMU001_000018_F06. Accession BP912403 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912403|Adiantum capillus-veneris m...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912403|

  7. AcEST: BP915403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B08 567 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B08. BP915403 - Show BP915403...is mRNA. clone: YMU001_000071_B08. Accession BP915403 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP915403|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B08. (567 letters) Dat...s, Nucleic Acids Res. 25:3389-3402. Query= BP915403|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B08

  8. AcEST: BP918403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B03 531 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B03. BP918403 - Show BP918403...is mRNA. clone: YMU001_000113_B03. Accession BP918403 Tissue type prothallium Developmental stage - Contig I...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918403...ucleic Acids Res. 25:3389-3402. Query= BP918403|Adiantum capillus-veneris mRNA, clone: YMU001_000113_B03. (5

  9. AcEST: BP920052 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E03 500 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E03. BP92005...2 CL183Contig1 Show BP920052 Clone id YMU001_000132_E03 Library YMU01 Length 500 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_E03. Accession BP920052 Tissue type prothallium Developmental stage...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92005...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920052|Adian

  10. AcEST: BP920053 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E04 141 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E04. BP92005...3 CL323Contig1 Show BP920053 Clone id YMU001_000132_E04 Library YMU01 Length 141 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_E04. Accession BP920053 Tissue type prothallium Developmental stage... Nucleic Acids Res. 25:3389-3402. Query= BP920053|Adiantum capillus-veneris mRNA,...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920053

  11. AcEST: BP920058 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E09 507 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E09. BP92005...8 CL621Contig1 Show BP920058 Clone id YMU001_000132_E09 Library YMU01 Length 507 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_E09. Accession BP920058 Tissue type prothallium Developmental stage... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92005...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920058|Adiantu

  12. AcEST: BP920059 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E10 367 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E10. BP920059 - Show BP92005...is mRNA. clone: YMU001_000132_E10. Accession BP920059 Tissue type prothallium Developmental stage - Contig I...s, Nucleic Acids Res. 25:3389-3402. Query= BP920059|Adiantum capillus-veneris mRNA, clone: YMU001_000132_E10... programs, Nucleic Acids Res. 25:3389-3402. Query= BP920059|Adiantum capillus-veneris mRNA, clone: YMU001_00

  13. AcEST: BP920056 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E07 303 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E07. BP92005...6 CL779Contig1 Show BP920056 Clone id YMU001_000132_E07 Library YMU01 Length 303 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_E07. Accession BP920056 Tissue type prothallium Developmental stage... 25:3389-3402. Query= BP920056|Adiantum capillus-veneris mRNA, clone: YMU001_000132_E07. (303 letters) Datab... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92005

  14. AcEST: BP920051 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E02 361 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E02. BP92005...1 CL2821Contig1 Show BP920051 Clone id YMU001_000132_E02 Library YMU01 Length 361 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000132_E02. Accession BP920051 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920051|Adiant... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92005

  15. Analysis list: Irf2bp2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Irf2bp2 Blood + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Irf2bp2.1....tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Irf2bp2.5.tsv http://dbarchive.biosciencedbc.jp/k...yushu-u/mm9/target/Irf2bp2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Irf2bp2.Blood.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Blood.gml ...

  16. AcEST: BP915008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D10 581 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D10. BP915008 - Show BP91500...is mRNA. clone: YMU001_000065_D10. Accession BP915008 Tissue type prothallium Developmental stage - Contig I...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP915008|Adiantum capillus-veneris mRNA, clone: YMU001_0000...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915008|Adiant

  17. AcEST: BP917500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_F01 537 Adiantum capillus-veneris mRNA. clone: YMU001_000101_F01. BP917500 - Show BP917500...is mRNA. clone: YMU001_000101_F01. Accession BP917500 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP917500|Adiantum capillus-veneris mRNA, clone: YMU001_000101...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917500|Adiantum capillus-veneris

  18. AcEST: BP915500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_D04 497 Adiantum capillus-veneris mRNA. clone: YMU001_000072_D04. BP915500... CL2883Contig1 Show BP915500 Clone id YMU001_000072_D04 Library YMU01 Length 497 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000072_D04. Accession BP915500 Tissue type prothallium Developmental stag...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915500...programs, Nucleic Acids Res. 25:3389-3402. Query= BP915500|Adiantum capillus-veneris mRNA, clone: YMU001_000

  19. AcEST: BP915002 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D03 491 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D03. BP91500...2 CL2712Contig1 Show BP915002 Clone id YMU001_000065_D03 Library YMU01 Length 491 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000065_D03. Accession BP915002 Tissue type prothallium Developmental stag...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91500...grams, Nucleic Acids Res. 25:3389-3402. Query= BP915002|Adiantum capillus-veneris

  20. AcEST: BP915009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D11 575 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D11. BP915009 - Show BP91500...is mRNA. clone: YMU001_000065_D11. Accession BP915009 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915009|Adiantum capillus-veneris mRNA, clone: ...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915009|

  1. AcEST: BP920500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000137_G11 581 Adiantum capillus-veneris mRNA. clone: YMU001_000137_G11. BP920500... CL3073Contig1 Show BP920500 Clone id YMU001_000137_G11 Library YMU01 Length 581 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000137_G11. Accession BP920500 Tissue type prothallium Developmental stag...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920500...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920500|Adiantum capill

  2. AcEST: BP911938 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_A06 103 Adiantum capillus-veneris mRNA. clone: YMU001_000011_A06. BP911938 - Show BP911938...is mRNA. clone: YMU001_000011_A06. Accession BP911938 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911938|Adiantum ca...programs, Nucleic Acids Res. 25:3389-3402. Query= BP911938|Adiantum capillus-veneris mRNA, clone: YMU001_000

  3. AcEST: BP919384 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E05 553 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E05. BP919384 - Show BP91938...is mRNA. clone: YMU001_000124_E05. Accession BP919384 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91938...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91938

  4. AcEST: BP919381 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E02 515 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E02. BP919381 - Show BP91938...is mRNA. clone: YMU001_000124_E02. Accession BP919381 Tissue type prothallium Developmental stage - Contig I...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91938...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919381|Adiantum capillus-veneris

  5. AcEST: BP919386 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E08 575 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E08. BP919386 - Show BP91938...is mRNA. clone: YMU001_000124_E08. Accession BP919386 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919386|Adiantum capillus-veneris mRNA, clone: YMU001...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919386|Adiantum capillus-veneris mRNA, clo

  6. AcEST: BP919385 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E07 296 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E07. BP919385 - Show BP91938...is mRNA. clone: YMU001_000124_E07. Accession BP919385 Tissue type prothallium Developmental stage - Contig I...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91938...25:3389-3402. Query= BP919385|Adiantum capillus-veneris mRNA, clone: YMU001_00012...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res.

  7. AcEST: BP919388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E10 530 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E10. BP919388 - Show BP91938...is mRNA. clone: YMU001_000124_E10. Accession BP919388 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP919388|Adiantum capillus-veneris mRNA, clone: YMU001_000124_E10. ...cleic Acids Res. 25:3389-3402. Query= BP919388|Adiantum capillus-veneris mRNA, cl

  8. AcEST: BP919387 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E09 378 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E09. BP919387 - Show BP91938...is mRNA. clone: YMU001_000124_E09. Accession BP919387 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP919387|Adiantum capillus-veneris mRNA, clone: YMU001_000124... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919387|Adia

  9. AcEST: BP914444 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A03 493 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A03. BP914444... CL1628Contig1 Show BP914444 Clone id YMU001_000059_A03 Library YMU01 Length 493 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_A03. Accession BP914444 Tissue type prothallium Developmental stag...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914444... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914444|Adiantum capillus-veneri

  10. AcEST: BP918043 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A02 493 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A02. BP91804...3 CL3885Contig1 Show BP918043 Clone id YMU001_000109_A02 Library YMU01 Length 493 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000109_A02. Accession BP918043 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804

  11. AcEST: BP918040 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_H10 167 Adiantum capillus-veneris mRNA. clone: YMU001_000108_H10. BP918040 - Show BP91804...is mRNA. clone: YMU001_000108_H10. Accession BP918040 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918040|Adiantum capillus-veneris mRNA, clone: YMU001.... 25:3389-3402. Query= BP918040|Adiantum capillus-veneris mRNA, clone: YMU001_000108_H10. (167 letters) Data

  12. AcEST: BP911804 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_D03 453 Adiantum capillus-veneris mRNA. clone: YMU001_000009_D03. BP911804... CL245Contig1 Show BP911804 Clone id YMU001_000009_D03 Library YMU01 Length 453 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000009_D03. Accession BP911804 Tissue type prothallium Developmental stage...s Res. 25:3389-3402. Query= BP911804|Adiantum capillus-veneris mRNA, clone: YMU00... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911804|Adiantum capil

  13. AcEST: BP918044 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A03 150 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A03. BP918044 - Show BP91804...is mRNA. clone: YMU001_000109_A03. Accession BP918044 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918044|Adiantum cap

  14. AcEST: BP918047 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A06 349 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A06. BP91804...7 CL1525Contig1 Show BP918047 Clone id YMU001_000109_A06 Library YMU01 Length 349 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000109_A06. Accession BP918047 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918047|Adiantum capillus-veneris mRNA...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918047|Adian

  15. AcEST: BP918045 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A04 467 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A04. BP91804...5 CL1689Contig1 Show BP918045 Clone id YMU001_000109_A04 Library YMU01 Length 467 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000109_A04. Accession BP918045 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP918045|Adiantum capillus-ven...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918045|Adiantum capillus-veneris

  16. AcEST: BP918041 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_H11 404 Adiantum capillus-veneris mRNA. clone: YMU001_000108_H11. BP918041 - Show BP91804...is mRNA. clone: YMU001_000108_H11. Accession BP918041 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918041|Adiantum c...eic Acids Res. 25:3389-3402. Query= BP918041|Adiantum capillus-veneris mRNA, clone: YMU001_000108_H11. (404

  17. AcEST: BP918048 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A07 409 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A07. BP918048 - Show BP91804...is mRNA. clone: YMU001_000109_A07. Accession BP918048 Tissue type prothallium Developmental stage - Contig I...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804

  18. AcEST: BP918046 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A05 481 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A05. BP91804...6 CL10Contig1 Show BP918046 Clone id YMU001_000109_A05 Library YMU01 Length 481 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000109_A05. Accession BP918046 Tissue type prothallium Developmental stage ...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918046|Adi...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918046|Adiantum capillus-v

  19. AcEST: BP918049 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A08 458 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A08. BP91804...9 CL2636Contig1 Show BP918049 Clone id YMU001_000109_A08 Library YMU01 Length 458 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000109_A08. Accession BP918049 Tissue type prothallium Developmental stag...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918049|Adiantum capill...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918049|Adiantum ca

  20. AcEST: BP913036 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_F11 458 Adiantum capillus-veneris mRNA. clone: YMU001_000025_F11. BP913036 - Show BP91303...is mRNA. clone: YMU001_000025_F11. Accession BP913036 Tissue type prothallium Developmental stage - Contig I...25:3389-3402. Query= BP913036|Adiantum capillus-veneris mRNA, clone: YMU001_00002...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91303

  1. AcEST: BP913037 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_F12 436 Adiantum capillus-veneris mRNA. clone: YMU001_000025_F12. BP913037 - Show BP91303...is mRNA. clone: YMU001_000025_F12. Accession BP913037 Tissue type prothallium Developmental stage - Contig I...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91303...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913037|Adiantum capillus-veneris mR

  2. AcEST: BP912303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_E02 524 Adiantum capillus-veneris mRNA. clone: YMU001_000017_E02. BP912303 - Show BP912303...is mRNA. clone: YMU001_000017_E02. Accession BP912303 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP912303|Adiantum capillus-veneris mRNA, clone: YMU001_000017_E02. (524 l...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912303|Adiantum capillus-veneris mRNA, clon

  3. AcEST: BP921303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000148_B08 459 Adiantum capillus-veneris mRNA. clone: YMU001_000148_B08. BP921303 - Show BP921303...is mRNA. clone: YMU001_000148_B08. Accession BP921303 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP921303|Adiantum capillus-veneris mRNA, clone: YMU001_000148_B...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921303

  4. AcEST: BP913031 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_F06 302 Adiantum capillus-veneris mRNA. clone: YMU001_000025_F06. BP91303...1 CL1500Contig1 Show BP913031 Clone id YMU001_000025_F06 Library YMU01 Length 302 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000025_F06. Accession BP913031 Tissue type prothallium Developmental stag...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91303...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91303

  5. AcEST: BP913303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_G07 539 Adiantum capillus-veneris mRNA. clone: YMU001_000028_G07. BP913303 - Show BP913303...is mRNA. clone: YMU001_000028_G07. Accession BP913303 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913303...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913303

  6. AcEST: BP914303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_D07 644 Adiantum capillus-veneris mRNA. clone: YMU001_000057_D07. BP914303... CL2270Contig1 Show BP914303 Clone id YMU001_000057_D07 Library YMU01 Length 644 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000057_D07. Accession BP914303 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914303|Adiantum capillus-veneri...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914303

  7. AcEST: BP913038 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_G01 564 Adiantum capillus-veneris mRNA. clone: YMU001_000025_G01. BP91303...8 CL793Contig1 Show BP913038 Clone id YMU001_000025_G01 Library YMU01 Length 564 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000025_G01. Accession BP913038 Tissue type prothallium Developmental stage...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913038|Adiant...Nucleic Acids Res. 25:3389-3402. Query= BP913038|Adiantum capillus-veneris mRNA, clone: YMU001_000025_G01. (

  8. AcEST: BP918303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_H04 288 Adiantum capillus-veneris mRNA. clone: YMU001_000111_H04. BP918303 - Show BP918303...is mRNA. clone: YMU001_000111_H04. Accession BP918303 Tissue type prothallium Developmental stage - Contig I... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918303|Adiantum capillus-veneris mRNA, clone: YM...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918303|

  9. AcEST: BP919975 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_E02 472 Adiantum capillus-veneris mRNA. clone: YMU001_000131_E02. BP919975 - Show BP919975...is mRNA. clone: YMU001_000131_E02. Accession BP919975 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP919975|Adiantum capillus-veneris mRNA, clone: YMU...cids Res. 25:3389-3402. Query= BP919975|Adiantum capillus-veneris mRNA, clone: YM

  10. AcEST: BP920157 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G01 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G01. BP92015...7 CL541Contig1 Show BP920157 Clone id YMU001_000133_G01 Library YMU01 Length 550 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_G01. Accession BP920157 Tissue type prothallium Developmental stage...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920157|Adiantum capillus-veneris mRNA,...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920157|Adiantum capillus-veneris

  11. AcEST: BP920152 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F06 457 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F06. BP920152 - Show BP92015...is mRNA. clone: YMU001_000133_F06. Accession BP920152 Tissue type prothallium Developmental stage - Contig I...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920152|Adiantu...Res. 25:3389-3402. Query= BP920152|Adiantum capillus-veneris mRNA, clone: YMU001_

  12. AcEST: BP920159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G03 420 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G03. BP920159 - Show BP92015...is mRNA. clone: YMU001_000133_G03. Accession BP920159 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92015... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92015

  13. AcEST: BP920153 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F08 540 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F08. BP920153 - Show BP92015...is mRNA. clone: YMU001_000133_F08. Accession BP920153 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920153|Adiantum capillus-veneris mRNA, clone: YMU...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920153|Adiantum capillus-ve

  14. AcEST: BP920156 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F12 587 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F12. BP92015...6 CL200Contig1 Show BP920156 Clone id YMU001_000133_F12 Library YMU01 Length 587 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_F12. Accession BP920156 Tissue type prothallium Developmental stage...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920156...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920156|Adiantum

  15. AcEST: BP920150 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F04 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F04. BP920150 - Show BP92015...is mRNA. clone: YMU001_000133_F04. Accession BP920150 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920150|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F04. (550 lette...c Acids Res. 25:3389-3402. Query= BP920150|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F04. (550 le

  16. AcEST: BP921010 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E04 526 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E04. BP921010 - Show BP921010...is mRNA. clone: YMU001_000144_E04. Accession BP921010 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA...programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA, clone: YMU001_000...002030-PA (Fragment) OS=Anopheles gambiae GN=AGAP002030 PE=4 SV=4 Length = 2210 S

  17. AcEST: BP915100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000066_E04 551 Adiantum capillus-veneris mRNA. clone: YMU001_000066_E04. BP915100... CL3103Contig1 Show BP915100 Clone id YMU001_000066_E04 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000066_E04. Accession BP915100 Tissue type prothallium Developmental stag...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915100|Adiantum capillu...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP915100|Adiantum capillus-veneris mRNA, clone: YMU001

  18. AcEST: BP919100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_C03 561 Adiantum capillus-veneris mRNA. clone: YMU001_000121_C03. BP919100 - Show BP919100...is mRNA. clone: YMU001_000121_C03. Accession BP919100 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP919100|Adiantum capillus-veneris mRNA, clone: YMU001_000121_C03. (5...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919100

  19. AcEST: BP921006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D12 494 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D12. BP921006 - Show BP92100...is mRNA. clone: YMU001_000144_D12. Accession BP921006 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921006|Adiantum capillus-...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP921006|Adiantum capillus-veneris mRNA, clone: YMU001_

  20. AcEST: BP917100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_H06 514 Adiantum capillus-veneris mRNA. clone: YMU001_000095_H06. BP917100 - Show BP917100...is mRNA. clone: YMU001_000095_H06. Accession BP917100 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917100|... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917100

  1. AcEST: BP917432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_G02 450 Adiantum capillus-veneris mRNA. clone: YMU001_000100_G02. BP917432... CL1686Contig1 Show BP917432 Clone id YMU001_000100_G02 Library YMU01 Length 450 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_G02. Accession BP917432 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP917432|Adiantum capillus-veneris mRNA, clone: Y...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917432|Adiantum capillu

  2. AcEST: BP914326 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F07 599 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F07. BP91432...6 CL274Contig1 Show BP914326 Clone id YMU001_000057_F07 Library YMU01 Length 599 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000057_F07. Accession BP914326 Tissue type prothallium Developmental stage...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914326...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  3. AcEST: BP914321 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F02. BP914321 - Show BP91432...is mRNA. clone: YMU001_000057_F02. Accession BP914321 Tissue type prothallium Developmental stage - Contig I... 25:3389-3402. Query= BP914321|Adiantum capillus-veneris mRNA, clone: YMU001_000057_F02. (534 letters) Datab...leic Acids Res. 25:3389-3402. Query= BP914321|Adiantum capillus-veneris mRNA, clone: YMU001_000057_F02. (534

  4. AcEST: BP914432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_G12 488 Adiantum capillus-veneris mRNA. clone: YMU001_000058_G12. BP914432... CL2573Contig1 Show BP914432 Clone id YMU001_000058_G12 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000058_G12. Accession BP914432 Tissue type prothallium Developmental stag...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914432|...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914432|Adiantum ca

  5. AcEST: BP914324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F05 457 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F05. BP91432...4 CL2609Contig1 Show BP914324 Clone id YMU001_000057_F05 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000057_F05. Accession BP914324 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914324|Adiantum capillus-vener...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  6. AcEST: BP913432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000030_B10 512 Adiantum capillus-veneris mRNA. clone: YMU001_000030_B10. BP913432 - Show BP913432...is mRNA. clone: YMU001_000030_B10. Accession BP913432 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913432|Adiantum ... TY A +T+C Sbjct: 1417 TTVSPKTYTTATVTQC 1432 >sp|Q6ZRP5|YD019_HUMAN Putative uncharacterized protein FLJ4620...ucleic Acids Res. 25:3389-3402. Query= BP913432|Adiantum capillus-veneris mRNA, clone: YMU001_000030_B10. (5

  7. AcEST: BP914328 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F09 454 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F09. BP914328 - Show BP91432...is mRNA. clone: YMU001_000057_F09. Accession BP914328 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  8. AcEST: BP914320 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F01 393 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F01. BP914320 - Show BP91432...is mRNA. clone: YMU001_000057_F01. Accession BP914320 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914320|Adiantum capillus-veneris mRNA, clone: Y...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  9. AcEST: BP920432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000137_A06 513 Adiantum capillus-veneris mRNA. clone: YMU001_000137_A06. BP920432 - Show BP920432...is mRNA. clone: YMU001_000137_A06. Accession BP920432 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920432...eic Acids Res. 25:3389-3402. Query= BP920432|Adiantum capillus-veneris mRNA, clone: YMU001_000137_A06. (513

  10. AcEST: BP921521 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000150_H10 495 Adiantum capillus-veneris mRNA. clone: YMU001_000150_H10. BP921521... CL1722Contig1 Show BP921521 Clone id YMU001_000150_H10 Library YMU01 Length 495 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000150_H10. Accession BP921521 Tissue type prothallium Developmental stag... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921521...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921521|Adia

  11. AcEST: BP921219 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B05 600 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B05. BP92121...9 CL3191Contig1 Show BP921219 Clone id YMU001_000147_B05 Library YMU01 Length 600 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000147_B05. Accession BP921219 Tissue type prothallium Developmental stag...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921219|Adiantum capillus-...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121

  12. AcEST: BP921216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B01 347 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B01. BP921216 - Show BP92121...is mRNA. clone: YMU001_000147_B01. Accession BP921216 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP921216|Adiantum capillus-veneris mRNA, clone: YMU001_00...tities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 116 LLQTLIVTGYISFDEHLHNPHLSKHSALHITK 21 L LI...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121

  13. AcEST: BP921211 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A08 189 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A08. BP921211 - Show BP92121...is mRNA. clone: YMU001_000147_A08. Accession BP921211 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921211|Adiantum capillus-veneris... 25:3389-3402. Query= BP921211|Adiantum capillus-veneris mRNA, clone: YMU001_000147_A08. (189 letters) Datab

  14. AcEST: BP921821 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_E10 497 Adiantum capillus-veneris mRNA. clone: YMU001_000154_E10. BP921821 - Show BP921821...is mRNA. clone: YMU001_000154_E10. Accession BP921821 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921821|Adiantum capill...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921821|Adiantum capillus-veneris mRNA, clone: Y...ct: 159 PTSLIQPSIVTSKKEETGIDEIIRGMRDLQIKFAKLEEKGQSPRISTKQKPRLMEGVVHR 218 Query: 237 CIWCDSTDHGRRDC 196 C+WCD+ DH RR+C Sbjct: 21

  15. AcEST: BP921021 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_F03 449 Adiantum capillus-veneris mRNA. clone: YMU001_000144_F03. BP921021... CL4025Contig1 Show BP921021 Clone id YMU001_000144_F03 Library YMU01 Length 449 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_F03. Accession BP921021 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP921021|Adiantum capillus-veneris mRNA, clone: Y...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921021|Adiantum capillus-veneris mRN

  16. AcEST: BP915471 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_A04 434 Adiantum capillus-veneris mRNA. clone: YMU001_000072_A04. BP91547...1 CL1398Contig1 Show BP915471 Clone id YMU001_000072_A04 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000072_A04. Accession BP915471 Tissue type prothallium Developmental stag...ids Res. 25:3389-3402. Query= BP915471|Adiantum capillus-veneris mRNA, clone: YMU...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915471|Adiantum capi

  17. AcEST: BP917547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000102_C04 141 Adiantum capillus-veneris mRNA. clone: YMU001_000102_C04. BP917547 - Show BP917547...is mRNA. clone: YMU001_000102_C04. Accession BP917547 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917547|Adiantum c...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25...:3389-3402. Query= BP917547|Adiantum capillus-veneris mRNA, clone: YMU001_000102_

  18. AcEST: BP915473 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_A06 573 Adiantum capillus-veneris mRNA. clone: YMU001_000072_A06. BP91547...3 CL1347Contig1 Show BP915473 Clone id YMU001_000072_A06 Library YMU01 Length 573 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000072_A06. Accession BP915473 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915473|Adiantu... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915473|Adiantum capillus-ven

  19. AcEST: BP919547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_D03 369 Adiantum capillus-veneris mRNA. clone: YMU001_000126_D03. BP919547... CL894Contig1 Show BP919547 Clone id YMU001_000126_D03 Library YMU01 Length 369 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000126_D03. Accession BP919547 Tissue type prothallium Developmental stage... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919547...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919547

  20. AcEST: BP911547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000006_C03 552 Adiantum capillus-veneris mRNA. clone: YMU001_000006_C03. BP911547 - Show BP911547...is mRNA. clone: YMU001_000006_C03. Accession BP911547 Tissue type prothallium Developmental stage - Contig I...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911547...ms, Nucleic Acids Res. 25:3389-3402. Query= BP911547|Adiantum capillus-veneris mRNA, clone: YMU001_000006_C0

  1. AcEST: BP915475 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_A08 272 Adiantum capillus-veneris mRNA. clone: YMU001_000072_A08. BP915475 - Show BP91547...is mRNA. clone: YMU001_000072_A08. Accession BP915475 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP915475|Adiantum capillus-veneris mRNA, clone: YMU001_000072_A08. (259 letters) Data...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91547

  2. AcEST: BP915479 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_B02 372 Adiantum capillus-veneris mRNA. clone: YMU001_000072_B02. BP915479 - Show BP91547...is mRNA. clone: YMU001_000072_B02. Accession BP915479 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915479|Adiantum capillus-vener... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91547

  3. AcEST: BP915547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_H06 457 Adiantum capillus-veneris mRNA. clone: YMU001_000072_H06. BP915547... CL3574Contig1 Show BP915547 Clone id YMU001_000072_H06 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000072_H06. Accession BP915547 Tissue type prothallium Developmental stag...ams, Nucleic Acids Res. 25:3389-3402. Query= BP915547|Adiantum capillus-veneris m...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915547|Ad

  4. AcEST: BP920127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D02 541 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D02. BP92012...7 CL3843Contig1 Show BP920127 Clone id YMU001_000133_D02 Library YMU01 Length 541 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_D02. Accession BP920127 Tissue type prothallium Developmental stag...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adian

  5. AcEST: BP920124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C09 380 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C09. BP920124 - Show BP92012...is mRNA. clone: YMU001_000133_C09. Accession BP920124 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920124|Adiantum capillus-veneris ...ic Acids Res. 25:3389-3402. Query= BP920124|Adiantum capillus-veneris mRNA, clone: YMU001_000133_C09. (380 l

  6. AcEST: BP920125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C12 422 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C12. BP920125 - Show BP92012...is mRNA. clone: YMU001_000133_C12. Accession BP920125 Tissue type prothallium Developmental stage - Contig I...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012

  7. AcEST: BP921260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_F02 609 Adiantum capillus-veneris mRNA. clone: YMU001_000147_F02. BP921260 - Show BP921260...is mRNA. clone: YMU001_000147_F02. Accession BP921260 Tissue type prothallium Developmental stage - Contig I...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921260...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP921260|Adiantum capillus-vener

  8. AcEST: BP913260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_C08 256 Adiantum capillus-veneris mRNA. clone: YMU001_000028_C08. BP913260 - Show BP913260...is mRNA. clone: YMU001_000028_C08. Accession BP913260 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913260|Adiantum capillus-veneris mRNA, clone: YMU00...25:3389-3402. Query= BP913260|Adiantum capillus-veneris mRNA, clone: YMU001_000028_C08. (256 letters) Databa

  9. AcEST: BP912607 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H02 459 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H02. BP912607 - Show BP91260...is mRNA. clone: YMU001_000020_H02. Accession BP912607 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912607|Adiantum capill...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91260

  10. AcEST: BP912604 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G11 244 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G11. BP912604 - Show BP91260...is mRNA. clone: YMU001_000020_G11. Accession BP912604 Tissue type prothallium Developmental stage - Contig I...s, Nucleic Acids Res. 25:3389-3402. Query= BP912604|Adiantum capillus-veneris mRNA, clone: YMU001_000020_G11...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91260

  11. AcEST: BP919260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000123_A09 469 Adiantum capillus-veneris mRNA. clone: YMU001_000123_A09. BP919260 - Show BP919260...is mRNA. clone: YMU001_000123_A09. Accession BP919260 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919260|Adiantum capillu...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919260...ed signal transduction protein OS=Uncultured methanogenic archaeon RC-I GN=UNCMA_12260

  12. AcEST: BP912605 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G12 437 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G12. BP91260...5 CL1961Contig1 Show BP912605 Clone id YMU001_000020_G12 Library YMU01 Length 437 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000020_G12. Accession BP912605 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91260...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912605|Adiantum capillus-veneris mRNA, clone: YMU001_000020_G

  13. AcEST: BP912608 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H03 451 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H03. BP912608 - Show BP91260...is mRNA. clone: YMU001_000020_H03. Accession BP912608 Tissue type prothallium Developmental stage - Contig I...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91260...programs, Nucleic Acids Res. 25:3389-3402. Query= BP912608|Adiantum capillus-veneris mRNA, clone: YMU001_000

  14. AcEST: BP916260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000085_C09 277 Adiantum capillus-veneris mRNA. clone: YMU001_000085_C09. BP916260 - Show BP916260...is mRNA. clone: YMU001_000085_C09. Accession BP916260 Tissue type prothallium Developmental stage - Contig I...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916260|Adiantum capillus-vene...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916260

  15. AcEST: BP912600 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G07 375 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G07. BP91260...0 CL1497Contig1 Show BP912600 Clone id YMU001_000020_G07 Library YMU01 Length 375 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000020_G07. Accession BP912600 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912600|Adiantum capillus-vener...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912600|Adiantum capillus-vener

  16. AcEST: BP912601 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G08 479 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G08. BP912601 - Show BP91260...is mRNA. clone: YMU001_000020_G08. Accession BP912601 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912601|Adiantum capillus-veneris m...ids Res. 25:3389-3402. Query= BP912601|Adiantum capillus-veneris mRNA, clone: YMU...SG-DTEDIHYQTITGLRKDLSGPSQEPSILTEQAIEDDSED 415 Query: 298 FLPVKANDQADDE 260 +++D +D E Sbjct: 416 SSSTESSDDSDT

  17. AcEST: BP920400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_F07 401 Adiantum capillus-veneris mRNA. clone: YMU001_000136_F07. BP920400 - Show BP920400...is mRNA. clone: YMU001_000136_F07. Accession BP920400 Tissue type prothallium Developmental stage - Contig I...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920400|Adi...ery: 234 EVEDYAVRLERGLNHYGRWDSLLTRLAIDNGDCSKISSEDL 356 E+ Y + G N+ D+ +TRL I D SK+ +DL Sbjct: 400 EIAPYIITAL...ids Res. 25:3389-3402. Query= BP920400|Adiantum capillus-veneris mRNA, clone: YMU001_000136_F07. (401 letter

  18. AcEST: BP914009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G12. BP914009 - Show BP91400...is mRNA. clone: YMU001_000038_G12. Accession BP914009 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914009|Adiantum ca...programs, Nucleic Acids Res. 25:3389-3402. Query= BP914009|Adiantum capillus-veneris mRNA, clone: YMU001_000

  19. AcEST: BP914005 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G08 416 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G08. BP914005 - Show BP91400...is mRNA. clone: YMU001_000038_G08. Accession BP914005 Tissue type prothallium Developmental stage - Contig I...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91400...s Res. 25:3389-3402. Query= BP914005|Adiantum capillus-veneris mRNA, clone: YMU001_000038_G08. (416 letters)

  20. AcEST: BP914400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E03 571 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E03. BP914400 - Show BP914400...is mRNA. clone: YMU001_000058_E03. Accession BP914400 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914400|Adiantum capillus-veneris mRNA, clone... OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 Length = 697 Score = 158 bits (400), Expect = 2e-38 Identities = 70...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914400

  1. AcEST: BP914004 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G07 450 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G07. BP914004 - Show BP91400...is mRNA. clone: YMU001_000038_G07. Accession BP914004 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP914004|Adiantum capillus-veneris mRNA, clo...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914004|Adiantum capillus-veneris mRN

  2. AcEST: BP915400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B04 438 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B04. BP915400 - Show BP915400...is mRNA. clone: YMU001_000071_B04. Accession BP915400 Tissue type prothallium Developmental stage - Contig I... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915400...ucleic Acids Res. 25:3389-3402. Query= BP915400|Adiantum capillus-veneris mRNA, c

  3. AcEST: BP918400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A11 368 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A11. BP918400 - Show BP918400...is mRNA. clone: YMU001_000113_A11. Accession BP918400 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918400|Adiantum capillus-veneris mRNA, clone: YMU001_000113_A1...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918400

  4. AcEST: BP914000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G03 555 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G03. BP914000 - Show BP91400...is mRNA. clone: YMU001_000038_G03. Accession BP914000 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP914000|Adiantum capillus-veneris mRNA, clone: YMU001_000038_G03. (5...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914000|Adiantum capil

  5. AcEST: BP914002 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G05. BP91400...2 CL1073Contig1 Show BP914002 Clone id YMU001_000038_G05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000038_G05. Accession BP914002 Tissue type prothallium Developmental stag... Nucleic Acids Res. 25:3389-3402. Query= BP914002|Adiantum capillus-veneris mRNA, clone: YMU001_000038_G05. ...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91400

  6. AcEST: BP912400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F03 584 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F03. BP912400 - Show BP912400...is mRNA. clone: YMU001_000018_F03. Accession BP912400 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP912400|Adiantum capillus-veneris mRNA, clone: YMU001_000018_F03. (... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912400...ASYGVFEGEGEYYGGRE 1233 Query: 400 GPSRTQWFRASPDGTQREIKGATGDRYTCQTEDLDAFLCVSYEPVRS

  7. AcEST: BP917400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D03 356 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D03. BP917400 - Show BP917400...is mRNA. clone: YMU001_000100_D03. Accession BP917400 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP917400|Adiantum capillus-veneris mRNA, clone: YMU001_000100_D03. (356 l...cids Res. 25:3389-3402. Query= BP917400|Adiantum capillus-veneris mRNA, clone: YMU001_000100_D03. (356 lette

  8. AcEST: BP919218 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E11 400 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E11. BP919218 - Show BP91921...is mRNA. clone: YMU001_000122_E11. Accession BP919218 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919218|Adiantum capillus-ven...leic Acids Res. 25:3389-3402. Query= BP919218|Adiantum capillus-veneris mRNA, clo

  9. AcEST: BP919216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E09 388 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E09. BP919216 - Show BP91921...is mRNA. clone: YMU001_000122_E09. Accession BP919216 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919216|Adiantum cap...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919216|Adiantum capillus-veneris

  10. AcEST: BP919213 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E06 293 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E06. BP919213 - Show BP91921...is mRNA. clone: YMU001_000122_E06. Accession BP919213 Tissue type prothallium Developmental stage - Contig I...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919213|Adiantu...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91921

  11. AcEST: BP919211 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E04 158 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E04. BP919211 - Show BP91921...is mRNA. clone: YMU001_000122_E04. Accession BP919211 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP919211|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E04. (1...Nucleic Acids Res. 25:3389-3402. Query= BP919211|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E04. (

  12. AcEST: BP919217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E10 547 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E10. BP91921...7 CL1907Contig1 Show BP919217 Clone id YMU001_000122_E10 Library YMU01 Length 547 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000122_E10. Accession BP919217 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919217|Adiantum capillus-ven...ds Res. 25:3389-3402. Query= BP919217|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E10. (547 letters

  13. AcEST: BP920174 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H08 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H08. BP920174 - Show BP92017...is mRNA. clone: YMU001_000133_H08. Accession BP920174 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017

  14. AcEST: BP912017 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A11 578 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A11. BP912017... CL1368Contig1 Show BP912017 Clone id YMU001_000012_A11 Library YMU01 Length 578 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A11. Accession BP912017 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912017|Adiant...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912017|Adiantum capillus-veneris mRNA

  15. AcEST: BP920171 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H05 509 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H05. BP920171 - Show BP92017...is mRNA. clone: YMU001_000133_H05. Accession BP920171 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017...s. 25:3389-3402. Query= BP920171|Adiantum capillus-veneris mRNA, clone: YMU001_000133_H05. (509 letters) Dat

  16. AcEST: BP920175 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H09 490 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H09. BP920175 - Show BP92017...is mRNA. clone: YMU001_000133_H09. Accession BP920175 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920175|Adiantum

  17. AcEST: BP920178 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A02 473 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A02. BP920178 - Show BP92017...is mRNA. clone: YMU001_000134_A02. Accession BP920178 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017... Res. 25:3389-3402. Query= BP920178|Adiantum capillus-veneris mRNA, clone: YMU001_000134_A02. (473 letters)

  18. AcEST: BP920179 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A03 487 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A03. BP92017...9 CL3508Contig1 Show BP920179 Clone id YMU001_000134_A03 Library YMU01 Length 487 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_A03. Accession BP920179 Tissue type prothallium Developmental stag...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920179|Adiantum ca...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017

  19. AcEST: BP917177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_C05 471 Adiantum capillus-veneris mRNA. clone: YMU001_000097_C05. BP917177 - Show BP91717...is mRNA. clone: YMU001_000097_C05. Accession BP917177 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917177|Adiantum capillus-veneris mRNA, clone: YMU...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917

  20. AcEST: BP917117 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000096_B11 125 Adiantum capillus-veneris mRNA. clone: YMU001_000096_B11. BP917117... CL2704Contig1 Show BP917117 Clone id YMU001_000096_B11 Library YMU01 Length 125 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000096_B11. Accession BP917117 Tissue type prothallium Developmental stag...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917117...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917117