WorldWideScience

Sample records for receptor da histamina

  1. Efeito analgésico de antagonistas do receptor da histamina H1 em modelo de dor provocada por formalina em ratos Efecto analgésico de antagonistas del receptor de la histamina H1 en un modelo de dolor provocado por formalina en ratones Analgesic effects of H1 receptor antagonists in the rat model of formalin-induced pain

    Directory of Open Access Journals (Sweden)

    Hazem Adel Ashmawi

    2009-08-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Os receptores de histamina mediam vias nociceptivas principalmente no sistema nervoso central. Alguns estudos mostraram efeito analgésico de antagonistas de receptor de histamina no sistema nervoso periférico. Não está claro se o efeito analgésico local é classe específico ou droga específico. MÉTODO: Para responder a essa questão, utilizamos três diferentes antagonistas do receptor H1 (pirilamina, prometazina e cetirizina administrados diretamente na pata do rato, pela via intraperitoneal ou por bloqueio de nervo periférico em modelo de dor induzida por formalina. Observamos o efeito das drogas no comportamento do número de elevações da pata. RESULTADOS: Na fase I, a pirilamina local diminuiu o número de elevações da pata de forma dose-dependente. Na dose mais alta, a diminuição foi de 97,8%. Para a prometazina, a diminuição foi de 92% e para cetizirina, 23,9%. Na fase II, a pirilamina diminuiu o número de elevações da pata em 93,5%, a prometazina em 78,2% e a cetirizina em 80,1%. A administração dos fármacos por via intraperitoneal não alterou o comportamento doloroso. Quando utilizadas para bloqueio de nervo periférico, na fase I, a pirilamina diminuiu o número de elevações da pata em 96,7%, a prometazina em 73,3% e a cetirizina em 23,9%. Na fase II, a pirilamina levou à diminuição de 86,6%, a prometazina de 64,4% e a cetirizina de 19,9%. CONCLUSÕES: Os resultados mostraram que os antagonistas de receptor da histamina H1 apresentam efeitos analgésicos locais, diferentes do efeito sistêmico, sendo um deles anti-inflamatório e classe específico e o outro específico para prometazina e pirilamina, semelhante a efeito clínico anestésico local.JUSTIFICATIVA Y OBJETIVOS: Los receptores de histamina intermedian las vías nociceptivas, principalmente en el sistema nervioso central. Algunos estudios arrojaron un efecto analgésico de antagonistas de receptor de histamina en el

  2. Histamina, receptores de histamina e anti-histamínicos: novos conceitos Histamine, histamine receptors and antihistamines: new concepts

    Directory of Open Access Journals (Sweden)

    Paulo Ricardo Criado

    2010-04-01

    Full Text Available As drogas com ação anti-histamínica estão entre as medicações mais comumente prescritas na prática dermatológica diária, tanto em adultos como em crianças. Este artigo aborda os novos conceitos da função dos receptores de histamina (receptores H1 e discute os efeitos anti-inflamatórios dessas drogas. A segunda geração de anti-histamínicos difere da primeira geração devido a sua elevada especificidade e afinidade pelos receptores H1 periféricos e devido a seu menor efeito no sistema nervoso central, tendo como resultado menores efeitos sedativos. Embora a eficácia dos diferentes anti-histamínicos H1 (anti-H1 no tratamento de doentes alérgicos seja similar, mesmo quando se comparam anti-H1 de primeira e de segunda geração, eles são muito diferentes em termos de estrutura química, farmacologia e propriedades tóxicas. Consequentemente o conhecimento de suas características farmacocinéticas e farmacodinâmicas é importante para a melhor prática médica, especialmente em gestantes, crianças, idosos e doentes com comorbidades.Drugs with antihistamine action are the most commonly prescribed medication in daily dermatologic practice, both to adults and children. This article addresses new concepts of the role of histamine receptors (H1 receptors and discusses the anti-inflammatory effects of these drugs. Second generation antihistamines differs from first generation because of their high specificity and affinity for peripheral H1-receptors. Second generation antihistamines are also less likely to produce sedation because they have less effect on the central nervous system. Although the efficacy of the various H1-antihistamines in the treatment of allergic patients is similar, even when comparing first- and second-generation drugs, these drugs are still very different in terms of their chemical structure, pharmacology and toxic properties. Consequently, knowledge of their pharmacokinetic and pharmacodynamic characteristics

  3. HISTAMINE IN CANNED SARDINES HISTAMINA EM CONSERVAS DE SARDINHA

    Directory of Open Access Journals (Sweden)

    Fancislene Bernardes Tebalti do Carmo

    2010-04-01

    Full Text Available In this study, the presence of histamine in 122 samples of canned sardines produced with three different species by three industries located in the municipalities of Sao Goncalo and Niteroi was evaluated. The samples were divided into five lots with copies of sardines from Venezuela (Sardinella aurita, Morocco (S. pilchardus and Brazil (S. brasiliensis. The initial quality of raw material was evaluated by sensorial parameters and by the histamine level using a semi-quantitative method of thin-layer chromatography. The results of the samples from Venezuela and Morocco showed values below 5 mg/100g, and the national samples showed values similar or greater than 10 mg/100g. It follows that there is need for greater control and monitoring of temperature from capture to processing, to guarantee good quality to the final product, and to avoid risk of poisoning to the consumer.

    KEY WORDS: Canned fish, histamine, quality, sardines.

    O presente estudo avaliou a presença de histamina em 122 amostras de sardinha em conserva, produzidas com três diferentes espécies, por três indústrias, localizadas nos municípios de São Gonçalo e Niterói. As amostras foram divididas em cinco lotes com exemplares de sardinhas provenientes da Venezuela (Sardinella aurita, Marrocos (S. pilchardus e do Brasil (S. brasiliensis. Avaliou-se a qualidade inicial da matéria-prima por meio de parâmetros sensoriais e pelo teor de histamina utilizando-se o método de cromatografia em camada delgada. As amostras oriundas da Venezuela e Marrocos apresentaram valores abaixo de 5 mg/100 g e as nacionais, valores semelhantes ou superiores a 10 mg/100g. Conclui-se que há necessidade de um maior controle e monitorização da temperatura da sardinha desde a captura até o processamento, para que o produto final apresente boa qualidade e não represente perigo de intoxicação ao consumidor.

    PALAVRAS-CHAVES: Conserva, histamina, qualidade, sardinha.

  4. Inhibición de la síntesis de neurotransmisor en neuronas dopaminérgicas de los ganglios basales. Localización celular del receptor H3 de histamina

    OpenAIRE

    González Sepúlveda, Marta

    2011-01-01

    En esta tesis se pretende aportar datos experimentales que ayuden a comprender las interacciones entre el sistema neuronal histaminérgico y otros sistemas de neurotransmisores presentes en los ganglios basales, particularmente el dopaminérgico. Dicho conocimiento podría ayudar a paliar patologías tales como la adicción a drogas de abuso, la esquizofrenia o la enfermedad de Parkinson. Al intentar estudiar efectos de ligandos de receptores sobre la síntesis de dopamina nos encont...

  5. TEORES DE HISTAMINA E QUALIDADE FÍSICO-QUÍMICA E SENSORIAL DE FILÉ DE PEIXE CONGELADO HISTAMINE LEVELS AND PHYSICO-CHEMICAL AND SENSORY QUALITY OF FROZEN FISH FILLET

    Directory of Open Access Journals (Sweden)

    Valéria F. M. SOARES

    1998-10-01

    Full Text Available A qualidade de 120 amostras de diferentes tipos de filé de peixe congelado foi avaliada com relação às características sensoriais, pH, teores de bases voláteis totais e histamina e presença de gás sulfídrico. Os resultados da análise sensorial indicaram boa qualidade dos peixes com valores médios de 5,52 (CV £ 13% tanto para odor quanto para aspecto geral. Com relação a bases voláteis totais (BVT, teores médios de 62,71 mg N/100 g foram encontrados, com valores significativamente maiores (> 80 mg N/100 g para namorado (Pseudopercis numida e cação (famílias Carcharhinidae e Squalidae e menores que 68 mg N/100 g para os demais tipos de peixe. Os valores médios de pH variaram de 6,11 em abrótea (Urophycis brasiliensis a 7,49 em castanha (Umbrina sp.. Baseado nestes resultados, 79, 39 e 62% das amostras não atenderiam aos limites estipulados pela legislação vigente para BVT, pH e gás sulfídrico, respectivamente. Histamina foi encontrada em 37% das amostras com teores médios de 0,00 para linguado (Paralichthys sp. e Pleuronectes sp. a 0,50 mg/100 g para namorado. A presença de histamina não foi detectada em abrótea. Foram observadas diferenças significativa entre os valores de BVT, pH e histamina das amostras de peixe agrupadas por famílias. Para uma melhor avaliação do potencial de utilização e estabelecimento de limites críticos para estes parâmetros como critério de qualidade, sugere-se que amostras sejam monitoradas desde o momento da captura. Os teores de histamina detectados nas amostras não seriam, por si só, capazes de causar intoxicação.The quality of 120 samples of different types of frozen fish fillet was evaluated with respect to sensory characteristics, pH, levels of total volatile basis, histamine and presence of sulfidric gas. The results from the sensory evaluation indicated good quality with scores of 5.52 (CV £ 13% for both odor and general aspects. With respect to total volatile bases

  6. Histamine combined with melphalan in isolated limb perfusion for the treatment of locally advanced soft tissue sarcomas: preclinical studies in rats Histamina combinada ao melfalano na perfusão de membro isolado para o tratamento de sarcomas de partes moles localmente avançado: estudos pré-clínicos em ratos

    Directory of Open Access Journals (Sweden)

    Flavia Brunstein

    2005-08-01

    Full Text Available PURPOSE: To evaluate the potential benefit of histamine combined with melphalan in the isolated limb perfusion (ILP as an alternative to TNF-alfa and melphalan combination, for the treatment of irressectable soft tissue sarcomas of the limbs in Brown Norway (BN rats. METHODS: 20 BN rats had small fragments of syngeneic BN-175 fibosarcoma inserted on the right hind limb. In 7-10 days the tumor reached a median diameter of 12-15 mm and they were randomly divided in four groups (sham, melphalan, histamine and escalating doses of histamine combined to melphalan being submitted to experimental ILP for 30 minutes. Tumors were measured daily with a caliper and the volume was calculated. RESULTS: Response curves showed a significant effect of the combination of histamine 200 mg/mL with melphalan, with 66% overall response, including 33% complete responses (pOBJETIVO: Avaliar o potencial benéfico da histamina combinada ao melfalano, na perfusão de membro isolado (PMI, como alternativa à combinação TNF-alfa mais melfalano, no tratamento de sarcomas de partes moles irressecaveis em extremidades, em ratos de linhagem Brown Norway (BN. MÉTODOS: 20 ratos BN foram submetidos a implantação de fragmentos de fibrosarcoma singênico BN-175 na pata traseira direita. Em cerca de 7-10 dias o tumor atingiu um diâmetro médio de 12-15 mm e foram aleatóriamente divididos em quatro grupos (controle, melfalano, histamina em doses progessivas combinada ao melfalano e histamina sendo submetidos a PMI experimental por 30 minutos. Os tumores foram então medidos diariamente com o uso de paquímetro e o volume tumoral calculado. RESULTADOS: As curvas de resposta mostram um efeito significativo da combinação de Histamina na concentração de 200 mg/mL ao melfalano, com 66% de resposta global incluindo 33% de respostas completas (p < 0.01. Não houve efeitos colaterais sistêmicos e localmente apenas edema leve e transitório nos animais tratados com histamine

  7. Disruption of the 37-kDa/67-kDa laminin receptor gene in bovine ...

    African Journals Online (AJOL)

    The 37-kDa/67-kDa laminin receptor (LRP/LR), also known as ribosomal protein SA (RPSA), acts as a cell surface receptor for prions and plays an important role in internalization of cellular prion protein. In this study, we knocked out the part of prion binding sites (aa 161-205) by gene targeting in the bovine fetal fibroblasts ...

  8. Aspectos clínicos y nutricionales de la intolerancia a la histamina en pacientes pediátricos con sintomatología digestiva crónica

    OpenAIRE

    Rosell Camps, Antonio

    2016-01-01

    INTRODUCCIÓN: La intolerancia a la histamina (IH) es una enfermedad poco estudiada, particularmente en pacientes pediátricos. El presente trabajo representa la serie más amplia de pacientes pediátricos con IH y el único que realiza un estudio nutricional de los pacientes. La IH se produce por una alteración en la capacidad de catabolizar la histamina ingerida con los alimentos, causada por una actividad reducida de la enzima diaminooxidasa (DAO). El consiguiente acúmulo histamínico puede c...

  9. PCSK9-mediated degradation of the LDL receptor generates a 17 kDa C-terminal LDL receptor fragment.

    Science.gov (United States)

    Tveten, Kristian; Strøm, Thea Bismo; Berge, Knut Erik; Leren, Trond P

    2013-06-01

    Proprotein convertase subtilisin/kexin type 9 (PCSK9) binds to the LDL receptor (LDLR) at the cell surface and reroutes the internalized LDLR to intracellular degradation. In this study, we have shown that PCSK9-mediated degradation of the full-length 160 kDa LDLR generates a 17 kDa C-terminal LDLR fragment. This fragment was not generated from mutant LDLRs resistant to PCSK9-mediated degradation or when degradation was prevented by chemicals such as ammonium chloride or the cysteine cathepsin inhibitor E64d. The observation that the 17 kDa fragment was only detected when the cells were cultured in the presence of the γ-secretase inhibitor DAPT indicates that this 17 kDa fragment undergoes γ-secretase cleavage within the transmembrane domain. The failure to detect the complementary 143 kDa ectodomain fragment is likely to be due to its rapid degradation in the endosomal lumen. The 17 kDa C-terminal LDLR fragment was also generated from a Class 5 mutant LDLR undergoing intracellular degradation. Thus, one may speculate that an LDLR with bound PCSK9 and a Class 5 LDLR with bound LDL are degraded by a similar mechanism that could involve ectodomain cleavage in the endosome.

  10. Heterómeros de receptores de dopamina. Nuevos mecanismos para la regulación de la transmisión dopaminérgica

    OpenAIRE

    Moreno Guillén, Estefanía

    2012-01-01

    [spa] El Objetivo General de esta Tesis ha sido investigar la formación y función de heterómeros entre receptores de dopamina y otros receptores que puedan estar implicados en la regulación de la transmisión dopaminérgica, como receptores de galanina, histamina, adrenérgicos o receptores sigma-1. Basándonos en que tanto la galanina como la dopamina modulan la liberación de acetilcolina en el hipocampo, se ha demostrado que los receptores de dopamina de la familia D1 (receptores D1 y D5) puede...

  11. Brain-specific interaction of a 91-kDa membrane-bound protein with the cytoplasmic tail of the 300-kDa mannose 6-phosphate receptor

    DEFF Research Database (Denmark)

    Rosorius, O; Issinger, O G; Braulke, T

    1996-01-01

    The cytoplasmic tail of the 300 kDa mannose 6-phosphate receptor (MPR 300-CT) is thought to play an important role in sorting and targeting of lysosomal enzymes and the insulin-like growth factor II along the biosynthetic and endocytic pathway. In this study a brain specific 91 kDa protein and a 35...... kDa protein salt-washed from membranes (referred as TIP 91-M and TIP 35-M) were found to interact with the cytoplasmic receptor tail as assayed by cross-linkage with recombinant [32P] labeled MPR 300-CT. Subcellular fractionation revealed a distinct pattern of distribution of TIP 35-M and TIP 91-M...... in microsomal and synaptosomal fractions. Furthermore, the formation of cross-link complexes with membrane proteins appeared to be developmentally and regionally regulated in the brain and inhibited upon ATP hydrolysis. The data suggest the requirement of specific protein interactions for MPR 300 functions...

  12. Reatividade vascular da artéria mamária interna: estudos farmacológicos comparativos entre artérias caninas direita e esquerda

    Directory of Open Access Journals (Sweden)

    EVORA Paulo Roberto B.

    1999-01-01

    Full Text Available Para estudos comparativos da reatividade vascular entre artéria mamária interna (AMI canina direita e esquerda, realizaram-se experimentos "in vitro" utilizando-se banhos orgânicos ("organ chambers" e ensaios biológicos: 1 os produtos plaquetários ADP e 5-HT induziram, respectivamente, vasodilatação dependente e independente do endotélio; 2 os autacóides, bradicinina e histamina, também induziram vasodilatação, respectivamente, dependente e independente do endotélio; 3 o A23187, vasodilatador independente de receptor, induziu relaxamentos dependentes do endotélio; 4 dopamina, dobutamina, papaverina e a poli-L-arginina induziram vasodilatações independentes do endotélio; 5 a NOR induziu intensa vasoconstrição comparável à causada pelo KCI e pela endotelina; 6 em 83% de 24 ensaios, a liberação basal de NO foi maior na AMI esquerda, em comparação com a AMI direita; 7 ensaios biológicos de AMIs demonstraram a importância da PGI2 nas condições de hipóxia, uma vez que a indometacina aboliu vasodilatação adicional em resposta à hipóxia em condições de vasodilatação induzida pela liberação basal de NO; 8 não ocorreram diferenças significantes de resposta, comparando-se estudos realizados em AMIs direita e esquerda.

  13. Green tea polyphenol EGCG sensing motif on the 67-kDa laminin receptor.

    Directory of Open Access Journals (Sweden)

    Yoshinori Fujimura

    Full Text Available BACKGROUND: We previously identified the 67-kDa laminin receptor (67LR as the cell-surface receptor conferring the major green tea polyphenol (--epigallocatechin-3-O-gallate (EGCG responsiveness to cancer cells. However, the underlying mechanism for interaction between EGCG and 67LR remains unclear. In this study, we investigated the possible role of EGCG-67LR interaction responsible for its bioactivities. METHODOLOGY/PRINCIPAL FINDINGS: We synthesized various peptides deduced from the extracellular domain corresponding to the 102-295 region of human 67LR encoding a 295-amino acid. The neutralizing activity of these peptides toward EGCG cell-surface binding and inhibition of cancer cell growth were assayed. Both activities were inhibited by a peptide containing the 10-amino acid residues, IPCNNKGAHS, corresponding to residues 161-170. Furthermore, mass spectrometric analysis revealed the formation of a EGCG-LR161-170 peptide complex. A study of the amino acid deletion/replacement of the peptide LR161-170 indicated that the 10-amino acid length and two basic amino acids, K(166 and H(169, have a critical role in neutralizing EGCG's activities. Moreover, neutralizing activity against the anti-proliferation action of EGCG was observed in a recombinant protein of the extracellular domain of 67LR, and this effect was abrogated by a deletion of residues 161-170. These findings support that the 10 amino-acid sequence, IPCNNKGAHS, might be the functional domain responsible for the anti-cancer activity of EGCG. CONCLUSIONS/SIGNIFICANCE: Overall, our results highlight the nature of the EGCG-67LR interaction and provide novel structural insights into the understanding of 67LR-mediated functions of EGCG, and could aid in the development of potential anti-cancer compounds for chemopreventive or therapeutic uses that can mimic EGCG-67LR interactions.

  14. Seventeen copies of the human 37 kDa laminin receptor precursor/p40 ribosome-associated protein gene are processed pseudogenes arisen from retropositional events

    DEFF Research Database (Denmark)

    Jackers, P; Clausse, N; Fernandez, M

    1996-01-01

    A cDNA coding for a 37 kDa polypeptide has been identified in several species as both the potential precursor of the 67 kDa laminin receptor (37LRP) and a putative ribosome-associated protein (p40). Interestingly, increased expression of this polypeptide (37LRP/p40) is consistently observed in in...

  15. Potencial envolvimento da adiponectina e seus receptores na modulação da esteroidogênese em corpo lúteo de cadelas ao longo do diestro

    Directory of Open Access Journals (Sweden)

    Vanessa U. Fonseca

    2012-10-01

    Full Text Available No ciclo estral de cadelas a fase luteínica, denominada diestro, compreende um período que varia de 60 a 100 dias em animais não-prenhes, caracterizado pela elevação plasmática de progesterona nos primeiros 20 dias pós ovulação (p.o. A adiponectina é a mais abundante proteína secretada pelo tecido adiposo, porém sua concentração plasmática diminui significativamente em alterações metabólicas como resistência insulínica e Diabetes mellitus tipo2, alterações descritas como relacionadas em algumas cadelas com o período de diestro. O objetivo do estudo foi determinar a expressão e imunolocalização do sistema adiponectina (adiponectina e seus receptores, adipoR1 e adipoR2 no corpo lúteo de cadelas ao longo do diestro, correlacionando-o ao perfil hormonal de 17β-estradiol e progesterona, assim como à expressão de um dos genes alvo do sistema, o PPAR-γ. Para realização do estudo foram coletados corpos lúteos de 28 cadelas durante ovariosalpingohisterectomia de eleição nos dias 10, 20, 30, 40, 50, 60 e 70 pós ovulação (o dia zero da ovulação foi considerado aquele no qual a concentração plasmática de progesterona atingiu 5ng/mL. Os corpos lúteos foram avaliados por imunohistoquímica para adiponectina e seus receptores e a expressão do RNAm do PPAR-γ por PCR em tempo real. A análise estatística da avaliação gênica foi realizada com o teste ANOVA, seguido por comparação múltipla Newman-Keuls. O sinal da adiponectina apresentou-se mais intenso até os primeiros 20 dias p.o, momento de regência da progesterona; houve queda gradativa após este período, coincidindo com a ascensão do 17β-estradiol, cujo pico foi notado próximo do dia 40 p.o. A queda marcante da adiponectina ocorreu após 50 dias p.o. O sinal do adipoR1 mostrou-se bem evidente até os 40 dias p.o e o do adipoR2 até os 50 dias p. o, decaindo posteriormente. Foi observada maior expressão do gene PPAR-γ aos 10, 30 e 70 dias p

  16. A 106-kDa aminopeptidase is a putative receptor for Bacillus thuringiensis Cry11Ba toxin in the mosquito Anopheles gambiae†

    OpenAIRE

    Zhang, Rui; Hua, Gang; Andacht, Tracy M.; Adang, Michael J.

    2008-01-01

    Bacillus thuringiensis (Bt)1 insecticidal toxins bind to receptors on midgut epithelial cells of susceptible insects, and binding triggers biochemical events that lead to insect mortality. Recently, a 100-kDa aminopeptidase N (APN) was isolated from brush border membrane vesicles (BBMV) of Anopheles quadrimaculatus and shown to bind Cry11Ba toxin with surface plasmon resonance (SPR) detection [Abdullah et al. (2006) BMC Biochemistry 7, 16]. In our study, a 106-kDa APN, called AgAPN2, released...

  17. Effects of the beta-adrenergic receptor antagonist Propranolol on dyskinesia and L-DOPA-induced striatal DA efflux in the hemi-parkinsonian rat

    Science.gov (United States)

    Bhide, Nirmal; Lindenbach, David; Barnum, Christopher J.; George, Jessica A.; Surrena, Margaret A.; Bishop, Christopher

    2015-01-01

    Dopamine (DA) replacement therapy with L-DOPA continues to be the primary treatment of Parkinson's disease; however, long-term therapy is accompanied by L-DOPA-induced dyskinesias (LID). Several experimental and clinical studies have established that Propranolol, a β-adrenergic receptor antagonist, reduces LID without affecting L-DOPA's efficacy. However, the exact mechanisms underlying these effects remain to be elucidated. The aim of the current study was to evaluate the anti-dyskinetic profile of Propranolol against a panel of DA replacement strategies, as well as elucidate the underlying neurochemical mechanisms. Results indicated that Propranolol, in a dose-dependent manner, reduced LID, without affecting motor performance. Propranolol failed to alter dyskinesia produced by the D1 receptor agonist, SKF81297 (0.08 mg/kg, sc), or the D2 receptor agonist, Quinpirole (0.05 mg/kg, sc). These findings suggested a presynaptic mechanism for Propranolol's anti-dyskinetic effects, possibly through modulating L-DOPA-mediated DA efflux. To evaluate this possibility, microdialysis studies were carried out in the DA-lesioned striatum of dyskinetic rats and results indicated that co-administration of Propranolol (20 mg/kg, ip) was able to attenuate L-DOPA- (6 mg/kg, sc) induced DA efflux. Therefore, Propranolol's anti-dyskinetic properties appear to be mediated via attenuation of L-DOPA-induced extraphysiological efflux of DA. PMID:25866285

  18. Characterization of phosphorylation sites in the cytoplasmic domain of the 300 kDa mannose-6-phosphate receptor

    DEFF Research Database (Denmark)

    Rosorius, O; Mieskes, G; Issinger, O G

    1993-01-01

    The human 300 kDa mannose-6-phosphate receptor (MPR 300) is phosphorylated in vivo at serine residues of its cytoplasmic domain. Two-dimensional separation can resolve tryptic phosphopeptides into four major species. To identify the kinases involved in MPR 300 phosphorylation...... kinases phosphorylate the cytoplasmic tail exclusively on serine residues. Inhibition studies using synthetic peptides, partial sequencing of isolated tryptic phosphopeptides and co-migration with tryptic phosphopeptides from MPR 300 labelled in vivo showed that (i) PKA phosphorylates the cytoplasmic MPR...... 300 domain at Ser20 and at a non-identified site, neither of which are phosphorylated in vivo, and that (ii) the two sites phosphorylated by CK II in vivo and in vitro are Ser82 and Ser157. The results indicate that the human MPR 300 is a physiological substrate of either CK II or a related kinase...

  19. Tratamento da doença de Meige com droga agonista de receptores GABA

    Directory of Open Access Journals (Sweden)

    Luiz Augusto Franco de Andrade

    1985-09-01

    Full Text Available A doença de Meige é distúrbio de movimento que consiste no aparecimento espontâneo de blefarospasmo associado a movimentos distônicos de musculatura orofacial. Associadamene podem ser encontrados torcicolo espasmódico, disfonia espástica e distonia de extremidades. Várias hipóteses foram formuladas para explicar esse distúrbio, tendo em vista a resposta a drogas com ação conhecida nos sistemas de neurotransmissores do cérebro. Algumas evidências apontam para um estado de preponderância dopaminérgica e, nesse sentido, justifica-se a estimulação da atividade GABA, sabendo-se que esse neurotrans-missor age sobre uma das alças de controle da produção de dopamina na substância negra. Por essa razão investigamos a ação de um agonista GABA, o baclofen, sobre a doença de Meige. Foram incluídos no protocolo 5 pacientes, 4 mulheres e um homem, com idade variando entre 50 e 63 anos e duração da doença variando entre 4 meses e 18 anos. Todos apresentavam blefaros-pasmo-distonia orofacial e, além disso três apresentavam disfonia espástica e um distonia de extremidades. A droga era iniciada em dose de 20mg/dia, aumentada em lOmg a cada três dias até ser obtida resposta ou surgirem efeitos colaterais. Um dos pacientes apresentou melhora marcada do blefaros-pasmo-distonia orofacial e outro melhora moderada dos mesmos sintomas, em avaliação 30 dias após estabilização da dose. Não houve melhora da disfonia espástica e ocorreu melhora moderada da distonia de extremidades. Não podemos afirmar que a melhora observada ao fim de um mês se mantenha, ou mesmo que melhora mais significativa fosse observada em avaliação feita mais tardiamente. Concluimos que o baclofen pode ser útil, pelo menos por algum tempo, na doença de Meige.

  20. Pretreatment with a 55-kDa tumor necrosis factor receptor-immunoglobulin fusion protein attenuates activation of coagulation, but not of fibrinolysis, during lethal bacteremia in baboons

    NARCIS (Netherlands)

    van der Poll, T.; Jansen, P. M.; van Zee, K. J.; Hack, C. E.; Oldenburg, H. A.; Loetscher, H.; Lesslauer, W.; Lowry, S. F.; Moldawer, L. L.

    1997-01-01

    Baboons (Papio anubis) receiving a lethal intravenous infusion with live Escherichia coli were pretreated with either a 55-kDa tumor necrosis factor (TNF) receptor-IgG fusion protein (TNFR55:IgG) (n = 4, 4.6 mg/kg) or placebo (n = 4). Neutralization of TNF activity in TNFR55:IgG-treated animals was

  1. Immunoprecipitation of a 50-kDa protein: a candidate receptor component for tomato spotted wilt tospovirus (Bunyaviridae) in its main vector, Frankliniella occidentalis.

    Science.gov (United States)

    Medeiros, R B; Ullman, D E; Sherwood, J L; German, T L

    2000-04-01

    A 50-kDa protein that binds to viral particles in solid-phase assays and that is recognized by anti-idiotypic antibodies made against anti-viral glycoproteins G1/G2 (anti-Ids) has been proposed as a receptor candidate for tomato spotted wilt tospovirus (TSWV) in its main thrips vector, Frankliniella occidentalis Pergande (Bandla et al., 1998. Phytopathology 88, 98-104). Here we show the immunoprecipitation of the 50-kDa protein by anti-Ids and by an anti-G1/G2-TSWV conjugate - a new immunoprecipitation method. In addition, we show that anti-Ids made against anti-G1 (anti-IdG1) block virus replication in an insect tissue replication assay. The results indicate that (a) the TSWV-50-kDa protein interaction occurs in solution, as it must do in vivo; (b) G1 is a viral attachment protein; and (c) the 50-kDa protein is a candidate host factor essential for TSWV entry. These results provide additional support for the role of the 50-kDa thrips protein as a viral receptor. Additionally these experiments provide the basis for testing saturable binding and represent an important step toward the first cloning and identification of a cellular receptor for a plant virus.

  2. Variable levels of 37-kDa/67-kDa laminin receptor (RPSA) mRNA in ovine tissues: potential contribution to the regulatory processes of PrPSc propagation?

    Science.gov (United States)

    Qiao, Jun-Wen; Su, Xiao-Ou; Li, Yu-Xing; Yang, Jian-Min; Wang, Yi-Qin; Kouadir, Mohammed; Zhou, Xiang-Mei; Yang, Li-Feng; Yin, Xiao-Min; Zhao, De-Ming

    2009-01-01

    The 37-kDa laminin receptor precursor/67-kDa laminin receptor (LRP/LR, also known as ribosomal protein SA, RPSA) has been reported to be involved in cancer development and prion internalization. Previous studies have shown that the LRP/LR is expressed in a wide variety of tissues. In particular, expression of LRP/LR mRNA may be closely related to the degree of PrP(Sc) propagation. This study presents a detailed investigation of the LRP/LR mRNA expression levels in eleven normal ovine tissues. Using real-time quantitative PCR, the highest LRP/LR expression was found in neocortex (p < 0.05). Slightly lower levels were found in the heart and obex. Intermediate levels were seen in hippocampus, cerebellum, spleen, thalamus, mesenteric lymph node, and the lowest levels were present in liver, kidney, and lung. In general, the LRP/LR mRNA levels were much higher in neuronal tissues than in peripheral tissues. The observation that differences in LRP/LR mRNA expression levels are consistent with the corresponding variation in PrP(Sc) accumulation suggests that the 37-kDa/67-kDa laminin receptor may be involved in the regulation of PrP(Sc) propagation.

  3. Concentrações de FSH, LH, estradiol, progesterona e histamina no soro, no fluido peritoneal e no fluido folicular de mulheres com e sem endometriose FSH, LH, estradiol, progesterone, and histamine concentrations in serum, peritoneal fluid and follicular fluid of women with and without endometriosis

    Directory of Open Access Journals (Sweden)

    Andréa Pereira de Lima

    2006-11-01

    Full Text Available OBJETIVOS: relatos da literatura mostram que não há dados conclusivos sobre a associação entre a endometriose e as concentrações de hormônios envolvidos no controle da reprodução. Este estudo foi realizado para determinar as concentrações de FSH, LH, estradiol (E, progesterona (P e histamina (Hi no soro, no fluido peritoneal e no fluido folicular de mulheres com e sem endometriose. MÉTODOS: a extensão da doença foi estadiada de acordo com a American Fertility Society classification (1997. Para a coleta de soro e de fluido peritoneal foram selecionadas 28 mulheres com endometriose submetidas à laparoscopia diagnóstica (18 mulheres inférteis com endometriose I-II e dez mulheres inférteis com endometriose III-IV. Para o grupo controle, foram selecionadas 21 mulheres férteis submetidas à laparoscopia para esterilização tubárea. O fluido folicular foi obtido de 39 mulheres inférteis submetidas a fertilização in vitro (21 mulheres com endometriose e 18 mulheres sem endometriose. RESULTADOS: as concentrações de FSH e LH no soro, no fluido peritoneal e no fluido folicular não diferiram significativamente entre os grupos. As concentrações de E e P no fluido peritoneal foram significativamente mais baixas em mulheres inférteis com endometriose (E: 154,2±15,3 para estágios I-II e 89,3±9,8 ng/mL para estágios III-IV; P: 11,2±1,5 para estágios I-II e 7,6±0,8 ng/mL para estágios III-IV em comparação com mulheres controle (E: 289,1±30,1; P: 32,8±4,1 ng/mL (Testes de Kruskal-Wallis/Dunn; pPURPOSE: literature reports show that there are no conclusive data about the association between endometriosis and the concentrations of hormones involved in the control of reproduction. Thus, the present study was undertaken to determine FSH, LH, estradiol (E, progesterone (P, and histamine (Hi concentrations in serum, peritoneal fluid and follicular fluid of women with and without endometriosis. METHODS: the extent of the disease

  4. receptores

    Directory of Open Access Journals (Sweden)

    Salete Regina Daronco Benetti

    2006-01-01

    Full Text Available Se trata de un estudio etnográfico, que tuvo lo objetivo de interpretar el sistema de conocimiento y del significado atribuidos a la sangre referente a la transfusión sanguínea por los donadores y receptores de un banco de sangre. Para la colecta de las informaciones se observaron los participantes y la entrevista etnográfica se realizó el análisis de dominio, taxonómicos y temáticos. Los dominios culturales fueron: la sangre es vida: fuente de vida y alimento valioso; creencias religiosas: fuentes simbólicas de apoyos; donación sanguínea: un gesto colaborador que exige cuidarse, gratifica y trae felicidad; donación sanguínea: fuente simbólica de inseguridad; estar enfermo es una condición para realizar transfusión sanguínea; transfusión sanguínea: esperanza de vida; Creencias populares: transfusión sanguínea como riesgo para la salud; donadores de sangre: personas benditas; donar y recibir sangre: como significado de felicidad. Temática: “líquido precioso que origina, sostiene, modifica la vida, provoca miedo e inseguridad”.

  5. Um paradigma da química medicinal: a flexibilidade dos ligantes e receptores A medicinal chemistry paradigm: ligands and receptor flexibility

    Directory of Open Access Journals (Sweden)

    Hugo Verli

    2005-02-01

    Full Text Available In general, molecular modeling techniques applied in medicinal chemistry have been static and drug based. However the active site geometry and the intrinsic flexibility of both receptor and ligand are fundamental properties for molecular recognition and drug action. As a consequence, the use of dynamic models to describe the ligand-receptor complex is becoming a more common procedure. In this work we discuss the relevance of considering the receptor structure in medicinal chemistry studies as well as the flexibility of the ligand-receptor complex.

  6. Polimorfismos dos genes do receptor de serotonina (5-HT2A e da catecol-O-metiltransferase (COMT: fatores desencadeantes da fibromialgia? Serotonin receptor (5-HT 2A and catechol-O-methyltransferase (COMT gene polymorphisms: Triggers of fibromyalgia?

    Directory of Open Access Journals (Sweden)

    Josie Budag Matsuda

    2010-04-01

    Full Text Available INTRODUÇÃO: A fibromialgia é uma síndrome reumática caracterizada por dor difusa e crônica associada a fadiga, insônia, ansiedade, depressão, perda de memória e tontura. Embora os mecanismos fisiológicos que controlam a fibromialgia não tenham sido estabelecidos, fatores neuroendócrinos, genéticos ou moleculares podem estar envolvidos. OBJETIVO: O objetivo do presente estudo foi caracterizar os polimorfismos dos genes do receptor de serotonina (5-HT2A e da catecolO-metiltransferase (COMT em pacientes brasileiros com fibromialgia, a fim de avaliar sua participação na etiologia da doença. MATERIAL E MÉTODOS: O DNA genômico extraído de 102 amostras de sangue (51 pacientes, 51 controles foi usado para a caracterização molecular dos polimorfismos dos genes 5-HT2A e COMT, por meio de PCR-RFLP. RESULTADOS: A análise molecular dos polimorfismos do gene 5-HT2A demonstrou frequências de 25,49% C/C, 49,02% T/C e 25,49% T/T, nos pacientes com fibromialgia, e 17,65% C/C, 62,74% T/C e 19,61% T/T, no grupo controle, não apresentando diferença significativa entre o grupo de pacientes e o grupo controle. Os polimorfismos do gene da COMT em pacientes com fibromialgia apresentaram uma frequência de 17,65% e 45,10% para os genótipos H/H e L/H, respectivamente. No grupo controle, as frequências foram de 29,42%, para H/H, e 60,78%, para L/H, sem diferença significativa entre ambos os grupos. Entretanto, houve diferença significativa na frequência do genótipo L/L em pacientes (37,25% e controles (9,8%, o que permitiu a diferenciação entre os dois grupos. CONCLUSÃO: A frequência do genótipo L/L foi maior nos pacientes com fibromialgia. Apesar de a fibromialgia envolver uma situação poligênica e fatores ambientais, o estudo molecular do SNP rs4680 do gene da COMT pode auxiliar a identificação de indivíduos suscetíveis.INTRODUCTION: Fibromyalgia is a rheumatic syndrome characterized by diffuse and chronic pain associated with

  7. A 106-kDa aminopeptidase is a putative receptor for Bacillus thuringiensis Cry11Ba toxin in the mosquito Anopheles gambiae†

    Science.gov (United States)

    Zhang, Rui; Hua, Gang; Andacht, Tracy M.; Adang, Michael J.

    2009-01-01

    Bacillus thuringiensis (Bt)1 insecticidal toxins bind to receptors on midgut epithelial cells of susceptible insects, and binding triggers biochemical events that lead to insect mortality. Recently, a 100-kDa aminopeptidase N (APN) was isolated from brush border membrane vesicles (BBMV) of Anopheles quadrimaculatus and shown to bind Cry11Ba toxin with surface plasmon resonance (SPR) detection [Abdullah et al. (2006) BMC Biochemistry 7, 16]. In our study, a 106-kDa APN, called AgAPN2, released by phosphatidylinositol-specific phospholipase C (PI-PLC) from Anopheles gambiae BBMV was extracted by Cry11Ba bound to beads. The AgAPN2 cDNA was cloned and analysis of the predicted AgAPN2 protein revealed a zinc-binding motif (HEIAH), three potential N-glycosylation sites and a predicted glycosylphosphatidylinositol (GPI) anchor site. Immunohistochemistry localized AgAPN2 to the microvilli of the posterior midgut. A 70-kDa fragment of the 106-kDa APN was expressed in Escherichia coli. When purified, it competitively displaced 125I-Cry11Ba binding to An. gambiae BBMV, and bound Cry11Ba on dot blot and microtiter plate binding assays with a calculated Kd of 6.4 nM. Notably, this truncated peptide inhibited Cry11Ba toxicity to An. gambiae larvae. These results are evidence that the 106-kDa GPI-anchored APN is a specific binding protein, and a putative midgut receptor, for Bt Cry11Ba toxin. PMID:18826260

  8. A 106-kDa aminopeptidase is a putative receptor for Bacillus thuringiensis Cry11Ba toxin in the mosquito Anopheles gambiae.

    Science.gov (United States)

    Zhang, Rui; Hua, Gang; Andacht, Tracy M; Adang, Michael J

    2008-10-28

    Bacillus thuringiensis (Bt) insecticidal toxins bind to receptors on midgut epithelial cells of susceptible insects, and binding triggers biochemical events that lead to insect mortality. Recently, a 100-kDa aminopeptidase N (APN) was isolated from brush border membrane vesicles (BBMV) of Anopheles quadrimaculatus and shown to bind Cry11Ba toxin with surface plasmon resonance (SPR) detection [Abdullah et al. (2006) BMC Biochem. 7, 16]. In our study, a 106-kDa APN, called AgAPN2, released by phosphatidylinositol-specific phospholipase C (PI-PLC) from Anopheles gambiae BBMV was extracted by Cry11Ba bound to beads. The AgAPN2 cDNA was cloned, and analysis of the predicted AgAPN2 protein revealed a zinc-binding motif (HEIAH), three potential N-glycosylation sites, and a predicted glycosylphosphatidylinositol (GPI) anchor site. Immunohistochemistry localized AgAPN2 to the microvilli of the posterior midgut. A 70-kDa fragment of the 106-kDa APN was expressed in Escherichia coli. When purified, it competitively displaced 125I-Cry11Ba binding to An. gambiae BBMV and bound Cry11Ba on dot blot and microtiter plate binding assays with a calculated K d of 6.4 nM. Notably, this truncated peptide inhibited Cry11Ba toxicity to An. gambiae larvae. These results are evidence that the 106-kDa GPI-anchored APN is a specific binding protein, and a putative midgut receptor, for Bt Cry11Ba toxin.

  9. GPS receivers for georeferencing of spatial variability of soil attributes Receptores GPS para georreferenciamento da variabilidade espacial de atributos do solo

    Directory of Open Access Journals (Sweden)

    David L Rosalen

    2011-12-01

    áveis. Foi implantada uma malha amostral de 60 pontos, espaçados em 20 m. Para as medições da RP, utilizou-se de penetrógrafo eletrônico e, para a determinação da UG, utilizou-se de trado holandês (profundidade de 0,0-0,1 m. As amostras foram georreferenciadas, utilizando-se do método de Posicionamento por Ponto Simples (PPS, com de (retirar receptor GPS de navegação, e Posicionamento Relativo Semicinemático, com receptor GPS geodésico L1. Os resultados indicaram que o georreferenciamento realizado pelo PPS não interferiu na caracterização da variabilidade espacial da RP e da UG, assim como na estrutura espacial da relação dos atributos.

  10. Mycobacterium tuberculosis 38-kDa antigen induces endoplasmic reticulum stress-mediated apoptosis via toll-like receptor 2/4.

    Science.gov (United States)

    Lim, Yun-Ji; Choi, Ji-Ae; Lee, Jeong-Hwan; Choi, Chul Hee; Kim, Hwa-Jung; Song, Chang-Hwa

    2015-03-01

    Endoplasmic reticulum (ER) stress responses play critical roles in the pathogenesis of tuberculosis. To investigate the regulatory role of the ER stress response in 38-kDa antigen-induced apoptosis, we examined the relationship between the ER stress response and apoptosis in bone marrow-derived macrophages (BMDMs) stimulated with Mycobacterium tuberculosis antigen (38-kDa Ag). The expression of ER molecular chaperones, including C/EBP homologous protein (CHOP), glucose-regulated protein (Bip) and phosphorylated alpha subunit of eukaryotic initiation factor 2, was induced in BMDMs stimulated with the 38-kDa Ag. Interestingly, 38-kDa Ag-stimulation induced apoptosis via activation of caspase-12, -9 and -3. However, 38-kDa Ag-induced apoptosis was significantly reduced in TLR2- and TLR4-deficient macrophages. Because toll-like receptors (TLRs) initiate the activation of mitogen-activated protein kinase (MAPK) signaling cascades, we evaluated the effect of MAPK activation on ER stress. The 38-kDa Ag activated Jun N-terminal kinase, extracellular signal-regulated kinase and p38 phosphorylation. MAPK signaling induced the secretion of proinflammatory cytokines such as MCP-1, TNF-α and IL-6. The 38-kDa Ag-induced MCP-1 was especially associated with the induction of MCP-1-induced protein (MCPIP), which increased the generation of reactive oxygen species (ROS) and ER stress. To investigate the role of MCPIP in ROS-induced ER stress by 38-kDa Ag stimulation, we transfected MCPIP siRNA into RAW264.7 cells before 38-kDa Ag stimulation, and measured the generation of ROS and expression of ER molecular chaperones. ROS production and CHOP expression were decreased by the silencing of MCPIP induction. Our results demonstrate that the expression of MCPIP by 38-kDa Ag stimulation is increased through a TLR-MAPK-dependent signaling pathway, and leads to ER stress-induced apoptosis. In conclusion, MCPIP is important for host defense mechanisms in mycobacterial pathogenesis.

  11. INTERACCION MOLECULAR DE LOS RECEPTORES CRH-R2 Y DA-D1 EN EL AREA TEGMENTAL VENTRAL DE RATA

    OpenAIRE

    ARAYA GUTIERREZ, KATHERINE ANGELICA

    2013-01-01

    La administración repetida de drogas de abuso genera cambios plásticos perdurables que se traducen en alteraciones en las propiedades funcionales de las neuronas del sistema mesocorticolímbico, como lo es la sensibilización de la liberación de glutamato en el área tegmental ventral (VTA) inducida por la administración repetida de cocaína, esto determina la recaída a la droga (Wang y cols. 2005). Dicha sensibilización estaría siendo modulada por la activación de receptores dopam...

  12. Papel de los receptores tlr y el inflamasoma en el daño que induce el etanol en el cerebro

    OpenAIRE

    Ureña Peralta, Juan Ramon

    2016-01-01

    “PAPEL DE LOS RECEPTORES TLR Y EL INFLAMASOMA EN EL DAÑO QUE INDUCE EL ETANOL EN EL CEREBRO” Realizada por: Juan R. Ureña Peralta. Licenciado en Bioquímica por la Universidad de Valencia Dirigida por: Dra. Consuelo Guerri Sirera. Los efectos del alcohol en el sistema neuro-inmunitario y su acción en la neuroinflamación, desmielinización y daño cerebral han sido ampliamente demostrados por nuestro laboratorio. Los resultados previos muestran que el etanol es capaz de activar a lo...

  13. Atividade antiulcerogênica do extrato aquoso da Bryophyllum pinnatum (Lam. Kurz Antiulcerogenic activity of aqueous extract from Bryophyllum pinnatum (Lam. Kurz

    Directory of Open Access Journals (Sweden)

    D.C. Braz

    2013-01-01

    Full Text Available Bryophyllum pinnatum (Lam. Kurz pertence a família Crassulaceae e é conhecida vulgarmente como coirama, folha-da-fortuna, ou folha-do-ar, sendo usada popularmente como antifúngico, no tratamento da hipertensão, em úlceras e em inflamações. O presente estudo objetivou analisar a atividade antiulcerogênica do extrato aquoso das folhas de Bryophyllum pinnatum (Lam. Kurz em modelo de úlcera gástrica induzida por indometacina em Rattus norvegicus, machos (150 a 250 g com idade de 70 dias. Os animais receberam por via oral: água, extrato aquoso de Bryophyllum pinnatum (Lam. Kurz (1 e 2 g Kg-1 ou ranitidina (60 mg Kg-1 , fármaco com ação gastroprotetora conhecida que atua bloqueando os receptores de histamina H2. Após uma hora dos tratamentos, todos animais receberam indometacina via intraperitoneal. Os resultados demonstraram que o extrato aquoso da Bryophyllum pinnatum (Lam. Kurz possui ação gastroprotetora; na dose de 1 g Kg-1 inibiu 45,49% o índice de ulceração induzido pela indometacina, e, na dose de 2 g Kg-1, inibiu 49,50%. Sugere-se o envolvimento de vários mecanismos na ação gastroprotetora dessa planta e não somente uma possível participação das prostaglandinas nesse efeito. Estudos futuros com diferentes modelos de indução de úlcera gástrica tornam-se necessários para melhor avaliar a atividade antiulcerogênica do extrato aquoso de Bryophyllum pinnatum (Lam. Kurz.Bryophyllum pinnatum (Lam. Kurz belongs to the family Crassulaceae, is popularly known as "coirama", "folha-da-fortuna", or "folha-do-ar" and has been commonly used as antifungal, in the treatment of hypertension, ulcers and inflammation. The present study aimed to analyze the antiulcerogenic activity of aqueous extract from the leaves of Bryophyllum pinnatum (Lam. Kurz using indomethacin-induced gastric ulcer models in Rattus norvegicus, males (150-250 g aged 70 days old. The animals received by the oral route: water, aqueous extract from

  14. Protease activated receptors (PARS) mediation in gyroxin biological activity; Mediacao dos receptores ativados por proteases (PARs) em atividades biologicas da giroxina

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Jose Alberto Alves da

    2009-07-01

    Gyroxin is a serine protease enzyme from the South American rattlesnake (Crotalus durissus terrificus) venom; it is only partially characterized and has multiple activities. Gyroxin induces blood coagulation, blood pressure decrease and a neurotoxic behavior named barrel rotation. The mechanisms involved in this neurotoxic activity are not known. Whereas gyroxin is a member of enzymes with high potential to become a new drug with clinical applications such as thrombin, batroxobin, ancrod, tripsyn and kalicrein, it is important to find out how gyroxin works. The analysis on agarose gel electrophoresis and circular dichroism confirmed the molecules' integrity and purity. The gyroxin intravenous administration in mice proved its neurotoxicity (barrel rotation). In vivo studies employing intravital microscopy proved that gyroxin induces vasodilation with the participation of protease activated receptors (PARs), nitric oxide and Na+K+ATPase. The leukocytes' adherence and rolling counting indicated that gyroxin has no pro inflammatory activity. Gyroxin induced platelet aggregation, which was blocked by inhibitors of PAR1 and PAR4 receptors (SCH 79797 and tcY-NH{sub 2}, respectively). Finally, it was proved that the gyroxin temporarily alter the permeability of the blood brain barrier (BBB). Our study has shown that both the protease-activated receptors and nitric oxide are mediators involved in the biological activities of gyroxin. (author)

  15. Epigallocatechin-3-gallate-mediated Tollip induction through the 67-kDa laminin receptor negatively regulating TLR4 signaling in endothelial cells.

    Science.gov (United States)

    Byun, Eui-Baek; Mi-SoYang; Kim, Jae-Hun; Song, Du-Sup; Lee, Byung-Soo; Park, Jae-Nam; Park, Sang-Hyun; Park, Chulhwan; Jung, Pil-Mun; Sung, Nak-Yun; Byun, Eui-Hong

    2014-11-01

    Green tea polyphenol epigallocatechin-3-gallate (EGCG) has the potential to impact a variety of inflammation-related diseases; however, the anti-inflammatory action of EGCG in endothelial cells has not been understood. Recently, we demonstrated that the 67-kDa laminin receptor (67LR) acts as a cell-surface EGCG receptor. This research was carried out to clarify the molecular basis for the down-regulation of toll-like receptor 4 (TLR4) signal transduction by EGCG in lipopolysaccharide (LPS)-stimulated endothelial cells. RNAi-mediated silencing of 67LR resulted in an abrogation of the inhibitory action of EGCG on the LPS-induced activation of downstream signaling pathways. Also, we found that EGCG induced a rapid upregulation of Toll-interacting protein (Tollip), a negative regulator of TLR signaling, through 67LR in endothelial cells. RNAi-mediated silencing of Tollip impaired the TLR4 signaling inhibitory activity of EGCG. Additionally, silencing of Tollip resulted in an abrogation of the inhibitory action of EGCG on the LPS-induced expressions of cell-associated adhesion molecules, such as ICAM-1 and VCAM-1. Taken together, these novel findings provide new insights into an understanding of negative regulatory mechanisms of the TLR4 signaling pathway and effective therapeutic intervention for the treatment of inflammatory disease. Copyright © 2014 Elsevier GmbH. All rights reserved.

  16. Green tea polyphenol epigallocatechin-3-gallate inhibits TLR4 signaling through the 67-kDa laminin receptor on lipopolysaccharide-stimulated dendritic cells

    Energy Technology Data Exchange (ETDEWEB)

    Byun, Eui-Baek [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Choi, Han-Gyu [Department of Microbiology and Research Institute for Medical Sciences, College of Medicine, Chungnam National University, Daejeon 301-747 (Korea, Republic of); Sung, Nak-Yun [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Byun, Eui-Hong, E-mail: ehbyun80@gmail.com [Department of Microbiology and Research Institute for Medical Sciences, College of Medicine, Chungnam National University, Daejeon 301-747 (Korea, Republic of)

    2012-10-05

    Highlights: Black-Right-Pointing-Pointer Expressions of CD80, CD86, and MHC class I/II were inhibited by EGCG via 67LR. Black-Right-Pointing-Pointer EGCG-treated DCs inhibited LPS-induced pro-inflammatory cytokines via 67LR. Black-Right-Pointing-Pointer EGCG-treated DCs inhibited MAPKs activation and NF-{kappa}B p65 translocation via 67LR. Black-Right-Pointing-Pointer EGCG elevated the expression of the Tollip protein through 67LR in DCs. -- Abstract: Epigallocatechin-3-gallate (EGCG), a major active polyphenol of green tea, has been shown to down-regulate inflammatory responses in dendritic cells (DCs); however, the underlying mechanism has not been understood. Recently, we identified the 67-kDa laminin receptor (67LR) as a cell-surface EGCG receptor. In this study, we showed the molecular basis for the down-regulation of toll-like receptor 4 (TLR4) signal transduction by EGCG in DCs. The expressions of CD80, CD86, and MHC class I and II, which are molecules essential for antigen presentation by DCs, were inhibited by EGCG via 67LR. In addition, EGCG-treated DCs inhibited lipopolysaccharide (LPS)-induced production of pro-inflammatory cytokines (tumor necrosis factor [TNF]-{alpha}, interleukin [IL]-1{beta}, and IL-6) and activation of mitogen-activated protein kinases (MAPKs), e.g., extracellular signal-regulated kinase 1/2 (ERK1/2), p38, c-Jun N-terminal kinase (JNK), and nuclear factor {kappa}B (NF-{kappa}B) p65 translocation through 67LR. Interestingly, we also found that EGCG markedly elevated the expression of the Tollip protein, a negative regulator of TLR signaling, through 67LR. These novel findings provide new insight into the understanding of negative regulatory mechanisms of the TLR4 signaling pathway and consequent inflammatory responses that are implicated in the development and progression of many chronic diseases.

  17. Análise da sobrevida e fatores associados à mortalidade em receptores de transplante renal em Hospital Universitário no Maranhão

    Directory of Open Access Journals (Sweden)

    Maria Inês Gomes de Oliveira

    2012-09-01

    Full Text Available INTRODUÇÃO: O transplante renal (TR é considerado como a melhor terapia para a Doença Renal Crônica (DRC. Fatores associados à sobrevida dos receptores de TR devem ser avaliados tendo em vista a implementação de condutas adequadas no manejo desses pacientes. OBJETIVOS: Analisar a sobrevida de receptores de TR e fatores associados à sua mortalidade. MÉTODOS: Estudo observacional de coorte, retrospectivo, com todos os 215 pacientes submetidos a TR no Hospital Universitário da Universidade Federal do Maranhão-HUUFMA, entre 18 de março de 2000 e 18 de setembro de 2008, com seguimento mínimo de 12 e máximo de 101 meses. Características demográficas e clínicas dos pacientes foram observadas. Utilizou-se o método Kaplan-Meier para construção das curvas de sobrevida do paciente, sendo as mesmas comparadas pelo teste log-rank. O modelo de riscos proporcionais de Cox identificou fatores associados à mortalidade. RESULTADOS: A prevalência de óbito no período foi de 10,6%. A sobrevida de 1, 3 e 5 anos com doadores vivos foi de 97,8%, 94,1% e 92,9%, respectivamente, e com doadores falecidos, 95,6% e 95,6% para 1 e 3 anos, respectivamente. Foram fatores associados à menor sobrevida do paciente: idade > 40 anos (RR = 6,19; p = 0,001; IC 95% = 2,01-18,99 e intercorrência cirúrgica (RR = 4,98; p = 0,041; IC 95% = 1,07-23,27. CONCLUSÕES: As taxas de sobrevida do receptor de TR no HUUFMA foram semelhantes àquelas encontradas em outros trabalhos, nacionais e internacionais. Idade do receptor acima de 40 anos e intercorrências cirúrgicas foram significantemente associados à mortalidade do paciente neste estudo.

  18. Efeito da deleção genética do receptor da angiotensina - 1-7, MAS, na morfologia e expressão de proteínas da matriz extracelular em corações de camundongos adultos e neonatais

    OpenAIRE

    Elisandra Gava de Castro

    2006-01-01

    A expressão de vários tipos de colágenos e outras proteínas da matriz extracelular (MEC) mostram estar alteradas sob várias condições fisiológicas e patológicas. O Sistema Renina Angiotensina (SRA) apresenta um papel importante na biossíntese da MEC dentro do coração. Foi mostrado recentemente que angiotensina-(1-7) (Ang1-7) é um ligante endógeno do receptor Mas, o qual esta acoplado à proteína G e modula várias funções importantes no coração (Santos et al., 2003). Porém, pouco se sabe sobre ...

  19. Dopamine Receptors and Parkinson's Disease

    Directory of Open Access Journals (Sweden)

    Shin Hisahara

    2011-01-01

    Full Text Available Parkinson's disease (PD is a progressive extrapyramidal motor disorder. Pathologically, this disease is characterized by the selective dopaminergic (DAergic neuronal degeneration in the substantia nigra. Correcting the DA deficiency in PD with levodopa (L-dopa significantly attenuates the motor symptoms; however, its effectiveness often declines, and L-dopa-related adverse effects emerge after long-term treatment. Nowadays, DA receptor agonists are useful medication even regarded as first choice to delay the starting of L-dopa therapy. In advanced stage of PD, they are also used as adjunct therapy together with L-dopa. DA receptor agonists act by stimulation of presynaptic and postsynaptic DA receptors. Despite the usefulness, they could be causative drugs for valvulopathy and nonmotor complication such as DA dysregulation syndrome (DDS. In this paper, physiological characteristics of DA receptor familyare discussed. We also discuss the validity, benefits, and specific adverse effects of pharmaceutical DA receptor agonist.

  20. The receptor-like protein-tyrosine phosphatase DEP-1 is constitutively associated with a 64-kDa protein serine/threonine kinase.

    Science.gov (United States)

    Jallal, B; Mossie, K; Vasiloudis, G; Knyazev, P; Zachwieja, J; Clairvoyant, F; Schilling, J; Ullrich, A

    1997-05-02

    Protein-tyrosine phosphatases (PTPs) are involved in the regulation of diverse cellular processes and may function as positive effectors as well as negative regulators of intracellular signaling. Recent data demonstrate that malignant transformation of cells is frequently associated with changes in PTP expression or activity. Our analysis of PTP expression in mammary carcinoma cell lines resulted in the molecular cloning of a receptor-like PTP, also known as DEP-1. DEP-1 was found to be expressed at varying levels in mammary carcinoma cell lines and A431 cells. In all tumor cell lines analyzed, DEP-1 was constitutively phosphorylated on tyrosine residues. Phosphorylation of DEP-1 increased significantly after treatment of cells with the PTP inhibitor pervanadate. In A431 cells, tyrosine phosphorylation of DEP-1 was also observed after stimulation with epidermal growth factor, however, only after prolonged exposure of the cells to the ligand, suggesting an indirect mechanism of phosphorylation. In addition, DEP-1 coprecipitated with several tyrosine-phosphorylated proteins from pervanadate-treated cells. In vitro binding experiments using a glutathione S-transferase fusion protein containing the catalytically inactive PTP domain of DEP-1 (Gst-DEP-1-C/S) identify these proteins as potential substrates of DEP-1. In addition, we found a 64-kDa serine/threonine kinase to be constitutively associated with DEP-1 in all tumor cell lines tested. The 64-kDa kinase forms a stable complex with DEP-1 and phosphorylates DEP-1 and DEP-1-interacting proteins in vitro. These data suggest a possible mechanism of DEP-1 regulation in tumor cell lines involving serine/threonine and/or tyrosine phosphorylation.

  1. Localization and dynamic expression of a 27.8 kDa receptor protein for lymphocystis disease virus infection in sea bass ( Lateolabrax japonicus) tissues

    Science.gov (United States)

    Wu, Ronghua; Sheng, Xiuzhen; Tang, Xiaoqian; Xing, Jing; Zhan, Wenbin

    2017-10-01

    Lymphocystis disease virus (LCDV) infects target cells by attaching to a 27.8 kDa receptor (27.8R) protein in flounder Paralichthys olivaceus, and anti-27.8R monoclonal antibodies (MAbs) have been developed. However, the 27.8R existence in tissues of sea bass ( Lateolabrax japonicus) and its role in LCDV infection have remained unclear. In this study, the results of western blotting demonstrated that the same 27.8R was shared by flounder and sea bass. LCDV-free sea bass individuals were intramuscularly injected with LCDV, and viral copies were detected in tissues from 3 h post infection and showed a time-dependent increase during 9 days infection. Distribution and synthesis of 27.8R in sea bass tissues were investigated by using anti-27.8R MAbs as probes. It was found that 27.8R was distributed in all the tested tissues. The levels of 27.8R protein were highest in gill and skin, then a bit lowly in stomach, head kidney and heart, followed by spleen, intestine, blood cells, gonad and liver, and least in kidney and brain in healthy sea bass. Upon LCDV infection, 27.8R synthesis was up-regulated in each tissue, and higher in the tissues with higher LCDV copies. The 27.8R and LCDV were detected in some peripheral blood leukocytes but not in red blood cells. These results suggested that 27.8R was widely distributed in sea bass tissues, and it served as a receptor and correlated with tissue tropism of LCDV infection. Furthermore, leukocytes had the potential of being a LCDV carrier and were responsible for a systemic infection of LCDV in sea bass.

  2. Synergetic downregulation of 67 kDa laminin receptor by the green tea (Camellia sinensis secondary plant compound epigallocatechin gallate: a new gateway in metastasis prevention?

    Directory of Open Access Journals (Sweden)

    Müller Jakob

    2012-12-01

    Full Text Available Abstract Background In traditional Chinese medicine, green tea is considered to have a life-prolonging effect, possibly as a result of its rich content of antioxidant tea polyphenols, and hence has the potential to prevent cancer. This study investigated the role of the major tea secondary plant compound epigallocatechin gallate (EGCG for its inhibitory effects on the metastasis-associated 67 kDa laminin receptor (67LR. Methods To clarify the impact of EGCG on siRNA-silenced expression of 67LR, we applied an adenoviral-based intestinal in vitro knockdown model, porcine IPEC-J2 cells. Quantitative real-time polymerase chain reaction was performed to analyze 67LR gene expression following treatment with physiological and pharmacological concentrations of EGCG (1.0 g/l, 0.1 g/l, 0.02 g/l and 0.002 g/l. Results We report co-regulation of EGCG and 67LR, which is known to be an EGCG receptor. siRNA selectively and highly significantly suppressed expression of 67LR under the impact of EGCG in a synergetic manner. Conclusions Our findings suggest that 67LR expression is regulated by EGCG via a negative feedback loop. The explicit occurrence of this effect in synergy with a small RNA pathway and a plant-derived drug reveals a new mode of action. Our findings may help to provide insights into the many unsolved health-promoting activities of other natural pharmaceuticals.

  3. Assessment of dopamine (DA synthesis rate in selected parts of the rat brain with central noradrenergic lesion after administration of 5-HT3 receptor ligands

    Directory of Open Access Journals (Sweden)

    Wojciech Roczniak

    2013-07-01

    Full Text Available Introduction: The study objective was to determine the effect of central noradrenergic system lesions performed in the early extrafetal life period on dopamine synthesis in the rat brain. The content of L-dihydroxyphenylalanine (L-DOPA was assessed in the frontal lobe, thalamus, hypothalamus and brain stem of rats by high-pressure chromatography with electrochemical detection (HPLC/ED after administration of 5-HT3 receptor ligands.Material and Methods: Adult male Wistar rats which underwent central noradrenergic lesions by DSP-4 administration (50 mg/kg m.c. i.p. on day 1 and 3 of life received i.p. injections of the aromatic amino acid decarboxylase inhibitor (NSD-1050 in a dose of 100 mg/kg b.w. Next, 30 min after NSD-1050 injection, the animals were decapitated by guillotine. Selected brain structures were dissected and L-DOPA content was determined by HPLC/ED.Results and Conclusions: A statistically significant reduction was found in DA synthesis in the group of animals with DSP-4 lesions induced by PBG (1-phenylbiguanide, 7.5 mg/kg b.w. i.p. and ondansetron (1.0 mg/kg b.w. i.p.. Morphine and PBG had no major effect on DA synthesis in the cerebral cortex of both control animals and in rats with noradrenergic lesions. The assessment of the effect of DSP-4 lesions on L-DOPA content in the brain stem after administration of morphine (7.5 mg/kg b.w. s.c., PBG (7.5 mg/kg b.w. i.p. or ondansetron (1.0 mg/kg b.w. i.p. separately or jointly showed a statistically significant increase in the synthesis of DA in animals with DSP-4 lesions, as compared to the control group exposed to 0.9�0NaCl and morphine. The analysis of the effect of DSP-4 lesions on L-DOPA content in the thalamus and hypothalamus revealed no statistically significant differences between the control groups of rats and those with DSP-4 lesions. As shown by this model, permanent noradrenergic lesions in animals in the early extra-fetal period result in increased reactivity of the

  4. The influence of clozapine treatment and other antipsychotics on the 18 kDa translocator protein, formerly named the peripheral-type benzodiazepine receptor, and steroid production.

    Science.gov (United States)

    Danovich, Lena; Veenman, Leo; Leschiner, Svetlana; Lahav, Michal; Shuster, Vered; Weizman, Abraham; Gavish, Moshe

    2008-01-01

    It has been shown that the atypical antipsychotic drug clozapine increases the levels of the neurosteroid allopregnanolone in the rat brain. The 18 kDa translocator protein (TSPO), formerly known as the peripheral-type benzodiazepine receptor, has been demonstrated to be involved in the process of steroid biosynthesis, in peripheral steroidogenic tissues as well as in glia cells in the brain. In the current study, we investigated the influence of chronic treatment with clozapine and other antipsychotics (thioridazine,sulpiride and risperidone) on TSPO binding in cell cultures and rat tissues. Clozapine significantly increased TSPO binding density in C6 rat glioma cells and in MA-10 mouse Leydig tumor cells, while the antipsychotic sulpiride had no effect on TSPO binding density in both cell lines. In addition, clozapine, but not sulpiride, significantly increased progesterone synthesis by MA-10 Leydig tumor cells. In an animal experiment, male Sprague-Dawley rats were treated with clozapine (20 mg/kg), risperidone (0.5 mg/kg), thioridazine (20 mg/kg), or sulpiride (20 mg/kg) for 21 days, followed by 7 days of withdrawal. Clozapine induced significant increases in TSPO binding in brain and peripheral steroidogenic tissues, whereas the other antipsychotics did not show such pronounced effects on TSPO binding. Our results suggest that TSPO may be involved in the modulation of steroidogenesis by clozapine.

  5. Midazolam ameliorates the behavior deficits of a rat posttraumatic stress disorder model through dual 18 kDa translocator protein and central benzodiazepine receptor and neurosteroidogenesis.

    Directory of Open Access Journals (Sweden)

    Yu-Liang Miao

    Full Text Available Post-traumatic stress disorder (PTSD is a debilitating anxiety disorder that may develop after an individual has experienced or witnessed a severe traumatic event. It has been shown that the 18 kDa translocator protein (TSPO may be correlated with PTSD and that the TSPO ligand improved the behavioral deficits in a mouse model of PTSD. Midazolam, a ligand for TSPO and central benzodiazepine receptor (CBR, induces anxiolytic- and anti-depressant-like effects in animal models. The present study aimed to determine whether midazolam ameliorates PTSD behavior in rats as assessed by the single prolonged stress (SPS model. The SPS rats received daily Sertraline (Ser (15 mg/kg, i.p. [corrected] and midazolam (0.125, 0.25, 0.5, and 1 mg/kg, i.p. [corrected] during the exposure to SPS and behavioral assessments, which included the open field (OF test, the contextual fear paradigm (CFP, and the elevated plus-maze (EPM. The results showed that, like Ser (15 mg/kg, i.p. [corrected], midazolam (0.25 and 0.5 mg/kg, i.p. [corrected] significantly reversed the behavioral deficiencies of the SPS rats, including PTSD-associated freezing and anxiety-like behavior but not the effects on spontaneous locomotor activity. In addition, the anti-PTSD effects of midazolam (0.5 mg/kg, i.p. [corrected] were antagonized by the TSPO antagonist PK11195 (3 mg/kg, i.p., the CBR antagonist flumazenil (15 mg/kg, i.p. [corrected] and the inhibitor of steroidogenic enzymes finasteride (30 mg/kg, i.p. [corrected], which by themselves had no effect on PTSD-associated freezing and anxiety-like behavior. In summary, this study demonstrated that midazolam improves the behavioral deficits in the SPS model through dual TSPO and CBR and neurosteroidogenesis.

  6. Immunohistochemical expression of oestrogen and progesterone receptors during experimental acute and chronic murine Schistosomiasis mansoni Expressão imunohistoquímica de receptores para estrogênio e progesterona nas fases aguda e crônica da esquistossomose mansônica experimental em camundongos

    Directory of Open Access Journals (Sweden)

    Fawzia Ahmed Habib

    2010-10-01

    Full Text Available INTRODUCTION: The responsibility of Schistosoma mansoni in female infertility is still controversial. This study was conducted to evaluate the effect of acute and chronic schistosomiasis mansoni infection on the endometrium using immunohistochemical analysis of uterine hormone receptor expression. METHODS: Twenty-four nonpregnant swiss albino mice were divided into three groups: control, noninfected; acute; and chronic Schistosoma mansoni infection. Histological sections of uterine specimens were examined by light microscope with an image analyzing system to detect structural histological, estrogen receptor (ER and progesterone receptor (PR expression in the endometrium. RESULTS: No secretory phase was detected in the endometrium in acute and chronic Schistosoma infection. Hormone receptor expression (ER and PR showed statistically significant differences among the groups (pINTRODUÇÃO: A responsabilidade do Schistosoma mansoni em esterilidade feminina é ainda controversa. Este estudo é conduzido para avaliar o efeito da esquistossomose mansoni aguda e crônica no endométrio usando análise de imuno-histoquímíca da expressão de receptor hormonal uterina. MÉTODOS: Vinte e quatro camundongos fêmeas albinas suíças não grávidas foram divididas em 3 grupos (controle não-infectado, grupos agudos e crônicos infeccionados com Schistosoma mansoni. As seções histológicas de espécimes uterinos foram examinadas por microscópio leve com imagem, analisando sistema para detectar no endométrio expressões histológicas estruturais, receptor de estrogênio (ER e receptor de progesterona (PR. RESULTADOS: Nenhuma fase secretora foi detectada no endométrio com infecção aguda e crônica de Schistosoma. A expressão hormonal de receptor (ER e PR mostrou diferenças estatisticamente significantes entre grupos diferentes (p<0,05 com baixa significativa hormonal de ER com infecção crônica (comparado com controle proliferativo, controle secret

  7. Leptin receptor 170 kDa (OB-R170) protein expression is reduced in obese human skeletal muscle: a potential mechanism of leptin resistance

    DEFF Research Database (Denmark)

    Fuentes, T; Ara, I; Guadalupe-Grau, A

    2010-01-01

    To examine whether obesity-associated leptin resistance could be due to down-regulation of leptin receptors (OB-Rs) and/or up-regulation of suppressor of cytokine signalling 3 (SOCS3) and protein tyrosine phosphatase 1B (PTP1B) in skeletal muscle, which blunt janus kinase 2-dependent leptin...... had a greater amount of leptin receptors than the vastus lateralis, whilst SOCS3 protein expression was increased and basal STAT3, AMPKalpha and ACCbeta phosphorylation levels were reduced in the vastus lateralis compared with the deltoid muscle (all P leptin...... receptors and leptin signalling are reduced in obesity, particularly in the leg muscles....

  8. Forever Young: The Role of Ubiquitin Receptor DA1 and E3 Ligase BIG BROTHER in Controlling Leaf Growth and Development.

    Science.gov (United States)

    Vanhaeren, Hannes; Nam, Youn-Jeong; De Milde, Liesbeth; Chae, Eunyoung; Storme, Veronique; Weigel, Detlef; Gonzalez, Nathalie; Inzé, Dirk

    2017-02-01

    The final size of plant organs is determined by a combination of cell proliferation and cell expansion. Leaves account for a large part of above-ground biomass and provide energy to complete the plant's life cycle. Although the final size of leaves is remarkably constant under fixed environmental conditions, several genes have been described to enhance leaf growth when their expression is modulated. In Arabidopsis (Arabidopsis thaliana), mutations in DA1 and BB increase leaf size, an effect that is synergistically enhanced in the double mutant. Here, we show that overexpression of a dominant-negative version of DA1 enhances leaf size in a broad range of natural accessions of this species, indicating a highly conserved role of this protein in controlling organ size. We also found that during early stages of development, leaves of da1-1 and bb/eod1-2 mutants were already larger than the isogenic Col-0 wild type, but this phenotype was triggered by different cellular mechanisms. Later during development, da1-1 and bb/eod1-2 leaves showed a prolonged longevity, which was enhanced in the double mutant. Conversely, ectopic expression of DA1 or BB restricted growth and promoted leaf senescence. In concert, shortly upon induction of DA1 and BB expression, several marker genes for the transition from proliferation to expansion were highly up-regulated. Additionally, multiple genes involved in maintaining the mitotic cell cycle were rapidly down-regulated and senescence genes were strongly up-regulated, particularly upon BB induction. With these results, we demonstrate that DA1 and BB restrict leaf size and promote senescence through converging and different mechanisms. © 2017 American Society of Plant Biologists. All Rights Reserved.

  9. 5 prime -Azido-(3,6- sup 3 H sub 2 )-1-naphthylphthalamic acid, a photoactivatable probe for naphthylphthalamic acid receptor proteins from higher plants: Identification of a 23-kDa protein from maize coleoptile plasma membranes

    Energy Technology Data Exchange (ETDEWEB)

    Zettl, R.; Feldwisch, J.; Schell, J.; Palme, K. (Max-Planck-Inst. fuer Zuechtungsforschung, Koeln (West Germany)); Boland, W. (Univ. Karlsruhe (West Germany))

    1992-01-15

    1-Naphthylphthalamic acid (NPA) is a specific inhibitor of polar auxin transport that blocks carrier mediated auxin efflux from plant cells. To allow identification of the NPA receptor thought to be part of the auxin efflux carrier, the authors have synthesized a tritiated, photolabile NPA analogue, 5{prime}-azido-(3,6-{sup 3}H{sub 2})NPA (({sup 3}H{sub 2})N{sub 3}NPA). This analogue was used to identify NPA-binding proteins in fractions highly enriched for plasma membrane vesicles isolated from maize coleoptiles (Zea mays L.). Competition studies showed that binding of ({sup 3}H{sub 2})N{sub 3}NPA to maize plasma membrane vesicles was blocked by nonradioactive NPA but not by benzoic acid. After incubation of plasma membrane vesicles with ({sup 3}H{sub 2})N{sub 3}NPA and exposure to UV light, they observed specific photoaffinity labeling of a protein with an apparent molecular mass of 23 kDa. Pretreatment of the plasma membrane vesicles with indole-3-acetic acid or with the auxin-transport inhibitors NPA and 2,3,5-triiodobenzoic acid strongly reduced specific labeling of this protein. This 23-kDa protein was also labeled by addition of 5-azido-(7-{sup 3}H)indole-3-acetic acid to plasma membranes prior to exposure to UV light. The 23-kDa protein was solubilized from plasma membranes by 1% Triton X-100. The possibility that this 23-kDa polypeptide is part of the auxin efflux carrier system is discussed.

  10. Phosphorylation of the cytoplasmic tail of the 300-kDa mannose 6-phosphate receptor is required for the interaction with a cytosolic protein

    DEFF Research Database (Denmark)

    Rosorius, O; Issinger, O G; Braulke, T

    1993-01-01

    ) and to 35- and 91-kDa proteins salt-washed from bovine brain membranes. Gel filtration suggested that TIP 35 is part of a higher molecular mass complex of approximately 130-150 kDa. Inhibition studies, using non-phosphorylated and phosphorylated MPR 300-CT and cross-linking, indicate that the interaction...... with a cytosolic protein depending on the phosphorylation by a casein kinase II-like kinase. The cross-linking with salt-washed membrane proteins, however, is inhibited by non-phosphorylated MPR 300-CT, suggesting that different structural determinants in the MPR 300-CT interact with cytosol- and membrane...

  11. Acidos graxos com diferentes caracteristicas afetam o crescimento prostatico e a expressão dos receptores de androgeno (AR) e dos ativadores da proliferação dos peroxissomos y (PPARy)

    OpenAIRE

    Esdras Launi Oliveira Escobar

    2007-01-01

    Resumo: A próstata é uma glândula acessória do trato reprodutor masculino. Muitos são os fatores envolvidos no carcinogênese prostática. Os nutricionais são usualmente associados com a etiopatogenia do câncer de próstata, sendo que os ácidos graxos estão entre os mais importantes. O objetivo deste trabalho foi avaliar o efeito dos ácidos graxos presentes na dieta sobre o crescimento da próstata ventral de ratos, sobre a organização do tecido e sobre a expressão do receptor de andrógeno (AR) e...

  12. Análise da expressão de receptores de fator de crescimento epidérmico (EGFR) em folículos pericoronários

    OpenAIRE

    Cristina da Silva Baumgart

    2003-01-01

    Proposição: Avaliar a expressão de Receptores de Fator de Crescimento Epidérmico (EGFR) nos remanescentes do epitélio odontogênico em folículos pericoronários e em amostras de mucosa bucal normal e sua relação com a gênese de cistos e tumores odontogênicos. Materiais e Métodos: 20 folículos pericoronários de terceiros molares inferiores, completamente retidos, de pacientes com idade média de 18 anos e 16 amostras de mucosa bucal destes pacientes foram selecionadas e analisadas pelo método da ...

  13. Contaminantes emergentes: detectecção de histamina em solução aquosa e degradação de hidrocarbonetos policíclicos aromáticos da fração solúvel do petróleo utilizando processos oxidativos avançados

    OpenAIRE

    de Cássia Rodrigues de Souza, Rita

    2011-01-01

    Os contaminantes emergentes tem sido um assunto largamente discutido na comunidade cientifica, principalmente quando relacionado à poluição em ambientes aquáticos. Esses poluentes abrangem fármacos, cosméticos, surfactantes, aditivos para a gasolina, compostos orgânicos fluorados, corantes, hidrocarbonetos poliaromáticos, entre outros. Estes compostos, em sua maioria, são dificilmente detectados e geralmente não são degradados pelos métodos convencionais de tratamento (processo...

  14. Implicación de los receptores TLR4 en el daño cerebral causado por el consumo de alcohol

    OpenAIRE

    Alfonso Loeches, Silvia

    2012-01-01

    El abuso de alcohol puede causar daño cerebral y en ciertos casos cursa con neurodegeneración, aunque los mecanismos moleculares de estos efectos se desconocen. El Sistema Nervioso Central (SNC) ha sido considerado, hasta muy recientemente, como un sistema inmunológicamente privilegiado (Galea et al., 2007). Sin embargo, estudios de los últimos años indican que el cerebro coordina y regula numerosos aspectos de la respuesta inmune innata, y que la inflamación representa un factor crítico y e...

  15. Efeito da colite ulcerativa experimental sobre o receptor P2X7 no sistema nervoso entérico de ratos wistar.

    OpenAIRE

    Marcos Vinicius da Silva

    2011-01-01

    No trato digestório a colite ulcerativa apresenta necrose no intestino como processos patofisiológicos. Este projeto visou estudar neurônios com códigos químicos do sistema nervoso entérico (SNE) e a morfologia estrutural do intestino grosso de animais com colite ulcerativa. Grupos: a) Colite: injetados com TNBS, b) PBS: injetados com PBS e c) controle. Os tecidos foram preparados por métodos imunohistoquímicos de duplas marcações do receptor P2X7 com NOS, ChAT, Calb, Calr, anti-HuC/D (pan-ne...

  16. De muitos um – o Ethos da marca Harley Davidson

    Directory of Open Access Journals (Sweden)

    Bruna Panzarini

    2013-07-01

    Full Text Available Este estudo tem por objetivo mostrar como o discurso da marca Harley Davidson vem sendo produzido, e como o ethos da marca é formado, comunicado e compartilhado pelos próprios receptores. Como o receptor pode ser um codenunciador e efetivo participante do discurso da organização. Embasando-nos em teóricos que tratam da linguagem, a metodologia utilizada para desenvolver o presente trabalho foi a pesquisa bibliográfica e documental.

  17. De muitos um – o Ethos da marca Harley Davidson

    OpenAIRE

    Bruna Panzarini

    2013-01-01

    Este estudo tem por objetivo mostrar como o discurso da marca Harley Davidson vem sendo produzido, e como o ethos da marca é formado, comunicado e compartilhado pelos próprios receptores. Como o receptor pode ser um codenunciador e efetivo participante do discurso da organização. Embasando-nos em teóricos que tratam da linguagem, a metodologia utilizada para desenvolver o presente trabalho foi a pesquisa bibliográfica e documental.

  18. Estudo da modelagem molecular do receptor canabinóide CB1 e suas interações com o ∆9 - THC

    OpenAIRE

    Emmanuela Ferreira de Lima

    2009-01-01

    Marihuana (Cannabis sativa) é uma planta amplamente usada pelo ser humano há séculos e suas várias aplicações têm benefícios importantes. A planta Cannabis sativa tem sido usada pelo homem como comida, em práticas medicinais e rituais religiosos. Seus efeitos incluem analgesia, alteração na percepção, cognição, memória e atividade psicomotora. Os compostos canabinoides têm sido usados na quimioterapia do câncer e AIDS. No entanto, o uso da marijuana é um problema devido aos seus efeitos indes...

  19. The 18 kDa translocator protein (peripheral benzodiazepine receptor expression in the bone of normal, osteoprotegerin or low calcium diet treated mice.

    Directory of Open Access Journals (Sweden)

    Winnie Wai-Ying Kam

    Full Text Available The presence of the translocator protein (TSPO, previously named as the mitochondrial or peripheral benzodiazepine receptor, in bone cells was studied in vitro and in situ using RT-qPCR, and receptor autoradiography using the selective TSPO ligand PK11195.In vitro, the TSPO is highly expressed in osteoblastic and osteoclastic cells.In situ, constitutive expression of TSPO is found in bone marrow and trabecular bone, e.g., spongiosa. Mice with a reduction of bone turnover induced by a 4-day treatment of osteoprotegerin reduces [(3H]PK11195 binding in the spongiosa (320±128 Bq x mg(-1, 499±106 Bq x mg(-1 in saline-treated controls. In contrast, mice with an increase in bone turnover caused by a 4-day low calcium diet increases [(3H]PK11195 binding in the spongiosa (615±90 Bq x mg(-1. Further, our study includes technical feasibility data on [(18F]fluoride microPET imaging of rodent bone with altered turnover. Despite [(18F]fluoride having high uptake, the in vivo signal differences were small. Using a phantom model, we describe the spillover effect and partial volume loss that affect the quantitative microPET imaging of the small bone structures in experimental mouse models. In summary, we demonstrate the expression of TSPO in small rodent bone tissues, including osteoblasts and osteoclasts. A trend increase in TSPO expression was observed in the spongiosa from low to high bone turnover conditions. However, despite the potential utility of TSPO expression as an in vivo biomarker of bone turnover in experimental rodent models, our small animal PET imaging data using [(18F]fluoride show that even under the condition of a good biological signal-to-noise ratio and high tracer uptake, the currently achievable instrument sensitivity and spatial resolution is unlikely to be sufficient to detect subtle differences in small structures, such as mouse bone.

  20. Inhibition of EMMPRIN and MMP-9 Expression by Epigallocatechin-3-Gallate through 67-kDa Laminin Receptor in PMA-Induced Macrophages

    Directory of Open Access Journals (Sweden)

    Qi-Ming Wang

    2016-11-01

    Full Text Available Background/Aims: It is well documented that overexpression of EMMPRIN (extracellular matrix metalloproteinase inducer and MMPs (matrix metalloproteinases by monocytes/macrophages plays an important role in atherosclerotic plaque rupture. Green tea polyphenol epigallocatechin-3-gallate (EGCG has a variety of pharmacological properties and exerts cardiovascular protective effects. Recently, the 67-kD laminin receptor (67LR has been identified as a cell surface receptor of EGCG. The aim of the present study was to evaluate the effects of EGCG on the expression of EMMPRIN and MMP-9 in PMA-induced macrophages, and the potential mechanisms underlying its effects. Methods: Human monocytic THP-1 cells were induced to differentiate into macrophages with phorbol 12-myristate 13-acetate (PMA. Protein expression and MMP-9 activity were assayed by Western blot and Gelatin zymography, respectively. Real-time PCR was used to examine EMMPRIN and MMP-9 mRNA expression. Results: We showed that EGCG (10-50µmol/L significantly inhibited the expression of EMMPRIN and MMP-9 and activation of extracellular signal-regulated kinase 1/2 (ERK1/2, p38 and c-Jun N-terminal kinase (JNK in PMA-induced macrophages. Downregulation of EMMPRIN by gene silencing hindered PMA-induced MMP-9 secretion and expression, indicating an important role of EMMPRIN in the inhibition of MMP-9 by EGCG. Moreover, 67LR was involved in EGCG-mediated suppression of EMMPRIN and MMP-9 expression. Anti-67LR antibody treatment led to abrogation of the inhibitory action of EGCG on the expression of EMMPRIN and MMP-9 and activation of ERK1/2, p38, and JNK. Conclusion: Our results indicate that EGCG restrains EMMPRIN and MMP-9 expression via 67LR in PMA-induced macrophages, which also suggests that EGCG may be a possible therapeutic agent for stabilizing atherosclerotic plaque.

  1. Epigallocatechin-3-Gallate Inhibits Matrix Metalloproteinase-9 and Monocyte Chemotactic Protein-1 Expression Through the 67-κDa Laminin Receptor and the TLR4/MAPK/NF-κB Signalling Pathway in Lipopolysaccharide-Induced Macrophages

    Directory of Open Access Journals (Sweden)

    Ya-Fei Li

    2017-09-01

    Full Text Available Background/Aims: Epigallocatechin-3-gallate (EGCG, a major catechin found in green tea, has been shown to prevent cardiovascular diseases. Previously, Matrix metalloproteinase-9 (MMP-9, monocyte chemotactic protein-1 (MCP-1 and toll-like receptor 4 (TLR4 were confirmed to play an important role in atherosclerosis and plaque instability. Both TLR4 and its negative regulator, Toll-interacting protein (Tollip, could be mediated by EGCG. The present study aimed to examine the effect of physiological concentration of EGCG (1 µM on the expression of MMP-9 and MCP-1 in lipopolysaccharide (LPS-induced macrophages and the potential mechanisms underlying its actions. Methods: The RAW264.7 cell line was used. Western blot was used to determine MCP-1, TLR4, Tollip, Mitogen-activated protein kinase (MAPK and Nuclear factor-κB (NF-κB protein expression. MMP-9 activity was assayed by gelatine zymography. The mRNA expression of MMP-9 and MCP-1 was measured by realtime polymerase chain reaction (RT-PCR. Results: EGCG (1 µM significantly suppressed the expression of MMP-9 and MCP-1 and inhibited MAPK and NF-κB in LPS-induced macrophages but was blocked by Tollip silencing. The expression of LPS-induced MMP-9 and MCP-1 and the phosphorylation of the ERK1/2, P38 and NF-κB pathway proteins decreased after TLR4 siRNA treatment. Furthermore, EGCG mediated TLR4 and Tollip expression through binding to 67-kDa laminin receptor (67LR. Conclusion: The results of our study suggested that EGCG (1 µM suppresses the TLR4/MAPK/NF-κB signalling pathway, decreases the expression of the plaque instability-mediating cytokines MMP-9 and MCP-1, and might prove to be effective in stabilizing atherosclerotic plaque.

  2. Dopamine receptors - physiological understanding to therapeutic intervention potential

    NARCIS (Netherlands)

    Emilien, G; Maloteaux, JM; Hoogenberg, K; Cragg, S

    1999-01-01

    There are two families of dopamine (DA) receptors, called D(1) and D(2), respectively. The D(1) family consists of D(1)- and D(5)-receptor subtypes and the D(2) family consists of D(2)-, D(3)-, and D(4)-receptor subtypes. The amino acid sequences of these receptors show that they all belong to a

  3. Interação funcional entre o receptor do peptídeo liberador de gastrina (GRPR) e o fator de crescimento de fibroblastro básico (bFGF) na formação da memória no hipocampo dorsal

    OpenAIRE

    Thales Preissler

    2008-01-01

    O peptídeo liberador da gastrina (GRP), pertencente à família dos peptídeos semelhantes à bombesina, e seus receptores (GRPR) estão presentes em todo o sistema nervoso central, em particular em áreas límbicas cerebrais como o hipocampo e a amídala, as quais estão envolvidas de forma importante na regulação emocional, na função cognitiva e, possivelmente, em transtornos neuropsiquiátricos e neurodegenerativos. Crescentes evidências indicam que o receptor do peptídeo liberador de gastrina (GRPR...

  4. Influência da manutenção hemodinâmica do doador falecido na função renal do receptor de transplante renal

    Directory of Open Access Journals (Sweden)

    Ana Paula Maia Baptista

    2013-12-01

    Full Text Available INTRODUÇÃO: A incidência de função tardia do enxerto (FTE e função renal insatisfatória (FRI após o transplante renal é significativamente maior no Brasil comparada com aquela observada nos Estados Unidos ou na Europa. Fatores relacionados ao doador falecido (DF devem influenciar diretamente a ocorrência desses dois desfechos. OBJETIVO: Este estudo propõe-se a avaliar a influência das características do DF na incidência de FTE e FRI no Brasil. MÉTODOS: Variáveis clínicas e laboratoriais dos DF foram correlacionadas com a incidência de FTE e FRI. RESULTADOS: Foram avaliados 787 DF cujos órgãos foram transplantados em 1.298 pacientes. Notou-se elevada prevalência de uso de droga vasoativa (90,2%, hipernatremia (66,6% e disfunção renal (34,8%. A incidência de FTE foi de 60,6% e de FRI foi de 55,2%. Considerando as características dos DF, observamos um aumento progressivo no risco de desenvolvimento de FTE para faixas etárias acima de 30 anos e a partir de tempo de isquemia fria (TIF maior que 24 horas. O risco de FTE foi duas vezes maior em receptores de rim de doadores com creatinina sérica final (Cr superior a 1,5 mg/dl. Hipertensão arterial (HA e o TIF acima de 36 horas associou-se com aumentos de 82% e 99% no risco de FRI, respectivamente. A idade do doador acima de 40 anos associou-se com um aumento progressivo no risco de FRI. CONCLUSÃO: A idade, a função renal e a presença de hipertensão arterial no doador falecido, além do TIF prolongado, associaram-se com maior risco de FTE e FRI.

  5. Role of Dopamine Type 1 Receptors and Dopamine- and cAMP-Regulated Phosphoprotein Mr 32 kDa in Δ9-Tetrahydrocannabinol-Mediated Induction of ΔFosB in the Mouse Forebrain.

    Science.gov (United States)

    Lazenka, Matthew F; Tomarchio, Aaron J; Lichtman, Aron H; Greengard, Paul; Flajolet, Marc; Selley, Dana E; Sim-Selley, Laura J

    2015-09-01

    Δ(9)-Tetrahydrocannabinol (THC), the main psychoactive component of marijuana, produces motor and motivational effects via interactions with the dopaminergic system in the caudate-putamen and nucleus accumbens. However, the molecular events that underlie these interactions after THC treatment are not well understood. Our study shows that pretreatment with dopamine D1 receptor (D1R) antagonists before repeated administration of THC attenuated induction of Δ FBJ murine osteosarcoma viral oncogene homolog B (ΔFosB) in the nucleus accumbens, caudate-putamen, amygdala, and prefrontal cortex. Anatomical studies showed that repeated THC administration induced ΔFosB in D1R-containing striatal neurons. Dopamine signaling in the striatum involves phosphorylation-specific effects of the dopamine- and cAMP-regulated phosphoprotein Mr 32 kDa (DARPP-32), which regulates protein kinase A signaling. Genetic deletion of DARPP-32 attenuated ΔFosB expression measured after acute, but not repeated, THC administration in both the caudate-putamen and nucleus accumbens. THC was then acutely or repeatedly administered to wild-type (WT) and DARPP-32 knockout (KO) mice, and in vivo responses were measured. DARPP-32 KO mice exhibited enhanced acute THC-mediated hypolocomotion and developed greater tolerance to this response relative to the WT mice. Agonist-stimulated guanosine 5'-O-(3-[(35)S]thio)triphosphate ([(35)S]GTPγS) binding showed that cannabinoid-stimulated G-protein activity did not differ between DARPP-32 KO and WT mice treated with vehicle or repeated THC. These results indicate that D1Rs play a major role in THC-mediated ΔFosB induction in the forebrain, whereas the role of DARPP-32 in THC-mediated ΔFosB induction and modulation of motor activity appears to be more complex. Copyright © 2015 by The American Society for Pharmacology and Experimental Therapeutics.

  6. Psicofarmacologia de antidepressivos

    Directory of Open Access Journals (Sweden)

    Moreno Ricardo Alberto

    1999-01-01

    Full Text Available O advento de medicamentos antidepressivos tornou a depressão um problema médico, passível de tratamento. Nas últimas cinco décadas, a psicofarmacologia da depressão evoluiu muito e rapidamente. Os primeiros antidepressivos - os antidepressivos tricíclicos (ADTs e os inibidores da monaminooxidase (IMAOs - foram descobertos através da observação clínica. Os ADTs apresentavam boa eficácia devido à sua ação, aumentando a disponibilidade de norepinefrina e serotonina. Seu uso foi limitado em função do bloqueio de receptores de histamina, colinérgicos e alfa-adrenérgicos que acarretavam efeitos colaterais levando à baixa tolerabilidade e risco de toxicidade. Da mesma forma, o uso dos IMAOs ficava comprometido em função do risco da interação com tiramina e o risco de crises hipertensivas potencialmente fatais. A nova geração de antidepressivos é constituída por medicamentos que agem em um único neurotransmissor (como os inibidores seletivos de recaptação de serotonina ou de noradrenalina ou em múltiplos neurotransmissores/receptores, como venlafaxina, bupropion, trazodona, nefazodona e mirtazapina, sem ter como alvo outros sítios receptores cerebrais não relacionados com a depressão (tais como histamina e acetilcolina. Este artigo revisa a farmacologia dos antidepressivos, particularmente quanto ao mecanismo de ação, farmacocinética, efeitos colaterais e interações farmacológicas.

  7. Polimorfismos gênicos de citocinas e receptores envolvidos no processo inflamatório da carcinogênese gástrica e alterações nos níveis de expressão gênica

    OpenAIRE

    Oliveira, Juliana Garcia de [UNESP

    2011-01-01

    O câncer gástrico é uma doença caracterizada como multifatorial associada a fatores ambientais e genéticos. A carcinogênese do estômago pode progredir de uma inflamação crônica da mucosa gástrica, resultante da infecção pela bactéria Helicobacter pylori que ativa a resposta inflamatória do hospedeiro. Portanto, selecionamos um grupo de polimorfismos presentes em genes de citocinas pró-inflamatórias (IL8, TNFA e TNFB), anti-inflamatórias (IL10 e IL-1RN) e receptores de reconhecimento de padrõe...

  8. Role of dopamine D2 receptors in human reinforcement learning.

    Science.gov (United States)

    Eisenegger, Christoph; Naef, Michael; Linssen, Anke; Clark, Luke; Gandamaneni, Praveen K; Müller, Ulrich; Robbins, Trevor W

    2014-09-01

    Influential neurocomputational models emphasize dopamine (DA) as an electrophysiological and neurochemical correlate of reinforcement learning. However, evidence of a specific causal role of DA receptors in learning has been less forthcoming, especially in humans. Here we combine, in a between-subjects design, administration of a high dose of the selective DA D2/3-receptor antagonist sulpiride with genetic analysis of the DA D2 receptor in a behavioral study of reinforcement learning in a sample of 78 healthy male volunteers. In contrast to predictions of prevailing models emphasizing DA's pivotal role in learning via prediction errors, we found that sulpiride did not disrupt learning, but rather induced profound impairments in choice performance. The disruption was selective for stimuli indicating reward, whereas loss avoidance performance was unaffected. Effects were driven by volunteers with higher serum levels of the drug, and in those with genetically determined lower density of striatal DA D2 receptors. This is the clearest demonstration to date for a causal modulatory role of the DA D2 receptor in choice performance that might be distinct from learning. Our findings challenge current reward prediction error models of reinforcement learning, and suggest that classical animal models emphasizing a role of postsynaptic DA D2 receptors in motivational aspects of reinforcement learning may apply to humans as well.

  9. Transmissão da doença de Chagas por transplante renal: ocorrência da forma aguda da doença em dois receptores de um mesmo doador Transmission of Chagas' disease through transplantede kidney: occurrence of the acute form of the disease in two recipients from the same donor

    Directory of Open Access Journals (Sweden)

    A.S. Ferraz

    1993-10-01

    Full Text Available São apresentados dois casos de doença de Chagas aguda, adquiridos através de transplante de rins originários de um mesmo doador. O presente relato confirma a transmissão da doença de Chagas a partir do transplante renal e reforça a necessidade de exclusão de doadores renais infectados pelo Trypanosoma cruzi.Two cases of acute Chagas' disease acquired after renal transplantation are reported. The two patients received the kidney from the same donor. The present paper confirms this form of transmission of Chagas' disease and reinforces the need to exclude kidney donors with Trypanosoma cruzi infection.

  10. Uso da gonadotrofina coriônica eqüina em receptoras de embriões para avaliar o incremento da progesterona endógena no dia da inovulação e sua correlação com a taxa de prenhez Use of equine chorionic gonadotrophin in heifers embryo receptors to evaluate the increment of endogenous progesterone in the inovulation day in relation to pregnancy rate

    Directory of Open Access Journals (Sweden)

    Carlos Martins Rodrigues

    2002-04-01

    Full Text Available O experimento foi realizado com a finalidade de avaliar a influência da administração de gonadotrofina coriônica eqüina (eCG em receptoras de embrião na formação de corpos lúteos acessórios e a correlação com o índice de prenhez. Utilizaram-se 64 novilhas de 18 a 30 meses de idade, mestiças Simental, com peso médio de 400 kg, as quais foram avaliadas por palpação retal, entre os dias 7 e 12 após a manifestação do cio, considerado como cio base. Neste intervalo de 7 a 12 dias após o cio, definido como dia zero (D0, os animais que se encontravam com corpo lúteo fisiológico foram divididos, aleatoriamente, em 4 tratamentos, sendo que os animais do tratamento 1 (controle, n=21, receberam solução fisiológica, via intramuscular (IM; no tratamento 2 (n=14 receberam 200 UI de eCG (FOLLIGON® - Intervet, via IM; no tratamento 3 (n=16, receberam 400 UI de eCG, via IM; e no tratamento 4 (n=13, receberam 600 UI de eCG, via IM. Transcorridos 2 dias (D2 da aplicação do eCG, administrou-se 2 mL de prostaglandina F2 alfa (PROSOLVIN® - Intervet por animal. Em seguida, observou-se a manifestação de cio e, 7 dias após a sua detecção, avaliou-se os animais, por ultrassonografia, para seleção das fêmeas aptas a receber os embriões congelados. Vinte e três dias após a inovulação, procedeu-se ao diagnóstico de prenhez por ultrassonografia. Não houve diferença (P > 0,05 para a taxa de prenhez. Concluiu-se que o uso de eCG em receptoras de embrião congelado não melhorou os índices de aproveitamento das receptoras nem a taxa de prenhez.The experiment was carried out to evaluate the influence of pregnant Mare Serum Gonadotrophin (eCG administration in embryo receptors on the formation of accessory corpus luteum and correlation with the pregnancy rate. Sixty-four beef cattle heifers -18 to 30 months old were used, ½ Simental, with 400 kg of average live weight. The heifers were evaluated through rectal palpation between days

  11. Structure and function of the androgen receptor.

    Science.gov (United States)

    Brinkmann, A O; Klaasen, P; Kuiper, G G; van der Korput, J A; Bolt, J; de Boer, W; Smit, A; Faber, P W; van Rooij, H C; Geurts van Kessel, A

    1989-01-01

    The androgen receptor in several species (human, rat, calf) is a monomeric protein with a molecular mass of 100-110 kDa. The steroid binding domain is confined to a region of 30 kDa, while the DNA-binding domain has the size of approx. 10 kDa. A 40 kDa fragment containing both the DNA and steroid binding domain displayed a higher DNA binding activity than did the intact 100 kDa molecule. cDNA encoding the major part of the human androgen receptor was isolated. The cDNA contains an open reading frame of 2,277 bp but still lacks part of the 5'-coding sequence. Homology with the progesterone and glucocorticoid receptor was about 80% in the DNA binding domain and 50% in the steroid binding domain. The present data provide evidence that the androgen receptor belongs to the superfamily of ligand responsive transcriptional regulators and consists of three distinct domains each with a specialized function.

  12. Synergistic suppression of pre-perfusion of donor livers with recipient serum and cobra venom factor treatment on hyperacute rejection following liver xenotransplantation Supressão sinérgica da rejeição hiperaguda no xenotransplante hepático com uso da pre-perfusão dos fígados doadores tratados com soro do receptor e com fator veneno de cobra

    Directory of Open Access Journals (Sweden)

    Baohua Zhu

    2012-05-01

    Full Text Available PURPOSE: To investigate synergistic suppression of donor liver pre-perfusion with recipient serum (RS and cobra venom factor (CVF treatment on hyperacute rejection (HAR following liver xenotransplantation. METHODS: Guinea-pigs (GP, n=24 and Sprague-Dawley rats (SD, n=24 were recruited. Before transplantation, serum was collected from SD rats and used for preparation of inactivated complements. GP and SD rats were randomly assigned into four groups (n=6, respectively: RS group, CVF group, RS+CVF group and control group. Orthotopic liver xenotransplantation was performed with modified two-cuff technique. The survival time and liver function of recipients, morphological and pathological changes in rat livers were investigated. RESULTS: There was no piebald like change in the recipient livers in all experiment groups. The survival time of recipients in all experiment groups was longer than that in control group (pOBJETIVO: Investigar a supressão sinérgica da pré-perfusão do doador de fígado com soro do receptor (SR e tratamento com fator veneno de cobra (FVC na rejeição hiperaguda (RHA após o xenotransplante de fígado. MÉTODOS: Foram utilizados Cobaias (GP, n=24 e ratos Sprague-Dawley (SD, n=24. Antes do transplante foram coletadas amostras de soro dos ratos SD e usados para a preparação dos complementos inativados. Cobaias GP e ratos SD foram randomicamente distribuídos em quatro grupos (n=6, respectivamente: grupo RS, grupo FVC, grupo SR+FVC e grupo controle. Xenotransplante ortotópico do fígado foi realizado com a técnica de dois cuffs modificados. Foram investigados o de tempo de sobrevida, a função hepática dos receptores e alterações morfopatológicas em fígados de ratos. RESULTADOS: Não houve alteração na coloração do parênquima dos fígados nos receptores. O tempo de sobrevida dos receptores em todos os grupos experimentais foi mais longo do que o grupo controle (p<0,05. Além disso, o tempo de sobrevida do grupo

  13. Efeito hiperpolarizante do isoproterenol na membrana da célula de sertoli de ratos imaturos : envolvimento dos receptores beta2-adrenérgicos e dos canais K+ATP

    OpenAIRE

    Ana Paula Jacobus

    2004-01-01

    No presente estudo, foi investigado o mecanismo pelo qual, o isoproterenol hiperpolariza o potencial de membrana (PM) da célula de Sertoli em túbulos seminíferos de ratos, com quinze dias de idade (imaturos). Foram analisadas a modificação do potencial de membrana e a resistência, utilizando-se a técnica de registro intracelular. O isoproterenol (2x10-6M) induziu uma hiperpolarização imediata e significativa na membrana da célula de Sertoli. O antagonista β2-adrenérgico butoxamina (1x10-6M) a...

  14. Dopamine D2 receptor occupancy by olanzapine or risperidone in young patients with schizophrenia

    NARCIS (Netherlands)

    Lavalaye, J.; Linszen, D. H.; Booij, J.; Reneman, L.; Gersons, B. P.; van Royen, E. A.

    1999-01-01

    A crucial characteristic of antipsychotic medication is the occupancy of the dopamine (DA) D2 receptor. We assessed striatal DA D2 receptor occupancy by olanzapine and risperidone in 36 young patients [31 males, 5 females; mean age 21.1 years (16-28)] with first episode schizophrenia, using

  15. Role of Dopaminergic Receptors in Glaucomatous Disease Modulation

    Directory of Open Access Journals (Sweden)

    Nicola Pescosolido

    2013-01-01

    Full Text Available Both studies on animals and humans suggest the presence of dopamine (DA receptors in the anterior segment of the eye. Their role in the dynamics of intraocular pressure (IOP is not yet clear. DA2 and DA3 receptors are mainly located on postganglionic sympathetic nerve endings. Their stimulation reduces the release of norepinephrine and suppresses the production of aqueous humor. DA1 receptors seem to be more expressed by the ciliary body and the outflow pathway of aqueous humor. The administration of DA1-selective agonists stimulates the production of aqueous humor, increasing IOP, whereas DA2- and DA3-selective agonists could reduce IOP and, therefore, the risk to develop a glaucoma (GL. GL is a broad spectrum of eye diseases which have in common the damage to the optic nerve and the progressive loss of the visual field. Further studies are desirable to clarify the role of the dopaminergic system and the usefulness of DA2 and DA3 agonists in reducing IOP.

  16. Caffeine increases striatal dopamine D2/D3 receptor availability in the human brain

    OpenAIRE

    Volkow, N.D.; Wang, G-J; Logan, J; Alexoff, D; Fowler, J.S.; Thanos, P K; Wong, C.; Casado, V.; Ferre, S.; Tomasi, D

    2015-01-01

    Caffeine, the most widely consumed psychoactive substance in the world, is used to promote wakefulness and enhance alertness. Like other wake-promoting drugs (stimulants and modafinil), caffeine enhances dopamine (DA) signaling in the brain, which it does predominantly by antagonizing adenosine A2A receptors (A2AR). However, it is unclear if caffeine, at the doses consumed by humans, increases DA release or whether it modulates the functions of postsynaptic DA receptors through its interactio...

  17. The role of N-methyl-D-aspartate receptors and nitric oxide in cochlear dopamine release

    NARCIS (Netherlands)

    Halmos, Gyorgy; Horvath, T.; Polony, G.; Fekete, A.; Kittel, A.; Vizi, E. S.; van der Laan, B. F. A. M.; Zelles, T.; Lendvai, B.

    2008-01-01

    Dopamine (DA) released from lateral olivocochlear (LOC) terminals may have a neuroprotective effect in the cochlea. To explore the role of N-methyl-D-aspartate (NMDA) receptors and nitric oxide (NO) in the modulation of a cochlear DA release, we measured the release of [(3)H]DA from isolated mouse

  18. Expression of dopamine receptors in immune organs and circulating immune cells.

    Science.gov (United States)

    Ricci, A; Mariotta, S; Greco, S; Bisetti, A

    1997-01-01

    The existence of dopamine (DA) D1- and D2-like receptors in the rat and pigeon thymus and in human peripheral blood lymphocytes was investigated. The selective D1-like antagonist [3H]-SCH 23390 was used as a ligand of DA D1-like receptors (D1 and D5 sites). Pharmacological analysis suggests that binding of [3H]-SCH 23390 to sections of thymus and to human peripheral blood lymphocytes belongs mainly to the dopamine D5 receptor subtype. Light microscope autoradiography, performed in sections of rat and pigeon thymus, revealed that these receptors are located primarily in the cortical layer. DA D2-like receptors (D2, D3 and D4 sites) were studied in sections of rat thymus and in peripheral blood lymphocytes by using the putative DA D3 receptor agonist [3H]-7-OH-DPAT as a ligand. Both rat and pigeon thymus and human peripheral blood lymphocytes express a putative DA D3 receptor. These data are in agreement with recent molecular biology studies performed in human peripheral blood lymphocytes. The demonstration of different subtypes of DA receptors in a primary immune organ such as the thymus and in circulating immune cells supports the hypothesis of an involvement of DA in the control of immune function.

  19. The importance of the adenosine A(2A) receptor-dopamine D(2) receptor interaction in drug addiction.

    Science.gov (United States)

    Filip, M; Zaniewska, M; Frankowska, M; Wydra, K; Fuxe, K

    2012-01-01

    Drug addiction is a serious brain disorder with somatic, psychological, psychiatric, socio-economic and legal implications in the developed world. Illegal (e.g., psychostimulants, opioids, cannabinoids) and legal (alcohol, nicotine) drugs of abuse create a complex behavioral pattern composed of drug intake, withdrawal, seeking and relapse. One of the hallmarks of drugs that are abused by humans is that they have different mechanisms of action to increase dopamine (DA) neurotransmission within the mesolimbic circuitry of the brain and indirectly activate DA receptors. Among the DA receptors, D(2) receptors are linked to drug abuse and addiction because their function has been proven to be correlated with drug reinforcement and relapses. The recognition that D(2) receptors exist not only as homomers but also can form heteromers, such as with the adenosine (A)(2A) receptor, that are pharmacologically and functionally distinct from their constituent receptors, has significantly expanded the range of potential drug targets and provided new avenues for drug design in the search for novel drug addiction therapies. The aim of this review is to bring current focus on A(2A) receptors, their physiology and pharmacology in the central nervous system, and to discuss the therapeutic relevance of these receptors to drug addiction. We concentrate on the contribution of A(2A) receptors to the effects of different classes of drugs of abuse examined in preclinical behavioral experiments carried out with pharmacological and genetic tools. The consequences of chronic drug treatment on A(2A) receptor-assigned functions in preclinical studies are also presented. Finally, the neurochemical mechanism of the interaction between A(2A) receptors and drugs of abuse in the context of the heteromeric A(2A)-D(2) receptor complex is discussed. Taken together, a significant amount of experimental analyses provide evidence that targeting A(2A) receptors may offer innovative translational strategies

  20. Purification and affinity labeling of dihydropyridine receptor from rabbit skeletal muscle membranes

    Energy Technology Data Exchange (ETDEWEB)

    Kanngiesser, U.; Nalik, P.; Pongs, O.

    1988-05-01

    Undegraded dihydropyridine (DHP)-receptor (putatively a voltage-gated Ca/sup 2 +/ channel) has been purified as a 340-kDa protein complex to approx.80% homogeneity (2.4 nmol of DHP-receptor per mg of protein) from rabbit skeletal muscle by a rapid purification protocol. Transverse-tubule membranes were prepared in high yield by Ribi-press treatment. The DHP-receptor complex was solubilized in 1% digitonin followed by a two step-chromatographic purification procedure. The equilibrium dissociation constant of (/sup 3/H) (+) -PN200-110 binding (K/sub d/; 0.9 nM) was not significantly changed by solubilization or purification. The purified DHP-receptor is composed of two subunits with apparent molecular masses of 148 kDa and 195 kDa migrating in polyacrylamide gels under nonreducing conditions as a single moiety of approx.300 kDa. The 195-kDa subunit was affinity-labeled with (/sup 3/H)azidopine in both transverse-tubule membranes and purified DHP-receptor preparations. The subunit can be degraded by high-energy irradiation to a 26-kDa peptide and by proteolysis to a 32-kDa peptide. Thus, it is probably due to proteolytic cleavage and/or photolysis that neither purification nor affinity-labeling studies have previously identified a DHP-receptor subunit of comparable molecular mass (195 kDa).

  1. Epidemiology of neglected tropical diseases in transplant recipients: review of the literature and experience of a Brazilian HSCT center Epidemiologia das doenças tropicais negligenciadas em receptores de transplantes: revisão da literatura e experiência de um centro brasileiro

    Directory of Open Access Journals (Sweden)

    Clarisse Martins Machado

    2009-12-01

    Full Text Available The rising success rate of solid organ (SOT and haematopoietic stem cell transplantation (HSCT and modern immunosuppression make transplants the first therapeutic option for many diseases affecting a considerable number of people worldwide. Consequently, developing countries have also grown their transplant programs and have started to face the impact of neglected tropical diseases (NTDs in transplant recipients. We reviewed the literature data on the epidemiology of NTDs with greatest disease burden, which have affected transplant recipients in developing countries or may represent a threat to transplant recipients living in other regions. Tuberculosis, Leprosy, Chagas disease, Malaria, Leishmaniasis, Dengue, Yellow fever and Measles are the topics included in this review. In addition, we retrospectively revised the experience concerning the management of NTDs at the HSCT program of Amaral Carvalho Foundation, a public transplant program of the state of São Paulo, Brazil.O sucesso crescente dos transplantes de órgãos sólidos (TOS e de células tronco-hematopoiéticas (TCTH e as novas drogas imunossupressoras fizeram dos transplantes a primeira opção terapêutica para muitas doenças que afetam milhares de pessoas em todo o mundo. Também os populosos países em desenvolvimento investiram no crescimento de seus programas de transplante e desde então começaram a vivenciar o impacto das doenças tropicais negligenciadas (DTNs nestes pacientes. Revisamos os dados da literatura sobre a epidemiologia das DTNs de maior impacto clinico e social que afetam receptores de transplante de países em desenvolvimento, ou que podem representar um risco para receptores de transplante vivendo em outras regiões não afetadas por estas doenças. Tuberculose, hanseníase, doença de Chagas, malaria, leishmaniose, dengue, febre amarela e sarampo são os tópicos incluídos nesta revisão. Além disso, revisamos retrospectivamente a experiência referente ao

  2. Pharmacological properties of the mouse neurotensin receptor 3. Maintenance of cell surface receptor during internalization of neurotensin.

    Science.gov (United States)

    Navarro, V; Martin, S; Sarret, P; Nielsen, M S; Petersen, C M; Vincent, J; Mazella, J

    2001-04-20

    We recently reported the molecular identification of a new type of receptor for the neuropeptide neurotensin (NT), the neurotensin receptor 3 (NTR3), identical to sortilin, which binds receptor-associated protein. Here, we demonstrate that the cloned mouse NTR3 is expressed on the plasma membrane of transfected COS-7 cells. The mouse NTR3 is detectable by photoaffinity labeling and immunoblotting at the cell surface as a 100 kDa N-glycosylated protein. Biochemical analysis and confocal microscopic imaging clearly indicate that NT is efficiently internalized after binding to NTR3, and that despite this internalization, the amount of receptor present on the cell surface is maintained.

  3. The androgen receptor and estrogen receptor

    NARCIS (Netherlands)

    Oosterkamp, H.M.; Bernards, R.A.

    2002-01-01

    The androgen receptor (AR) and the estrogen receptors (ER) are members of the nuclear receptor (NR) family. These NRs are distinguished from the other transcription factors by their ability to control gene expression upon ligand binding (steroids, retinoids, thyroid hormone, vitamin D, fatty

  4. Estrogen receptor, progesterone receptor, and human epidermal ...

    African Journals Online (AJOL)

    Current clinical practice employs the use of estrogen receptor (ER), progesterone receptor (PR), and human epidermal growth factor receptor 2 (HER2), as biomarkers to appropriately select patients that would benefit from targeted therapy against these major molecular pathways of the disease. This study aims at ...

  5. Linking Functional Domains of the Human Insulin Receptor with the Bacterial Aspartate Receptor

    Science.gov (United States)

    Ellis, Leland; Morgan, David O.; Koshland, Daniel E.; Clauser, Eric; Moe, Gregory R.; Bollag, Gideon; Roth, Richard A.; Rutter, William J.

    1986-11-01

    A hybrid receptor has been constructed that is composed of the extracellular domain of the human insulin receptor fused to the transmembrane and cytoplasmic domains of the bacterial aspartate chemoreceptor. This hybrid protein can be expressed in rodent (CHO) cells and displays several functional features comparable to wild-type insulin receptor. It is localized to the cell surface, binds insulin with high affinity, forms oligomers, and is recognized by conformation-specific monoclonal antibodies. Although most of the expressed protein accumulates as a 180-kDa proreceptor, some processed 135-kDa receptor can be detected on the cell surface by covalent cross-linking. Expression of the hybrid receptor inhibits the insulin-activated uptake of 2-deoxyglucose by CHO cells. Thus, this hybrid is partially functional and can be processed; however, it is incapable of native transmembrane signaling. The results indicate that the intact domains of different types of receptors can retain some of the native features in a hybrid molecule but specific requirements will need to be satisfied for transmembrane signaling.

  6. Caracterização da população dos receptores em lista e os submetidos ao transplante de pâncreas e pâncreas-rim Caracterización de la población de los receptores en lista y los que fueron sometidos a el trasplante de páncreas y páncreas-riñon Characterization of the receptor population as listed and those who were submitted to pancreas and pancreas-kidney transplantation

    Directory of Open Access Journals (Sweden)

    Vivian Cintra

    2008-04-01

    Full Text Available Cerca de 1 milhão de casos do transplante foram registrados no mundo. O primeiro transplante de Pãncreas no Brasil data de 1996, realizado por uma equipe médica de São Paulo. Este trabalho teve como objetivo caracterizar o perfil sócio-demográfico e epidemiológico dos receptores em lista e os submetidos a este procedimento. Trata-se de estudo um estudo inter-relacional retrospectivo compreendendo o período de 1996 a 2004. O estudo revelou a predominância de mulheres, da raça branca e, com média de idade de 35 anos. A procedência dos pacientes foi dos estados de São Paulo e Minas Gerais.Cerca de 1 millón de casos de trasplante fueron registrados en el mundo. El primer transplante tiene origen en 1996 in Brasil por un equipo de médicos de San Pablo. El objetivo de esto estudio fué caracterizar el perfil sociodemográfico y epidemiológico de los receptores en lista y los sometidos a esto procedimiento. Tratase de un estudio inter-relacional retrospectivo, que consideró el periodo de 1996 al 2004. El estudio reveló la predomináncia de mujeres de la raza blanca y, con media de edad de 35 años. La procedencia de los pacientes fueram los estados de San Pablo y Minas Gerais.About 1 million cases of transplantation were registered around the world. The first Pancreas transplantation in Brazil was in 1996, proceeded by a medical team of São Paulo. The objetctive of this study was to characterize the socio- demographic and epidemiological profile of the receivers in list and those submitted to this procedure. It is an inter-relational retrospective study considereing the period from 1996 to 2004. Results demonstrated the predominance of women, from white race, and, with an average of 35 years. The origin of the patients was the states of São Paulo and Minas Gerais.

  7. Dimers of G-Protein Coupled Receptors as Versatile Storage and Response Units

    Directory of Open Access Journals (Sweden)

    Michael S. Parker

    2014-03-01

    Full Text Available The status and use of transmembrane, extracellular and intracellular domains in oligomerization of heptahelical G-protein coupled receptors (GPCRs are reviewed and for transmembrane assemblies also supplemented by new experimental evidence. The transmembrane-linked GPCR oligomers typically have as the minimal unit an asymmetric ~180 kDa pentamer consisting of receptor homodimer or heterodimer and a G-protein αβγ subunit heterotrimer. With neuropeptide Y (NPY receptors, this assembly is converted to ~90 kDa receptor monomer-Gα complex by receptor and Gα agonists, and dimers/heteropentamers are depleted by neutralization of Gαi subunits by pertussis toxin. Employing gradient centrifugation, quantification and other characterization of GPCR dimers at the level of physically isolated and identified heteropentamers is feasible with labeled agonists that do not dissociate upon solubilization. This is demonstrated with three neuropeptide Y (NPY receptors and could apply to many receptors that use large peptidic agonists.

  8. The Role of GABAA Receptors in the Development of Alcoholism

    Science.gov (United States)

    Enoch, Mary-Anne

    2008-01-01

    Alcoholism is a common, heritable, chronic relapsing disorder. GABAA receptors undergo allosteric modulation by ethanol, anesthetics, benzodiazepines and neurosteroids and have been implicated in the acute as well as the chronic effects of ethanol including tolerance, dependence and withdrawal. Medications targeting GABAA receptors ameliorate the symptoms of acute withdrawal. Ethanol induces plasticity in GABAA receptors: tolerance is associated with generally decreased GABAA receptor activation and differentially altered subunit expression. The dopamine (DA) mesolimbic reward pathway originating in the ventral tegmental area (VTA), and interacting stress circuitry play an important role in the development of addiction. VTA GABAergic interneurons are the primary inhibitory regulators of DA neurons and a subset of VTA GABAA receptors may be implicated in the switch from heavy drinking to dependence. GABAA receptors modulate anxiety and response to stress; important elements of sustained drinking and relapse. The GABAA receptor subunit genes clustered on chromosome 4 are highly expressed in the reward pathway. Several recent studies have provided strong evidence that one of these genes, GABRA2, is implicated in alcoholism in humans. The influence of the interaction between ethanol and GABAA receptors in the reward pathway on the development of alcoholism together with genetic and epigenetic vulnerabilities will be explored in this review. PMID:18440057

  9. Molecular characterization of a novel human hybrid-type receptor that binds the alpha2-macroglobulin receptor-associated protein

    DEFF Research Database (Denmark)

    Jacobsen, Linda; Madsen, P; Moestrup, S K

    1996-01-01

    The 39-40-kDa receptor-associated protein (RAP) binds to the members of the low density lipoprotein receptor gene family and functions as a specialized endoplasmic reticulum/Golgi chaperone. Using RAP affinity chromatography, we have purified a novel approximately 250-kDa brain protein and isolated...... the corresponding cDNA. The gene, designated SORL1, maps to chromosome 11q 23/24 and encodes a 2214-residue type 1 receptor containing a furin cleavage site immediately preceding the N terminus determined in the purified protein. The receptor, designated sorLA-1, has a short cytoplasmic tail containing a tyrosine......-based internalization signal and a large external part containing (from the N-terminal): 1) a segment homologous to domains in the yeast vacuolar protein sorting 10 protein, Vps10p, that binds carboxypeptidase Y, 2) five tandemly arranged YWTD repeats and a cluster of 11 class A repeats characteristic of the low...

  10. Role of D2 dopamine receptors of the ventral pallidum in inhibitory avoidance learning.

    Science.gov (United States)

    Lénárd, László; Ollmann, Tamás; László, Kristóf; Kovács, Anita; Gálosi, Rita; Kállai, Veronika; Attila, Tóth; Kertes, Erika; Zagoracz, Olga; Karádi, Zoltán; Péczely, László

    2017-03-15

    In our present experiments, the role of D2 dopamine (DA) receptors of the ventral pallidum (VP) was investigated in one trial step-through inhibitory avoidance paradigm. Animals were shocked 3 times in the conditioning trial, with 0.5mA current for 1s. Subsequently bilateral microinjection of the D2 DA receptor agonist quinpirole was administered into the VP in three doses (0.1μg, 1.0μg or 5.0μg in 0.4μl saline). We also applied the D2 DA receptor antagonist sulpiride (0.4μg in 0.4μl saline) alone or 15min prior to the agonist treatment to elucidate whether the agonist effect was specific for the D2 DA receptors. Control animals received saline. In a supplementary experiment, it was also investigated whether application of the same conditioning method leads to the formation of short-term memory in the experimental animals. In the experiment with the D2 DA receptor agonist, only the 0.1μg quinpirole increased significantly the step-through latency during the test trials: retention was significant compared to the controls even 2 weeks after conditioning. The D2 DA receptor antagonist sulpiride pretreatment proved that the effect was due to the agonist induced activation of the D2 DA receptors of the VP. The supplementary experiment demonstrated that short-term memory is formed after conditioning in the experimental animals, supporting that the agonist enhanced memory consolidation in the first two experiments. Our results show that the activation of the D2 DA receptors in the VP facilitates memory consolidation as well as memory-retention in inhibitory avoidance paradigm. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. Avaliação da expressão de interleucina 1 beta (IL-1β e antagonista do receptor de interleucina 1 (IL-1Ra em pacientes com hanseníase Evaluation of the expression of interleukin 1 beta(IL-1β and interleukin 1 receptor antagonist (IL-1Ra in leprosy patients

    Directory of Open Access Journals (Sweden)

    Rosane Dias Costa

    2008-01-01

    Full Text Available A hanseníase é uma doença infectocontagiosa espectral que acompanha-se por uma série de eventos imunológicos desencadeados pela resposta do hospedeiro frente ao agente etiológico, o Mycobacterium leprae. Evidências sugerem que a indução e manutenção da resposta imune/inflamatória na hanseníase estão vinculadas a interações de múltiplas células e fatores solúveis, particularmente através da ação de citocinas. Nesse estudo, foram mensurados níveis de IL-1β e IL-1Ra de 37 casos novos de hanseníase acompanhados ao longo do tratamento e 30 controles sadios pelo teste ELISA. A coleta de sangue periférico foi realizada em quatro tempos para os casos de hanseníase (pré-tratamento com PQT, 2ª dose, 6ª dose e pós-PQT e em único momento para os controles. Na comparação dos níveis das moléculas de casos no pré-PQT e controles, houve diferença estatisticamente significativa somente para IL-1β. Nossos resultados sugerem a participação dessa citocina no processo imune/inflamatório.Leprosy is an infectious and contagious spectral disease accompanied by a series of immunological events triggered by the host's response to the etiologic agent, Mycobacterium leprae. Evidence suggests that the induction and maintenance of the immune/inflammatory response in leprosy are linked to multiple cell interactions and soluble factors, mainly through the action of cytokines. The ELISA test was used to measure the levels of IL-1β and IL-1Ra in 37 new leprosy patients followed-up during treatment and 30 healthy controls. Peripheral blood was collected four times during the treatment of leprosy patients (MDT pretreatment, 2nd dose, 6th dose and post-MDT, and only once from the controls. The comparison of molecular levels in pre-MDT patients and controls showed a statistically significant difference for IL-1β. The results suggest the participation of this cytokine in the genesis of the immune/inflammatory process.

  12. Neurohumoral activation in heart failure: the role of adrenergic receptors

    Directory of Open Access Journals (Sweden)

    Patricia C. Brum

    2006-09-01

    Full Text Available Heart failure (HF is a common endpoint for many forms of cardiovascular disease and a significant cause of morbidity and mortality. The development of end-stage HF often involves an initial insult to the myocardium that reduces cardiac output and leads to a compensatory increase in sympathetic nervous system activity. Acutely, the sympathetic hyperactivity through the activation of beta-adrenergic receptors increases heart rate and cardiac contractility, which compensate for decreased cardiac output. However, chronic exposure of the heart to elevated levels of catecholamines released from sympathetic nerve terminals and the adrenal gland may lead to further pathologic changes in the heart, resulting in continued elevation of sympathetic tone and a progressive deterioration in cardiac function. On a molecular level, altered beta-adrenergic receptor signaling plays a pivotal role in the genesis and progression of HF. beta-adrenergic receptor number and function are decreased, and downstream mechanisms are altered. In this review we will present an overview of the normal beta-adrenergic receptor pathway in the heart and the consequences of sustained adrenergic activation in HF. The myopathic potential of individual components of the adrenergic signaling will be discussed through the results of research performed in genetic modified animals. Finally, we will discuss the potential clinical impact of beta-adrenergic receptor gene polymorphisms for better understanding the progression of HF.A insuficiência cardíaca (IC é a via final comum da maioria das doenças cardiovasculares e uma das maiores causas de morbi-mortalidade. O desenvolvimento do estágio final da IC freqüentemente envolve um insulto inicial do miocárdio, reduzindo o débito cardíaco e levando ao aumento compensatório da atividade do sistema nervoso simpático (SNS. Existem evidências de que apesar da exposição aguda ser benéfica, exposições crônicas a elevadas concentra

  13. Dopamine acting at D1-like, D2-like and α1-adrenergic receptors differentially modulates theta and gamma oscillatory activity in primary motor cortex.

    Science.gov (United States)

    Özkan, Mazhar; Johnson, Nicholas W; Sehirli, Umit S; Woodhall, Gavin L; Stanford, Ian M

    2017-01-01

    The loss of dopamine (DA) in Parkinson's is accompanied by the emergence of exaggerated theta and beta frequency neuronal oscillatory activity in the primary motor cortex (M1) and basal ganglia. DA replacement therapy or deep brain stimulation reduces the power of these oscillations and this is coincident with an improvement in motor performance implying a causal relationship. Here we provide in vitro evidence for the differential modulation of theta and gamma activity in M1 by DA acting at receptors exhibiting conventional and non-conventional DA pharmacology. Recording local field potentials in deep layer V of rat M1, co-application of carbachol (CCh, 5 μM) and kainic acid (KA, 150 nM) elicited simultaneous oscillations at a frequency of 6.49 ± 0.18 Hz (theta, n = 84) and 34.97 ± 0.39 Hz (gamma, n = 84). Bath application of DA resulted in a decrease in gamma power with no change in theta power. However, application of either the D1-like receptor agonist SKF38393 or the D2-like agonist quinpirole increased the power of both theta and gamma suggesting that the DA-mediated inhibition of oscillatory power is by action at other sites other than classical DA receptors. Application of amphetamine, which promotes endogenous amine neurotransmitter release, or the adrenergic α1-selective agonist phenylephrine mimicked the action of DA and reduced gamma power, a result unaffected by prior co-application of D1 and D2 receptor antagonists SCH23390 and sulpiride. Finally, application of the α1-adrenergic receptor antagonist prazosin blocked the action of DA on gamma power suggestive of interaction between α1 and DA receptors. These results show that DA mediates complex actions acting at dopamine D1-like and D2-like receptors, α1 adrenergic receptors and possibly DA/α1 heteromultimeric receptors to differentially modulate theta and gamma activity in M1.

  14. Dopamine acting at D1-like, D2-like and α1-adrenergic receptors differentially modulates theta and gamma oscillatory activity in primary motor cortex.

    Directory of Open Access Journals (Sweden)

    Mazhar Özkan

    Full Text Available The loss of dopamine (DA in Parkinson's is accompanied by the emergence of exaggerated theta and beta frequency neuronal oscillatory activity in the primary motor cortex (M1 and basal ganglia. DA replacement therapy or deep brain stimulation reduces the power of these oscillations and this is coincident with an improvement in motor performance implying a causal relationship. Here we provide in vitro evidence for the differential modulation of theta and gamma activity in M1 by DA acting at receptors exhibiting conventional and non-conventional DA pharmacology. Recording local field potentials in deep layer V of rat M1, co-application of carbachol (CCh, 5 μM and kainic acid (KA, 150 nM elicited simultaneous oscillations at a frequency of 6.49 ± 0.18 Hz (theta, n = 84 and 34.97 ± 0.39 Hz (gamma, n = 84. Bath application of DA resulted in a decrease in gamma power with no change in theta power. However, application of either the D1-like receptor agonist SKF38393 or the D2-like agonist quinpirole increased the power of both theta and gamma suggesting that the DA-mediated inhibition of oscillatory power is by action at other sites other than classical DA receptors. Application of amphetamine, which promotes endogenous amine neurotransmitter release, or the adrenergic α1-selective agonist phenylephrine mimicked the action of DA and reduced gamma power, a result unaffected by prior co-application of D1 and D2 receptor antagonists SCH23390 and sulpiride. Finally, application of the α1-adrenergic receptor antagonist prazosin blocked the action of DA on gamma power suggestive of interaction between α1 and DA receptors. These results show that DA mediates complex actions acting at dopamine D1-like and D2-like receptors, α1 adrenergic receptors and possibly DA/α1 heteromultimeric receptors to differentially modulate theta and gamma activity in M1.

  15. Effects of dopamine D2/D3 receptor antagonism on human planning and spatial working memory.

    Science.gov (United States)

    Naef, M; Müller, U; Linssen, A; Clark, L; Robbins, T W; Eisenegger, C

    2017-04-25

    Psychopharmacological studies in humans suggest important roles for dopamine (DA) D2 receptors in human executive functions, such as cognitive planning and spatial working memory (SWM). However, studies that investigate an impairment of such functions using the selective DA D2/3 receptor antagonist sulpiride have yielded inconsistent results, perhaps because relatively low doses were used. We believe we report for the first time, the effects of a higher (800 mg p.o.) single dose of sulpiride as well as of genetic variation in the DA receptor D2 gene (DA receptor D2 Taq1A polymorphism), on planning and working memory. With 78 healthy male volunteers, we apply a between-groups, placebo-controlled design. We measure outcomes in the difficult versions of the Cambridge Neuropsychological Test Automated Battery One-Touch Stockings of Cambridge and the self-ordered SWM task. Volunteers in the sulpiride group showed significant impairments in planning accuracy and, for the more difficult problems, in SWM. Sulpiride administration speeded response latencies in the planning task on the most difficult problems. Volunteers with at least one copy of the minor allele (A1+) of the DA receptor D2 Taq1A polymorphism showed better SWM capacity, regardless of whether they received sulpiride or placebo. There were no effects on blood pressure, heart rate or subjective sedation. In sum, a higher single dose of sulpiride impairs SWM and executive planning functions, in a manner independent of the DA receptor D2 Taq1A polymorphism.

  16. Screening of diseases transmissible by blood in recipients prior to transfusion at a university hospital in the northeast of Brazil Triagem de doenças transmissíveis por sangue em receptores de um hospital universitário no nordeste do Brasil, antes da transfusão

    Directory of Open Access Journals (Sweden)

    Cristina F. V. Carrazzone

    2006-03-01

    Full Text Available The Brazilian Ministry of Health has made tests for HIV1 and HIV2, HTLV I and HTLV II, HCV, HBV, T. cruzi, T. pallidum and Plasmodium in endemic areas, mandatory for all blood collection bags used in the country. However, blood-borne infectious diseases are not investigated in blood recipients before transfusion. For this study, a serological evaluation of recipients before transfusion was carried out. Prior to transfusion, serum samples from 159 blood recipients were analyzed using the same tests used in the serological screening of blood donors. The blood recipients were divided into three groups: Group 1 (G1, patients who had never received blood, Group 2 (G2, patients who had received multiple transfusions and Group 3 (G3 one-off recipients. SPSS v.8 was used for statistical analysis. Values of pO Ministério da Saúde brasileiro determina a realização de testes sorológicos para HIV 1 e 2, HTLV I e II, HCV, HBV, T. cruzi, T. pallidum e Plasmodium nas áreas endêmicas, em todas as bolsas de coleta de sangue utilizadas no País. Entretanto, as doenças infecciosas transmissíveis através do sangue não são inves­tigadas nos receptores de sangue (RS antes da transfusão. Neste estudo, realizamos uma avaliação sorológica dos RS anterior à transfusão. Amostras de soro de 159 RS foram analisadas aplicando-se os mesmos testes utilizados na triagem soro­lógica dos doadores de sangue. Os RS foram divididos em três grupos: Grupo 1 (G1, pacientes que nunca receberam sangue, Grupo 2 (G2, pacientes politransfundidos e Grupo 3 (G3 receptores eventuais. Para a análise estatística utilizou-se o pro­grama SPSS v.8. Valores de p<0,05 foram considerados signi­ficantes. Os resultados mostraram que 62 RS apresentaram positividade para uma ou mais doenças infecciosas trans­missíveis pelo sangue. Além disso, vários RS desconheciam seu estado sorológico anterior à transfusão. A identificação de doenças infecciosas transmissíveis pelo

  17. Dopamine modulates hemocyte phagocytosis via a D1-like receptor in the rice stem borer, Chilo suppressalis.

    Science.gov (United States)

    Wu, Shun-Fan; Xu, Gang; Stanley, David; Huang, Jia; Ye, Gong-Yin

    2015-07-16

    Dopamine (DA) is a signal moiety bridging the nervous and immune systems. DA dysregulation is linked to serious human diseases, including addiction, schizophrenia, and Parkinson's disease. However, DA actions in the immune system remain incompletely understood. In this study, we found that DA modulates insect hemocyte phagocytosis using hemocytes prepared from the rice stem borer (RSB), Chilo suppressalis. We investigated whether insect hemocytes are capable of de novo DA production. Here we show that exposing hemocytes to lipopolysaccharide (LPS) led to induction of DA-generating enzymes. Exogenous DA induced rapid phosphorylation of extracellular signal-regulated kinase (ERK) in naïve hemocytes. Activation of ERK was inhibited by preincubating with a DOP1 receptor antagonist. Thus, DA signaling via the DOP1 receptor may contribute to early hemocyte activation. DA synthesized and released from hemocytes may act in an autocrine mechanism to stimulate or maintain phagocytic activity. Consistent with this hypothesis, we found that inhibition of DA synthesis with α-methyl-DL-tyrosine methyl ester hydrochloride or blockage of DOP1 receptor with antagonist SCH23390 impaired hemocyte phagocytosis. Topical DA application also significantly decreased RSB mortality following challenge with the insect pathogenic fungus, Beauveria bassiana. We infer that a DA-dependent signaling system operates in hemocytes to mediate phagocytotic functions.

  18. LSD and structural analogs: pharmacological evaluation at D1 dopamine receptors.

    Science.gov (United States)

    Watts, V J; Lawler, C P; Fox, D R; Neve, K A; Nichols, D E; Mailman, R B

    1995-04-01

    The hallucinogenic effects of lysergic acid diethylamide (LSD) have been attributed primarily to actions at serotonin receptors. A number of studies conducted in the 1970s indicated that LSD also has activity at dopamine (DA) receptors. These latter studies are difficult to interpret, however, because they were completed before the recognition of two pharmacologically distinct DA receptor subtypes, D1 and D2. The availability of subtype-selective ligands (e.g., the D1 antagonist SCH23390) and clonal cell lines expressing a homogeneous receptor population now permits an assessment of the contributions of DA receptor subtypes to the DA-mediated effects of LSD. The present study investigated the binding and functional properties of LSD and several lysergamide and analogs at dopamine D1 and D2 receptors. Several of these compounds have been reported previously to bind with high affinity to serotonin 5HT2 (i.e., 3H-ketanserin) sites in the rat frontal cortex (K0.5 5-30 nM). All tested compounds also competed for both D1-like (3H-SCH 23390) and D2-like (3H-spiperone plus unlabeled ketanserin) DA receptors in rat striatum, with profiles indicative of agonists (nH LSD and analogs for D2 like receptors was similar to their affinity for 5HT2 sites. The affinity for D1 like receptors was slightly lower (2- to 3-fold), although LSD and several analogs bound to D1 receptors with affinity similar to the prototypical D1 partial agonist SKF38393 (K0.5 ca. 25 nM). A second series of experiments tested the binding and functional properties of LSD and selected analogs in C-6 glioma cells expressing the rhesus macaque D1A receptor.(ABSTRACT TRUNCATED AT 250 WORDS)

  19. Papel da esofagogastroplastia (Thal-Hatafuku e da gastrectomia parcial com anastomose gastrojejunal em Y (Holt -Large na prevenção do refluxo gastroesofágico. estudo experimental em cães Role of the esofagogastroplasty (Thal-Hatafuku and of the partial gastrectomy and gastrojejunoanastomosis with excluded loop on Y (Holt & Large in the gastroesophageal reflux prevention

    Directory of Open Access Journals (Sweden)

    Joaquim Mendes Castilho Netto

    2000-03-01

    Full Text Available O intento do presente estudo foi avaliar em cães os efeitos de dois tipos de procedimentos na prevenção do refluxo gastroesofágico. Foram utilizados 30 animais, divididos em grupos de 10. No Grupo I (controle foi realizada a esofagogastrostomia à Gröndhal; no Grupo II praticou-se a esofagogastroplastia à Thal-Hatafuku; no III, a esofagogastrostomia foi associada à gastrectomia dois terços e anastomose gastrojejunal em Y. Foram analisados os seguintes parâmetros: peso, endoscopia, exame radiológico e estudo morfológico do esôfago. Para estimular a secreção ácida do estômago foi aplicada diariamente injeção de histamina em cera de abelha. Os resultados foram obtidos em três fases: pré-operatório, entre o 30°.e o 40o.pós-operatório e após aplicação de histamina. No Grupo I, houve queda de peso significante entre as duas primeiras fases, que se acentuou na terceira; no Grupo II, a alteração de peso não foi significativa nas três fases; no III, a queda de peso significante foi verificada entre a 1a e a 2a fase, não havendo registro na fase seguinte devido a morte precoce dos animais com a aplicação da droga. À endoscopia, verificou-se intensidade da esofagite significativamente maior nos animais do Grupo I do que nos do II, após estímulo histamínico. Nos cães do Grupo III, não foi possível obter-se este dado pelo mesmo motivo relatado na análise do parâmetro anterior. O estudo radiológico demonstrou que nos cães do Grupo I o refluxo foi franco em 70% dos cães e, moderado em 30%. No Grupo II ,o refluxo foi ausente na maioria dos cães mas, moderado em 30%. No III, o conteúdo gástrico de bário refluiu em todos os animais e de modo significante na maioria deles (70%. Os dados macro e microscópicos não mostraram diferença significativa entre os três grupos, contudo o Grupo II foi o menos acometido. Os resultados do experimento evidenciaram que a esofagogastrostomia, como se esperava, produz intenso

  20. Localization of nigrostriatal dopamine receptor subtypes and adenylate cyclase

    Energy Technology Data Exchange (ETDEWEB)

    Filloux, F.; Dawson, T.M.; Wamsley, J.K.

    1988-04-01

    Quantitative autoradiography using (/sup 3/H)-SCH 23390, (/sup 3/H)-sulpiride and (/sup 3/H)-forskolin was used to assess the effects of single and combined neurotoxin lesions of the nigrostriatal pathway in the rat brain on dopamine (DA) receptor subtypes and adenylate cyclase (AC), respectively. Ibotenic acid (IA) lesions of the caudate-putamen (CPu) resulted in near total loss of both (/sup 3/H)-SCH 23390 and of (/sup 3/H)-forskolin binding in the ipsilateral CPu and substantia nigra reticulata (SNR). (/sup 3/H)-sulpiride binding in the CPu was only partially removed by this same lesion, and nigral (/sup 3/H)-sulpiride binding was virtually unchanged. 6-Hydroxydopamine (6-OHDA) and IA lesions of the substantia nigra compacta (SNC) did not affect (/sup 3/H)-SCH 23390 or (/sup 3/H)-forskolin binding, but largely removed (/sup 3/H)-sulpiride binding in the SNC. A 6-OHDA lesion of the nigrostriatal pathway followed by an ipsilateral IA injection of the CPu failed to further reduce (/sup 3/H)-sulpiride binding in the CPu. These results demonstrate that postsynaptic DA receptors in the CPu are of both the D1 and D2 variety; however, a portion of D2 receptors in the CPu may be presynaptic on afferent nerve terminals to this structure. D1 receptors in the SNR are presynaptic on striatonigral terminals, whereas the D2 receptors of the SNC are autoreceptors on nigral DA neurons. The existence of presynaptic D2 receptors on nigrostriatal DA-ergic terminals could not be confirmed by this study. Co-localization of D1 receptors and AC occurs in both the CPu and SNR.

  1. Lipophorin Receptor: The Insect Lipoprotein Receptor

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 8. Lipophorin Receptor: The Insect Lipoprotein Receptor. G Ravikumar N B Vijayaprakash. General Article Volume 18 Issue 8 August 2013 pp 748-755. Fulltext. Click here to view fulltext PDF. Permanent link:

  2. A Sintaxe da Janela

    Directory of Open Access Journals (Sweden)

    Luís Antônio Jorge

    1993-12-01

    Full Text Available A preocupação fundamenta! do trabalho é de caráter ontológico: esboçar o problema das significações apriorísticas e autônomas dos elementos que compõem a sintaxe arquitetônica. O trabalho elege um desses elementos: a janela. Este artigo parte da aproximação histórica entre a janela e a secção da pirâmide visual, construção imaginária da teoria da perspectiva renascentista. A consideração da janela na linguagem arquitetônica implica reconhecer uma ambigüidade essencial: a janela deve inserir-se ordenadamente no plano da parede - raciocínio típico da modenatura - mas também relacionar-se com a imagem vista através dela, que extrapola o plano, ressaltando a tridimensionalidade - herança da perspectiva renascentista, fundamentada no espaço euclidiano. Ver janela ou ver através da janela são alternativas que se colocam tanto ao observador interno ao edifício, quanto ao externo. Texto de duplaface, a sintaxe da janela versa sobre o relacionamento desses dois lados

  3. Acetylcholine receptor antibody

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/003576.htm Acetylcholine receptor antibody To use the sharing features on this page, please enable JavaScript. Acetylcholine receptor antibody is a protein found in the blood ...

  4. Repeated stressful experiences differently affect brain dopamine receptor subtypes

    Energy Technology Data Exchange (ETDEWEB)

    Puglisi-Allegra, S.; Cabib, S. (Istituto di Psicobiologia e Psicofarmacologia (CNR), Roma (Italy)); Kempf, E.; Schleef, C. (Centre de Neurochimi, Strasbourg (Italy))

    1991-01-01

    The binding of tritiated spiperone (D2 antagonist) and tritiated SCH 23390 (D1 antagonist), in vivo, was investigated in the caudatus putamen (CP) and nucleus accumbens septi (NAS) of mice submitted to ten daily restraint stress sessions. Mice sacrificed 24 hr after the last stressful experience presented a 64% decrease of D2 receptor density (Bmax) but no changes in D1 receptor density in the NAS. In the CP a much smaller (11%) reduction of D2 receptor density was accompanied by a 10% increase of D1 receptors. These results show that the two types of dopamine (DA) receptors adapt in different or even opposite ways to environmental pressure, leading to imbalance between them.

  5. Novas drogas no tratamento da dispepsia funcional

    Directory of Open Access Journals (Sweden)

    TRONCON Luiz Ernesto de Almeida

    2001-01-01

    Full Text Available Racional - A dispepsia funcional caracteriza-se pela ocorrência de sintomas digestivos altos, na ausência de qualquer evidência de doença orgânica ou anormalidade estrutural. O tratamento farmacológico atual desta condição é feito empiricamente com agentes anti-secretores ou drogas pró-cinéticas. Objetivos - Rever os avanços recentes nos conhecimentos sobre os mecanismos responsáveis pelo aparecimento dos sintomas, bem como o desenvolvimento de novas drogas capazes de interferir nestes mecanismos, que abrem a perspectiva de tratamento farmacológico mais racional e efetivo da dispepsia funcional. Método - Revisão sistemática do trabalhos publicados em língua inglesa, nos últimos 10 anos. Resultados - Novas drogas que aumentam a propulsão gastroduodenal incluem: derivados benzamídicos análogos da cisaprida, antagonistas dos receptores A da colecistocinina, agonistas de receptores opióides e uma nova classe de agonistas da motilina, semelhantes à eritromicina. Drogas agonistas dos receptores serotoninérgicos do plexo mioentérico, como o sumatriptano e a buspirona, podem aumentar a capacidade de acomodação do bolo alimentar. Por fim, novas drogas, de grupos farmacológicos diversos, estão sendo avaliadas quanto a sua capacidade de reduzir ou modificar a percepção sensorial visceral. Inclui este grupo a octreotida, a loxiglumida, o ondansetron e seus análogos, a fedotozina e os anti-depressivos tricíclicos, em doses baixas. Conclusões - Ainda que as novas drogas apresentem alto potencial de aperfeiçoar o tratamento da dispepsia funcional, há a necessidade de ensaios controlados, com número adequado de pacientes, para se comprovar a eficácia desses medicamentos. Além disso, as dificuldades em determinar o mecanismo subjacente aos sintomas pode limitar o impacto positivo das novas drogas no tratamento da dispepsia funcional.

  6. Androgen receptor abnormalities

    NARCIS (Netherlands)

    A.O. Brinkmann (Albert); G.G.J.M. Kuiper (George); C. Ris-Stalpers (Carolyn); H.C.J. van Rooij (Henri); G. Romalo (G.); G. Trifiro (Gianluca); E. Mulder (Eppo); L. Pinsky (L.); H.U. Schweikert (H.); J. Trapman (Jan)

    1991-01-01

    markdownabstract__Abstract__ The human androgen receptor is a member of the superfamily of steroid hormone receptors. Proper functioning of this protein is a prerequisite for normal male sexual differentiation and development. The cloning of the human androgen receptor cDNA and the elucidation of

  7. Estudo de descontinuidades crustais na província borborema usando a função do receptor

    OpenAIRE

    Pavão, Cesar Garcia

    2011-01-01

    As estimativas das espessuras da crosta, da crosta superior e da razão V p=V s são essenciais para o detalhamento de estruturas e feições geológicas, além de corroborarem para o entendimento da evolução tectônica regional. O estudo da crosta usando Função do Receptor é realizado com a onda P de um telessismo que atinge uma interface, sob a estação, com um ângulo próximo a vertical. Através da deconvolução da componente horizontal pela vertical, obtém-se a Função do Receptor. O sismograma sint...

  8. Phosphorylation of a 72-kDa protein in PDGF-stimulated cells which forms complex with c-Crk, c-Fyn and Eps15

    DEFF Research Database (Denmark)

    Hansen, Klaus; Rönnstrand, L; Claesson-Welsh, L

    1997-01-01

    -Crk, the non-receptor tyrosine kinase c-Fyn and the signaling molecule Eps15. The results obtained suggests that the 72-kDa protein might play an important role in signaling via the PDGF beta-receptor, coupling non-receptor tyrosine kinases of the Src family with c-Crk and Eps15....

  9. Immunologic analysis of human breast cancer progesterone receptors. 1. Immunonaffinity purification of transformed receptors and production of monoclonal antibodies

    Energy Technology Data Exchange (ETDEWEB)

    Estes, P.A.; Suba, E.J.; Lawler-Heavner, J.; Elashry-Stowers, D.; Wei, L.L.; Toft, D.O.; Sullivan, W.P.; Horwitz, K.B.; Edwards, D.P.

    1987-09-22

    A monoclonal antibody (MAb), designated PR-6, produced against chick oviduct progesterone receptors cross-reacts with the M/sub r/ 120,000 human B receptors. An immunomatrix prepared with PR-6 was used to purify progesterone receptors (PR) from T47D human breast cancer cells. Single-step immunoaffinity chromatography results in enrichment of B receptors (identified by immunoblot with PR-6 and by photoaffinity labeling with (/sup 3/H)promegestone) to a specific activity of 1915 pmol/mg of protein (or 23% purity) and with 27% yield. Purity and yields as judged by gel electrophoresis and densitometric scanning of the B protein were approximately 1.7-fold higher due to partial loss in hormone binding activity at the elution step. B receptors purified under these conditions are transformed and biologically active. They were maintained as undergraded 120-kDa doublets and retained both hormone and DNA binding activities. These purified B receptors were used as immunogen for production of four monoclonal antibodies against human PR. Three of the MAbs, designated as B-30 (IgG/sub 1/), B-64 (IgG/sub 1/), and B-11 (IgM), are specific for B receptors. The fourth MAb, A/B-52 (IgG/sub 1/), reacts with both A and B receptors. The IgG MAbs are monospecific for human PR since they recognize and absorb native receptor-hormone complexes, displace the sedimentation of 4S receptors on salt containing sucrose gradients, and, by immunoblot assay of crude T47D cytosol, react only with receptor polypeptides. Although mice were injected with B receptors only, production of A/B-52 which recognized both A and B receptors provides evidence that these two proteins share regions of structural homology.

  10. Posibles roles de los receptores a manosa-6-fosfato durante la organogénesis

    OpenAIRE

    Romano, Patricia Silvia

    2003-01-01

    Los receptores a manosa-6-fosfato (MPRs) son glicoproteínas que presentan como función principal el transporte de las hidrolasas lisosomales al lisosoma. Se conocen hasta el momento dos formas de MPRs: el receptor catión dependiente de 46 kDa (CD-MPR), que necesita iones bivalentes como Ca+2, Mg+2 o Mn+2 en muy bajas concentraciones para interactuar con sus ligandos; y el receptor catión independiente de 300 kDa (CI-MPR) que actúa aún en ausen...

  11. Molecular target size of the vanilloid (capsaicin) receptor in pig dorsal root ganglia

    Energy Technology Data Exchange (ETDEWEB)

    Szallasi, A.; Blumberg, P.M. (National Cancer Institute, Bethesda, MD (USA))

    1991-01-01

    The size of the vanilloid receptor was examined by high-energy radiation inactivation analysis of the binding of ({sup 3}H)resiniferatoxin to pig dorsal root ganglion membranes; it was found to be 270 {plus minus} 25 kDa. This value most likely represents the size of a receptor complex rather than of an individual subunit. Other ligand-gated cation channel complexes have reported molecular weights in this range, e.g. 300 kDa for the acetylcholine receptor.

  12. Genealogias da alegria

    Directory of Open Access Journals (Sweden)

    Bruno Vasconcelos de Almeid

    2009-08-01

    Full Text Available Genealogias da Alegria tem por objetivo rastrear conceitos e construir planos sobre os quais podemos pensar a alegria como campo problemático. Trata-se de traçar linhas e acoplar fragmentos históricos e literários com a finalidade de subsidiar a discussão contemporânea em torno da alegria. O procedimento genealógico vale-se de trechos das obras de Calímaco e Luciano de Samósata, da elegia erótica romana e da alegria cristã. O passo seguinte consiste em rastrear o pensamento da alegria na obra de Gilles Deleuze, especialmente em três momentos: uma passagem de Diferença e Repetição, um trecho dos Diálogos extraído de Da Superioridade da Literatura Anglo-americana e a comunicação Pensamento Nômade no Colóquio de Cerisy. A alegria não se define como sentimento ou emoção; ao contrário, está ligada à premissa de afirmação da vida e ao caráter trágico da existência.

  13. Comparison of serology, antigenemia assay and the polymerase chain reaction for monitoring active cytomegalovirus infections in hematopoietic stem cell transplantation patients Estudo comparativo entre sorologia, antigenemia e reação em cadeia da polimerase para o monitoramento da infecção por citomegalovírus em pacientes receptores de transplantes de células progenitoras hematopoéticas

    Directory of Open Access Journals (Sweden)

    Sandra Helena Alves Bonon

    2006-10-01

    Full Text Available Forty-six allogeneic hematopoietic stem cell transplantation (HSCT patients were monitored for the presence of CMV antibodies, CMV-DNA and CMV antigens after transplantation. Immunoenzymatic serological tests were used to detect IgM and the increase in CMV IgG antibodies (increase IgG, a nested polymerase chain reaction (N-PCR was used to detect CMV-DNA, and an antigenemia assay (AGM was used to detect CMV antigens. The presence of CMV-IgM and/or CMV-increase IgG antibodies was detected in 12/46 (26.1% patients, with a median time between HSCT and the detection of positive serology of 81.5 days. A positive AGM was detected in 24/46 (52.2% patients, with a median time between HSCT and antigen detection of 62 days. Two or more consecutive positive N-PCR results were detected in 32/46 (69.5% patients, with a median time between HSCT and the first positive PCR of 50.5 days. These results confirmed that AGM and mainly PCR are superior to serology for the early diagnosis of CMV infection. Six patients had CMV-IgM and/or CMV-increase IgG with a negative AGM (five cases or N-PCR assay (one case. In five of these cases the serological markers were detected during the first 100 days after HSCT, the period of highest risk. These findings support the idea that serology may be useful for monitoring CMV infections in HSCT patients, especially when PCR is unavailable.Quarenta e seis pacientes receptores de transplantes de células progenitoras hematopoéticas (TCPH foram monitorados em relação à infecção ativa por citomegalovírus (CMV. Testes sorológicos imunoenzimáticos foram utilizados para a detecção de anticorpos IgM e elevação significativa das concentrações de anticorpos IgG (aumento IgG, nested-PCR (N-PCR foi utilizada para a detecção de CMV-DNA e antigenemia (AGM para a detecção de antígenos virais. A presença de CMV-IgM e/ou CMV-aumento IgG foi detectada em 12/46 (26,1% pacientes, sendo o tempo mediano entre o transplante e a detec

  14. Distinctive Modulation of Dopamine Release in the Nucleus Accumbens Shell Mediated by Dopamine and Acetylcholine Receptors.

    Science.gov (United States)

    Shin, Jung Hoon; Adrover, Martin F; Alvarez, Veronica A

    2017-11-15

    Nucleus accumbens (NAc) shell shows unique dopamine (DA) signals in vivo and plays a unique role in DA-dependent behaviors such as reward-motivated learning and the response to drugs of abuse. A disynaptic mechanism for DA release was reported and shown to require synchronized firing of cholinergic interneurons (CINs) and activation of nicotinic acetylcholine (ACh) receptors (nAChRs) in DA neuron (DAN) axons. The properties of this disynaptic mechanism of DA transmission are not well understood in the NAc shell. In this study, in vitro fast-scan cyclic voltammetry was used to examine the modulation of DA transmission evoked by CINs firing in the shell of mice and compared with other striatal regions. We found that DA signals in the shell displayed significant degree of summation in response to train stimulation of CINs, contrary to core and dorsal striatum. The summation was amplified by a D2-like receptor antagonist and experiments with mice with targeted deletion of D2 receptors to DANs or CINs revealed that D2 receptors in CINs mediate a fast inhibition observed within 100 ms of the first pulse, whereas D2 autoreceptors in DAN terminals are engaged in a slower inhibition that peaks at ∼500 ms. ACh also contributes to the use-dependent inhibition of DA release through muscarinic receptors only in the shell, where higher activity of acetylcholinesterase minimizes nAChR desensitization and promotes summation. These findings show that DA signals are modulated differentially by endogenous DA and ACh in the shell, which may underlie the unique features of shell DA signals in vivoSIGNIFICANCE STATEMENT The present study reports that dopamine (DA) release evoked by activation of cholinergic interneurons displays a high degree of summation in the shell and shows unique modulation by endogenous DA and acetylcholine. Desensitization of nicotinic receptors, which is a prevailing mechanism for use-dependent inhibition in the nucleus accumbens core and dorsal striatum, is

  15. Caloric Restriction Protects against Lactacystin-Induced Degeneration of Dopamine Neurons Independent of the Ghrelin Receptor

    Directory of Open Access Journals (Sweden)

    Jessica Coppens

    2017-03-01

    Full Text Available Parkinson’s disease (PD is a neurodegenerative disorder, characterized by a loss of dopamine (DA neurons in the substantia nigra pars compacta (SNc. Caloric restriction (CR has been shown to exert ghrelin-dependent neuroprotective effects in the 1-methyl-4-phenyl-1,2,3,6-tetrathydropyridine (MPTP-based animal model for PD. We here investigated whether CR is neuroprotective in the lactacystin (LAC mouse model for PD, in which proteasome disruption leads to the destruction of the DA neurons of the SNc, and whether this effect is mediated via the ghrelin receptor. Adult male ghrelin receptor wildtype (WT and knockout (KO mice were maintained on an ad libitum (AL diet or on a 30% CR regimen. After 3 weeks, LAC was injected unilaterally into the SNc, and the degree of DA neuron degeneration was evaluated 1 week later. In AL mice, LAC injection significanty reduced the number of DA neurons and striatal DA concentrations. CR protected against DA neuron degeneration following LAC injection. However, no differences were observed between ghrelin receptor WT and KO mice. These results indicate that CR can protect the nigral DA neurons from toxicity related to proteasome disruption; however, the ghrelin receptor is not involved in this effect.

  16. Processing of the insulin-like growth factor-II-mannose 6-phosphate receptor in isolated liver subcellular fractions

    National Research Council Canada - National Science Library

    Tahiri K; Cam L; Desbuquois B; Chauvet G

    2001-01-01

    .... The receptor in plasma membrane fractions differed from that in Golgi-endosomal fractions by: (i) a lower molecular size upon reducing polyacrylamide gel electrophoresis (245 vs. 255 kDa); (ii...

  17. Class I Cytokine Receptors

    DEFF Research Database (Denmark)

    Steinocher, Helena

    The members of the class I cytokine receptor family are involved in a wide range of cellular processes and of high pharmaceutical importance, however, even though the transmembrane receptors have been studied for decades, it has not been fully elucidated yet, how these receptors induce their intr......The members of the class I cytokine receptor family are involved in a wide range of cellular processes and of high pharmaceutical importance, however, even though the transmembrane receptors have been studied for decades, it has not been fully elucidated yet, how these receptors induce...... their intracellular response. The overall goal of this thesis was to improve the understanding of class I cytokine receptor activation and regulation at an atomic level. Two members of the class I cytokine receptor family, the human growth hormone receptor (hGHR), and the human erythropoietin receptor (hEPOR) have...... the traptamers on the hEPOR TMD dimeric complex in detergent micelles. To gain a better understanding of hGHR regulation a point mutation in the hGHR intracellular domain (ICD), which has recently been linked to lung cancer, was characterized. The mutation was found to decrease binding of suppressor of cytokine...

  18. Traumatologia da coluna cervical

    OpenAIRE

    Silva, Cíntia da Costa Silvano,1989-

    2013-01-01

    Estima-se que mais de três milhões de pacientes com suspeita de lesão traumática da Coluna Cervical (CC) são atendidos nos serviços de urgência dos Estado Unidos da América (EUA), por ano. O mecanismo de trauma da CC é, numa grande parte das situações, incerto. A sua determinação depende maioritariamente dos padrões morfológicos da lesão e é indiretamente determinado a partir dos achados radiológicos. Uma lesão clinicamente significativa da CC é definida como qualquer fratura, luxação o...

  19. GABA receptor imaging

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jong Doo [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    2007-04-15

    GABA is primary an inhibitory neurotransmitter that is localized in inhibitory interneurons. GABA is released from presynaptic terminals and functions by binding to GABA receptors. There are two types of GABA receptors, GABA{sub A}-receptor that allows chloride to pass through a ligand gated ion channel and GABA{sub B}-receptor that uses G-proteins for signaling. The GABA{sub A}-receptor has a GABA binding site as well as a benzodiazepine binding sites, which modulate GABA{sub A}-receptor function. Benzodiazepine GABAA receptor imaging can be accomplished by radiolabeling derivates that activates benzodiazepine binding sites. There has been much research on flumazenil (FMZ) labeled with {sup 11}C-FMZ, a benzodiazepine derivate that is a selective, reversible antagonist to GABAA receptors. Recently, {sup 18}F-fluoroflumazenil (FFMZ) has been developed to overcome {sup 11}C's short half-life. {sup 18}F-FFMZ shows high selective affinity and good pharmacodynamics, and is a promising PET agent with better central benzodiazepine receptor imaging capabilities. In an epileptic focus, because the GABA/benzodiazepine receptor amount is decreased, using '1{sup 1}C-FMZ PET instead of {sup 18}F-FDG, PET, restrict the foci better and may also help find lesions better than high resolution MR. GABA{sub A} receptors are widely distributed in the cerebral cortex, and can be used as an viable neuronal marker. Therefore it can be used as a neuronal cell viability marker in cerebral ischemia. Also, GABA-receptors decrease in areas where neuronal plasticity develops, therefore, GABA imaging can be used to evaluate plasticity. Besides these usages, GABA receptors are related with psychological diseases, especially depression and schizophrenia as well as cerebral palsy, a motor-related disorder, so further in-depth studies are needed for these areas.

  20. Cartografia da paisagem alterada

    Directory of Open Access Journals (Sweden)

    Simone Cortezão

    2011-04-01

    Full Text Available O presente trabalho de pesquisa surge da investigação de paisagens alteradas, áreas pós-industriais e da geografia urbana que é conformada pela indústria. A preocupação principal é revê-las como espaço de investigação crítica sob o ponto de vista particular, integradas às noções da peculiar natureza industrial com suas consequentes transformações na paisagem, além das relações do indivíduo com esse novo meio produzido. “Cartografia da paisagem alterada” é uma pesquisa que indicia a paisagem alterada em pelo menos dois estratos: um que é o da construção da geografia da cidade pela indústria, e o outro que é a paisagem alterada subjetivamente, o que configura uma crítica e uma reação à conformação sócio geográfica em outros parâmetros - da proximidade, da experiência vivida e da construção de um vocabulário próprio.  A pesquisa teórica sobre áreas pós-industriais, associada a referências nas artes e arquitetura, constitui o primeiro estrato. Teorias e procedimentos artísticos de Robert Smithson, Joseph Beuys e Rem Koolhaas fornecem material para o segundo, mediante a pesquisa do cotidiano no lugar, a região do Vale do Aço, que se configura em um guia - glossário

  1. Dopamine signaling in food addiction: role of dopamine D2 receptors.

    Science.gov (United States)

    Baik, Ja-Hyun

    2013-11-01

    Dopamine (DA) regulates emotional and motivational behavior through the mesolimbic dopaminergic pathway. Changes in DA signaling in mesolimbic neurotransmission are widely believed to modify reward-related behaviors and are therefore closely associated with drug addiction. Recent evidence now suggests that as with drug addiction, obesity with compulsive eating behaviors involves reward circuitry of the brain, particularly the circuitry involving dopaminergic neural substrates. Increasing amounts of data from human imaging studies, together with genetic analysis, have demonstrated that obese people and drug addicts tend to show altered expression of DA D2 receptors in specific brain areas, and that similar brain areas are activated by food-related and drug-related cues. This review focuses on the functions of the DA system, with specific focus on the physiological interpretation and the role of DA D2 receptor signaling in food addiction.

  2. Qualidade da corvina (Micropogonias furnieri eviscerada em diferentes períodos de estocagem a 0°C Quality of gutted corvina (Micropogonias furnieri in different storage periods at 0°C

    Directory of Open Access Journals (Sweden)

    Alexandre Borges

    2007-02-01

    Full Text Available O trabalho objetivou, a partir de análises físico-químicas e sensoriais, determinar a vida útil da corvina (Micropogonias furnieri eviscerada e estocada à temperatura de 0°C. No 14° dia de estocagem, o pH da musculatura atingiu o valor limite aceitável para o consumo, estipulado em 6,4. Os teores de Bases Voláteis Totais se mantiveram dentro dos valores estipulados em 30mgN 100g-1 como próprios para o consumo até o 21° dia de estocagem. A histamina não ultrapassou, nos 28 dias de estocagem a 0°C, o valor-limite aceitável de 10mg 100g-1 de carne. A análise descritiva quantitativa empregou nove atributos para a descrição sensorial das corvinas, sendo que o aroma e o sabor característicos de peixe marinho, o aroma e o sabor de maresia, o gosto amargo e a cor da carne foram os mais importantes na diferenciação das amostras com 0, 4, 7, 10 e 14 dias de estocagem à temperatura de 0°C. Segundo os resultados obtidos e com base nos padrões existentes na legislação nacional e internacional, verificou-se que o prazo comercial da corvina (Micropogonias furnieri eviscerada fixou-se no 14° dia de estocagem a 0°C.This study was aimed at determining the shelf-life of gutted croaker (Micropogonias furnieri and stocked at 0°C using physical-chemical and sensory analyses. On the 14th day of storage, the pH of the muscle tissue reached the accepted limit for consumption (6.4. The levels of TVB were kept within the stipulated values for consumption (30mgN 100g-1 until the 21st day. In 28 days of storage at 0°C, the histamine level did not excess the acceptable level of 10mg 100g-1 of meat. The quantitative descriptive analysis method employed 9 attributes to describe the croaker. The study found that aroma and taste of sea fish, aroma and taste of marshy smell, bitterness, and the color of the meet were the most important aspects differentiating samples after 0, 4, 7, 10, 14 days of stocking at 0°C. According to the obtained results

  3. Antecedentes da adocao da computacao em nuvem: efeitos da infraestrutura, investimento e porte

    National Research Council Canada - National Science Library

    Prospero Sanchez, Otavio; Cappellozza, Alexandre

    2012-01-01

    ... em infraestrutura de Tecnologia da Informacao (TI). Paradoxalmente, ao mesmo tempo em que surge o beneficio para as organizacoes da possibilidade de executarem computacao em nuvem, os decisores deparam-se com o dilema advindo da possibilidade...

  4. [Nuclear receptors PPARalpha].

    Science.gov (United States)

    Soska, V

    2006-06-01

    Mechanism of the fibrates action is mediated by nuclear PPARalpha receptors (Peroxisome Proliferator-Activated Receptor). These receptors regulate a number of genes that are involved both in lipids and lipoproteins metabolism and other mediators (e.g. inflammatory mediatores). Due to PPARalpha activation by fibrates, triglycerides and small dense LDL concentration is decreased, HDL cholesterol is increased and both inflammation and prothrombotic status are reduced. These effects are very important in patients with metabolic syndrom.

  5. MACIEZ DA CARNE BOVINA

    Directory of Open Access Journals (Sweden)

    Antonio Bento Mancio

    2006-10-01

    Full Text Available Dentre as características de qualidade da carne bovina, a maciez assume posição de destaque, sendo considerada a característica organoléptica de maior influência na aceitação da carne por parte dos consumidores. A dureza da carne pode ser dividida em dureza residual, causada pelo tecido conjuntivo e outras proteínas do estroma, e dureza de actomiosina, causada pelas proteínas miofibrilares. Dentre os fatores que influenciam a maciez da carne, podem ser destacados a genética, a raça, a idade ao abate, o sexo, a alimentação, o uso de agentes hormonais (?-adrenérgicos e os tratamentos post-mortem. A qualidade final da carne é resultante de tudo o que aconteceu com o animal durante toda a cadeia produtiva. Devem-se assegurar procedimentos adequados de transporte, armazenamento, manipulação, exposição e preparo da carne, a fim de se obter um produto de melhor qualidade. PALAVRAS-CHAVE: Calpaínas, calpastatina, qualidade da carne, rigor mortis, tecido muscular.

  6. GERONTOLOGIA: ESTADO DA ARTE

    Directory of Open Access Journals (Sweden)

    Vera M.A.Tordino Brandão

    2010-02-01

    Full Text Available O Programa de Gerontologia da PUC desenvolve pesquisas focando o ser na perspectiva do envelhecimento. As atividades são interdisciplinares e reúnem docentes, alunos e ex-alunos. Nesta mesa redonda apresentamos um panorama sobre estes estudos. Na área da educação e comunicação o foco está centrado na longevidade e na preparação e representação social da velhice. São ressaltadas como temáticas: a formação continuada de profissionais e pesquisadores; o significado da religiosidade/espiritualidade ao longo da trajetória, e sua repercussão na qualidade de vida do idoso; os programas sócio-educacionais para idosos e concepções sobre educação; o monitoramento da mídia na cobertura da crescente longevidade e seus impactos. Em identidade e modos de morar reflete-se sobre soluções planejadas e sua adequação para a inclusão do envelhecimento populacional como questão fundamental, que implica a elaboração de novas políticas, investigações e, especialmente, apresenta-se como questão a ser analisada, refletida e vivenciada pela sociedade em geral. Quanto à saúde, o Programa desenvolve várias pesquisas numa abordagem interdisciplinar tendo como objetos de estudo: a terapia assistida com animais direcionada a idosos com diagnóstico de Alzheimer; o acompanhamento terapêutico e o atendimento psicoterapêutico em grupo, a aplicação da técnica de Calatonia em idosos moradores de ILPI, além da investigação sobre impasses clínicos no idoso frágil. Palavras-chave: gerontologia, longevidade, envelhecimento

  7. Activation of 5-HT2A/2C receptors within the nucleus accumbens increases local dopaminergic transmission.

    Science.gov (United States)

    Yan, Q S

    2000-01-01

    This study was designed to assess the involvement of the 5-hydroxytryptamine (5-HT)2A/2C receptor subtypes in the regulation of in vivo dopamine release in the rat nucleus accumbens (NAC). Extracellular dopamine (DA) in the NAC was measured using intracerebral microdialysis coupled with an HPLC-EC system. 5-HT2A/2C receptor agonist, (+/-)-1-(4-lodo-2,5-dimethoxyphenyl)-2-aminopropane (DOI) and antagonists, LY-53,857 and ketanserin, were all administered via a dialysis probe into the NAC. The results showed that perfusion with DOI at concentrations of 10, 50, 100, and 300 microM elicited a significant and concentration-dependent increase in extracellular DA. DA levels returned to control values within 40-60 min after terminating DOI perfusion. The increased DA induced by perfusion with 100 microM DOI was sensitive to sodium channel blockade with tetrodotoxin, and antagonized by co-perfusion with either LY-53,857 (25 and 50 microM) or ketanserin (50 microM). Perfusion with 50 microM LY-53,857 alone failed to alter basal levels of DA. The results suggest that local application of DOI increases DA release via a receptor-mediated process, and are consistent with the concept that activation of 5-HT2A/2C receptors within the NAC can augment dopaminergic transmission in this region although these receptors are not involved in the regulation of basal accumbal DA release.

  8. CONDICIONANTES DA COMPETITIVIDADE EMPRESARIAL

    Directory of Open Access Journals (Sweden)

    José Luiz Contador

    2010-03-01

    Full Text Available Este trabalho examina teoricamente os fatores determinantes da competitividade do produto e do negócio, imprescindíveis à elaboração de estratégias competitivas que visam à obtenção e sustentação de vantagens competitivas. Esse tema é objeto tanto da área de marketing estratégico quanto da de estratégia empresarial. Nas duas áreas, há um ponto de consenso que afirma que a empresa deve diferenciar sua oferta para conquistar e manter vantagem competitiva. Mas, os estudos conduzidos por meio do modelo de Campos e Armas da Competição revelaram que a empresa pode diferenciar seu produto e/ou serviço de modo mais amplo, levando em consideração, na formulação da sua estratégia competitiva, também o campo da competição, quer do produto, quer dela própria. Assim, o objetivo deste artigo é evidenciar que, para a empresa ser competitiva, além de diferenciar seu produto e/ou seu serviço no sentido tradicional, ela precisa: 1 diferenciar seu produto incluindo a definição em quais campos vai competir em cada segmento; e 2 escolher as armas da competição que irá utilizar e definir a intensidade de cada arma. Para atingir tal objetivo, foram necessários vários conceitos do modelo de Campos e Armas da Competição: campo da competição, arma da competição, tese do modelo, configuração dos campos da competição, campo coadjuvante, produto coadjuvante e par produto-mercado. Como uma proposta inovadora sempre desperta dúvida, é mostrado o processo de validação do modelo de Campos e Armas da Competição e são discutidas sua universalidade, consistência e completude.

  9. Evidence that the newly cloned low-density-lipoprotein receptor related protein (LRP) is the alpha 2-macroglobulin receptor

    DEFF Research Database (Denmark)

    Kristensen, T; Moestrup, Søren Kragh; Gliemann, Jørgen

    1990-01-01

    these polypeptides, and analysis of a 1772 bp cDNA encoding part of the 500 kDa polypeptide provide evidence that the 500 kDa and 85 kDa chains are the alpha- and beta-subunits, respectively, of a recently cloned hepatic membrane protein, termed the low density lipoprotein receptor related protein (LRP) (Herz, J......., Hamann, U., Rogne, S., Myklebost, O., Gausepohl, H. and Stanley, K.K. (1988) EMBO J. 7, 4119-4127; Herz, J., Kowal, R.C., Goldstein, J.L. and Brown, M.S. (1990) EMBO J. 9, 1769-1776). N-terminal sequence analysis of the 40 kDa polypeptide shows that it is of distinct genetic origin. It is suggested...

  10. Evidence that the newly cloned low-density-lipoprotein receptor related protein (LRP) is the alpha 2-macroglobulin receptor

    DEFF Research Database (Denmark)

    Kristensen, Torsten; Moestrup, Søren Kragh; Gliemann, Jørgen

    1990-01-01

    , and analysis of a 1772 bp cDNA encoding part of the 500 kDa polypeptide provide evidence that the 500 kDa and 85 kDa chains are the α- and β-subunits, respectively, of a recently cloned hepatic membrane protein, termed the low density lipoprotein receptor related protein (LRP) (Herz, J., Hamann, U., Rogne, S......., Myklebost, O., Gausepohl, H. and Stanley, K.K. (1988) EMBO J. 7, 4119-4127; Herz, J., Kowal, R.C., Goldstein, J.L. and Brown, M.S. (1990) EMBO J. 9, 1769-1776). N-terminal sequence analysis of the 40 kDa polypeptide shows that it is of distinct genetic origin. It is suggested that LRP is the functional...

  11. Expressão gênica de adipocinas em ovelhas alimentadas com resíduos da indústria do biodiesel da mamona

    OpenAIRE

    Duarte,S.S.; Gomes-Filho,M.A.; Silva,D.M.F.; Silva,L.M.; Oliveira,C.H.A.; Rodrigues,F.V.; Silva,A.M.; Fernandes,C.C.L.; Silva,C.M.G.; Rondina,D.

    2014-01-01

    A expressão de RNAm para leptina, receptor de leptina (obRb), adiponectina, receptor de adiponectina (AdipoR1) e resistina foi avaliada por meio da técnica de PCR em tempo real, em tecidos ovariano, hipofisário, adiposo do omento e da região perirrenal, em ovelhas alimentadas sem farelo de mamona ou com farelo de mamona detoxificada durante 14 meses. O tipo de dieta não afetou os níveis de RNAm para leptina, obRb, adiponectina, AdipoR1 e resistina nos diferentes ...

  12. Dopamine D2 receptor availability in opiate addicts at baseline and during naloxone precipitated withdrawal

    Energy Technology Data Exchange (ETDEWEB)

    Wang, G.J.; Volkow, N.D.; Logan, J. [Brookhaven National Lab., Upton, NY (United States)]|[SUNY, Stony Brook, NY (United States)]|[Psychiatry Services VAMC Northport, NY (United States)] [and others

    1996-05-01

    To determine if changes in dopamine activity contribute to the clinical presentation of opiate withdrawal we assessed dopamine (DA) D2 receptor availability in opiate-dependent subjects at baseline and during naloxone-precipitated withdrawal. DA D2 receptor availability was evaluated in eleven male heroine and methadone users using positron emission tomography (PET) and [11-C]raclopride and compared to eleven age matched male control subjects. Nine of the opiate-dependent subjects and two of the control were tested twice after placebo and naloxone (0.02 mg/kg) iv injection 7-10 min. prior to [11-C]raclopride. DA D2 receptor availability was measured using the ratio of the distribution volume in the region of interest (caudate, putamen and ventral striatum) to that in the cerebellum which is a function of B{sub max}/K{sub d}. DA D2 receptor availability in putamen was significantly lower in opiate-dependent subjects (3.44 {plus_minus} 0.4) than that in controls (3.97 {plus_minus} 0.45, p {ge} 0.009). Naloxone induced a short lasting withdrawal in all of the opiate-dependent subjects (79 {plus_minus} 17% of maximum withdrawal), but not in controls, with significant increase in pulse (p {le} 0.006), blood pressure (p {le} 0.0001), lacrimation (p {le} 0.01), muscle twitches (p {le} 0.01), annoyance (p {le} 0.005), anxiety (p {le} 0.0006), restlessness (p {le} 0.0005) and unhappiness (p {le} 0.001). DA D2 receptor availability in basal ganglia after naloxone administration was not different from that of baseline. These results document abnormalities in DA D2 receptors in opiate-dependent subjects. However, DA D2 availability did not change with naloxone-precipitated withdrawal.

  13. CUIDADO: EIXO DA VIDA, DESAFIO DA ENFERMAGEM

    Directory of Open Access Journals (Sweden)

    Flávia Souza Ramos

    2011-01-01

    Full Text Available Neste artigo, fazemos uma reflexão sobre o que seja cuidado, cuidado de enfermagem e de algumas premissas e consequências da realização deste cuidado. Assumimos o cuidado como componente essencial para a vida e dependente do amor, com as dimensões do eu, do outro e do planeta. Na enfermagem, o desafio que se coloca é como transformar este cuidado em cuidado terapêutico no qual, sujeito enfermo e sujeito cuidador se relacionem para buscar uma maior autonomia do primeiro, sempre com base em valores como conhecimento e respeito mútuo, ou seja: como realizar um cuidado mais plástico, mais arte ao lado da técnica, conhecendo o outro a partir do seu olhar.

  14. O paradoxo da lei

    OpenAIRE

    Ribeiro, Karla Pinhel

    2007-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Filosofia e Ciências Humanas. Programa de Pós-Graduação em Filosofia A tese principal da dissertação sobre a questão o que é ser humana é contemplada através dos conceitos de biopolítica, estado de exceção e vida nua na história da filosofia política e jurídica de Giorgio Agamben e à formulação da questão sobre o que é o homem na contemporaneidade, sobretudo, no pensamento da filosofia política e jurídica de Giorgio...

  15. ESPECTROS INFRAVERMELHOS DA CREATINA

    Directory of Open Access Journals (Sweden)

    Kumiko K. Sakane

    2011-08-01

    Full Text Available São apresentados espectros infravermelhos da creatina, na faixa de 4000 a 400 cm−1. Os resultados são comparados com espectros observados e calculados, publicados na literatura.

  16. Receptor, Ligand and Transducer Contributions to Dopamine D2 Receptor Functional Selectivity.

    Directory of Open Access Journals (Sweden)

    Sean M Peterson

    Full Text Available Functional selectivity (or biased agonism is a property exhibited by some G protein-coupled receptor (GPCR ligands, which results in the modulation of a subset of a receptor's signaling capabilities and more precise control over complex biological processes. The dopamine D2 receptor (D2R exhibits pleiotropic responses to the biogenic amine dopamine (DA to mediate complex central nervous system functions through activation of G proteins and β-arrestins. D2R is a prominent therapeutic target for psychological and neurological disorders in which DA biology is dysregulated and targeting D2R with functionally selective drugs could provide a means by which pharmacotherapies could be developed. However, factors that determine GPCR functional selectivity in vivo may be multiple with receptors, ligands and transducers contributing to the process. We have recently described a mutagenesis approach to engineer biased D2R mutants in which G protein-dependent ([Gprot]D2R and β-arrestin-dependent signaling ([βarr]D2R were successfully separated (Peterson, et al. PNAS, 2015. Here, permutations of these mutants were used to identify critical determinants of the D2R signaling complex that impart signaling bias in response to the natural or synthetic ligands. Critical residues identified in generating [Gprot]D2R and [βarr]D2R conferred control of partial agonism at G protein and/or β-arrestin activity. Another set of mutations that result in G protein bias was identified that demonstrated that full agonists can impart unique activation patterns, and provided further credence to the concept of ligand texture. Finally, the contributions and interplay between different transducers indicated that G proteins are not aberrantly activated, and that receptor kinase and β-arrestin activities are inextricably linked. These data provide a thorough elucidation of the feasibility and malleability of D2R functional selectivity and point to means by which novel in vivo

  17. Impacto ambiental da apicultura

    OpenAIRE

    Leticia M. Estevinho

    1999-01-01

    A cultura da abelha doméstica Apis. mellifera L. ou apicultura é conhecida desde a antiguidade, sendo o mel uni alimento natural corrente entre os povos primitivos. Pinturas rupestres mostram que desde o neolítico o homem era atraído pelo mel, pois tentava recolher ninhos de abelhas selvagens e instalava-os em cavidades naturais das rochas, muito perto da sua habitação.

  18. Differential distributions and trafficking properties of dopamine D1 and D5 receptors in nerve cells.

    Science.gov (United States)

    He, You; Yu, Lei-Ping; Jin, Guo-Zhang

    2009-04-01

    To explore the possible differential trafficking properties of the dopamine D1-like receptor subtypes, D1 receptor and D5 receptor. To visualize distributions of dopamine D1-like receptor subtypes at subcellular level, the yellow and cyan variants of green fluorescent protein (GFP) were used to tag D1 and D5 receptors. After transfection with the tagged dopamine receptors, the neuroblastoma cells NG108-15 were treated with D1 agonist SKF38393 or acetylcholine (ACh). Then we observed the subcellular distributions of the tagged receptors under the confocal microscopy and tried to determine trafficking properties by comparing their distribution patterns before and after the drug treatment. In resting conditions, D1 receptors located in the plasma membrane of NG108-15 cells, while D5 receptors located in both plasma membrane and cytosol. With the pre-treatment of SKF38393, the subcellular distribution of D1 receptors was changed. The yellow particle-like fluorescence of tagged D1 receptors appeared in the cytosol, indicating that D1 receptors were internalized into cytosol from the cell surface. Same situation also occurred in ACh pre-treatment. In contrast, the subcellular distribution of D5 receptors was not changed after SKF38393 or ACh treatment, indicating that D5R was not translocated to cell surface. Interestingly, when D1 and D5 receptors were co-expressed in the same cell, both kept their distinct subcellular distribution patterns and the trafficking properties. Our present study reveals that in NG108-15 nerve cells, dopamine D1 and D5 receptors exhibit differential subcellular distribution patterns, and only D1 receptor has a marked trafficking response to the drug stimulation. We further discuss the potential role of the differential trafficking properties of D1-like receptors in complex modulation of DA signaling.

  19. A2A adenosine receptor antagonism enhances synaptic and motor effects of cocaine via CB1 cannabinoid receptor activation.

    Directory of Open Access Journals (Sweden)

    Alessandro Tozzi

    Full Text Available BACKGROUND: Cocaine increases the level of endogenous dopamine (DA in the striatum by blocking the DA transporter. Endogenous DA modulates glutamatergic inputs to striatal neurons and this modulation influences motor activity. Since D2 DA and A2A-adenosine receptors (A2A-Rs have antagonistic effects on striatal neurons, drugs targeting adenosine receptors such as caffeine-like compounds, could enhance psychomotor stimulant effects of cocaine. In this study, we analyzed the electrophysiological effects of cocaine and A2A-Rs antagonists in striatal slices and the motor effects produced by this pharmacological modulation in rodents. PRINCIPAL FINDINGS: Concomitant administration of cocaine and A2A-Rs antagonists reduced glutamatergic synaptic transmission in striatal spiny neurons while these drugs failed to produce this effect when given in isolation. This inhibitory effect was dependent on the activation of D2-like receptors and the release of endocannabinoids since it was prevented by L-sulpiride and reduced by a CB1 receptor antagonist. Combined application of cocaine and A2A-R antagonists also reduced the firing frequency of striatal cholinergic interneurons suggesting that changes in cholinergic tone might contribute to this synaptic modulation. Finally, A2A-Rs antagonists, in the presence of a sub-threshold dose of cocaine, enhanced locomotion and, in line with the electrophysiological experiments, this enhanced activity required activation of D2-like and CB1 receptors. CONCLUSIONS: The present study provides a possible synaptic mechanism explaining how caffeine-like compounds could enhance psychomotor stimulant effects of cocaine.

  20. Glutamate receptor agonists

    DEFF Research Database (Denmark)

    Vogensen, Stine Byskov; Greenwood, Jeremy R; Bunch, Lennart

    2011-01-01

    The neurotransmitter (S)-glutamate [(S)-Glu] is responsible for most of the excitatory neurotransmission in the central nervous system. The effect of (S)-Glu is mediated by both ionotropic and metabotropic receptors. Glutamate receptor agonists are generally a-amino acids with one or more...... stereogenic centers due to strict requirements in the agonist binding pocket of the activated state of the receptor. By contrast, there are many examples of achiral competitive antagonists. The present review addresses how stereochemistry affects the activity of glutamate receptor ligands. The review focuses...... mainly on agonists and discusses stereochemical and conformational considerations as well as biostructural knowledge of the agonist binding pockets, which is useful in the design of glutamate receptor agonists. Examples are chosen to demonstrate how stereochemistry not only determines how the agonist...

  1. Disruption of the 37-kDa/67-kDa laminin receptor gene in bovine ...

    African Journals Online (AJOL)

    enoh

    2012-03-22

    Mar 22, 2012 ... State Key Laboratories for Agrobiotechnology, Key Lab of Animal Epidemiology and Zoonosis, Ministry of Agriculture,. National Animal ... disease (CJD) in humans, scrapie in sheep, bovine spongiform encephalopathy (BSE) in .... With the development of cloning techniques, transgenic animals can be ...

  2. Lipophorin Receptor: The Insect Lipoprotein Receptor

    Indian Academy of Sciences (India)

    IAS Admin

    five structural and functional domains, which are discussed here. (Figure 1). Figure 1. Structure of lipophorin receptor. 3 Vitellogenesis: The process by which the yolk is formed and accumulated in the ovum as a source of nutrients for the egg development. Vitellogenin and lipophorin are the major yolk pro- tein precursors in ...

  3. Receptor dependent immobilization of spermatozoa by sperm immobilization factor isolated from Escherichia coli: proof of evidence.

    Science.gov (United States)

    Kumar, Vijay; Prabha, Vijay; Kaur, Siftjit; Kaur, Kiranjeet; Singh, S K

    2011-08-01

    To examine the receptor-ligand interaction between E. coli and spermatozoa resulting in sperm immobilization. Sperm immobilization factor (SIF) was isolated and purified from filtrate of E. coli suspension. Receptor on human spermatozoa for SIF was made to isolated and purified by salt extraction, gel permeation and ion exchange chromatography. Receptor dependent immobilization of spermatozoa by SIF was confirmed by competitive inhibition by addition of the purified receptor and binding to sperm receptor by Fluorescin Isothiocynate (FITC) labelled SIF using fluorescence microscopy. Heat labile, non-dialyzable, sperm immobilization factor of ∼56 kDa was isolated and purified from E. coli. Using SIF as a tool, receptor of 113 kDa could be isolated and purified from human spermatozoa. Addition of purified receptor completely inhibited sperm immobilization and death induced by SIF suggesting receptor-dependent immobilization of spermatozoa. Further incubation of sperm with FITC labelled SIF resulted in staining of whole sperm. The study provides evidence of receptor-ligand interaction between E. coli and spermatozoa. © 2011 The Japanese Urological Association.

  4. The real code of leonardo da vinci.

    Science.gov (United States)

    Ose, Leiv

    2008-02-01

    Leonardo da Vinci was born in Italy. Among the researchers and scientists, he is favourably known for his remarkable efforts in scientific work. His investigations of atherosclerosis judiciously combine three separate fields of research. In 1506, he finished his masterpiece, painting of Mona Lisa. A careful clinical examination of the famous painting reveals a yellow irregular leather-like spot at the inner end of the left upper eyelid and a soft bumpy well-defined swelling of the dorsum of the right hand beneath the index finger about 3 cm long. This is probably the first case of familial hypercholesterolemia (FH). The FH code of Leonardo da Vinci was given immense consideration by scientists like Carl Muller, who described the xanthomas tuberosum and angina pectoris. On the contrary, Akira Endo searched for microbial metabolites that would inhibit HMG-CoA reductase, the rate-limiting enzyme in the synthesis of cholesterol and finally, Michael Brown and Joseph Goldstein published a remarkable series of elegant and insightful papers in the 70s and 80s. They established that the cellular uptake of low-density lipoprotein (LDL) essentially requires the LDL receptor. this was the real Code of Leonardo da Vinci.

  5. Micoses superficiais e os elementos da resposta imune Superficial mycosis and the immune response elements

    Directory of Open Access Journals (Sweden)

    Paulo Ricardo Criado

    2011-08-01

    Full Text Available As micoses superficiais são prevalentes em todo o mundo, geralmente ocasionadas por dermatófitos e restritas à camada córnea. A resposta imunológica do hospedeiro às infecções dos fungos dermatófitos depende basicamente das defesas do hospedeiro a metabólitos do fungo, da virulência da cepa ou da espécie infectante e da localização anatômica da infecção. Serão revistos alguns dos fatores da defesa imunológica do hospedeiro que influenciam na eficácia da resposta imune. Em especial, a participação dos receptores de padrão de reconhecimento (PRRs, tais como os receptores toll-like ou os da família lectina (DC-SIGN e dectin-2, que participam da resposta imune inata, conferindo-lhe especificidade e definindo o padrão da resposta imune como um todo. O predomínio celular ou humoral da resposta imune definirá o quadro clínico e o prognóstico da infecção, levando à cura ou cronicidadeSuperficial mycoses are prevalent worldwide. They are often caused by dermatophytes and restricted to the stratum corneum. The host's immune response against infections caused by dermatophytes basically depends on the host's defense against metabolites of the fungi, virulence of the infecting strain or species and anatomical site of the infection. We will review some of the factors of the host's immune defense that influence the efficacy of the immune response. We will particularly review the role of pattern recognition receptors (PRRs, such as toll-like receptors or lectin receptors (DCSIGN and Dectin 2, which participate in the innate immune response, bringing specificity to the immune response and setting its pattern. The predominance of a cellular or humoral immune response determines the clinical manifestations and the prognosis of the infection, leading to healing or chronicity

  6. Muscarinic receptor oligomerization.

    Science.gov (United States)

    Marsango, Sara; Ward, Richard J; Alvarez-Curto, Elisa; Milligan, Graeme

    2017-11-14

    G protein-coupled receptors (GPCRs) have been classically described as monomeric entities that function by binding in a 1:1 stoichiometric ratio to both ligand and downstream signalling proteins. However, in recent years, a growing number of studies has supported the hypothesis that these receptors can interact to form dimers and higher order oligomers although the molecular basis for these interactions, the overall quaternary arrangements and the functional importance of GPCR oligomerization remain topics of intense speculation. Muscarinic acetylcholine receptors belong to class A of the GPCR family. Each muscarinic receptor subtype has its own particular distribution throughout the central and peripheral nervous systems. In the central nervous system, muscarinic receptors regulate several sensory, cognitive, and motor functions while, in the peripheral nervous system, they are involved in the regulation of heart rate, stimulation of glandular secretion and smooth muscle contraction. Muscarinic acetylcholine receptors have long been used as a model for the study of GPCR structure and function and to address aspects of GPCR dimerization using a broad range of approaches. In this review, the prevailing knowledge regarding the quaternary arrangement for the various muscarinic acetylcholine receptors has been summarized by discussing work ranging from initial results obtained using more traditional biochemical approaches to those generated with more modern biophysical techniques. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  7. Neurotensin Receptor-1 Identifies a Subset of Ventral Tegmental Dopamine Neurons that Coordinates Energy Balance

    Directory of Open Access Journals (Sweden)

    Hillary L. Woodworth

    2017-08-01

    Full Text Available Dopamine (DA neurons in the ventral tegmental area (VTA are heterogeneous and differentially regulate ingestive and locomotor behaviors that affect energy balance. Identification of which VTA DA neurons mediate behaviors that limit weight gain has been hindered, however, by the lack of molecular markers to distinguish VTA DA populations. Here, we identified a specific subset of VTA DA neurons that express neurotensin receptor-1 (NtsR1 and preferentially comprise mesolimbic, but not mesocortical, DA neurons. Genetically targeted ablation of VTA NtsR1 neurons uncouples motivated feeding and physical activity, biasing behavior toward energy expenditure and protecting mice from age-related and diet-induced weight gain. VTA NtsR1 neurons thus represent a molecularly defined subset of DA neurons that are essential for the coordination of energy balance. Modulation of VTA NtsR1 neurons may therefore be useful to promote behaviors that prevent the development of obesity.

  8. Impacto do polimorfismo genetico da enzima conversora da angiotensina no remodelamento cardiaco

    Directory of Open Access Journals (Sweden)

    Felipe Neves de Albuquerque

    2014-01-01

    Full Text Available Fundamento: O papel dos polimorfismos genéticos da enzima de conversão da angiotensina na insuficiência cardíaca, como preditor de desfechos ecocardiográficos, ainda não está estabelecido. é necessário identificar o perfil local para observar o impacto desses genótipos na população brasileira, sendo inédito o estudo da insuficiência cardíaca de etiologia exclusivamente não isquêmica em seguimento mais longo que 5 anos. Objetivo: Determinar a distribuição das variantes do polimorfismo genético da enzima de conversão da angiotensina e sua relação com a evolução ecocardiográfica de pacientes com insuficiência cardíaca de etiologia não isquêmica. Métodos: Análise secundária de prontuários de 111 pacientes e identificação das variantes do polimorfismo genético da enzima de conversão da angiotensina, classificadas como DD (Deleção/Deleção, DI (Deleção/Inserção ou II (Inserção/Inserção. Resultados: As médias da coorte foram: seguimento de 64,9 meses, idade de 59,5 anos, 60,4% eram homens, 51,4% eram brancos, 98,2% faziam uso de betabloqueadores e 89,2% de inibidores da enzima de conversão da angiotensina ou de bloqueador do receptor da angiotensina. A distribuição do polimorfismo genético da enzima de conversão da angiotensina foi: 51,4% de DD; 44,1% de DI; e 4,5% de II. Não se observou nenhuma diferença das características clínicas ou de tratamento entre os grupos. O diâmetro sistólico do ventrículo esquerdo final foi a única variável ecocardiográfica isolada significativamente diferente entre os polimorfismos genéticos da enzima de conversão da angiotensina: 59,2 ± 1,8 para DD versus 52,3 ± 1,9 para DI versus 59,2 ± 5,2 para II (p = 0,029. No seguimento ecocardiográfico, todas as variáveis (diferença entre a fração de ejeção do ventrículo esquerdo da última e da primeira consulta; diferença entre o diâmetro sistólico do ventrículo esquerdo da última e da primeira

  9. Serotonin Receptors in Hippocampus

    Science.gov (United States)

    Berumen, Laura Cristina; Rodríguez, Angelina; Miledi, Ricardo; García-Alcocer, Guadalupe

    2012-01-01

    Serotonin is an ancient molecular signal and a recognized neurotransmitter brainwide distributed with particular presence in hippocampus. Almost all serotonin receptor subtypes are expressed in hippocampus, which implicates an intricate modulating system, considering that they can be localized as autosynaptic, presynaptic, and postsynaptic receptors, even colocalized within the same cell and being target of homo- and heterodimerization. Neurons and glia, including immune cells, integrate a functional network that uses several serotonin receptors to regulate their roles in this particular part of the limbic system. PMID:22629209

  10. Glutamate receptor ligands

    DEFF Research Database (Denmark)

    Guldbrandt, Mette; Johansen, Tommy N; Frydenvang, Karla Andrea

    2002-01-01

    Homologation and substitution on the carbon backbone of (S)-glutamic acid [(S)-Glu, 1], as well as absolute stereochemistry, are structural parameters of key importance for the pharmacological profile of (S)-Glu receptor ligands. We describe a series of methyl-substituted 2-aminoadipic acid (AA.......g., IC(50) = 300 microM for (2R,4S)-4-methyl-AA (5d)]. The two unsaturated analogs (S)- (7a) and (R)-(E)-Delta(4)-5-methyl-AA (7b) turned out to be a weak AMPA receptor agonist and a weak mixed NMDA/AMPA receptor antagonist, respectively....

  11. AMPA receptor ligands

    DEFF Research Database (Denmark)

    Strømgaard, Kristian; Mellor, Ian

    2004-01-01

    Alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionic acid (AMPA) receptors (AMPAR), subtype of the ionotropic glutamate receptors (IGRs), mediate fast synaptic transmission in the central nervous system (CNS), and are involved in many neurological disorders, as well as being a key player...... polyamines are known to modulate the function of these receptors in vivo. In this study, recent developments in the medicinal chemistry of polyamine-based ligands are given, particularly focusing on the use of solid-phase synthesis (SPS) as a tool for the facile generation of libraries of polyamine toxin...

  12. Mycobacterium tuberculosis 19-kDa lipoprotein promotes neutrophil activation.

    Science.gov (United States)

    Neufert, C; Pai, R K; Noss, E H; Berger, M; Boom, W H; Harding, C V

    2001-08-01

    Certain microbial substances, e.g., LPS, can activate neutrophils or prime them to enhance their response to other activating agents, e.g., fMLP. We investigated the role of the Mycobacterium tuberculosis (MTB) 19-kDa lipoprotein in activation of human neutrophils. MTB 19-kDa lipoprotein initiated phenotypic changes characteristic of neutrophil activation, including down-regulation of CD62 ligand (L-selectin) and up-regulation of CD35 (CR1) and CD11b/CD18 (CR3, Mac-1). In addition, exposure of neutrophils to MTB 19-kDa lipoprotein enhanced the subsequent oxidative burst in response to fMLP as assessed by oxidation of dihydrorhodamine 123 (determined by flow cytometry). LPS also produced these effects with similar kinetics, but an oligodeoxynucleotide containing a CpG motif failed to induce any priming or activation response. Although the effects of LPS required the presence of serum, neutrophil activation by MTB 19-kDa lipoprotein occurred independently of serum factors, suggesting the involvement of different receptors and signaling mechanisms for LPS and MTB 19-kDa lipoprotein. Thus, MTB 19-kDa lipoprotein serves as a pathogen-associated molecular pattern that promotes neutrophil priming and activation.

  13. Identification of a Bacillus thuringiensis Cry8Da toxin-binding glucosidase from the adult Japanese beetle, Popillia japonica.

    Science.gov (United States)

    Yamaguchi, Takuya; Bando, Hisanori; Asano, Shin-ichiro

    2013-06-01

    Cry8Da from Bacillus thuringiensis galleriae SDS-502 has insecticidal activity against both the larvae and adult Japanese beetle (Popillia japonica Newman). The receptor determines the specificity of the insecticidal activity of Cry proteins and hence, in order to reveal the mode of action of Cry toxin, receptor identification is a necessary step. However, a receptor for Cry8-type toxin has not been identified in the Scarabaeidae family of insects. Therefore, we aimed to identify the receptor of Cry8Da toxin in adult P. japonica BBMV. A ligand blot showed the Cry8Da toxin only bound to a 150kDa protein in the BBMV of adult P. japonica. In order to identify the Cry8Da toxin binding protein, it was purified by column chromatography and three internal amino acid sequences were determined. Two of the three internal amino acid sequences shared homology with Coleopteran β-glucosidases. In addition, the fraction containing the Cry8Da toxin binding protein had β-glucosidase activity but no aminopeptidase N and alkaline phosphatase activity, both of which are commonly reported as receptors for Cry toxins in Lepidopteran and Dipteran insects. The β-glucosidase homologous genes could be amplified by PCR using degenerate oligonucleotide primers designed from a conserved sequence of Coleopteran β-glucosidases and an internal amino acid sequence of the Cry8Da toxin binding protein. Taken together, the β-glucosidase in adult P. japonica BBMV is the receptor for B. thuringiensis Cry8Da toxin. Copyright © 2013 Elsevier Inc. All rights reserved.

  14. Validation of endothelin B receptor antibodies reveals two distinct receptor-related bands on Western blot.

    Science.gov (United States)

    Barr, Travis P; Kornberg, Daniel; Montmayeur, Jean-Pierre; Long, Melinda; Reichheld, Stephen; Strichartz, Gary R

    2015-01-01

    Antibodies are important tools for the study of protein expression but are often used without full validation. In this study, we used Western blots to characterize antibodies targeted to the N or C terminal (NT or CT, respectively) and the second or third intracellular loop (IL2 or IL3, respectively) of the endothelin B receptor (ETB). The IL2-targeted antibody accurately detected endogenous ETB expression in rat brain and cultured rat astrocytes by labeling a 50-kDa band, the expected weight of full-length ETB. However, this antibody failed to detect transfected ETB in HEK293 cultures. In contrast, the NT-targeted antibody accurately detected endogenous ETB in rat astrocyte cultures and transfected ETB in HEK293 cultures by labeling a 37-kDa band but failed to detect endogenous ETB in rat brain. Bands detected by the CT- or IL3-targeted antibody were found to be unrelated to ETB. Our findings show that functional ETB can be detected at 50 or 37kDa on Western blot, with drastic differences in antibody affinity for these bands. The 37-kDa band likely reflects ETB processing, which appears to be dependent on cell type and/or culture condition. Copyright © 2014 Elsevier Inc. All rights reserved.

  15. Effects of lisuride on body temperature of rats and rabbits: relation to microsomal biotransformation and dopaminergic receptor stimulation.

    Science.gov (United States)

    Carruba, M O; Ricciardi, S; Negreanu, J; Calogero, M; Mantegazza, P

    1980-01-01

    In rats, lisuride, either administered systemically or intracerebroventricularly induced a dose-related hypothermia. This effect was selectively antagonized by blockade of DA receptors in the CNS but not by inhibition of catecholamine synthesis or blockade of serotoninergic receptors. Also a blocker of "peripheral" DA receptors failed to antagonize the hypothermic effect of lisuride in rats. Induction of rat liver microsomal drug-metabolizing enzymes by phenobarbital counteracted lisuride-induced hypothermia. In rabbits lisuride induced a hyperthermic response which was sensitive to both pimozide and metergoline pretreatment. These findings indicate that stimulation of brain DA receptors involved in thermoregulation is responsible for the changes in body temperature indiced by lisuride in rats and rabbits and that these effects are caused by the drug itself and do not require previous biotransformation into an active metabolite.

  16. Os tempos da prematuridade

    Directory of Open Access Journals (Sweden)

    Silvia Abu-Jamra Zornig

    Full Text Available Este trabalho tem por objetivo discutir a clínica psicanalítica com bebês, tendo como referência um projeto de pesquisa desenvolvido com bebês pré-termo internados e suas famílias (Hospital Fernandes Figueira/Fiocruz. Parte da concepção freudiana sobre o desamparo estrutural do ser humano para analisar as vicissitudes da constituição do sujeito a partir dos diferentes tempos que se instalam nos primórdios da subjetividade: um tempo de retroação relacionado aos fantasmas e desejos parentais, um tempo de construção (Winnicott e de continuidade relacionado aos cuidados maternos e um tempo descontínuo, traumático, que se refere aos bebês nascidos prematuramente.

  17. A necessidade da arte

    OpenAIRE

    Crespo, Adriana Carneiro Anselmo da Costa e

    2014-01-01

    Tese apresentada para cumprimento dos requisitos necessários à obtenção do grau de Doutor em Filosofia, especialidade de Estética O problema da necessidade da arte é discutido nesta tese a partir da questão do desinteresse estético em Kant. Foi neste contexto que tentámos perceber com a maior exactidão possível o que acontecia, de facto, na apreensão estética de um corpo do qual foi abstraído o conceito e, em particular, na produção de uma imagem-nua. Recorremos a um caso concreto: O Gu...

  18. Receptors for anions

    Energy Technology Data Exchange (ETDEWEB)

    Itsikson, N A; Chupakhin, O N [I. Ya. Postovsky Institute of Organic Synthesis, Urals Branch of the Russian Academy of Sciences, Ekaterinburg (Russian Federation); Morzherin, Yu Yu; Matern, A I [B N Yeltsin Urals State Technical University - UPI (Russian Federation)

    2008-09-30

    The published data on receptors for anions with different geometry are generalised. Special attention is given to the analysis of binding abilities of organic ligands. Structural features of complex-forming agents and their properties are considered.

  19. Somatostatin receptor skintigrafi

    DEFF Research Database (Denmark)

    Rasmussen, Karin; Nielsen, Jørn Theil; Rehling, Michael

    2005-01-01

    Somatostatin receptor scintigraphy (SRS) is a very valuable imaging technique for visualisation of a diversity of neuroendocrine tumours. The sensitivity for localisation of carcinoid tumours is high, but somewhat lower for other neuroendocrine tumours. The methodology, multiple clinical aspects...

  20. Receptor mediated agglutination of human spermatozoa by spermagglutinating factor isolated from Staphylococcus aureus.

    Science.gov (United States)

    Kaur, Siftjit; Prabha, Vijay; Sarwal, Abha

    2010-12-01

    We examined spermagglutinating factor isolated from Staphylococcus aureus for evidence of receptor mediated agglutination of human spermatozoa. Binding to spermatozoa by spermagglutinating factor isolated from S. aureus with a high degree of specificity indicates receptor-ligand interaction. To examine this interaction we isolated and purified the ligand and the receptor. To assess receptor mediated agglutination of spermatozoa further we blocked spermagglutination induced by spermagglutinating factor in the presence of receptor. Spermagglutinating factor induced spermagglutination was competitively inhibited by adding purified receptor, indicating that sperm agglutinating factor isolated from S. aureus attaches to specific receptors on human spermatozoa. The spermagglutinating factor receptor was a protein with a molecular weight of approximately 57 kDa. Spermagglutinating factor induced spermagglutination and at higher concentrations had a spermicidal effect, which was inhibited by introducing the receptor. As observed on scanning electron microscopy studies, incubating spermatozoa with spermagglutinating factor showed profound morphological alterations. However, spermatozoa with normal morphology were noted when incubated with spermagglutinating factor in the presence of receptor, indicating that morphological alterations may account for spermatozoa agglutination by spermagglutinating factor. Results suggest that spermagglutinating factor isolated from S. aureus may bind specifically to sperm surface receptor sites before causing spermagglutination. Copyright © 2010 American Urological Association Education and Research, Inc. Published by Elsevier Inc. All rights reserved.

  1. Muscarinic receptor oligomerization

    OpenAIRE

    Marsango, Sara; Ward, Richard J.; Alvarez-Curto, Elisa; Milligan, Graeme

    2017-01-01

    G protein-coupled receptors (GPCRs) have been classically described as monomeric entities that function by binding in a 1:1 stoichiometric ratio to both ligand and downstream signalling proteins. However, in recent years, a growing number of studies has supported the hypothesis that these receptors can interact to form dimers and higher order oligomers although the molecular basis for these interactions, the overall quaternary arrangements and the functional importance of GPCR oligomerization...

  2. O mercado da arte

    OpenAIRE

    Oliveira, Emerson Dionisio Gomes de

    2010-01-01

    A presente resenha procurou apresentar o livro da socióloga Raymonde Moulin, O mercado da arte, cujo objetivo principal recaiu sobre a análise dos processos constituintes do atual mercado de artes visuais. Para tanto, o livro preocupa-se com dois mercados distintos. O mercado de arte classificada, que diz respeito às obras de artes autorizadas como patrimônio histórico por uma rede de instituições de arte, de memória e de cultura. E o mercado de arte contemporânea, privilegiado no livro, refe...

  3. Fundamentos da montagem audiovisual

    OpenAIRE

    Sílvia Okumura Hayashi

    2016-01-01

    Este trabalho é um estudo sobre a montagem audiovisual. A pesquisa se estrutura em torno das relações entre os elementos fundamentais do ofício de se montar imagens e sons: o tempo, o espaço, a montagem, as ferramentas de trabalho, media pipelines e o mapa. Para tanto, investigamos a natureza algorítmica e tecnológica da montagem audiovisual, as formas de sua aplicação na produção industrial e também as possibilidades de criação formas singulares de montagem que se originam a partir da explor...

  4. Expression of the growth hormone receptor gene in insulin producing cells

    DEFF Research Database (Denmark)

    Møldrup, Annette; Billestrup, N; Nielsen, Jens Høiriis

    1990-01-01

    Growth hormone (GH) plays a dual role in glucose homeostasis. On the one hand, it exerts an insulin antagonistic effect on the peripheral tissue, on the other hand, it stimulates insulin biosynthesis and beta-cell proliferation. The expression of GH-receptors on the rat insulinoma cell line RIN-5AH......-T2-clone B was studied. The binding characteristics with regard to specificity for the native 22 kDa hGH, and the 20 kDa variant were similar to that reported on rat adipocytes. Normal rat islet cells showed a similar affinity for hGH. The RIN cells express GH receptors similar to the cloned liver...... receptor. It is hypothesized that defects in the receptor expression on the beta-cells may contribute to the susceptibility to develop diabetes....

  5. Selective Glucocorticoid Receptor modulators.

    Science.gov (United States)

    De Bosscher, Karolien

    2010-05-31

    The ancient two-faced Roman god Janus is often used as a metaphor to describe the characteristics of the Glucocorticoid Receptor (NR3C1), which exhibits both a beneficial side, that serves to halt inflammation, and a detrimental side responsible for undesirable effects. However, recent developments suggest that the Glucocorticoid Receptor has many more faces with the potential to express a range of different functionalities, depending on factors that include the tissue type, ligand type, receptor variants, cofactor surroundings and target gene promoters. This behavior of the receptor has made the development of safer ligands, that trigger the expression program of only a desirable subset of genes, a real challenge. Thus more knowledge-based fundamental research is needed to ensure the design and development of selective Glucocorticoid Receptor modulators capable of reaching the clinic. Recent advances in the characterization of novel selective Glucocorticoid Receptor modulators, specifically in the context of anti-inflammatory strategies, will be described in this review. 2010 Elsevier Ltd. All rights reserved.

  6. Genetics of Taste Receptors

    Science.gov (United States)

    Bachmanov, Alexander A.; Bosak, Natalia P.; Lin, Cailu; Matsumoto, Ichiro; Ohmoto, Makoto; Reed, Danielle R.; Nelson, Theodore M.

    2016-01-01

    Taste receptors function as one of the interfaces between internal and external milieus. Taste receptors for sweet and umami (T1R [taste receptor, type 1]), bitter (T2R [taste receptor, type 2]), and salty (ENaC [epithelial sodium channel]) have been discovered in the recent years, but transduction mechanisms of sour taste and ENaC-independent salt taste are still poorly understood. In addition to these five main taste qualities, the taste system detects such noncanonical “tastes” as water, fat, and complex carbohydrates, but their reception mechanisms require further research. Variations in taste receptor genes between and within vertebrate species contribute to individual and species differences in taste-related behaviors. These variations are shaped by evolutionary forces and reflect species adaptations to their chemical environments and feeding ecology. Principles of drug discovery can be applied to taste receptors as targets in order to develop novel taste compounds to satisfy demand in better artificial sweeteners, enhancers of sugar and sodium taste, and blockers of bitterness of food ingredients and oral medications. PMID:23886383

  7. Adenosine receptor neurobiology: overview.

    Science.gov (United States)

    Chen, Jiang-Fan; Lee, Chien-fei; Chern, Yijuang

    2014-01-01

    Adenosine is a naturally occurring nucleoside that is distributed ubiquitously throughout the body as a metabolic intermediary. In the brain, adenosine functions as an important upstream neuromodulator of a broad spectrum of neurotransmitters, receptors, and signaling pathways. By acting through four G-protein-coupled receptors, adenosine contributes critically to homeostasis and neuromodulatory control of a variety of normal and abnormal brain functions, ranging from synaptic plasticity, to cognition, to sleep, to motor activity to neuroinflammation, and cell death. This review begun with an overview of the gene and genome structure and the expression pattern of adenosine receptors (ARs). We feature several new developments over the past decade in our understanding of AR functions in the brain, with special focus on the identification and characterization of canonical and noncanonical signaling pathways of ARs. We provide an update on functional insights from complementary genetic-knockout and pharmacological studies on the AR control of various brain functions. We also highlight several novel and recent developments of AR neurobiology, including (i) recent breakthrough in high resolution of three-dimension structure of adenosine A2A receptors (A2ARs) in several functional status, (ii) receptor-receptor heterodimerization, (iii) AR function in glial cells, and (iv) the druggability of AR. We concluded the review with the contention that these new developments extend and strengthen the support for A1 and A2ARs in brain as therapeutic targets for neurologic and psychiatric diseases. © 2014 Elsevier Inc. All rights reserved.

  8. QSAR modeling on dopamine D2 receptor binding affinity of 6-methoxy benzamides.

    Science.gov (United States)

    Samanta, Soma; Debnath, Bikash; Gayen, Shovanlal; Ghosh, Balaram; Basu, Anindya; Srikanth, Kolluru; Jha, Tarun

    2005-10-01

    QSAR modeling was performed on 58 (S) N-[(1-ethyl-2-pyrrolidinyl) methyl]-6-methoxy benzamides as dopamine (DA) D2 receptor antagonists to identify the structural requirements for DA D2 receptor binding affinity. The study pointed out that the presence of hydrophobic substituents at R3 position and electron-donating groups at R5 position increased the biological activity. Substitutions at phenyl ring favored the binding affinity of these benzamides. Ethyl group and iodine at R3 position were advantageous to the activity whereas nitro group at phenyl ring hindered the antagonistic activity.

  9. Site-Directed Mutagenesis of the Fibronectin Domains in Insulin Receptor-Related Receptor.

    Science.gov (United States)

    Deyev, Igor E; Chachina, Natalia A; Zhevlenev, Egor S; Petrenko, Alexander G

    2017-11-19

    The orphan insulin receptor-related receptor (IRR), in contrast to its close homologs, the insulin receptor (IR) and insulin-like growth factor receptor (IGF-IR) can be activated by mildly alkaline extracellular medium. We have previously demonstrated that IRR activation is defined by its extracellular region, involves multiple domains, and shows positive cooperativity with two synergistic sites. By the analyses of point mutants and chimeras of IRR with IR in, we now address the role of the fibronectin type III (FnIII) repeats in the IRR pH-sensing. The first activation site includes the intrinsically disordered subdomain ID (646-716) within the FnIII-2 domain at the C-terminus of IRR alpha subunit together with closely located residues L135, G188, R244, H318, and K319 of L1 and C domains of the second subunit. The second site involves residue T582 of FnIII-1 domain at the top of IRR lambda-shape pyramid together with M406, V407, and D408 from L2 domain within the second subunit. A possible importance of the IRR carbohydrate moiety for its activation was also assessed. IRR is normally less glycosylated than IR and IGF-IR. Swapping both FnIII-2 and FnIII-3 IRR domains with those of IR shifted beta-subunit mass from 68 kDa for IRR to about 100 kDa due to increased glycosylation and abolished the IRR pH response. However, mutations of four asparagine residues, potential glycosylation sites in chimera IRR with swapped FnIII-2/3 domains of IR, decreased the chimera glycosylation and resulted in a partial restoration of IRR pH-sensing activity, suggesting that the extensive glycosylation of FnIII-2/3 provides steric hindrance for the alkali-induced rearrangement of the IRR ectodomain.

  10. Partial characterization of endothelial FGF receptor functional domain by monoclonal antibody VBS-1.

    Science.gov (United States)

    Blanckaert, Vincent D; Venkateswaran, Subramaniam; Han, In Suk; Kim, Kwan Hee; Griswold, Michael D; Schelling, Margaret E

    2002-06-01

    Polypeptide growth factors mediate their cellular responses by binding to and activating specific cell surface receptors. Monoclonal antibody (MAb) VBS-1, produced against native fibroblast growth factor receptor-1 (FGFR-1), inhibited the binding of fibroblast growth factor-2 (FGF-2) to its receptor on coronary venular endothelial cells (CVECs) as determined by 125I-FGF-2 Scatchard analysis and [3H]thymidine uptake assays (ED50 = 80 ng/mL). Enzyme studies demonstrated that MAb VBS-1 binds to a protein epitope. Proteolytic mapping of the CVEC-FGFR established that a 52 kDa doublet contained the FGF binding site and the MAb VBS-1 antigenic epitope. N-glycanase digestion suggested the presence of a 50 kDa core protein for the CVEC-FGFR. Tunicamycin treatment resulted in the loss of expression of the core protein and the mature receptor, indicating the importance of CVEC-FGFR n-linked glycosylation. By Northern blot analysis, it was determined that CVECs express fgfr-1 and not fgfr-2. VBS-1 recognized FGFR-1 (140 kDa) and crossreacted weakly with FGFR-2 (135 kDa). Using a combination of affinity crosslinking, proteolytic mapping and Mab VBS-1 binding studies, we have located the FGF binding site near the NH2-terminal domain of the receptor close to the highly acidic box.

  11. Profilaxia da peste

    Directory of Open Access Journals (Sweden)

    Renato dos Santos Araújo

    1967-12-01

    Full Text Available O autor parte da premissa de que a profilaxia da doença infecciosa decorre do encadeamento epidemiológico: fonte de infecção-veículo transmissor - receptivel, para explicar a da peste, baseada no mesmo princípio. Depois de citar os 4 principais complexos epidemiológicos da peste e afirmar que tôda a profilaxia da doença consiste em atingir os dois primeiros elos dessas cadeias e proteger o último, passa a classificar os vários métodos profiláticos empregados em 2 grandes grupos: o das medidas destrutivas ou provisórias e o das medidas supressivas ou definitivas. Entre as primeiras arrola a desratização e a despulização, às quais acrescenta o tratamento e isolamento do doente e do portaãor, e entre as segundas inclui a anti-ratização e a imunização. A seguir, passa a explicar em que consistem essas várias medidas profiláticas e quais os agentes de que se tem lançado mão para executá-las, expendendo ao curso dessa exposição o conceito que formula a respeito de cada uma delas, à guisa de apreciação do seu valor relativo. Enaltece sobretudo as medidas supressivas ou definitivas, às quais empresta a maior significação na luta antipestosa, chamando a atenção, em especial, para a necessidade de estudos imunológicos para aperfeiçoamento do poder imunitário das vacinas de germes vivos avirulentos, que considera um grande recurso para a profilaxia da doença, sobretudo para a proteção do rurícola, cujo labor e modo de vida o expõem inevitavelmente a se infectar, por ocasião da ocorrência de epizootias de origem silvestre. Concluída essa primeira parte, passa a fazer o histórico de como se desenvolveu a campanha contra a peste, no Brasil, desde a época da sua invasão em 1899 pelo pôrto de Santos até os nossos dias. Nesse histórico, detem-se um pouco para expôr a atuação do extinto Serviço Nacional de Peste, o qual, criado em 1941, após a reorganização do Departamento Nacional de Saúde, passou

  12. Peripheral-type benzodiazepine receptor: a protein of mitochondrial outer membranes utilizing porphyrins as endogenous ligands

    Energy Technology Data Exchange (ETDEWEB)

    Snyder, S.H.; Verma, A.; Trifiletti, R.R.

    1987-10-01

    The peripheral-type benzodiazepine receptor is a site identified by its nanomolar affinity for (/sup 3/H)diazepam, similar to the affinity of diazepam for the central-type benzodiazepine receptor in the brain. The peripheral type benzodiazepine receptor occurs in many peripheral tissues but has discrete localizations as indicated by autoradiographic studies showing uniquely high densities of the receptors in the adrenal cortex and in Leydig cells of the testes. Subcellular localization studies reveal a selective association of the receptors with the outer membrane of mitochondria. Photoaffinity labeling of the mitochondrial receptor with (/sup 3/H)flunitrazepam reveals two discrete labeled protein bands of 30 and 35 kDa, respectively. The 35-kDa band appears to be identical with the voltage-dependent anion channel protein porin. Fractionation of numerous peripheral tissues reveals a single principal endogenous ligand for the receptor, consisting of porphyrins, which display nanomolar affinity. Interactions of porphyrins with the mitochondrial receptor may clarify its physiological role and account for many pharmacological actions of benzodiazepines.

  13. Differential role of ventral tegmental area acetylcholine and N-Methyl-D-Aspartate receptors in cocaine-seeking

    Science.gov (United States)

    Solecki, Wojciech; Wickham, Robert J.; Behrens, Shay; Wang, Jie; Zwerling, Blake; Mason, Graeme F.; Addy, Nii A.

    2013-01-01

    Exposure to drug-associated cues evokes drug-seeking behavior and is regarded as a major cause of relapse. Cues evoke burst firing of ventral tegmental area (VTA) dopamine (DA) neurons and phasic DA release in the nucleus accumbens (NAc). Cholinergic and glutamatergic input to the VTA is suggested to gate phasic DA activity. However, the role of VTA cholinergic and glutamatergic receptors in regulating phasic dopamine release and cue-induced drug-seeking in cocaine experienced subjects is not known. In male Sprague-Dawley rats, we found that VTA inactivation strongly inhibited, while VTA stimulation promoted, cocaine-seeking behavior during early withdrawal. Blockade of phasic activated D1 receptors in the NAc core also strongly inhibited cue-induced cocaine-seeking - suggesting an important role of phasic DA activity in the VTA to NAc core circuit. Next, we examined the role of VTA acetylcholine receptors (AChRs) and N-methyl-D-aspartate receptors (NMDARs) in regulating both NAc core phasic DA release and cue-induced cocaine-seeking. In cocaine naïve subjects, VTA infusion of the nicotinic acetylcholine receptor (AChR) antagonist mecamylamine, the muscarinic AChR antagonist scopolamine, or the NMDAR antagonist AP-5, led to robust attenuation of phasic DA release in the NAc core. During early cocaine withdrawal, VTA infusion of AP-5 had limited effects on NAc phasic DA release and cue-induced cocaine-seeking while VTA infusion of mecamylamine or scopolamine robustly inhibited both phasic DA release and cocaine-seeking. The results demonstrate that VTA AChRs, but not NMDARs, strongly regulate cue-induced cocaine-seeking and phasic DA release during early cocaine withdrawal. PMID:23850572

  14. DA INTANGIBILIDADE DA VERDADE À IMPROPRIEDADE DOS PRINCÍPIOS DA VERDADE MATERIAL E VERDADE FORMAL

    OpenAIRE

    Cardoso, Patrícia de Almeida

    2010-01-01

    A doutrina relaciona com os princípios dispositivo e da livre investigação das provas os princípios da verdade formal e da verdade material, respectivamente. Partindo-se do significado de cada um desses princípios, passando-se pelo conceito filosófico de verdade e da análise sistemática e normativa processual, este trabalho visa constatar a impropriedade da dicotomia entre os princípios da verdade formal e verdade material, atribuindo-lhes um conceito mais apropriado - o juízo de verossimilha...

  15. Rat insulinoma cells express both a 115-kDa growth hormone receptor and a 95-kDa prolactin receptor structurally related to the hepatic receptors

    DEFF Research Database (Denmark)

    Møldrup, Annette; Billestrup, N; Nielsen, Jens Høiriis

    1990-01-01

    Insulin-producing rat islet RIN-5AH tumor cells express multiple binding sites for human growth hormone (hGH). The effect of rat growth hormone (rGH), rat prolactin (rPRL), and human placental lactogen (hPL) on the binding of 125I-labeled hGH (125I-hGH) to RIN-5AH cells revealed the presence...

  16. Reduced dopamine receptors and transporters but not synthesis capacity in normal aging adults: a meta-analysis.

    Science.gov (United States)

    Karrer, Teresa M; Josef, Anika K; Mata, Rui; Morris, Evan D; Samanez-Larkin, Gregory R

    2017-09-01

    Many theories of cognitive aging are based on evidence that dopamine (DA) declines with age. Here, we performed a systematic meta-analysis of cross-sectional positron emission tomography and single-photon emission-computed tomography studies on the average effects of age on distinct DA targets (receptors, transporters, or relevant enzymes) in healthy adults (N = 95 studies including 2611 participants). Results revealed significant moderate to large, negative effects of age on DA transporters and receptors. Age had a significantly larger effect on D1- than D2-like receptors. In contrast, there was no significant effect of age on DA synthesis capacity. The average age reductions across the DA system were 3.7%-14.0% per decade. A meta-regression found only DA target as a significant moderator of the age effect. This study precisely quantifies prior claims of reduced DA functionality with age. It also identifies presynaptic mechanisms (spared synthesis capacity and reduced DA transporters) that may partially account for previously unexplained phenomena whereby older adults appear to use dopaminergic resources effectively. Recommendations for future studies including minimum required samples sizes are provided. Copyright © 2017 The Author(s). Published by Elsevier Inc. All rights reserved.

  17. Download da Revista

    OpenAIRE

    Revista EDUCAÇÃO: Teoria e Prática

    2014-01-01

    Aqui você pode fazer o download da Revista EDUCAÇÃO: Teoria e Prática, edição 47, volume 24. Disponibilizamos quatro formatos: XML, PDF, EPUB e MOBI. Agora você pode ler nossa revista diretamente do seu dispositivo móvel!

  18. Editoriais dourados da REBEn

    Directory of Open Access Journals (Sweden)

    Lygia Paim Müller Dias

    1998-12-01

    Full Text Available Este trabalho está escrito tendo como fonte uma re-leitura de Editoriais da REBEn escritos nos anos 70 a 80. À intencionalidade de alçar das entrelinhas motivações, atitudes, valores, crenças, tendências, ideologias, princípios, nem sempre visíveis tão claramente quando lidos sem o esforço sistemático do método, atrelou-se a opção pela análise de conteúdo, considerada como um conjunto de técnicas. A metodologia compreendeu três etapas no trabalho de análise: pré-análise, descrição analítica e interpretação inferencial. Os resultados esperados incluem ir além dos conteúdos manifestos e dão lugar ao descortinamento dos conteúdos latentes. Esta dimensão inferencial permitiu reconhecer quão brilhantes ou "dourados" são estes editoriais, sobremodo por irradiarem valores reais além dos formais. Essas interpretações não dispensaram o uso da dimensão subjetiva ao fazer a relação entre o Dourado da autora dos Editoriais e o emanado do conjunto da produção editorial analisada.

  19. Dopamine D(1) receptor activation of adenylyl cyclase, not phospholipase C, in the nucleus accumbens promotes maternal behavior onset in rats.

    Science.gov (United States)

    Stolzenberg, Danielle S; Zhang, Ke You; Luskin, Katharine; Ranker, Lynsie; Bress, Jennifer; Numan, Michael

    2010-01-01

    A body of evidence supports the idea that the mesolimbic dopamine (DA) system modulates the natural increase in responsiveness female rats show toward offspring (biological or foster) at birth. In the absence of the full hormonal changes associated with pregnancy and birth, female rats do not show immediate responsiveness toward foster offspring. Activation of the mesolimbic DA system can produce an immediate onset of maternal behavior in these females. For example, female rats that are hysterectomized and ovariectomized on day 15 of pregnancy (15HO) and presented with pups 48 hours later normally show maternal behavior after 2-3 days of pup exposure, but will show maternal behavior on day 0 of testing after microinjection of the DA D(1) receptor agonist, SKF 38393, into the nucleus accumbens (NA) at the time of pup presentation. DA D(1) receptor stimulation is known to activate cAMP intracellular signaling cascades via its stimulation of adenylyl cyclase (AC). However, some DA D(1) receptors are also linked to phospholipase C (PLC) and are capable of activating phosphatidylinositol signaling cascades. SKF 38393 stimulates both types of D(1) receptors. Here we provide evidence that the facilitatory effects of DA D(1) receptor stimulation in the NA on maternal behavior are mediated by AC-linked DA D(1) receptors. By examining the effects of intra-NA application of SKF 83822, a drug which selectively binds DA D(1)-AC receptors, or SKF 83959, a drug which selectively activates D(1)-PLC-linked receptors, we find that only SKF 83822 facilitates maternal behavior onset. Published by Elsevier Inc.

  20. The interaction of Clostridium perfringens enterotoxin with receptor claudins

    Science.gov (United States)

    Shrestha, Archana; Uzal, Francisco A.; McClane, Bruce A.

    2016-01-01

    Clostridium perfringens enterotoxin (CPE) has significant medical importance due to its involvement in several common human gastrointestinal diseases. This 35 kDa single polypeptide toxin consists of two domains: a C-terminal domain involved in receptor binding and an N-terminal domain involved in oligomerization, membrane insertion and pore formation. The action of CPE starts with its binding to receptors, which include certain members of the claudin tight junction protein family; bound CPE then forms a series of complexes, one of which is a pore that causes the calcium influx responsible for host cell death. Recent studies have revealed that CPE binding to claudin receptors involves interactions between the C-terminal CPE domain and both the 1st and 2nd extracellular loops (ECL-1 and ECL-2) of claudin receptors. Of particular importance for this binding is the docking of ECL-2 into a pocket present in the C-terminal domain of the toxin. This increased understanding of CPE interactions with claudin receptors is now fostering the development of receptor decoy therapeutics for CPE-mediated gastrointestinal disease, reagents for cancer therapy/diagnoses and enhancers of drug delivery. PMID:27090847

  1. Cannabinoid receptors in invertebrates.

    Science.gov (United States)

    McPartland, J M; Agraval, J; Gleeson, D; Heasman, K; Glass, M

    2006-03-01

    Two cannabinoid receptors, CB1 and CB2, are expressed in mammals, birds, reptiles, and fish. The presence of cannabinoid receptors in invertebrates has been controversial, due to conflicting evidence. We conducted a systematic review of the literature, using expanded search parameters. Evidence presented in the literature varied in validity, ranging from crude in vivo behavioural assays to robust in silico ortholog discovery. No research existed for several clades of invertebrates; we therefore tested for cannabinoid receptors in seven representative species, using tritiated ligand binding assays with [3H]CP55,940 displaced by the CB1-selective antagonist SR141716A. Specific binding of [3H]CP55,940 was found in neural membranes of Ciona intestinalis (Deuterstoma, a positive control), Lumbricusterrestris (Lophotrochozoa), and three ecdysozoans: Peripatoides novae-zealandiae (Onychophora), Jasus edwardi (Crustacea) and Panagrellus redivivus (Nematoda); the potency of displacement by SR141716A was comparable to measurements on rat cerebellum. No specific binding was observed in Actinothoe albocincta (Cnidaria) or Tethya aurantium (Porifera). The phylogenetic distribution of cannabinoid receptors may address taxonomic questions; previous studies suggested that the loss of CB1 was a synapomorphy shared by ecdysozoans. Our discovery of cannabinoid receptors in some nematodes, onychophorans, and crustaceans does not contradict the Ecdysozoa hypothesis, but gives it no support. We hypothesize that cannabinoid receptors evolved in the last common ancestor of bilaterians, with secondary loss occurring in insects and other clades. Conflicting data regarding Cnidarians precludes hypotheses regarding the last common ancestor of eumetazoans. No cannabinoid receptors are expressed in sponges, which probably diverged before the origin of the eumetazoan ancestor.

  2. NMDA receptors on non-dopaminergic neurons in the VTA support cocaine sensitization.

    Directory of Open Access Journals (Sweden)

    Yu Luo

    2010-08-01

    Full Text Available The initiation of behavioral sensitization to cocaine and other psychomotor stimulants is thought to reflect N-methyl-D-aspartate receptor (NMDAR-mediated synaptic plasticity in the mesolimbic dopamine (DA circuitry. The importance of drug induced NMDAR mediated adaptations in ventral tegmental area (VTA DA neurons, and its association with drug seeking behaviors, has recently been evaluated in Cre-loxp mice lacking functional NMDARs in DA neurons expressing Cre recombinase under the control of the endogenous dopamine transporter gene (NR1(DATCre mice.Using an additional NR1(DATCre mouse transgenic model, we demonstrate that while the selective inactivation of NMDARs in DA neurons eliminates the induction of molecular changes leading to synaptic strengthening, behavioral measures such as cocaine induced locomotor sensitization and conditioned place preference remain intact in NR1(DATCre mice. Since VTA DA neurons projecting to the prefrontal cortex and amygdala express little or no detectable levels of the dopamine transporter, it has been speculated that NMDA receptors in DA neurons projecting to these brain areas may have been spared in NR1(DATCre mice. Here we demonstrate that the NMDA receptor gene is ablated in the majority of VTA DA neurons, including those exhibiting undetectable DAT expression levels in our NR1(DATCre transgenic model, and that application of an NMDAR antagonist within the VTA of NR1(DATCre animals still blocks sensitization to cocaine.These results eliminate the possibility of NMDAR mediated neuroplasticity in the different DA neuronal subpopulations in our NR1(DATCre mouse model and therefore suggest that NMDARs on non-DA neurons within the VTA must play a major role in cocaine-related addictive behavior.

  3. Ethanol and trichloroethanol alter gating of 5-HT3 receptor-channels in NCB-20 neuroblastoma cells.

    Science.gov (United States)

    Lovinger, D M; Sung, K W; Zhou, Q

    2000-02-14

    Alcohol potentiation of 5-HT3 receptors was examined in NCB-20 neuroblastoma cells using whole-cell patch-clamp electrophysiological techniques. Activation of the receptor with the weak partial agonist dopamine (DA) was used to examine alcohol effects under conditions of full agonist occupancy, but low probability of channel opening. Dopamine activation of the receptor increased in a concentration-dependent manner (EC50=0.28 mM), and on average maximal responses to DA were 8.0+/-0.8% of the maximal response to 5-HT. Ethanol (EtOH) and trichloroethanol (TCEt) potentiated DA-activated ion current mediated by 5-HT3 receptors. Potentiation of responses to a maximally effective dopamine concentration averaged 52.0+/-8.0% for EtOH and 567+/-43% for TCEt, which was comparable to the potentiation observed when receptors were activated by a low concentration of 5-HT. The alcohols increased both the potency and efficacy with which dopamine activated the receptor. The observation that alcohols increase the maximal efficacy of dopamine activation of the receptor indicates that one action of alcohols on the 5-HT3 receptor is to increase the probability of channel opening independent of any effect on agonist affinity.

  4. Ionotropic crustacean olfactory receptors.

    Directory of Open Access Journals (Sweden)

    Elizabeth A Corey

    Full Text Available The nature of the olfactory receptor in crustaceans, a major group of arthropods, has remained elusive. We report that spiny lobsters, Panulirus argus, express ionotropic receptors (IRs, the insect chemosensory variants of ionotropic glutamate receptors. Unlike insects IRs, which are expressed in a specific subset of olfactory cells, two lobster IR subunits are expressed in most, if not all, lobster olfactory receptor neurons (ORNs, as confirmed by antibody labeling and in situ hybridization. Ligand-specific ORN responses visualized by calcium imaging are consistent with a restricted expression pattern found for other potential subunits, suggesting that cell-specific expression of uncommon IR subunits determines the ligand sensitivity of individual cells. IRs are the only type of olfactory receptor that we have detected in spiny lobster olfactory tissue, suggesting that they likely mediate olfactory signaling. Given long-standing evidence for G protein-mediated signaling in activation of lobster ORNs, this finding raises the interesting specter that IRs act in concert with second messenger-mediated signaling.

  5. Altered levels of laminin receptor mRNA in various human carcinoma cells that have different abilities to bind laminin

    DEFF Research Database (Denmark)

    Wewer, U M; Liotta, L A; Jaye, M

    1986-01-01

    The human laminin receptor was purified and molecularly cloned to investigate its biosynthetic regulation. Laminin receptor from normal and neoplastic tissue was preparatively affinity purified to homogeneity based on the high affinity of the receptor for laminin. The apparent molecular weight...... of the receptor from different carcinoma sources and from normal placental tissue is in the range of 68-72 kDa. Isoelectric focusing and two-dimensional gel electrophoresis indicated that the receptor protein consists of one major polypeptide chain with a pI value of 6.4 +/- 0.2. Laminin receptor cDNA clones were...... isolated after screening a human endothelial lambda gt11 cDNA library with a monoclonal antibody directed against a domain of the laminin receptor involved in ligand binding. Definitive identification of the cDNA clones was based on comparison of cDNA sequence with the amino acid sequence of a cyanogen...

  6. Striatal dopamine D2 receptor availability predicts the thalamic and medial prefrontal responses to reward in cocaine abusers three years later

    Energy Technology Data Exchange (ETDEWEB)

    Asensio, S.; Goldstein, R.; Asensio, S.; Romero, M.J.; Romero, F.J.; Wong, C.T.; Alia-Klein, N.; Tomasi, D.; Wang, G.-J.; Telang, F..; Volkow, N.D.; Goldstein, R.Z.

    2010-05-01

    Low levels of dopamine (DA) D2 receptor availability at a resting baseline have been previously reported in drug addicted individuals and have been associated with reduced ventral and dorsal prefrontal metabolism. The reduction in DA D2 receptor availability along with the reduced ventral frontal metabolism is thought to underlie compromised sensitivity to nondrug reward, a core characteristic of drug addiction. We therefore hypothesized that variability in DA D2 receptor availability at baseline will covary with dynamic responses to monetary reward in addicted individuals. Striatal DA D2 receptor availability was measured with [{sup 11}C]raclopride and positron emission tomography and response to monetary reward was measured (an average of three years later) with functional magnetic resonance imaging in seven cocaine-addicted individuals. Results show that low DA D2 receptor availability in the dorsal striatum was associated with decreased thalamic response to monetary reward; while low availability in ventral striatum was associated with increased medial prefrontal (Brodmann Area 6/8/32) response to monetary reward. These preliminary results, that need to be replicated in larger sample sizes and validated with healthy controls, suggest that resting striatal DA D2 receptor availability predicts variability in functional responses to a nondrug reinforcer (money) in prefrontal cortex, implicated in behavioral monitoring, and in thalamus, implicated in conditioned responses and expectation, in cocaine-addicted individuals.

  7. Striatal dopamine D2 receptor availability predicts the thalamic and medial prefrontal responses to reward in cocaine abusers three years later

    Science.gov (United States)

    Asensio, Samuel; Romero, Maria J.; Romero, Francisco J.; Wong, Christopher; Alia-Klein, Nelly; Tomasi, Dardo; Wang, Gene-Jack; Telang, Frank; Volkow, Nora D.; Goldstein, Rita Z.

    2009-01-01

    Low levels of dopamine (DA) D2 receptor availability at a resting baseline have been previously reported in drug addicted individuals and have been associated with reduced ventral and dorsal prefrontal metabolism. The reduction in DA D2 receptor availability along with the reduced ventral frontal metabolism is thought to underlie compromised sensitivity to non-drug reward, a core characteristic of drug addiction. We therefore hypothesized that variability in DA D2 receptor availability at baseline will covary with dynamic responses to monetary reward in addicted individuals. Striatal DA D2 receptor availability was measured with [11C]raclopride and positron emission tomography and response to monetary reward was measured (an average of 3 years later) with functional magnetic resonance imaging in seven cocaine addicted individuals. Results show that low DA D2 receptor availability in the dorsal striatum was associated with decreased thalamic response to monetary reward; while low availability in ventral striatum was associated with increased medial prefrontal (Brodmann Area 6/8/32) response to monetary reward. These preliminary results, that need to be replicated in larger sample sizes and validated with healthy controls, suggest that resting striatal DA D2 receptor availability predicts variability in functional responses to a non-drug reinforcer (money) in prefrontal cortex, implicated in behavioral monitoring, and in thalamus, implicated in conditioned responses and expectation, in cocaine addicted individuals. PMID:20034014

  8. Taste Receptors in Innate Immunity

    Science.gov (United States)

    Lee, Robert J.

    2014-01-01

    Taste receptors were first identified on the tongue, where they initiate a signaling pathway that communicates information to the brain about the nutrient content or potential toxicity of ingested foods. However, recent research has shown that taste receptors are also expressed in a myriad of other tissues, from the airway and gastrointestinal epithelia to the pancreas and brain. The functions of many of these extraoral taste receptors remain unknown, but emerging evidence suggests that bitter and sweet taste receptors in the airway are important sentinels of innate immunity. This review discusses taste receptor signaling, focusing on the G-protein coupled–receptors that detect bitter, sweet, and savory tastes, followed by an overview of extraoral taste receptors and in-depth discussion of studies demonstrating the roles of taste receptors in airway innate immunity. Future research on extraoral taste receptors has significant potential for identification of novel immune mechanisms and insights into host-pathogen interactions. PMID:25323130

  9. Malacofauna da plataforma continental portuguesa

    OpenAIRE

    Gomes, Jaime Alberto Jardim

    2009-01-01

    Este estudo tem como objectivo principal a identificação e caracterização da malacofauna da plataforma continental portuguesa. Baseia-se no estudo de 72 amostras de sedimentos colhidas em campanhas oceanográficas efectuadas ao longo da plataforma, de Caminha à Figueira da Foz e de Sagres a Vila Real de Santo António (incluindo alguns locais na Baía de Cádiz, Espanha). Foi recenseado um total de 1500 indivíduos, dos quais 1251 são representantes da classe Bivalvia, 201 ...

  10. Human presynaptic receptors.

    Science.gov (United States)

    Schlicker, Eberhard; Feuerstein, Thomas

    2017-04-01

    Presynaptic receptors are sites at which transmitters, locally formed mediators or hormones inhibit or facilitate the release of a given transmitter from its axon terminals. The interest in the identification of presynaptic receptors has faded in recent years and it may therefore be justified to give an overview of their occurrence in the autonomic and central nervous system; this review will focus on presynaptic receptors in human tissues. Autoreceptors are presynaptic receptors at which a given transmitter restrains its further release, though in some instances may also increase its release. Inhibitory autoreceptors represent a typical example of a negative feedback; they are tonically activated by the respective endogenous transmitter and/or are constitutively active. Autoreceptors also play a role under pathophysiological conditions, e.g. by limiting the massive noradrenaline release occurring during congestive heart failure. They can be used for therapeutic purposes; e.g., the α2-adrenoceptor antagonist mirtazapine is used as an antidepressant and the inverse histamine H3 receptor agonist pitolisant has been marketed as a new drug for the treatment of narcolepsy in 2016. Heteroreceptors are presynaptic receptors at which transmitters from adjacent neurons, locally formed mediators (e.g. endocannabinoids) or hormones (e.g. adrenaline) can inhibit or facilitate transmitter release; they may be subject to an endogenous tone. The constipating effect of the sympathetic nervous system or of the antihypertensive drug clonidine is related to the activation of inhibitory α2-adrenoceptors on postganglionic parasympathetic neurons. Part of the stimulating effect of adrenaline on the sympathetic nervous system during stress is related to its facilitatory effect on noradrenaline release via β2-adrenoceptors. Copyright © 2016 Elsevier Inc. All rights reserved.

  11. Co-purification of A1 adenosine receptors and guanine nucleotide-binding proteins from bovine brain.

    Science.gov (United States)

    Munshi, R; Linden, J

    1989-09-05

    molecular mass of 35 kDa which when deglycosylated undergoes a characteristic shift in molecular mass to a sharp band at 32 kDa. In addition to the receptor, silver staining revealed polypeptides with molecular masses of 39 and 41 kDa, which are ADP-ribosylated by pertussis toxin, and 36 kDa corresponding to G protein beta-subunits.

  12. Role of Kv1 potassium channels in regulating dopamine release and presynaptic D2 receptor function.

    Directory of Open Access Journals (Sweden)

    Philippe Martel

    Full Text Available Dopamine (DA release in the CNS is critical for motor control and motivated behaviors. Dysfunction of its regulation is thought to be implicated in drug abuse and in diseases such as schizophrenia and Parkinson's. Although various potassium channels located in the somatodendritic compartment of DA neurons such as G-protein-gated inward rectifying potassium channels (GIRK have been shown to regulate cell firing and DA release, little is presently known about the role of potassium channels localized in the axon terminals of these neurons. Here we used fast-scan cyclic voltammetry to study electrically-evoked DA release in rat dorsal striatal brain slices. We find that although G-protein-gated inward rectifying (GIRK and ATP-gated (K(ATP potassium channels play only a minor role, voltage-gated potassium channels of the Kv1 family play a major role in regulating DA release. The use of Kv subtype-selective blockers confirmed a role for Kv1.2, 1.3 and 1.6, but not Kv1.1, 3.1, 3.2, 3.4 and 4.2. Interestingly, Kv1 blockers also reduced the ability of quinpirole, a D2 receptor agonist, to inhibit evoked DA overflow, thus suggesting that Kv1 channels also regulate presynaptic D2 receptor function. Our work identifies Kv1 potassium channels as key regulators of DA release in the striatum.

  13. Distribution of epidermal growth factor receptors in rat tissues during embryonic skin development, hair formation, and the adult hair growth cycle

    DEFF Research Database (Denmark)

    Green, M R; Couchman, J R

    1984-01-01

    In a previous study on neonatal rat skin (Green MR, Basketter DA, Couchman JR, Rees DA: Dev Biol 100:506-512, 1983) a close positive correlation was found between epidermal growth factor (EGF) receptor tissue distribution and areas of potential epithelial cell proliferation. We now report...

  14. A REFORMA DA IGREJA

    Directory of Open Access Journals (Sweden)

    Vítor Galdino Feller

    2014-01-01

    Full Text Available O pontificado do papa Francisco trouxe à tona o tema da reforma da Igreja. Retoma-se essa causa que acompanha a história da Igreja desde os seus primórdios e que interessa a todos os membros do povo santo de Deus. O texto divide-se em quatro partes. Primeiro, faz-se um apanhado histórico dos anseios de reforma da Igreja, mostrando que, muitas vezes em instâncias subterrâneas, sempre houve o desejo e também ações concretas de renovação. Em seguida, apresenta-se como razão para a reforma da Igreja o anúncio e a realização do Reino de Deus, pelo qual é preciso que a Igreja se volte à concretude humana e histórica de Jesus de Nazaré, pela superação do apego ao poder e às estruturas religiosas. Num terceiro momento, trata-se do critério pelo qual se mede a realização e a veracidade da reforma da Igreja: a santidade de cada fiel e do povo cristão no meio do mundo. Por fim, conclui-se que o caminho para a reforma da Igreja está na escuta dos clamores do Espírito Santo, que fala na própria Igreja e no mundo através do sensus fidei dos fiéis, das Igrejas particulares, dos pobres, das mulheres e das realidades terrestres. ABSTRACT: The pontificate of Pope Francis brought to the surface the theme of reform of the Church. This essay takes up this cause that accompanies the history of the Church from its beginnings and concerns all the members of the holy people of God. The text is divided into four parts. First, it gives a historical summary of the yearnings for reform of the Church, showing that, in many instances subterranean, there has always been the desire and also the concrete actions of renewal. Following from this, the essay presents as the reason for the reform of the Church the proclamation and the realization of the Kingdom of God, whereby it is necessary that the Church return to the concrete human and historical Jesus of Nazareth, in order to overcome the addiction to power and to religious structures. In the

  15. The da Vinci robot.

    Science.gov (United States)

    Moran, Michael E

    2006-12-01

    One might assume from the title of this paper that the nuances of a complex mechanical robot will be discussed, and this would be correct. On the other hand, the date of the design and possible construction of this robot was 1495, a little more than five centuries ago. The key point in the title is the lack of a trademarked name, as Leonardo was the designer of this sophisticated system. His notes from the Codex Altanticus represent the foundation of this report. English translations of da Vinci's notebooks are currently available. Beginning in the 1950s, investigators at the University of California began to ponder the significance of some of da Vinci's markings on what appeared to be technical drawings. Such markings also occur in his Codex Atlanticus (the largest single collection of da Vinci's sheets, consisting of 1119 separate pages and 481 folios) along with a large number of other mechanical devices. Continuing research at the Instituto e Museo di Storia della Scienza in Florence has yielded a great deal of information about Leonardo's intentions with regard to his mechanical knight. It is now known that da Vinci's robot would have had the outer appearance of a Germanic knight. It had a complex core of mechanical devices that probably was human powered. The robot had two independent operating systems. The first had three degree-of-freedom legs, ankles, knees, and hips. The second had four degrees of freedom in the arms with articulated shoulders, elbows, wrists, and hands. A mechanical analog-programmable controller within the chest provided the power and control for the arms. The legs were powered by an external crank arrangement driving the cable, which connected to key locations near each lower extremity's joints. Da Vinci also is known to have devised a programmable front-wheel-drive automobile with rack-and-pinion suspension mechanisms at age 26. He would recall this device again, when, at age 40, he is thought to have built a programmable automated

  16. O Tema da Cidadania

    Directory of Open Access Journals (Sweden)

    Adriano Moreira

    2009-11-01

    Full Text Available Neste artigo tentaremos evidenciar a natureza pelo menos tripartida da cidadania que responde ao incontroladoglobalismo: uma que se confunde com os direitos humanos, exigentes querem seja o Estado o seu interlocutor,quer não exista tal interlocutor; outra que se insere na fenomenologia dos grandes espaços em formação, de que aUnião Europeia é exemplo, e a que o projecto da Constituição Europeia, agora em recolhimento de meditação, jáoferece o apoio de uma definição específica de direitos; e finalmente, a cidadania que diz respeito à relação com oEstado soberano em crise de redefinição, sobretudo, pelo que nos interessa, no espaço europeu.

  17. Efectividade da Fisioterapia

    OpenAIRE

    Faria, Pedro Joaquim Pereira

    2011-01-01

    Trabalho apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Licenciado em Fisioterapia Objectivo: Determinar a efectividade da Fisioterapia com recurso a técnicas de Ventilação Não Invasiva (VNI) em Doentes Neuromusculares (DNM). Metodologia: Pesquisa computorizada nas bases de dados Pubmed/Medline e PEDro permitindo identificar estudos randomizados controlados que avaliam diferentes técnicas de VNI associadas ao tratamento de DNM. Resultados: Nes...

  18. O surgimento da Midiocracia

    Directory of Open Access Journals (Sweden)

    César Steffen

    2013-06-01

    Full Text Available O sistema democrático contemporâneo é amplamente influenciado pela presença e ações dos meios de comunicação. A mídia é condição indispensável para os fazeres dos diversos campos sociais nas democracias contemporâneas, sendo o acesso às suas linguagens e tecnologias, em toda sua amplitude e diferentes características, indispensável para os fazeres e estratégias dos diversos atores sociais, naquilo que se denomina de midiatização da sociedade. Este processo de midiatização coloca a mídia como condição para os processos políticos e democráticos modernos. Na medida em que é através das redes midiáticas que as questões se fazem negociáveis e tensionam os processos dos demais campos, influencia as resoluções necessárias ao desenvolvimento e à sustentação das lógicas sociais e democráticas onde se insere. Assim, a mídia mostra-se como elemento fundamental da política e da democracia contemporâneas.

  19. Taste receptors for umami: the case for multiple receptors1234

    OpenAIRE

    Chaudhari, Nirupa; Pereira, Elizabeth; Roper, Stephen D

    2009-01-01

    Umami taste is elicited by many small molecules, including amino acids (glutamate and aspartate) and nucleotides (monophosphates of inosinate or guanylate, inosine 5′-monophosphate and guanosine-5′-monophosphate). Mammalian taste buds respond to these diverse compounds via membrane receptors that bind the umami tastants. Over the past 15 y, several receptors have been proposed to underlie umami detection in taste buds. These receptors include 2 glutamate-selective G protein–coupled receptors,...

  20. Efeito da trepanação na previsibilidade da correção da ametropia esférica pós-transplante

    Directory of Open Access Journals (Sweden)

    Renata Soares Magalhães

    2011-04-01

    Full Text Available OBJETIVO: Demonstrar a redução e previsibilidade da ametropia esférica com melhora da acuidade visual promovida pelo transplante penetrante (TP de córnea por ceratocone e o efeito da relação diâmetro doador-receptor neste resultado. MÉTODOS: Estudo retrospectivo revisando aleatoriamente os prontuários de 60 pacientes submetidos ao TP por ceratocone, realizados pelo mesmo cirurgião, com a mesma técnica cirúrgica, entre 2005 e 2008. Foram avaliados estatisticamente: ceratometria, equivalente esférico e acuidade visual no pré, pós-operatório de 1, 3 e 6 meses. Os grupos foram então divididos conforme a diferença de trepanação entre diâmetro do doador e receptor, sendo o grupo 1 composto por pacientes com diferença de zero ou 0,25mm (8,0/8,0 e 8,25/8,0mm e o grupo 2 por pacientes com diferença de 0,5mm (8,0/8,5mm. RESULTADOS: Observou-se redução significativa da ceratometria média e equivalente esférico e melhora da acuidade visual dos pacientes com ceratocone submetidos ao TP. No sexto mês a redução do equivalente esférico foi de 79% em relação ao pré-operatório. Cada dia de pós-operatório está associado à hipermetropização de 0,68D (p=0,005. Entretanto, a diferença entre os grupos não foi significativa. Em relação a ceratometria, cada dia de pós-operatório associou-se a um declínio de 1,87D (p<0,0001 que variou entre os grupos significativamente (p=0,007. O grupo 1 apresentou redução de 8,93D na ceratometria média, comparado a redução de 6,81D no grupo 2 (p=0,035. CONCLUSÃO : O planejamento da trepanação pode proporcionar redução significativa da elevada ametropia que comumente acompanha o pós-operatório do TP por ceratocone, permitindo assim correção ótica satisfatória.

  1. Gramatica da Forma da Sistematização da Coluna de Alberti

    OpenAIRE

    Quaresma, Pedro Filipe Coutinho Cabral d'Oliveira

    2014-01-01

    Tese de doutoramento em Arquitetura, na especialidade de Teoria e História da Arquitetura, apresentada ao Departamento de Arquitetura da Faculdade de Ciências e Tecnologia da Universidade de Coimbra Os resultados da investigação que relaciona a teoria de Alberti com a geração de alguns edifícios são apresentados e desenvolvidos nesta tese. A interpretação do tratado Da Arte Edificatória de Leon Battista Alberti, nomeadamente os Livros VI, VII, VIII e IX, teve como resultado a construção de...

  2. A utilização da teoria da aprendizagem significativa no ensino da Enfermagem

    OpenAIRE

    de Sousa, Alana Tamar Oliveira; Formiga,Nilton Soares; Oliveira,Simone Helena dos Santos; Costa, Marta Miriam Lopes; Soares, Maria Júlia Guimarães Oliveira

    2015-01-01

    RESUMO Objetivo: sintetizar a produção científica acerca da Teoria da Aprendizagem Significativa no processo de ensino-aprendizagem em Enfermagem. Método: revisão integrativa realizada nas bases de dados MEDLINE, LILACS, SciELO, BDENF e CINAHL, com artigos que abordaram a temática ou aspectos da teoria da aprendizagem significativa de David Ausubel. Fizeram parte da amostra dez artigos, sendo seis escritos no idioma português e quatro no inglês, publicados de 1998 a 2013. Resultados: cinco...

  3. Da natureza da computação à computação da natureza

    OpenAIRE

    Fiolhais, Carlos

    1992-01-01

    Referência bibliográfica: FIOLHAIS, Carlos – Da natureza da computação à computação da natureza. In TEODORO, Vítor Duarte, org. ; FREITAS, João Correia de, org. – Educação e computadores. 1.ª ed. Lisboa : Ministério da Educação, Gabinete de Estudos e Planeamento, 1992. (Desenvolvimento dos Sistemas Educativos). ISBN 9726142016. p. 189-196. "O computador conquistou por direito próprio um lugar na sociedade moderna. Encontra-se por todo o lado, nas mais diversas facetas da actividade humana....

  4. Solubilized benzodiazepine receptors for use in receptor assays

    NARCIS (Netherlands)

    Janssen, M.J; Stegeman, M; Ensing, K; de Zeeuw, R.A

    In the development of non-radioactive receptor assays for benzodiazepines, employing fluorescent ligands, it was observed that the fluorescence measurements were hampered by the background fluorescence of the receptor preparation. This receptor preparation is a brain tissue homogenate in which the

  5. Metformin and insulin receptors

    Energy Technology Data Exchange (ETDEWEB)

    Vigneri, R.; Gullo, D.; Pezzino, V.

    The authors evaluated the effect of metformin (N,N-dimethylbiguanide), a biguanide known to be less toxic than phenformin, on insulin binding to its receptors, both in vitro and in vivo. Specific /sup 125/I-insulin binding to cultured IM-9 human lymphocytes and MCF-7 human breast cancer cells was determined after preincubation with metformin. Specific /sup 125/I-insulin binding to circulating monocytes was also evaluated in six controls, eight obese subjects, and six obese type II diabetic patients before and after a short-term treatment with metformin. Plasma insulin levels and blood glucose were also measured on both occasions. Metformin significantly increased insulin binding in vitro to both IM-9 lymphocytes and MCF-7 cells; the maximum increment was 47.1% and 38.0%, respectively. Metformin treatment significantly increased insulin binding in vivo to monocytes of obese subjects and diabetic patients. Scatchard analysis indicated that the increased binding was mainly due to an increase in receptor capacity. Insulin binding to monocytes of normal controls was unchanged after metformin as were insulin levels in all groups; blood glucose was significantly reduced after metformin only in diabetic patients. These data indicate that metformin increases insulin binding to its receptors in vitro and in vivo. The effect in vivo is observed in obese subjects and in obese type II diabetic patients, paralleling the clinical effectiveness of this antidiabetic agent, and is not due to receptor regulation by circulating insulin, since no variation in insulin levels was recorded.

  6. Ginkgolides and glycine receptors

    DEFF Research Database (Denmark)

    Jaracz, Stanislav; Nakanishi, Koji; Jensen, Anders A.

    2004-01-01

    Ginkgolides from the Ginkgo biloba tree are diterpenes with a cage structure consisting of six five-membered rings and a unique tBu group. They exert a variety of biological properties. In addition to being antagonists of the platelet activating factor receptor (PAFR), it has recently been shown...

  7. Meeting report: nuclear receptors

    DEFF Research Database (Denmark)

    Tuckermann, Jan; Bourguet, William; Mandrup, Susanne

    2010-01-01

    The biannual European Molecular Biology Organization (EMBO) conference on nuclear receptors was organized by Beatrice Desvergne and Laszlo Nagy and took place in Cavtat near Dubrovnik on the Adriatic coast of Croatia September 25-29, 2009. The meeting brought together researchers from all over...

  8. The hallucinogen d-lysergic diethylamide (LSD) decreases dopamine firing activity through 5-HT1A, D2 and TAAR1 receptors.

    Science.gov (United States)

    De Gregorio, Danilo; Posa, Luca; Ochoa-Sanchez, Rafael; McLaughlin, Ryan; Maione, Sabatino; Comai, Stefano; Gobbi, Gabriella

    2016-11-01

    d-lysergic diethylamide (LSD) is a hallucinogenic drug that interacts with the serotonin (5-HT) system binding to 5-HT1 and 5-HT2 receptors. Little is known about its potential interactions with the dopamine (DA) neurons of the ventral tegmental area (VTA). Using in-vivo electrophysiology in male adult rats, we evaluated the effects of cumulative doses of LSD on VTA DA neuronal activity, compared these effects to those produced on 5-HT neurons in the dorsal raphe nucleus (DRN), and attempted to identify the mechanism of action mediating the effects of LSD on VTA DA neurons. LSD, at low doses (5-20μg/kg, i.v.) induced a significant decrease of DRN 5-HT firing activity through 5-HT2A and D2 receptors. At these low doses, LSD did not alter VTA DA neuronal activity. On the contrary, at higher doses (30-120μg/kg, i.v.), LSD dose-dependently decreased VTA DA firing activity. The depletion of 5-HT with p-chlorophenylalanine did not modulate the effects of LSD on DA firing activity. The inhibitory effects of LSD on VTA DA firing activity were prevented by the D2 receptor antagonist haloperidol (50μg/kg, i.v.) and by the 5-HT1A receptor antagonist WAY-100,635 (500μg/kg, i.v.). Notably, pretreatment with the trace amine-associate receptor 1 (TAAR1) antagonist EPPTB (5mg/kg, i.v.) blocked the inhibitory effect of LSD on VTA DA neurons. These results suggest that LSD at high doses strongly affects DA mesolimbic neuronal activity in a 5-HT independent manner and with a pleiotropic mechanism of action involving 5-HT1A, D2 and TAAR1 receptors. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Key region of laminin receptor 1 for interaction with human period 1

    African Journals Online (AJOL)

    GREGORY

    2010-09-20

    Sep 20, 2010 ... The 67 kDa laminin receptor 1 (Lamr1) is a novel protein that interacts with human circadian clock protein period 1 (hPer1). We confirmed the interaction between hPer1 and complete Lamr1 (295 amino acids) through yeast two-hybrid system in the present study. And we identified the interaction between.

  10. Expressão gênica de adipocinas em ovelhas alimentadas com resíduos da indústria do biodiesel da mamona

    Directory of Open Access Journals (Sweden)

    S.S. Duarte

    2014-08-01

    Full Text Available A expressão de RNAm para leptina, receptor de leptina (obRb, adiponectina, receptor de adiponectina (AdipoR1 e resistina foi avaliada por meio da técnica de PCR em tempo real, em tecidos ovariano, hipofisário, adiposo do omento e da região perirrenal, em ovelhas alimentadas sem farelo de mamona ou com farelo de mamona detoxificada durante 14 meses. O tipo de dieta não afetou os níveis de RNAm para leptina, obRb, adiponectina, AdipoR1 e resistina nos diferentes tecidos avaliados (P>0,05. Nos tecidos ovariano e hipofisário, não foi verificada a expressão da adiponecina e da resistina, respectivamente. Como consequência, pode-se concluir que o farelo de mamona detoxificada pode ser utilizado como fonte proteica na dieta de ovelhas, sem afetar a expressão do gene resistina e dos genes leptina e adiponectina, bem como de seus receptores.

  11. Angiotensin type 2 receptor (AT2R) and receptor Mas

    DEFF Research Database (Denmark)

    Villela, Daniel; Leonhardt, Julia; Patel, Neal

    2015-01-01

    The angiotensin type 2 receptor (AT2R) and the receptor Mas are components of the protective arms of the renin-angiotensin system (RAS), i.e. they both mediate tissue protective and regenerative actions. The spectrum of actions of these two receptors and their signalling mechanisms display striking...... the phenomenon of blockade of angiotensin-(1-7) [Ang-(1-7)] actions by AT2R antagonists and vice versa. Such mechanisms may comprise dimerization of the receptors or dimerization-independent mechanisms such as lack of specificity of the receptor ligands used in the experiments or involvement of the Ang-(1...

  12. Modelagem causal da astronomia antiga

    OpenAIRE

    Rodrigo Cristino de Faria

    2014-01-01

    Esta dissertação tem como objetivo apresentar a Modelagem Causal em História da Ciência (MCHC), e aplicá-la ao período da história da astronomia que vai dos primórdios ao século III AEC. Na primeira parte, exponho o método e discorro sobre algumas de suas implicações filosóficas especialmente aquelas relacionadas com a noção de avanço e historiográficas, ao mesmo tempo em que procuro inseri-lo no panorama da filosofia da ciência. Na segunda parte, que já é uma aplicação da MCHC, apresento u...

  13. A Utopia da Paz Universal

    Directory of Open Access Journals (Sweden)

    Daniel Serrão

    2009-11-01

    Full Text Available Como o Homem atingiu a fase da cultura exterior simbólica em que se encontra actualmente. Apresentaçãosucinta da teoria dos patamares evolutivos de Merlin Donald. O paradigma "popperiano" da investigaçãocientífica moderna: verificar ou falsificar hipóteses. O caso típico da teoria darwiniana da evolução das espéciesvivas. A Bioética como diálogo de saberes em ordem à criação de uma nova sabedoria (wisdom. Apresentação doconceito de Van Rensselaer Potter. O "credo" de Potter e a utopia da paz universal.

  14. Pioneirismo da associacao brasileira de enfermagem no desenvolvimento da pesquisa: da revista ao centro de pesquisa

    Directory of Open Access Journals (Sweden)

    Lais de Araujo Pereira

    2013-09-01

    Full Text Available O presente estudo tem como objetivo analisar as primeiras iniciativas da Associação Brasileira de Enfermagem para o desenvolvimento da pesquisa em enfermagem. Com um recorte temporal que engloba o período de 1932 a 1971, ano de criação da Revista Brasileira de Enfermagem à criação do Centro de Estudos e Pesquisas, da Associação Brasileira de Enfermagem. As fontes utilizadas foram documentos escritos localizados no Centro de Documentação da Escola de Enfermagem Anna Nery da Universidade Federal do Rio de Janeiro e no Centro de Memória da Associação Brasileira de Enfermagem, além de edições da revista localizadas na Biblioteca Setorial da Pós-Graduação da Escola de Enfermagem Anna Nery. Percebe-se, nesta análise, que os empreendimentos realizados por essa entidade representaram um verdadeiro espaço de investigação e de formação de enfermeiros pesquisadores no Brasil.

  15. Constitutive Endocytosis of VEGFR2 Protects the Receptor against Shedding.

    Science.gov (United States)

    Basagiannis, Dimitris; Christoforidis, Savvas

    2016-08-05

    VEGFR2 plays a fundamental role in blood vessel formation and in life threatening diseases, such as cancer angiogenesis and cardiovascular disorders. Although inactive growth factor receptors are mainly localized at the plasma membrane, VEGFR2 undergoes constitutive endocytosis (in the absence of ligand) and recycling. Intriguingly, the significance of these futile transport cycles of VEGFR2 remains unclear. Here we found that, unexpectedly, the function of constitutive endocytosis of VEGFR2 is to protect the receptor against plasma membrane cleavage (shedding), thereby preserving the functional state of the receptor until the time of activation by VEGF. Inhibition of constitutive endocytosis of VEGFR2, by interference with the function of clathrin, dynamin, or Rab5, increases dramatically the cleavage/shedding of VEGFR2. Shedding of VEGFR2 produces an N-terminal soluble fragment (100 kDa, s100), which is released in the extracellular space, and a residual C-terminal part (130 kDa, p130) that remains integrated at the plasma membrane. The released soluble fragment (s100) co-immunoprecipitates with VEGF, in line with the topology of the VEGF-binding domain at the N terminus of VEGFR2. Increased shedding of VEGFR2 (via inhibition of constitutive endocytosis) results in reduced response to VEGF, consistently with the loss of the VEGF-binding domain from the membrane remnant of VEGFR2. These data suggest that constitutive internalization of VEGFR2 protects the receptor against shedding and provides evidence for an unprecedented mechanism via which endocytosis can regulate the fate and activity of growth factor receptors. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  16. Role of NMDA receptors in dopamine neurons for plasticity and addictive behaviors.

    Science.gov (United States)

    Zweifel, Larry S; Argilli, Emanuela; Bonci, Antonello; Palmiter, Richard D

    2008-08-14

    A single exposure to drugs of abuse produces an NMDA receptor (NMDAR)-dependent long-term potentiation (LTP) of AMPA receptor (AMPAR) currents in DA neurons; however, the importance of LTP for various aspects of drug addiction is unclear. To test the role of NMDAR-dependent plasticity in addictive behavior, we genetically inactivated functional NMDAR signaling exclusively in DA neurons (KO mice). Inactivation of NMDARs results in increased AMPAR-mediated transmission that is indistinguishable from the increases associated with a single cocaine exposure, yet locomotor responses to multiple drugs of abuse were unaltered in the KO mice. The initial phase of locomotor sensitization to cocaine is intact; however, the delayed sensitization that occurs with prolonged cocaine withdrawal did not occur. Conditioned behavioral responses for cocaine-testing environment were also absent in the KO mice. These findings provide evidence for a role of NMDAR signaling in DA neurons for specific behavioral modifications associated with drug seeking behaviors.

  17. Alopecia cicatricial da sarcoidose

    Directory of Open Access Journals (Sweden)

    Teixeira Giane Pereira Giro

    2003-01-01

    Full Text Available Os autores apresentam um caso de alopecia cicatricial associada a lesões papulosas na face e no tronco, com quatro anos de evolução. O diagnóstico de sarcoidose foi confirmado pelo exame histopatológico. Durante o seguimento, a paciente desenvolveu lesões pulmonares. A alopecia cicatricial é complicação rara da sarcoidose e se confunde, clinicamente, com outras dermatoses, entre elas o lúpus eritematoso discóide e o líquen plano pilar.

  18. Em favor da talassografia

    OpenAIRE

    Jean-Louis Boudou

    2001-01-01

    A Talassografia (“descrição do mar”) interessa-sepelos impactos físicos, biológicos, ecológicos... culturais da violenta antropização dos ambientes costeiros (oceânicos e continentais), caracterizados pelaexigüidade, vulnerabilidade, fragilidade e plasticidade. Como o Brasil é um “país marítimo”, os geó-grafos (os talassógrafos) brasileiros são convidadosa intensificar suas pesquisas nas áreas costeiras e acriar novas estruturas para divulgá-las: Revista, Encontros, Associação, Pós-Graduaçã...

  19. HISTÓRIA E TEOLOGIA DA INFALIBILIDADE DA IGREJA

    Directory of Open Access Journals (Sweden)

    Bernard Sesboüé

    2014-01-01

    Full Text Available Faz-se o histórico da doutrina da infalibilidade da Igreja e, especialmente, do papa, diante da sensibilidade de hoje e diante da discrição do Vaticano II. Trata-se da verdade e da certeza da verdade na Igreja, que não pode errar. Distingue-se entre a indefectibilidade (da Igreja e a infalibilidade, que implica a irreformabilidade da proposição. No primeiro milênio tinha-se consciência do dom da inerrância confiado à Igreja. Na Idade Média, acentua-se a plenitude do poder atribuída ao papa. O caso de João XXII e dos franciscanos espirituais, o problema do papa herege, o cisma ocidental e os concílios de Constança e de Basileia, a crise jansenista e o empenho de Fénelon levaram finalmente, no Vaticano I, à definição da infalibilidade papal. Esta, porém, não foi invocada com a frequência que se esperava. O Vaticano II ensina dentro da indefectibilidade da fé, sem definições irreformáveis. ABSTRACT: This article presents the history of the doctrine of the infallibility of the Church, and especially of the Pope, in light of the today’s sensibility and of the discretion of Vatican II. It deals with the truth and certainty of truth in the Church, which cannot err. A distinction is made between the indefectibility (of the Church and the infallibility, which implies a “non-reformability” of the proposition. In the first Millennium there was an awareness of the gift of inerrancy entrusted to the Church. In the Middle Ages, the fullness of power assigned to the Pope became accentuated. The case of John XXII and of the spiritual Franciscans, the problem of the heretical pope, the Western schism and the Councils of Constance and Basileia, the Jansenist crisis and the work of Fénelon led finally, in Vatican I, to the definition of papal infallibility. This, however, was not invoked as often as expected. Vatican II teaches within the indefectibility of faith, without unalterable definitions.

  20. [GABA receptors: structure and functions].

    Science.gov (United States)

    Tiurenkov, I N; Perfilova, V N

    2010-10-01

    Data on the structure, localization, physiology, and pharmacology of GABA receptors are reviewed. These receptors belong to cis-loop receptors and consist of 16 subunits in various combinations and occur in both central nervous system and peripheral organs. There are a great number of their allosteric modulators, agonists and antagonists. Activation of GABA receptors is accompanied by changes in the permeability of plasmatic membranes for chloride ions, which is followed by depolarization (presynaptic inhibition) or hyperpolarization (postsynaptic inhibition). GABA receptors contain some topographically different binding sites, intended for the interaction both with the main mediator (GABA) and with allosteric regulators such as benzodiazepines, barbiturates, convulsants, ethanol, and neurosteroids.

  1. Levamisole receptors: a second awakening

    Science.gov (United States)

    Martin, Richard J.; Robertson, Alan P.; Buxton, Samuel K.; Beech, Robin N.; Charvet, Claude L.; Neveu, Cedric

    2012-01-01

    Levamisole and pyrantel are old (1965) but useful anthelmintics that selectively activate nematode acetylcholine ion-channel receptors; they are used to treat roundworm infections in humans and animals. Interest in their actions has surged, giving rise to new knowledge and technical advances, including an ability to reconstitute receptors that reveal more details of modes of action/resistance. We now know that the receptors are plastic and may form diverse species-dependent subtypes of receptor with different sensitivities to individual cholinergic anthelmintics. Understanding the biology of the levamisole receptors is expected to inform other studies on anthelmintics (ivermectin and emodepside) that act on ion-channels. PMID:22607692

  2. Teoria da Mente: diferentes abordagens

    OpenAIRE

    Jou Graciela Inchausti de; Sperb Tania Mara

    1999-01-01

    A capacidade de compreender os estados mentais (i.e. sentimentos, desejos, crenças e intenções) dos outros e de si mesmo é uma das características sociais do ser humano. Quando essa habilidade emerge e como se desenvolve são aspectos que têm sido pesquisados por psicólogos desenvolvimentistas e cognitivistas sob o nome de Teoria da Mente das crianças. Nesse trabalho, procura-se relacionar os diferentes enfoques teóricos acerca da natureza, gênese e desenvolvimento da teoria da mente com os ac...

  3. Structural biology of GABAB receptor.

    Science.gov (United States)

    Frangaj, Aurel; Fan, Qing R

    2017-10-12

    Metabotropic GABAB receptor is a G protein-coupled receptor (GPCR) that mediates slow and prolonged inhibitory neurotransmission in the brain. It functions as a constitutive heterodimer composed of the GABAB1 and GABAB2 subunits. Each subunit contains three domains; the extracellular Venus flytrap module, seven-helix transmembrane region and cytoplasmic tail. In recent years, the three-dimensional structures of GABAB receptor extracellular and intracellular domains have been elucidated. These structures reveal the molecular basis of ligand recognition, receptor heterodimerization and receptor activation. Here we provide a brief review of the GABAB receptor structures, with an emphasis on describing the different ligand-bound states of the receptor. We will also compare these with the known structures of related GPCRs to shed light on the molecular mechanisms of activation and regulation in the GABAB system, as well as GPCR dimers in general. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Receptores para el virus de la rabia

    Directory of Open Access Journals (Sweden)

    Jaime E. Castellanos

    2001-12-01

    Full Text Available El virus de la rabia causa una infección en el sistema nervioso que puede provocar la muerte. La patogenia y el neurotropismo de este virus han sido estudiados extensamente con el objeto de explicar el porque la letalidad de la enfermedad y proponer nuevas alternativas terapéuticas. El proceso de adsorción del virus a la célula bianco se considera un evento que define el neurotropismo del virus. Se piensa que debe existir una molécula en la superficie de las neuronas que une con alta afinidad al virus y da comienzo al proceso infeccioso. Durante los últimos años se han propuesto varias proteínas, carbohidratos y lipidos complejos, como receptores para el virus de rabia y se han hecho nuevas proposiciones de terapia antirreceptor. Además de los gangliósidos y fosfolípidos para los que se ha hallado evidencia sobre su participación en la adsorción del virus de la rabia, hay datos experimentales sobre la participación del receptor nicotinico de acetilcolina. la molécula de adhesión celular neural y el receptor de baja afinidad para neurotrofinas en la infección neurona1 En este articulo se hace una revisión de los datos que sustentan a cada una de las moléculas propuestas, se discuten sus implicaciones para la explicación del neurotropismo del virus de rabia y la exploración de nuevas terapias antivirales.

  5. Os usos da diversidade

    Directory of Open Access Journals (Sweden)

    Clifford Geertz

    1999-05-01

    Full Text Available Resumo Ao discorrer sobre o “Futuro do Etnocentrismo”, este artigo parte da premissa de que a globalização, apesar de ter – em muitos casos – diminuído as diferenças entre povos, não tem amenizado os preconceitos e as formas de discriminação que ocorrem em nome dessas diferenças. Ele resgata a importância do antropólogo neste cenário lembrando que a diversidade cultural faz parte da sociedade complexa, remetendo-se não apenas a grupos étnicos ou nacionais bem delimitados, mas também a diferenças de geração, gênero, sexo e classe, entre outros. Neste contexto, a tolerância passiva de modos distantes de vida assim como a aceitação pragmática de nosso próprio paroquialismo são atitudes não somente intelectualmente desonestas mas também moralmente repreensíveis. É no encontro incômodo de subjetividades variantes na sua própria sociedade que o antropólogo define seu lugar.

  6. A morte da bailarina

    Directory of Open Access Journals (Sweden)

    Nancy Mangabeira Unger

    2010-04-01

    Full Text Available A história do Ocidente pode ser lida de acordo com o sentido da palavra grega hybris: transgressão, presunção, desmesura. Hoje, vivemos o ápice de um percurso marcado pela desejo de tudo dominar. Por sua extrema gravidade, a crise contemporânea nos coloca diante da responsabilidade de questionar a própria dimensão na qual pensamos, e a maneira em que compreendemos nossa identidade enquanto humanos e nosso lugar na totalidade do real.Palavras-chave: civilização ocidental; crise; hybris; questionamento. AbstractThe history of the West can be read according to the meaning of the greek word hybris: transgression, arrogance, loss of measure. We presently live the pinnacle of a course marked by the desire to dominate all beings.  The extreme gravity of  contemporary crisis confronts us with the responsibility of questioning the very dimension in which we think, as well as the manner in which we understand our identity as human beings and our place in the totality of being.Key words: western civilization; crisis; hybris; questioning. 

  7. O CORPO DE BAILE DA LINGUAGEM DA VIDA

    Directory of Open Access Journals (Sweden)

    Ronaldes de Melo e Souza

    2014-09-01

    Full Text Available “O corpo de baile da linguagem da vida” propõe-se a evidenciar a unidade primordial da música e da linguagem. Ambas se correspondem, quando se compreende a primeira como arte das musas e a segunda como expressão da vida em si mesma. O livro As musas e a origem divina do canto e da saga, de Walter F. Otto, dá o mote que o ensaio persegue e desdobra com o auxílio de inúmeros estudos altamente especializados, convalidando-se no exame da obra de artífices notáveis da expressão poética, de Homero a Joyce.  The essay proposes to evince the primordial unity between music and language. Their bond becomes apparent when the first is comprehended as the art of the muses and the second as the expression of life itself. The book The muses and the divine origin of singing and saga, by Walter Friedrich Otto, motivates the research which the essay pursues and develops with the aid of highly specialized studies. An incursion into the works of remarkable artifices of poetic expression from Homer to Joyce helps to corroborate the issue.  

  8. REFLETINDO SOBRE AS ESPECIFICIDADES DA GEOGRAFIA NA CRISE DA MODERNIDADE

    Directory of Open Access Journals (Sweden)

    Patrício A. S. Carneiro Carneiro

    2010-08-01

    Full Text Available O presente artigo discute a evolução da ciência moderna, bem como a crise desse paradigma dominante e seus efeitos sobre a geografia. Destaca ainda a necessidade da construção de um novo pensamento científico para além das fronteiras disciplinares e do método absoluto.

  9. Activation of Retinoid X Receptor increases dopamine cell survival in models for Parkinson's disease

    Directory of Open Access Journals (Sweden)

    Bergsland Maria

    2009-12-01

    Full Text Available Abstract Background Parkinson's disease (PD is caused by degeneration of dopamine (DA neurons in the ventral midbrain (vMB and results in severely disturbed regulation of movement. The disease inflicts considerable suffering for the affected and their families. Today, the opportunities for pharmacological treatment are meager and new technologies are needed. Previous studies have indicated that activation of the nuclear receptor Retinoid X Receptor (RXR provides trophic support for DA neurons. Detailed investigations of these neurotrophic effects have been hampered by the lack of readily available DA neurons in vitro. The aim of this study was to further describe the potential neurotrophic actions of RXR ligands and, for this and future purposes, develop a suitable in vitro-platform using mouse embryonic stem cells (mESCs. Results We studied the potential neurotrophic effects of the RXR ligand LG100268 (LG268 and the RXR-Nurr1 ligand XCT0139508 (XCT in neuronal cultures derived from rat primary vMB and mESCs. RXR ligands protect DA neurons from stress, such as that induced by the PD-modeling toxin 6-hydroxy dopamine (6-OHDA and hypoxia, but not from stress induced by oxidative hydrogen peroxide (H2O2 or the excitotoxic agent kainic acid (KA. The neurotrophic effect is selective for DA neurons. DA neurons from rat primary vMB and mESCs behaved similarly, but the mESC-derived cultures contained a much higher fraction of DA cells and thus provided more accessible experimental conditions. Conclusions RXR ligands rescue DA neurons from degeneration caused by the PD simulating 6-OHDA as well as hypoxia. Thus, RXR is a novel promising target for PD research. mESC-derived DA cells provide a valid and accessible in vitro-platform for studying PD inducing toxins and potential trophic agents.

  10. Human dopamine receptor nanovesicles for gate-potential modulators in high-performance field-effect transistor biosensors

    Science.gov (United States)

    Park, Seon Joo; Song, Hyun Seok; Kwon, Oh Seok; Chung, Ji Hyun; Lee, Seung Hwan; An, Ji Hyun; Ahn, Sae Ryun; Lee, Ji Eun; Yoon, Hyeonseok; Park, Tai Hyun; Jang, Jyongsik

    2014-03-01

    The development of molecular detection that allows rapid responses with high sensitivity and selectivity remains challenging. Herein, we demonstrate the strategy of novel bio-nanotechnology to successfully fabricate high-performance dopamine (DA) biosensor using DA Receptor-containing uniform-particle-shaped Nanovesicles-immobilized Carboxylated poly(3,4-ethylenedioxythiophene) (CPEDOT) NTs (DRNCNs). DA molecules are commonly associated with serious diseases, such as Parkinson's and Alzheimer's diseases. For the first time, nanovesicles containing a human DA receptor D1 (hDRD1) were successfully constructed from HEK-293 cells, stably expressing hDRD1. The nanovesicles containing hDRD1 as gate-potential modulator on the conducting polymer (CP) nanomaterial transistors provided high-performance responses to DA molecule owing to their uniform, monodispersive morphologies and outstanding discrimination ability. Specifically, the DRNCNs were integrated into a liquid-ion gated field-effect transistor (FET) system via immobilization and attachment processes, leading to high sensitivity and excellent selectivity toward DA in liquid state. Unprecedentedly, the minimum detectable level (MDL) from the field-induced DA responses was as low as 10 pM in real- time, which is 10 times more sensitive than that of previously reported CP based-DA biosensors. Moreover, the FET-type DRNCN biosensor had a rapid response time (<1 s) and showed excellent selectivity in human serum.

  11. Increase in platelet non-integrin type I collagen receptor in patients with systemic sclerosis.

    Science.gov (United States)

    Chiang, Thomas M; Takayama, Hiroshi; Postlethwaite, Arnold E

    2006-01-01

    Microvascular injury is one of the major pathogenetic processes involved in systemic sclerosis (SSc). Interaction of the platelet types I and III collagen receptors with their respective ligand in the exposed subendothelial stroma as a result of ongoing microvascular injury in SSc patients results in platelet activation and aggregation with the release of mediators, which contribute to vascular damage and inflammation. We have found that there is a twofold increase in radiolabeled type I collagen binding to washed platelets from patients with SSc compared to platelets obtained from normal volunteers. Western blot analyses showed that the non-integrin platelet type I collagen receptor protein (65 kDa) is increased dramatically in lysates of platelet from patients with SSc. However, the integrin (alpha(2)beta(1)) and other non-integrin receptors such as glycoprotein VI, glycoprotein IV, and the platelet receptor for type III collagen remain unchanged. In addition, platelet lysates from rheumatic disease controls (rheumatoid arthritis, osteoarthritis, gout, and systemic lupus erythematosus) do not show any significant increases. There is no nitrotyrosylation on 65 kDa in patients with SSc compared to controls, suggesting this might also contribute to binding of CI to the 65-kDa CIR. These results suggest that there is a specific increase in the number of platelet type I collagen receptors in SSc patient's platelets. In addition, the activity of nitric oxide synthase is decreased in patients' platelet lysates compared to controls. The increase in platelet expression of the 65-kDa non-integrin platelet type I collagen receptor may explain the enhanced aggregation of platelets from patients with SSc to CI in vitro and microvascular thrombosis in the disease in vivo.

  12. Neural stem cells express melatonin receptors and neurotrophic factors: colocalization of the MT1 receptor with neuronal and glial markers

    Directory of Open Access Journals (Sweden)

    McMillan Catherine R

    2004-10-01

    Full Text Available Abstract Background In order to optimize the potential benefits of neural stem cell (NSC transplantation for the treatment of neurodegenerative disorders, it is necessary to understand their biological characteristics. Although neurotrophin transduction strategies are promising, alternative approaches such as the modulation of intrinsic neurotrophin expression by NSCs, could also be beneficial. Therefore, utilizing the C17.2 neural stem cell line, we have examined the expression of selected neurotrophic factors under different in vitro conditions. In view of recent evidence suggesting a role for the pineal hormone melatonin in vertebrate development, it was also of interest to determine whether its G protein-coupled MT1 and MT2 receptors are expressed in NSCs. Results RT-PCR analysis revealed robust expression of glial cell-line derived neurotrophic factor (GDNF, brain-derived neurotrophic factor (BDNF and nerve growth factor (NGF in undifferentiated cells maintained for two days in culture. After one week, differentiating cells continued to exhibit high expression of BDNF and NGF, but GDNF expression was lower or absent, depending on the culture conditions utilized. Melatonin MT1 receptor mRNA was detected in NSCs maintained for two days in culture, but the MT2 receptor was not seen. An immature MT1 receptor of about 30 kDa was detected by western blotting in NSCs cultured for two days, whereas a mature receptor of about 40 – 45 kDa was present in cells maintained for longer periods. Immunocytochemical studies demonstrated that the MT1 receptor is expressed in both neural (β-tubulin III positive and glial (GFAP positive progenitor cells. An examination of the effects of melatonin on neurotrophin expression revealed that low physiological concentrations of this hormone caused a significant induction of GDNF mRNA expression in NSCs following treatment for 24 hours. Conclusions The phenotypic characteristics of C17.2 cells suggest that they are

  13. Filosofia da amizade: uma proposta

    Directory of Open Access Journals (Sweden)

    Konrad Utz

    2010-12-01

    Full Text Available http://dx.doi.org/10.5007/1677-2954.2008v7n2p151 O artifo tenciona desenvolver o conceito da amizade como conceito-base de toda Filosofia Prática. Porém pretende apresentar apenas uma entre as várias argumentações possíveis em favor desta concepção: defende que a amizade, no sentido exposto, seja a solução mais convincente ao problema da intersubjetividade. A questão é como a  concepção da subjetividade pode ser entendida a outros indivíduos, se essa, como o autor defende pode ser compreendida priginariamente somente a partir da auto-referência da primeira pessoa. Para isso, ele faz uso do conceito aristotélico do amor amigável enquanto direcionado a um "heterosautos", identificando como seus momentos tanto o conhecimento e o desejo do outro, como o respeito e a benevolência. Os últimos dois momentos são interpretados como "conversão" da consciência dos primeiros. Por meio dessa "conversão da consciência" a consciência do Outro é estabelecida. Como se trata da conversão de uma consciência concreta, tanto cognitiva quanto volitiva, seu resultado não é um conceito abstrato e geral de uma subjetividade diferente da minha, mas uma relação concreta entre indivíduos que implica um compromisso e a partir da qual forma-se um étos específico da comunidade assim estabelecida.

  14. Insulin-like growth factor-II receptors in cultured rat hepatocytes: regulation by cell density

    Energy Technology Data Exchange (ETDEWEB)

    Scott, C.D.; Baxter, R.C.

    1987-12-01

    Insulin-like growth factor-II (IGF-II) receptors in primary cultures of adult rat hepatocytes were characterized and their regulation by cell density examined. In hepatocytes cultured at 5 X 10(5) cells per 3.8 cm2 plate (/sup 125/I)IGF-II bound to specific, high affinity receptors (Ka = 4.4 +/- 0.5 X 10(9) l/mol). Less than 1% cross-reactivity by IGF-I and no cross-reactivity by insulin were observed. IGF-II binding increased when cells were permeabilized with 0.01% digitonin, suggesting the presence of an intracellular receptor pool. Determined by Scatchard analysis and by polyacrylamide gel electrophoresis after affinity labeling, the higher binding was due solely to an increase in binding sites present on 220 kDa type II IGF receptors. In hepatocytes cultured at low densities, the number of cell surface receptors increased markedly, from 10-20,000 receptors per cell at a culture density of 6 X 10(5) cells/well to 70-80,000 receptors per cell at 0.38 X 10(5) cells/well. The increase was not due simply to the exposure of receptors from the intracellular pool, as a density-related increase in receptors was also seen in cells permeabilized with digitonin. There was no evidence that IGF binding proteins, either secreted by hepatocytes or present in fetal calf serum, had any effect on the measurement of receptor concentration or affinity. We conclude that rat hepatocytes in primary culture contain specific IGF-II receptors and that both cell surface and intracellular receptors are regulated by cell density.

  15. Afferent-specific AMPA receptor subunit composition and regulation of synaptic plasticity in midbrain dopamine neurons by abused drugs

    OpenAIRE

    Good, Cameron H.; Lupica, Carl R.

    2010-01-01

    Ventral tegmental area (VTA) dopamine (DA) neurons play a pivotal role in processing reward-related information and are involved in drug addiction and mental illness in humans. Information is conveyed to the VTA in large part by glutamatergic afferents that arise in various brain nuclei, including the pedunculopontine nucleus (PPN). Using a unique rat brain slice preparation, we found that PPN stimulation activates afferents targeting GluR2-containing AMPA receptors (AMPAR) on VTA DA neurons,...

  16. Para pensar o consumo da música digital

    OpenAIRE

    Castro/ESPM-SP, Gisela G. S.

    2008-01-01

    Este trabalho examina as transformações nas formas de distribuição e consumo de música no contexto da cibercultura. Somada à escuta crescentemente mediada por sofisticadas tecnologias do som, temos a radical imaterialidade dos meios digitais. A extrema maleabilidade do som digital favorece a diluição de fronteiras entre cópia e original, autor e editor, receptor e distribuidor. A disseminação de sites de distribui- ção gratuita de música na Internet vem ainda desafiando sobremaneira a formata...

  17. Evolutionary analysis of functional divergence among chemokine receptors, decoy receptors and viral receptors

    Directory of Open Access Journals (Sweden)

    Hiromi eDaiyasu

    2012-07-01

    Full Text Available Chemokine receptors (CKRs function in the inflammatory response and in vertebrate homeostasis. Decoy and viral receptors are two types of CKR homologues with modified functions from those of the typical CKRs. The decoy receptors are able to bind ligands without signaling. On the other hand, the viral receptors show constitutive signaling without ligands. We examined the sites related to the functional difference. At first, the decoy and viral receptors were each classified into five groups, based on the molecular phylogenetic analysis. A multiple amino acid sequence alignment between each group and the CKRs was then constructed. The difference in the amino acid composition between the group and the CKRs was evaluated as the Kullback-Leibler (KL information value at each alignment site. The KL information value is considered to reflect the difference in the functional constraints at the site. The sites with the top 5% of KL information values were selected and mapped on the structure of a CKR. The comparisons with decoy receptor groups revealed that the detected sites were biased on the intracellular side. In contrast, the sites detected from the comparisons with viral receptor groups were found on both the extracellular and intracellular sides. More sites were found in the ligand-binding pocket in the analyses of the viral receptor groups, as compared to the decoy receptor groups. Some of the detected sites were located in the GPCR motifs. For example, the DRY motif of the decoy receptors was often degraded, although the motif of the viral receptors was basically conserved. The observations for the viral receptor groups suggested that the constraints in the pocket region are loose and that the sites on the intracellular side are different from those for the decoy receptors, which may be related to the constitutive signaling activity of the viral receptors.

  18. Melatonin Receptor Genes in Vertebrates

    Directory of Open Access Journals (Sweden)

    Hua Dong Yin

    2013-05-01

    Full Text Available Melatonin receptors are members of the G protein-coupled receptor (GPCR family. Three genes for melatonin receptors have been cloned. The MT1 (or Mel1a or MTNR1A and MT2 (or Mel1b or MTNR1B receptor subtypes are present in humans and other mammals, while an additional melatonin receptor subtype, Mel1c (or MTNR1C, has been identified in fish, amphibians and birds. Another melatonin related orphan receptor, GPR50, which does not bind melatonin, is found exclusively in mammals. The hormone melatonin is secreted primarily by the pineal gland, with highest levels occurring during the dark period of a circadian cycle. This hormone acts systemically in numerous organs. In the brain, it is involved in the regulation of various neural and endocrine processes, and it readjusts the circadian pacemaker, the suprachiasmatic nucleus. This article reviews recent studies of gene organization, expression, evolution and mutations of melatonin receptor genes of vertebrates. Gene polymorphisms reveal that numerous mutations are associated with diseases and disorders. The phylogenetic analysis of receptor genes indicates that GPR50 is an outgroup to all other melatonin receptor sequences. GPR50 may have separated from a melatonin receptor ancestor before the split between MTNR1C and the MTNR1A/B ancestor.

  19. Pattern recognition receptors: an update.

    Science.gov (United States)

    Goutagny, Nadege; Fitzgerald, Katherine A

    2006-07-01

    The vertebrate immune system consists of two inter-related components, the innate and adaptive responses, which are required for the resolution of infection. The innate immune response is critical for the immediate protection from infection and for marshalling the B- and T-cell responses of the adaptive response. A key component of the innate immune response is germline-encoded pattern recognition receptors that detect pathogens. Several families of these pattern recognition receptors have now been described. Microbial recognition by these receptors triggers appropriate immune responses, including the direct uptake and killing of pathogens and/or initiation of intracellular signaling pathways that culminate in the activation of immune responsive transcriptional programs. Pattern recognition receptors include soluble receptors in serum (collectins), transmembrane receptors on cell surfaces or vacuolar membranes (C-type lectins and Toll-like receptors) or cytoplasmic sensors (NACHT-LRR proteins and RNA helicases). Roles for these pattern recognition receptor families are emerging in the susceptibility to bacterial and viral infections and in acute and chronic conditions, such as sepsis, autoimmune disease and atherosclerosis. These findings suggest that the selective targeting of pattern recognition receptors and the pathways they trigger may be useful clinically. Progress towards therapeutics designed to target Toll-like receptor signaling is already well underway. This review will describe our current understanding of innate immune sensors and the mechanisms regulating their activity.

  20. Identification, expression and functional characterization of M4L, a muscarinic acetylcholine M4 receptor splice variant.

    Directory of Open Access Journals (Sweden)

    Douglas A Schober

    Full Text Available Rodent genomic alignment sequences support a 2-exon model for muscarinic M4 receptor. Using this model a novel N-terminal extension was discovered in the human muscarinic acetylcholine M4 receptor. An open reading frame was discovered in the human, mouse and rat with a common ATG (methionine start codon that extended the N-terminus of the muscarinic acetylcholine M4 receptor subtype by 155 amino acids resulting in a longer variant. Transcriptional evidence for this splice variant was confirmed by RNA-Seq and RT-PCR experiments performed from human donor brain prefrontal cortices. We detected a human upstream exon indicating the translation of the mature longer M4 receptor transcript. The predicted size for the longer two-exon M4 receptor splice variant with the additional 155 amino acid N-terminal extension, designated M4L is 69.7 kDa compared to the 53 kDa canonical single exon M4 receptor (M4S. Western blot analysis from a mammalian overexpression system, and saturation radioligand binding with [3H]-NMS (N-methyl-scopolamine demonstrated the expression of this new splice variant. Comparative pharmacological characterization between the M4L and M4S receptors revealed that both the orthosteric and allosteric binding sites for both receptors were very similar despite the addition of an N-terminal extension.

  1. Accumulation of human full-length tau induces degradation of nicotinic acetylcholine receptor ?4 via activating calpain-2

    OpenAIRE

    Yaling Yin; Yali Wang; Di Gao; Jinwang Ye; Xin Wang; Lin Fang; Dongqin Wu; Guilin Pi; Chengbiao Lu; Xin-Wen Zhou; Ying Yang; Jian-Zhi Wang

    2016-01-01

    Cholinergic impairments and tau accumulation are hallmark pathologies in sporadic Alzheimer?s disease (AD), however, the intrinsic link between tau accumulation and cholinergic deficits is missing. Here, we found that overexpression of human wild-type full-length tau (termed hTau) induced a significant reduction of ?4 subunit of nicotinic acetylcholine receptors (nAChRs) with an increased cleavage of the receptor producing a ~55kDa fragment in primary hippocampal neurons and in the rat brains...

  2. Tratamento da diarreia aguda

    OpenAIRE

    Araújo, Carlos Manuel Arantes

    2014-01-01

    Projeto de Pós-Graduação/Dissertação apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Mestre em Ciências Farmacêuticas A diarreia aguda é uma doença de elevada prevalência e incidência que atinge todas as classes sociais e idades, sendo um relevante problema de saúde pública. O quadro diarreico é caracterizado por alterações no volume, consistência e frequência das fezes, sendo característico da diarreia aguda o surgimento de fezes líquidas e...

  3. Derrida: aporias da subjetividade

    Directory of Open Access Journals (Sweden)

    Diogo Bogéa

    2015-06-01

    Full Text Available Nosso objetivo neste artigo é tratar a questão do “sujeito” de uma maneira diferente daquela característica do pensamento tradicional metafísico, procurando evitar as respostas imediatas baseadas nos conceitos e preconceitos de uma metafísica da presença/ausência, ser/não-ser, essência/existência, eu/outro, etc. Para tal, utilizaremos algumas das principais formulações teóricas de Derrida tais como “segredo/secreto”, “vida-a-morte”, “sacrifício”, “rastro”, différance e “suplemento”.

  4. Berengario da Carpi.

    Science.gov (United States)

    De Santo, N G; Bisaccia, C; De Santo, L S; De Santo, R M; Di Leo, V A; Papalia, T; Cirillo, M; Touwaide, A

    1999-01-01

    Berengario da Carpi was magister of anatomy and surgery at the University of Bologna from 1502 to 1527. Eustachio and Falloppia defined him as 'the restaurator of anatomy'. He was a great surgeon, anatomist and physician of illustrious patients including Lorenzo II dei Medici, Giovanni dalle Bande Nere, Galeazzo Pallavicini, Cardinal Colonna, and Alessandro Soderini. He had strong links to the intellectuals of his time (Forni, Bonamici, Manuzio, Pomponazzi) as well as with the Medici family. He was respected by the Popes Julius II, Leo X and Clement VII. His main contributions are the Isogogae Breves, De Fractura calvae sive cranei, and the illustrated Commentaria on the Anatomy of Mondino de Liucci, a textbook utilized for more than 200 years, which Berengario aimed to restore to its initial text. The Commentaria constitutes the material for the last part of this paper which concludes with a personal translation of some passages on 'The kidney', where the author gives poignant examples of experimental ingenuity.

  5. Em favor da talassografia

    Directory of Open Access Journals (Sweden)

    Jean-Louis Boudou

    2001-01-01

    Full Text Available A Talassografia (“descrição do mar” interessa-sepelos impactos físicos, biológicos, ecológicos... culturais da violenta antropização dos ambientes costeiros (oceânicos e continentais, caracterizados pelaexigüidade, vulnerabilidade, fragilidade e plasticidade. Como o Brasil é um “país marítimo”, os geó-grafos (os talassógrafos brasileiros são convidadosa intensificar suas pesquisas nas áreas costeiras e acriar novas estruturas para divulgá-las: Revista, Encontros, Associação, Pós-Graduação... tudo em prolda talassografia.

  6. ANÁLISE PRELIMINAR DA CONTROLADORIA DA CIDADE DE SALVADOR

    Directory of Open Access Journals (Sweden)

    João Marcelo Pitiá Barreto

    2012-06-01

    Full Text Available A Controladoria tem sido alvo de estudos e destaque de análises e reflexões dos estudiosos das ciências que têm como foco o campo gerencial das organizações como a da Administração e Contabilidade. É importante observar a contribuição da Controladoria à governança pública, fundamento de uma gestão democrática e participativa. Nesse contexto, insere-se o objetivo deste estudo, refletir sobre atuação da controladoria pública da cidade de Salvador, observando a contribuição efetiva na governança nesse município. Os estudos foram desenvolvidos na Secretaria da Fazenda (SEFAZ do município a quem Controladoria vincula-se. Com caráter exploratório, essa investigação descritiva envolveu pesquisa de campo, análise de documentos e relatórios emitidos pela SEFAZ e pelo Tribunal de Contas do Município (TCM. Verificou-se o organograma da SEFAZ, seu orçamento e os pareceres do TCM. Os resultados expressam a importância da Controladoria e denotam a impressão de que, na instituição estudada, essa área não esteja cumprindo bem seu papel. 

  7. NMDA Receptors in Dopaminergic Neurons are Crucial for Habit Learning

    Science.gov (United States)

    Wang, Lei Phillip; Li, Fei; Wang, Dong; Xie, Kun; Wang, Deheng; Shen, Xiaoming; Tsien, Joe Z.

    2011-01-01

    Summary Dopamine is crucial for habit learning. Activities of midbrain dopaminergic neurons are regulated by the cortical and subcortical signals among which glutamatergic afferents provide excitatory inputs. Cognitive implications of glutamatergic afferents in regulating and engaging dopamine signals during habit learning however remain unclear. Here we show that mice with dopaminergic neuron-specific NMDAR1 deletion are impaired in a variety of habit learning tasks while normal in some other dopamine-modulated functions such as locomotor activities, goal directed learning, and spatial reference memories. In vivo neural recording revealed that DA neurons in these mutant mice could still develop the cue-reward association responses, but their conditioned response robustness was drastically blunted. Our results suggest that integration of glutamatergic inputs to DA neurons by NMDA receptors, likely by regulating associative activity patterns, is a crucial part of the cellular mechanism underpinning habit learning. PMID:22196339

  8. Flavivirus Entry Receptors: An Update

    Directory of Open Access Journals (Sweden)

    Manuel Perera-Lecoin

    2013-12-01

    Full Text Available Flaviviruses enter host cells by endocytosis initiated when the virus particles interact with cell surface receptors. The current model suggests that flaviviruses use at least two different sets of molecules for infectious entry: attachment factors that concentrate and/or recruit viruses on the cell surface and primary receptor(s that bind to virions and direct them to the endocytic pathway. Here, we present the currently available knowledge regarding the flavivirus receptors described so far with specific attention to C-type lectin receptors and the phosphatidylserine receptors, T-cell immunoglobulin and mucin domain (TIM and TYRO3, AXL and MER (TAM. Their role in flavivirus attachment and entry as well as their implication in the virus biology will be discussed in depth.

  9. [GABAC receptors: structure and functions].

    Science.gov (United States)

    Perfilova, V N; Tiurenkov, I N

    2011-01-01

    Data on the structure, localization, physiology and pharmacology of GABA(C) receptors are reviewed. Thece receptors belong to cys-loop receptors and consist of rho1-3 subunits representing pentamers with five subunits that form a chloride channel. They are found in both central nervous system and peripheral organs. The pentamer can be homomeric, consisting of five similar protomers (e.g., p1), or heteromeric (pseudo-homomeric), consisting of rho1 and rho2 subunits. Chloride channel function also depends on the GABA(C) receptor subunit composition. The activation of GABAc receptors is accompanied by a change in the permeability of plasmatic membranes for C1 ions, which is followed by depolarization (presynaptic inhibition) or hyperpolarization (postsynaptic inhibition). There are a great number of the allosteric modulators, agonists and antagonists of GABA(C) receptors.

  10. Dopamine D3 receptor antagonism contributes to blonanserin-induced cortical dopamine and acetylcholine efflux and cognitive improvement.

    Science.gov (United States)

    Huang, Mei; Kwon, Sunoh; Oyamada, Yoshihiro; Rajagopal, Lakshmi; Miyauchi, Masanori; Meltzer, Herbert Y

    2015-11-01

    Blonanserin is a novel atypical antipsychotic drug (APD), which, unlike most atypical APDs, has a slightly higher affinity for dopamine (DA) D2 than serotonin (5-HT)2A receptors, and is an antagonist at both, as well as at D3 receptors. The effects of atypical APDs to enhance rodent cortical, hippocampal, limbic, and dorsal striatal (dSTR) DA and acetylcholine (ACh) release, contribute to their ability to improve novel object recognition (NOR) in rodents treated with sub-chronic (sc) phencyclidine (PCP) and cognitive impairment associated with schizophrenia (CIAS). Here we determined the ability of blonanserin, the D3 antagonist NGB 2904, and the typical APD, haloperidol, a D2 antagonist, to enhance neurotransmitter efflux in the medial prefrontal cortex (mPFC) and dSTR of mice, and to ameliorate the scPCP-induced deficit in NOR in rats. Blonanserin, 10mg/kg, i.p., increased DA, norepinephrine (NE), and ACh efflux in mPFC and dSTR. NGB 2904, 3mg/kg, increased DA and ACh, but not NE, efflux in mPFC, and DA, but not ACh, efflux in dSTR. Haloperidol increased DA and NE efflux in dSTR only. The selective D3 agonist PD 128907 partially blocked the blonanserin-induced cortical ACh, DA, NE and striatal DA efflux. NGB 2904, 3mg/kg, like blonanserin, 1mg/kg, and the combination of sub-effective doses of NGB 2904 and blonanserin (both 0.3mg/kg), ameliorated the scPCP-induced NOR deficit in rats. These results suggest that D3 receptor blockade may contribute to the ability of blonanserin to increase cortical DA and ACh efflux, as well as to restore NOR and improve CIAS. Copyright © 2015 Elsevier Inc. All rights reserved.

  11. Dimensão da maturidade à luz da logoterapia

    Directory of Open Access Journals (Sweden)

    Libardi, Tadeu Antonio

    2008-01-01

    Full Text Available O artigo aborda o tema da maturidade humana à luz da logoterapia, fundada por Viktor Emil Frankl. Nos dias de hoje, existe a frustração existencial, não mais a sexual, como analisada por Freud. Cada ser humano, como pessoa livre e responsável e tendo como meta a busca da maturidade, vai percorrendo seu próprio caminho, que o leva à ceitação de si, de seus limites e potencialidades e ao relacionamento social e religioso, capacitando-o ao confronto com o sofrimento humano

  12. Dimensão da maturidade à luz da logoterapia

    OpenAIRE

    Libardi, Tadeu Antonio

    2008-01-01

    O artigo aborda o tema da maturidade humana à luz da logoterapia, fundada por Viktor Emil Frankl. Nos dias de hoje, existe a frustração existencial, não mais a sexual, como analisada por Freud. Cada ser humano, como pessoa livre e responsável e tendo como meta a busca da maturidade, vai percorrendo seu próprio caminho, que o leva à ceitação de si, de seus limites e potencialidades e ao relacionamento social e religioso, capacitando-o ao confronto com o sofrimento humano

  13. Uncompetitive antagonism of AMPA receptors

    DEFF Research Database (Denmark)

    Andersen, Trine F; Tikhonov, Denis B; Bølcho, Ulrik

    2006-01-01

    Philanthotoxins are uncompetitive antagonists of Ca2+-permeable AMPA receptors presumed to bind to the pore-forming region, but a detailed molecular mechanism for this interaction is missing. Here a small library of novel philanthotoxins was designed and synthesized using a solid-phase strategy. ...... polyamine toxins antagonize the AMPA receptor ion channel and provide the basis for rational development of uncompetitive antagonists of AMPA receptors....

  14. Cloning and expression of a widely expressed receptor tyrosine phosphatase

    DEFF Research Database (Denmark)

    Sap, J; D'Eustachio, P; Givol, D

    1990-01-01

    and Bmp-2a loci. The corresponding mRNA (3.0 kilobases) is expressed in most murine tissues and most abundantly expressed in brain and kidney. Antibodies against a synthetic peptide of R-PTP-alpha identified a 130-kDa protein in cells transfected with the R-PTP-alpha cDNA.......We describe the identification of a widely expressed receptor-type (transmembrane) protein tyrosine phosphatase (PTPase; EC 3.1.3.48). Screening of a mouse brain cDNA library under low-stringency conditions with a probe encompassing the intracellular (phosphatase) domain of the CD45 lymphocyte...... antigen yielded cDNA clones coding for a 794-amino acid transmembrane protein [hereafter referred to as receptor protein tyrosine phosphatase alpha (R-PTP-alpha)] with an intracellular domain displaying clear homology to the catalytic domains of CD45 and LAR (45% and 53%, respectively). The 142-amino acid...

  15. Dopamine D3 receptor dysfunction prevents anti-nociceptive effects of morphine in the spinal cord

    Directory of Open Access Journals (Sweden)

    Kori L Brewer

    2014-06-01

    Full Text Available Dopamine (DA modulates spinal reflexes, including nociceptive reflexes, in part via the D3 receptor subtype. We have previously shown that mice lacking the functional D3 receptor (D3KO exhibit decreased paw withdrawal latencies from painful thermal stimuli. Altering the DA system in the CNS, including D1 and D3 receptor systems, reduces the ability of opioids to provide analgesia. Here, we tested if the increased pain sensitivity in D3KO might result from a modified µ-opioid receptor (MOR function at the spinal cord level. As D1 and D3 receptor subtypes have competing cellular effects and can form heterodimers, we tested if the changes in MOR function may be mediated in D3KO through the functionally intact D1 receptor system.We assessed thermal paw withdrawal latencies in D3KO and wild type (WT mice before and after systemic treatment with morphine, determined MOR and phosphorylated MOR (p-MOR protein expression levels in lumbar spinal cords, and tested the functional effects of DA and MOR receptor agonists in the isolated spinal cord.In vivo, a single morphine administration (2 mg/kg increased withdrawal latencies in WT but not D3KO, and these differential effects were mimicked in vitro, where morphine modulated spinal reflex amplitudes (SRAs in WT but not D3KO. Total MOR protein expression levels were similar between WT and D3KO, but the ratio of phosphorylated MOR (pMOR/total MOR was higher in D3KO. Blocking D3 receptors in the isolated WT cord precluded morphine’s inhibitory effects observed under control conditions. Lastly, we observed an increase in D1 receptor protein expression in the lumbar spinal cord of D3KO.Our data suggest that the D3 receptor modulates the MOR system in the spinal cord, and that a dysfunction of the D3 receptor can induce a morphine-resistant state. We propose that the D3KO mouse may serve as a model to study the onset of morphine resistance at the spinal cord level, the primary processing site of the

  16. A lamin B receptor in the nuclear envelope.

    OpenAIRE

    Worman, H.J.; Yuan, J; Blobel, G; Georgatos, S D

    1988-01-01

    Using a solution binding assay, we show that purified 125I-labeled lamin B binds in a saturable and specific fashion to lamin-depleted avian erythrocyte nuclear membranes with a Kd of approximately 0.2 microM. This binding is significantly greater than the binding of 125I-labeled lamin A and is competitively inhibited by unlabeled ligand. We demonstrate that a 58-kDa integral membrane protein (p58) is a lamin B receptor by virtue of its abundance in the nuclear envelope and association with 1...

  17. Controle da ferrugem e da broca-dos-ramos da figueira com diferentes fungicidas e inseticidas

    Directory of Open Access Journals (Sweden)

    Éder Júnior Mezzalira

    2015-02-01

    Full Text Available Temperaturas e precipitações elevadas favorecem a incidência da ferrugem (Cerotelium fici(Cast. e da broca-dos-ramos (Azochis gripusalis (Walker, 1859 (Lepidoptera: Pyralidae, limitando a produção comercial de figos. O objetivo deste trabalho foi comparar a eficiência de fungicidas e inseticidas alternativos em relação à de produtos convencionais registrados para a cultura. Foram realizados dois experimentos, no delineamento de blocos inteiramente casualizados, com quatro repetições, no setor de fruticultura da Universidade Tecnológica Federal do Paraná, Campus Dois Vizinhos. Para controle da ferrugem, foram utilizados, em 100 L de água, azoxistrobin (10 g, calda bordalesa (1.500 g de cal virgem + 1.500 g de sulfato de cobre e testemunha (água. No controle da broca-dos-ramos utilizaram-se, em 100 L de água, azadiractina (1.000 mL P.C., alho (Allium sativumL. (100 mL P.C., cinza (20.000 g, extrato de fumo (nicotina (10.000 mL do preparado, deltametrina (50 mL P.C., Bacillus thuringiensisBerliner (100 g P.C., rotenona (1.000 mL P.C., sabão de coco (1.000 g e testemunha (água. A calda bordalesa foi o tratamento mais efetivo no controle da ferrugem, promovendo aumento da produtividade e da qualidade dos frutos. A deltametrina promoveu o melhor controle da broca-dos-ramos da figueira. Entre os produtos alternativos testados, o alho foi o mais efetivo no controle dessa praga.

  18. Dimerization of nuclear receptors.

    Science.gov (United States)

    Germain, Pierre; Bourguet, William

    2013-01-01

    Multicellular organisms require specific intercellular communication to properly organize the complex body plan during embryogenesis and maintain its properties and functions during the entire life. While growth factors, neurotransmitters, and peptide hormones bind to membrane receptors, thereby inducing the activity of intracellular kinase cascades or the JAK-STAT signaling pathways, other small signaling compounds such as steroid hormones, certain vitamins, and metabolic intermediates enter, or are generated, within the target cells and bind to members of a large family of nuclear receptors (NRs). NRs are ligand-inducible transcription factors that control a plethora of biological phenomena, thus orchestrating complex events like development, organ homeostasis, immune function, and reproduction. NR-NR interactions are of major importance in these regulatory processes, as NRs regulate their target genes by binding to cognate DNA response elements essentially as homo- or heterodimers. A number of structural and functional studies have provided significant insights as to how combinatorial NRs rely on protein-protein contacts that discriminate geometric features of their DNA response elements, thereby allowing both binding site diversity and physiological specificity. Here, we will review our current understanding of NR-NR interactions and provide protocols for a number of experimental approaches that are useful for their study. Copyright © 2013 Elsevier Inc. All rights reserved.

  19. Axonal GABAA receptors.

    Science.gov (United States)

    Trigo, Federico F; Marty, Alain; Stell, Brandon M

    2008-09-01

    Type A GABA receptors (GABA(A)Rs) are well established as the main inhibitory receptors in the mature mammalian forebrain. In recent years, evidence has accumulated showing that GABA(A)Rs are prevalent not only in the somatodendritic compartment of CNS neurons, but also in their axonal compartment. Evidence for axonal GABA(A)Rs includes new immunohistochemical and immunogold data: direct recording from single axonal terminals; and effects of local applications of GABA(A)R modulators on action potential generation, on axonal calcium signalling, and on neurotransmitter release. Strikingly, whereas presynaptic GABA(A)Rs have long been considered inhibitory, the new studies in the mammalian brain mostly indicate an excitatory action. Depending on the neuron that is under study, axonal GABA(A)Rs can be activated by ambient GABA, by GABA spillover, or by an autocrine action, to increase either action potential firing and/or transmitter release. In certain neurons, the excitatory effects of axonal GABA(A)Rs persist into adulthood. Altogether, axonal GABA(A)Rs appear as potent neuronal modulators of the mammalian CNS.

  20. Endogenous dopamine (DA) modulates (3H)spiperone binding in vivo in rat brain

    Energy Technology Data Exchange (ETDEWEB)

    Bischoff, S.; Krauss, J.; Grunenwald, C.; Gunst, F.; Heinrich, M.; Schaub, M.; Stoecklin, K.V.; Vassout, A.; Waldmeier, P.; Maitre, L. (Research Department, CIBA-GEIGY Ltd., Basel (Switzerland))

    1991-01-01

    (3H)spiperone (SPI) binding in vivo, biochemical parameters and behavior were measured after modulating DA levels by various drug treatments. DA releasers and uptake inhibitors increased SPI binding in rat striatum. In other brain areas, the effects were variable, but only the pituitary remained unaffected. Surprisingly, nomifensine decreased SPI binding in frontal cortex. The effects of these drugs were monitored by measuring DA, serotonin (5-HT) and their metabolites in the same rats. The increased SPI binding in striatum was parallel to the locomotor stimulation with the following rank order: amfonelic acid greater than nomifensine greater than D-amphetamine greater than or equal to methylphenidate greater than amineptine greater than bupropion. Decreasing DA levels with reserpine or alpha-methyl-para-tyrosine reduced SPI binding by 45% in striatum only when both drugs were combined. In contrast, reserpine enhanced SPI binding in pituitary. Thus, the amount of releasable DA seems to modulate SPI binding characteristics. It is suggested that in vivo, DA receptors are submitted to dynamic regulation in response to changes in intrasynaptic concentrations of DA.

  1. JORNALISMO AUDIOVISUAL: DA TELA DA TV PARA OUTRAS TELAS

    Directory of Open Access Journals (Sweden)

    Mayra Ferreira

    2012-12-01

    Full Text Available O presente trabalho é fruto de uma pesquisa em desenvolvimento em parceria com a TV Unesp, emissora universitária vinculada à Universidade Estadual Paulista Júlio de Mesquita, campus de Bauru/SP e que tem por objetivo identificar os pontos convergentes e divergentes na produção de conteúdo audiovisual informativo para a TV aberta e demais plataformas digitais e móveis. O texto em questão é a conclusão da primeira etapa da pesquisa que se pautou por identificar os pressupostos básicos que deverão nortear os conteúdos que serão produzidos posteriormente e veiculados pela emissora no decorrer da pesquisa. Foram analisadas as características do jornalismo audiovisual online e o modelo de negócios da TV aberta em contraste com o modelo de negócios presente na Internet.

  2. Jornalismo audiovisual: da tela da TV para outras telas

    Directory of Open Access Journals (Sweden)

    Francisco Machado Filho

    2012-12-01

    Full Text Available O presente trabalho é fruto de uma pesquisa em desenvolvimento em parceria com a TV Unesp, emissora universitária vinculada à Universidade Estadual Paulista Júlio de Mesquita, campus de Bauru/SP e que tem por objetivo identificar os pontos convergentes e divergentes na produção de conteúdo audiovisual informativo para a TV aberta e demais plataformas digitais e móveis. O texto em questão é a conclusão da primeira etapa da pesquisa que se pautou por identificar os pressupostos básicos que deverão nortear os conteúdos que serão produzidos posteriormente e veiculados pela emissora no decorrer da pesquisa. Foram analisadas as características do jornalismo audiovisual online e o modelo de negócios da TV aberta em contraste com o modelo de negócios presente na Internet.

  3. Leitura visual da HQ Cachalote

    OpenAIRE

    Renan Luis Salermo

    2015-01-01

    Com base na teoria semiótica gremasiana, buscamos nesta pesquisa evidenciar a aplicabilidade da teoria semiótica no ensino de Língua Portuguesa para o tratamento do texto visual. Por meio da leitura da história em quadrinhos Cachalote (2010), de Daniel Galera e Rafael Coutinho, aplicamos o percurso gerativo do sentido evidenciando o nível discursivo (sintaxe e semântica discursiva), e o nível narrativo (paixões dos sujeitos). Sendo uma pesquisa descritivo interpretativa, selecionamos a narrat...

  4. A subjetividade fora da mente

    OpenAIRE

    Simões, Alexandre; Gonçalves, Gesianni Amaral; Corgozinho, Batistina Maria de Sousa; Lopes, Ana Mônica Henrique

    2011-01-01

    O artigo contextualiza uma tradição que se apresenta de maneira recorrente nas práticas clínicas da psicologia e da saúde mental: o Mentalismo. O Mentalismo pressupõe uma concepção interiorizada do sujeito em prol de modelos instrumentais de clínica. A partir da crítica ao Mentalismo, os autores examinam outras possibilidades de se lidar não mais com o sujeito essencializado, porém, com os complexos processos de subjetivação. Esta é uma perspectiva clínica que recorrendo a Deleuze, Guattari e...

  5. REFLEXOS DA RECEPÇÃO NO TEXTO LITERÁRIO LATINO – A PARTIR DA ARS POETICA DE HORÁCIO –

    Directory of Open Access Journals (Sweden)

    Francisco Edi de Oliveira Sousa

    2016-01-01

    Full Text Available Este trabalho revisita a literatura latina, lançandolhe um olhar pautado em recente tendência dos estudos literários: a interação texto-receptor. As teorias e métodos que desenvolvem tal tendência convergem ao horizonte de uma poética da leitura. Nesta linha, destacam-se a estética da recepção e a teoria do efeito estético: a primeira corrente analisa a recepção histórica de obras literárias e efeitos estéticos que elas produzem nos receptores; a segunda parte destes princípios, todavia volta-se mais para o texto, permitindo examinar nas obras procedimentos artísticos orientados para a interação com o receptor. Ancorados nestas abordagens, comentamos a recepção de obras literárias no universo romano do início do Império e procedimentos artísticos condicionados por esta interação. Ao fim, as reflexões tecidas encontram respaldo na Ars poetica de Horácio. Palavras-chave: Literatura latina; Ars poetica de Horácio; poética da leitura.

  6. Characterization of the receptor for the 1,4-dihydropyridine Ca sup 2+ channel modulators in skeletal muscle

    Energy Technology Data Exchange (ETDEWEB)

    Leung, A.T.

    1989-01-01

    The 1,4-dihydropyridine receptor was purified in high yield from isolated rabbit skeletal muscle triads. The purified receptor contains four integral subunits: {alpha}{sub 1} (170 kDa), {alpha}{sub 2} (175/150 kDa), {beta} (52 kDa) and {gamma} (32 kDa) in a 1:1:1:1 stoichiometry. The {alpha}{sub 2} subunit is a glycoprotein that binds wheat germ agglutinin and its electrophoretic mobility on sodium dodecyl sulfate-polyacrylamide gels is increased upon reduction whereas the {alpha}{sub 1} subunit does not exhibit these properties but is recognized by specific monoclonal antibodies. These monoclonal antibodies to the {alpha}{sub 1} subunit, as well as a specific monoclonal antibody to the {beta} subunit, are capable of immunoprecipitating dihydropyridine binding activity from digitonin-solubilized skeletal muscle triads as well as co-immunoprecipitating the {alpha}{sub 1} and {beta} subunits. The {alpha}{sub 1} and {beta} subunits are highly labile to mild trypsin digestion in isolated triads but the dihydropyridine binding activity of the receptor does not depend on an intact {alpha}{sub 1} (dihydropyridine binding) subunit. The {alpha}{sub 2} and {gamma} subunits are resistant to trypsin digestion and the proteolytic fragments of the {alpha} subunit remain associated with the {alpha}{sub 2} subunit even after solubilization of the receptor with digitonin. A binding site for the dihydropyridines is proposed based on the identification of a 28 kDa peptide that is both photoaffinity labeled with ({sup 3}H)azidopine and contains the epitope of a specific monoclonal antibody. Polyclonal antibodies raised against a synthetic peptide corresponding to the deduced carboxyl-terminus of the {alpha}{sub 1} subunit of the receptor did not react with the purified dihydropyridine receptor and skeletal muscle membranes from various sources.

  7. Dos Males da Medida

    Directory of Open Access Journals (Sweden)

    Lilia Moritz Schwarcz

    1997-01-01

    Full Text Available Esse artigo tem como objeto a difícil percepção da "diferença". Tema polêmico, o debate sobre as variedades culturais foi transformado, em meados do século XIX, em uma questão racial e, nesse sentido, vinculado às regularidades da biologia. Tecendo comparações entre os teóricos raciais brasileiros e os impasses mais contemporâneos, sobre a aferição de inteligência e capacidade, esse ensaio pretende provocar. Em pauta estarão as contradições que têm se destacado, mais recentemente, quando se opõem de um lado as etnicidades locais, de outro a tão propalada globalização. Tal qual dois lados de uma mesma moeda, a afirmação de identidades tem se mostrado tão evidente como o próprio estreitamento das relações internacionais. Mudam os termos do debate - de raça, para etnia -, mas, de alguma maneira, continuamos presos a uma lógica positiva de estabelecimento de hierarquias ontológicas.This article has as its objective the difficult perception of "difference". A controversial theme, in the nineteenth century, this debate on cultural varieties, became a racial issue and in this sense, bonded to the regularities of biology. In such a context, this essay intends to provoke comparisons about the standard measure of intelligence and capacity, between Brazilian racial theorists and the impasse of more contemporary times. Appointed here will be the contradictions which have, more recently grown in importance, and have opposed through one aspect, local ethnic groups and through another the greatly publicized globalization. As are the two sides of a coin, the affirmation of identities has shown itself as evident as the tightening of international relations. The terms of the debate change from race to ethnicism, but in some way, we are still tied to a positivist logic which establishes ontologic hierarchies.

  8. Avaliação da influência do polimorfismo do códon 16 do receptor beta-2 adrenérgico na incidência de hipotensão arterial e uso de efedrina em grávidas submetidas à anestesia subaracnoidea Evaluación de la influencia del polimorfismo del codón 16 del receptor beta-2 adrenérgico en la incidencia de hipotensión arterial y uso de efedrina en embarazadas sometidas a la anestesia subaracnoidea Evaluation of the influence of the codon 16 polymorphism of the beta-2 adrenergic receptor gene on the incidence of arterial hypotension and ephedrine use in pregnant patients submitted to subarachnoid anesthesia

    Directory of Open Access Journals (Sweden)

    Edno Magalhães

    2010-06-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: O gene do receptor beta-2 adrenérgico possui diversos polimorfismos. Estudos recentes vêm demonstrando sua importância clínica. O objetivo deste trabalho foi avaliar a influência do polimorfismo Arg16Gli na incidência de hipotensão arterial e uso de efedrina em parturientes submetidas ao bloqueio subaracnoideo para cesariana. MÉTODO: Parturientes hígidas (ASA I e II foram submetidas à anestesia raquidiana para realização de cesariana eletiva (n = 50. Efedrina foi administrada nos casos de hipotensão arterial. A incidência de hipotensão arterial e a dose requerida de efedrina para correção da pressão arterial foram comparadas entre os diferentes genótipos encontrados. RESULTADOS: O genótipo mais prevalente foi o Arg16Gli (60%, n = 30 seguido pelo Gli16Gli (26%, n = 13 e Arg16Arg (14%, n = 7. Não foram observadas diferenças entre as características básicas dos genótipos. Com relação ao genótipo Arg16Arg, o Gli16Gli apresentou aumento da razão de risco de hipotensão arterial (hazard ratio de 3,95 vezes (IC 95% 0,86-18,11; p = 0,076, enquanto o Arg16Gli apresentou aumento de 4,83 vezes (IC 95% 1,13-20,50; p = 0,033. As parturientes com Arg16Arg precisaram, em média, de 6,4 ± 8,5 mg de efedrina para correção de hipotensão arterial, enquanto as do Arg16Gli precisaram de 19,5 ± 15,9 mg (p = 0,0445; IC 95% 0,3325-25,78 e as do tipo Gli16Gli, 19,2 ± 14,3 (p = 0,0445, IC 95% 0,3476-25,26. CONCLUSÕES: Os resultados mostraram que a variante genética Arg16Arg apresenta menor incidência de hipotensão arterial e que menores doses de efedrina foram necessárias para restabelecimento de normotensão arterial nas pacientes com esse perfil genético. Concluímos que o genótipo Arg16Arg confere maior estabilidade pressórica às parturientes submetidas à anestesia raquidiana para cesariana.JUSTIFICATIVA Y OBJETIVOS: El gen del receptor beta-2 adrenérgico posee diversos polimorfismos. Estudios

  9. Central phencyclidine (PCP) receptor binding is glutamate dependent: evidence for a PCP/excitatory amino acid receptor (EAAR) complex

    Energy Technology Data Exchange (ETDEWEB)

    Loo, P.; Braunwalder, A.; Lehmann, J.; Williams, M.

    1986-03-01

    PCP and other dissociative anesthetica block the increase in neuronal firing rate evoked by the EAAR agonist, N-methyl-Daspartate. NMDA and other EAAs such as glutamate (glu) have not been previously shown to affect PCP ligand binding. In the present study, using once washed rat forebrain membranes, 10 ..mu..M-glu was found to increase the binding of (/sup 3/H)TCP, a PCP analog, to defined PCP recognition sites by 20%. Removal of glu and aspartate (asp) by extensive washing decreased TCP binding by 75-90%. In these membranes, 10 ..mu..M L-glu increased TCP binding 3-fold. This effect was stereospecific and evoked by other EAAs with the order of activity, L-glu > D-asp > L- asp > NMDA > D-glu > quisqualate. Kainate, GABA, NE, DA, 5-HT, 2-chloroadenosine, oxotremorine and histamine had no effect on TCP binding at concentrations up to 100 ..mu..M. The effects of L-glu were attenuated by the NMDA-type receptor antagonist, 2-amino-7--phosphonoheptanoate (AP7; 10 ..mu..M-1 mM). These findings indicate that EAAS facilitate TCP binding, possibly through NMDA-type receptors. The observed interaction between the PCP receptor and EAARs may reflect the existence of a macromolecular receptor complex similar to that demonstrated for the benzodiazepines and GABA.

  10. SOBRE OS FUNDAMENTOS DA ARQUITETURA DA INFORMAÇÃO

    Directory of Open Access Journals (Sweden)

    Alfram Roberto Rodrigues de Albuquerque

    2011-10-01

    Full Text Available Expõe-se o estado atual da disciplina Arquitetura da Informação quanto a problemática terminológica da definição do campo de estudo, apresentando-se argumentos para uma definição de Arquitetura da Informação de uma forma ampla na qual os usos correntes dessa expressão sejam vistos como especializações. Defende-se uma definição com a utilização de um conjunto de propriedades mínimas cujas interações levam a uma terminologia formal e cuja abstração leva a uma definição formal do conceito que emprega a linguagem de morfismos da Teoria das Categorias. Trata-se de um recorte de alguns dos resultados obtidos na tese de doutoramento de um dos autores, defendida em setembro de 2010. O contexto da pesquisa é exposto e alguns dos resultados obtidos são delineados.

  11. O sentido da espiritualidade na transitoriedade da vida

    Directory of Open Access Journals (Sweden)

    Isabel Cristina de Oliveira Arrieira

    Full Text Available Resumo Objetivo: Compreender o sentido da espiritualidade para a pessoa em cuidados paliativos. Métodos: Abordagem qualitativa, fundamentada na fenomenologia existencialista e referencial de Viktor Frankl. Os participantes foram nove pessoas em cuidados paliativos atendidas no domicílio. Informações coletadas por meio da observação e de entrevista realizadas no período de junho a outubro de 2014, gravadas, transcritas e transformadas em texto interpretado com a abordagem fenomenológica hermenêutica. Resultados: Surgiram as seguintes categorias: sentido de continuidade da vida; sentido de alívio do sofrimento; sentido de naturalidade da morte e sentido de valorização do viver. Conclusão: Para a integralidade da atenção faz-se necessário a inclusão da espiritualidade na prática do cuidado em saúde. A espiritualidade proporciona o encontro existencial entre a pessoa em cuidados paliativos e os profissionais que a cuidam em sua integralidade.

  12. Possible Relevance of Receptor-Receptor Interactions between Viral- and Host-Coded Receptors for Viral-Induced Disease

    Directory of Open Access Journals (Sweden)

    Luigi F. Agnati

    2007-01-01

    Full Text Available It has been demonstrated that some viruses, such as the cytomegalovirus, code for G-protein coupled receptors not only to elude the immune system, but also to redirect cellular signaling in the receptor networks of the host cells. In view of the existence of receptor-receptor interactions, the hypothesis is introduced that these viral-coded receptors not only operate as constitutively active monomers, but also can affect other receptor function by interacting with receptors of the host cell. Furthermore, it is suggested that viruses could also insert not single receptors (monomers, but clusters of receptors (receptor mosaics, altering the cell metabolism in a profound way. The prevention of viral receptor-induced changes in host receptor networks may give rise to novel antiviral drugs that counteract viral-induced disease.

  13. Striatal But Not Extrastriatal Dopamine Receptors Are Critical to Dopaminergic Motor Stimulation

    Directory of Open Access Journals (Sweden)

    Yuhan Wang

    2017-12-01

    Full Text Available Dopamine (DA is required for motor function in vertebrate animals including humans. The striatum, a key motor control center, receives a dense DA innervation and express high levels of DA D1 receptors (D1Rs and D2 receptors (D2Rs. Other brain areas involved in motor function such as the globus pallidus external segment (GPe and the substantia nigra pars reticulata (SNr and the motor cortex (MC also receive DA innervation and express DA receptors. Thus, the relative contribution of the striatal and extrastriatal DA systems to the motor function has been an important question critical for understanding the functional operation of the motor control circuits and also for therapeutic targeting. We have now experimentally addressed this question in the transcription factor Pitx3 null mutant (Pitx3Null mice that have an autogenic and parkinsonian-like striatal DA denervation and hence supersensitive motor response to DA stimulation. Using DA agonist unilateral microinjection-induced rotation as a reliable readout of motor stimulation, our results show that L-dopa microinjection into the dorsal striatum (DS induced 5–10 times more rotations than that induced by L-dopa microinjection into GPe and SNr, while L-dopa microinjection into the primary MC induced the least number of rotations. Furthermore, our results show that separate microinjection of the D1R-like agonist SKF81297 and the D2R-like agonist ropinirole into the DS each induced only modest numbers of rotation, whereas concurrent injection of the two agonists triggered more rotations than the sum of the rotations induced by each of these two agonists separately, indicating D1R–D2R synergy. These results suggest that the striatum, not GPe, SNr or MC, is the primary site for D1Rs and D2Rs to synergistically stimulate motor function in L-dopa treatment of Parkinson’s disease (PD. Our results also predict that non-selective, broad spectrum DA agonists activating both D1Rs and D2Rs are more

  14. A utilização da teoria da aprendizagem significativa no ensino da Enfermagem

    Directory of Open Access Journals (Sweden)

    Alana Tamar Oliveira de Sousa

    2015-08-01

    Full Text Available RESUMOObjetivo:sintetizar a produção científica acerca da Teoria da Aprendizagem Significativa no processo de ensino-aprendizagem em Enfermagem.Método:revisão integrativa realizada nas bases de dados MEDLINE, LILACS, SciELO, BDENF e CINAHL, com artigos que abordaram a temática ou aspectos da teoria da aprendizagem significativa de David Ausubel. Fizeram parte da amostra dez artigos, sendo seis escritos no idioma português e quatro no inglês, publicados de 1998 a 2013.Resultados:cinco artigos fizeram alusão à Teoria da Aprendizagem Significativa, quatro citaram Ausubel como autor dessa teoria e apenas dois seguiram a estrutura para a aplicação da teoria completamente. Há escassez de estudos sobre o tema e os que o abordam não o correlacionam com a teoria de Ausubel.Conclusão:faz-se necessário romper com a dicotomia entre teoria e prática e promover a articulação dos conteúdos com a ação, introduzindo o aluno como autor de seu próprio conhecimento.

  15. New horizons for lipoprotein receptors

    DEFF Research Database (Denmark)

    Andersen, Olav M.; Dagil, Robert; Kragelund, Birthe Brandt

    2013-01-01

    The lipoprotein receptor (LR) family constitutes a large group of structurally closely related receptors with broad ligand-binding specificity. Traditionally, ligand binding to LRs has been anticipated to involve merely the complement type repeat (CR)-domains omnipresent in the family. Recently...

  16. Coronavirus spike-receptor interactions

    NARCIS (Netherlands)

    Mou, H.

    2015-01-01

    Coronaviruses cause important diseases in humans and animals. Coronavirus infection starts with the virus binding with its spike proteins to molecules present on the surface of host cells that act as receptors. This spike-receptor interaction is highly specific and determines the virus’ cell, tissue

  17. A subjetividade fora da mente

    Directory of Open Access Journals (Sweden)

    Alexandre Simões

    2011-08-01

    Full Text Available O artigo contextualiza uma tradição que se apresenta de maneira recorrente nas práticas clínicas da psicologia e da saúde mental: o Mentalismo. O Mentalismo pressupõe uma concepção interiorizada do sujeito em prol de modelos instrumentais de clínica. A partir da crítica ao Mentalismo, os autores examinam outras possibilidades de se lidar não mais com o sujeito essencializado, porém, com os complexos processos de subjetivação. Esta é uma perspectiva clínica que recorrendo a Deleuze, Guattari e à Filosofia da Diferença oferece estratégias mais condizentes com a complexidade do mundo contemporâneo, introduzindo debates éticos, políticos e estéticos na dimensão psíquica.

  18. Atlas nacional da Espanha, demografia

    Directory of Open Access Journals (Sweden)

    Hervé Théry

    2009-03-01

    Full Text Available Calvo Palacios J.L., Pueyo Campos Á. (2008, Atlas nacional de España, Demografía. Madrid: Centro Nacional de Información Geográfica, 386 p. ISBN: 978-8-4416-0685-2.O volume, que faz parte da série Monografias do Atlas Nacional de Espanha, inclui 420 mapas, 91 dos quais apresentam informações por município que dão uma visão global, concisa e muito completa da realidade da população espanhola e da sua evolução (em alguns casos analisada desde 1857. Seus diretores científicos são José Luis Cal...

  19. Efecto neuroprotector de los cannabinoides sobre la muerte neuronal inducida por Ampa en la médula espinal: Activación conjunta de los receptores CB1 y CB2

    Directory of Open Access Journals (Sweden)

    Carmen Guaza

    2005-03-01

    Full Text Available La sobreactivación de receptores de glutamato, como el receptor AMPA, induce la muerte neural por un proceso denominado excitotoxicidad, el cual ha sido claramente implicado en enfermedades agudas del sistema nerviso central (SNC, particularmente con daño axonal.

  20. Efecto neuroprotector de los cannabinoides sobre la muerte neuronal inducida por Ampa en la médula espinal: Activación conjunta de los receptores CB1 y CB2

    OpenAIRE

    Carmen Guaza; Manuel Nieto Sampedro; Joaquín Sancho; F. Docagne; V. Muñetón Gómez

    2005-01-01

    La sobreactivación de receptores de glutamato, como el receptor AMPA, induce la muerte neural por un proceso denominado excitotoxicidad, el cual ha sido claramente implicado en enfermedades agudas del sistema nerviso central (SNC), particularmente con daño axonal.

  1. Da janela do meu quarto

    Directory of Open Access Journals (Sweden)

    Esther Hamburger

    2008-12-01

    Full Text Available O texto aborda o curta Da Janela do Meu Quarto de Cao Guimarães como contraponto a filmes brasileiros recentes que lidam com a desigualdade social brasileira na chave da violência. O texto contrasta o distanciamento imposto pelo posicionamento de câmera e efeitos de montagem e som nesse filme, com o uso de estratégias de pertencimento e apropriação presentes em filmes "de resultado".

  2. Alcohol drinking increases the dopamine-stimulating effects of ethanol and reduces D2 auto-receptor and group II metabotropic glutamate receptor function within the posterior ventral tegmental area of alcohol preferring (P) rats.

    Science.gov (United States)

    Ding, Zheng-Ming; Ingraham, Cynthia M; Rodd, Zachary A; McBride, William J

    2016-10-01

    Repeated local administration of ethanol (EtOH) sensitized the posterior ventral tegmental area (pVTA) to the local dopamine (DA)-stimulating effects of EtOH. Chronic alcohol drinking increased nucleus accumbens (NAC) DA transmission and pVTA glutamate transmission in alcohol-preferring (P) rats. The objectives of the present study were to determine the effects of chronic alcohol drinking by P rats on the (a) sensitivity and response of the pVTA DA neurons to the DA-stimulating actions of EtOH, and (b) negative feedback control of DA (via D2 auto-receptors) and glutamate (via group II mGlu auto-receptors) release in the pVTA. EtOH (50 or 150 mg%) or the D2/3 receptor antagonist sulpiride (100 or 200 μM) was microinjected into the pVTA while DA was sampled with microdialysis in the NAC shell (NACsh). The mGluR2/3 antagonist LY341495 (1 or 10 μM) was perfused through the pVTA via reverse microdialysis and local extracellular glutamate and DA levels were measured. EtOH produced a more robust increase of NACsh DA in the 'EtOH' than 'Water' groups (e.g., 150 mg% EtOH: to ∼ 210 vs 150% of baseline). In contrast, sulpiride increased DA release in the NACsh more in the 'Water' than 'EtOH' groups (e.g., 200 μM sulpiride: to ∼ 190-240 vs 150-160% of baseline). LY341495 (at 10 μM) increased extracellular glutamate and DA levels in the 'Water' (to ∼ 150-180% and 180-230% of baseline, respectively) but not the 'EtOH' groups. These results indicate that alcohol drinking enhanced the DA-stimulating effects of EtOH, and attenuated the functional activities of D2 auto-receptors and group II mGluRs within the pVTA. Copyright © 2016 Elsevier Ltd. All rights reserved.

  3. Probing Biased Signaling in Chemokine Receptors

    DEFF Research Database (Denmark)

    Amarandi, Roxana Maria; Hjortø, Gertrud Malene; Rosenkilde, Mette Marie

    2016-01-01

    The chemokine system mediates leukocyte migration during homeostatic and inflammatory processes. Traditionally, it is described as redundant and promiscuous, with a single chemokine ligand binding to different receptors and a single receptor having several ligands. Signaling of chemokine receptors...

  4. Serotonin and dopamine receptors in cognitive and motivational disturbances of psychiatric disorders

    Directory of Open Access Journals (Sweden)

    Tomiki eSumiyoshi

    2014-12-01

    Full Text Available Negative symptoms (e.g. decreased spontaneity, social withdrawal, blunt affect and disturbances of cognitive function (e.g. several types of memory, attention, processing speed, executive function, fluency provide a major determinant of long-term outcome in patients with schizophrenia. Specifically, motivation deficits, a type of negative symptoms, have been attracting interest as a moderator of cognitive performance in schizophrenia and related disorders, and also a modulating factor of cognitive enhancers/remediation. These considerations suggest the need to clarify neurobiological substrates regulating motivation. Genetic studies indicate a role for the monoamine systems in motivation and key cognitive domains. For example, polymorphism of genes encoding catecholamine-O-methyltransferase, an enzyme catabolizing dopamine (DA, affects performance on tests of working memory and executive function in a phenotype (schizophrenia vs. healthy controls-dependent fashion. On the other hand, motivation to maximize rewards has been shown to be influenced by other DA-related genes, such as DARPP-32 and DA-D2 receptors. Serotonin (5-HT receptors may also play a key role in cognitive and motivational disabilities in psychoses and mood disorders. For example, mutant mice over-expressing D2 receptors in the striatum, an animal model of schizophrenia, exhibit both decreased willingness to work for reward and up-regulation of 5-HT2C receptors. Taken together, genetic predisposition related to 5-HT receptors may mediate the diversity of incentive motivation that is impaired in patients receiving biological and/or psychosocial treatments. Taken together, research into genetic and neurobiological measures of motivation, in association with 5-HT receptors, is likely to facilitate intervention into patients seeking better social consequences.

  5. Teoria da Mente: diferentes abordagens

    Directory of Open Access Journals (Sweden)

    Jou Graciela Inchausti de

    1999-01-01

    Full Text Available A capacidade de compreender os estados mentais (i.e. sentimentos, desejos, crenças e intenções dos outros e de si mesmo é uma das características sociais do ser humano. Quando essa habilidade emerge e como se desenvolve são aspectos que têm sido pesquisados por psicólogos desenvolvimentistas e cognitivistas sob o nome de Teoria da Mente das crianças. Nesse trabalho, procura-se relacionar os diferentes enfoques teóricos acerca da natureza, gênese e desenvolvimento da teoria da mente com os achados empíricos e as metodologias empregadas. Questões referentes à idade em que os pesquisadores entendem que emerge uma teoria da mente nas crianças e a necessidade de desenvolver uma visão que englobe os diferentes níveis de compreensão que elas têm da mente, à luz das teorias existentes, são discutidas.

  6. Dopamine D1 receptor stimulation of the nucleus accumbens or the medial preoptic area promotes the onset of maternal behavior in pregnancy-terminated rats.

    Science.gov (United States)

    Stolzenberg, Danielle S; McKenna, Jonathan B; Keough, Samantha; Hancock, Rebecca; Numan, Marilyn J; Numan, Michael

    2007-10-01

    There is good evidence that interference with the mesolimbic dopamine (DA) system results in impaired maternal responding in postpartum female rats. However, whether activation of the mesolimbic DA system is capable of promoting maternal behavior has not been investigated. This study examined whether increasing DA activity in various brain regions of pregnancy-terminated, naive female rats would stimulate the onset of maternal behavior. Experiments 1 and 2 examined the effects of microinjection of various doses (0, 0.2, or 0.5 microg/0.5 microl/side) of a D1 DA receptor agonist, SKF 38393, or a D2 DA receptor agonist, quinpirole, into the nucleus accumbens (NA) on latency to show full maternal behavior, and Experiment 3 determined the effects of SKF 38393 injection into a control site. Finally, because the medial preoptic area (MPOA) is also important for maternal behavior, receives DA input, and expresses DA receptors, the authors examined whether microinjection of SKF 38393 into MPOA was capable of stimulating the onset of maternal behavior. Results indicated that microinjection of SKF 38393 into either the NA or the MPOA facilitates maternal responding in pregnancy-terminated rats. (PsycINFO Database Record (c) 2007 APA, all rights reserved).

  7. Structural basis for receptor recognition of vitamin-B(12)-intrinsic factor complexes

    DEFF Research Database (Denmark)

    Andersen, Christian Brix Folsted; Madsen, Mette; Storm, Tina

    2010-01-01

    Cobalamin (Cbl, vitamin B(12)) is a bacterial organic compound and an essential coenzyme in mammals, which take it up from the diet. This occurs by the combined action of the gastric intrinsic factor (IF) and the ileal endocytic cubam receptor formed by the 460-kilodalton (kDa) protein cubilin...... and the 45-kDa transmembrane protein amnionless. Loss of function of any of these proteins ultimately leads to Cbl deficiency in man. Here we present the crystal structure of the complex between IF-Cbl and the cubilin IF-Cbl-binding-region (CUB(5-8)) determined at 3.3 A resolution. The structure provides...

  8. Biochemical Pharmacology of the Sigma-1 Receptor.

    Science.gov (United States)

    Chu, Uyen B; Ruoho, Arnold E

    2016-01-01

    The sigma-1 receptor (S1R) is a 223 amino acid two transmembrane (TM) pass protein. It is a non-ATP-binding nonglycosylated ligand-regulated molecular chaperone of unknown three-dimensional structure. The S1R is resident to eukaryotic mitochondrial-associated endoplasmic reticulum and plasma membranes with broad functions that regulate cellular calcium homeostasis and reduce oxidative stress. Several multitasking functions of the S1R are underwritten by chaperone-mediated direct (and indirect) interactions with ion channels, G-protein coupled receptors and cell-signaling molecules involved in the regulation of cell growth. The S1R is a promising drug target for the treatment of several neurodegenerative diseases related to cellular stress. In vitro and in vivo functional and molecular characteristics of the S1R and its interactions with endogenous and synthetic small molecules have been discovered by the use of pharmacologic, biochemical, biophysical, and molecular biology approaches. The S1R exists in monomer, dimer, tetramer, hexamer/octamer, and higher oligomeric forms that may be important determinants in defining the pharmacology and mechanism(s) of action of the S1R. A canonical GXXXG in putative TM2 is important for S1R oligomerization. The ligand-binding regions of S1R have been identified and include portions of TM2 and the TM proximal regions of the C terminus. Some client protein chaperone functions and interactions with the cochaperone 78-kDa glucose-regulated protein (binding immunoglobulin protein) involve the C terminus. Based on its biochemical features and mechanisms of chaperone action the possibility that the S1R is a member of the small heat shock protein family is discussed. Copyright © 2015 by The American Society for Pharmacology and Experimental Therapeutics.

  9. GRAU DA PRÁXIS DA GESTÃO DA RESPONSABILIDADE AMBIENTAL PRATICADA POR USINAS SUCROALCOOLEIRAS

    Directory of Open Access Journals (Sweden)

    Renata Longo

    2014-12-01

    gerencial (PCDA foi o Action que apresentou maior grau de aderência. Há uma concordância acentuada às características fundamentais do ciclo gerencial na Gestão da Responsabilidade Socioambiental.

  10. Heterotypic interactions between transferrin receptor and transferrin receptor 2

    OpenAIRE

    Vogt, TM; Blackwell, AD; Giannetti, AM; Bjorkman, PJ; Enns, CA

    2003-01-01

    Cellular iron uptake in most tissues occurs via endocytosis of diferric transferrin (Tf) bound to the transferrin receptor (TfR). Recently, a second transferrin receptor, transferrin receptor 2 (TfR2), has been identified and shown to play a critical role in iron metabolism. TfR2 is capable of Tf-mediated iron uptake and mutations in this gene result in a rare form of hereditary hemochromatosis unrelated to the hereditary hemochromatosis protein, HFE. Unlike TfR, TfR2 expression is not contro...

  11. Lasar Segall e as festas da SPAM

    Directory of Open Access Journals (Sweden)

    Fernando Antonio Pinheiro Filho

    2004-06-01

    Full Text Available A partir da análise da produção visual de Lasar Segall no âmbito das festas da SPAM, o trabalho busca iluminar as ambigüidades de seu posicionamento no interior da elite que o abriga. Nesse movimento, trata-se de atentar para o uso da arte como mecanismo de distinção social e o manejo que Segall logrou realizar desse dispositivo.

  12. m2-toxin: A selective ligand for M2 muscarinic receptors.

    Science.gov (United States)

    Carsi, J M; Valentine, H H; Potter, L T

    1999-11-01

    Selective ligands are needed for distinguishing the functional roles of M2 receptors in tissues containing several muscarinic receptor subtypes. Because the venom of the green mamba Dendroaspis angusticeps contains the most specific antagonists known for M1 and M4 receptors (m1-toxin and m4-toxin), it was screened for toxins that inhibit the binding of [(3)H]N-methylscopolamine ([(3)H]NMS) to cloned M2 receptors. Desalted venom had as much anti-M2 as anti-M4 activity. The most active anti-M2 toxin in the venom was isolated by gel filtration, cation-exchange chromatography, and reversed-phase HPLC, and called m2-toxin. Spectrometry yielded a mass of 7095 Da, and N-terminal sequencing of 53 amino acids showed RICHSQMSSQPPTTTFCRVNSCYRRTLRDPHDPRGT-IIVRGCGCPRMKPGTKL. This sequence is more homologous to antinicotinic than antimuscarinic toxins, but it lacks three almost invariant residues of antinicotinic toxins required for their activity. m2-Toxin fully blocked the binding of [(3)H]NMS and [(3)H]oxotremorine-M to M2 receptors with Hill coefficients near 1, and blocked 77% of the binding sites for 0.1 nM [(3)H]NMS in the rat brainstem (K(i) = 11 nM). Concentrations that fully blocked cloned M2 receptors had no effect on M4 receptors, but slightly increased [(3)H]NMS binding to M1 receptors, an allosteric effect. In accord with these results, light microscopic autoradiography of the rat brain showed that m2-toxin decreased [(3)H]NMS binding in regions rich in M2 receptors and increased binding in regions rich in M1 receptors. Thus m2-toxin is a novel M2-selective, short-chain neurotoxin that may prove useful for binding and functional studies.

  13. Estrogen-related receptor β (ERRβ) - renaissance receptor or receptor renaissance?

    Science.gov (United States)

    Divekar, Shailaja D; Tiek, Deanna M; Fernandez, Aileen; Riggins, Rebecca B

    2016-01-01

    Estrogen-related receptors (ERRs) are founding members of the orphan nuclear receptor (ONR) subgroup of the nuclear receptor superfamily. Twenty-seven years of study have yet to identify cognate ligands for the ERRs, though they have firmly placed ERRα and ERRγ at the intersection of cellular metabolism and oncogenesis. The pace of discovery for novel functions of ERRβ, however, has until recently been somewhat slower than that of its family members. ERRβ has also been largely ignored in summaries and perspectives of the ONR literature. Here, we provide an overview of established and emerging knowledge of ERRβ in mouse, man, and other species, highlighting unique aspects of ERRβ biology that set it apart from the other two estrogen-related receptors, with a focus on the impact of alternative splicing on the structure and function of this receptor.

  14. Activation of Dopamine D1 Receptors Regulates Dendritic Morphogenesis Through Rac1 and RhoA in Prefrontal Cortex Neurons.

    Science.gov (United States)

    Li, Juan; Gu, Jingjing; Wang, Bin; Xie, Minjuan; Huang, Lu; Liu, Yutong; Zhang, Lei; Xue, Jinhua; Guo, Fukun; Zhang, Lin; Zhang, Lu

    2015-01-01

    Dopamine (DA) is an important regulator of neuronal plasticity in the prefrontal cortex (PFC) and plays a critical role in addiction-related neuroadaptation. The Rho GTPases, including Rac1, RhoA and Cdc42, are key regulators of actin cytoskeleton rearrangement that play important roles in dendritic morphogenesis. The goal of the current study was to use cultures of primary PFC neurons to gain a better understanding of the molecular mechanisms underlying DA-induced dendritic morphogenesis, a phenomenon that mimics the increase in DA synaptic transmission observed in the PFC of in vivo cocaine administration. We investigated the effects of repeated DA treatments on dendritic morphology changes in PFC neurons, and identified Rac1 and RhoA as downstream effectors of D1 receptors during the regulation of dendritic morphogenesis. Importantly, we found that D1 receptor-regulated Rac1 and RhoA have distinct roles in the regulation of dendritic morphogenesis after repeated DA treatments. Our data provide the first evidence that Rac1 and RhoA are effectors of D1 receptor signaling during dendritic morphogenesis and represent new signaling molecules involved in long-lasting neuroadaptation in the PFC.

  15. Stargazin Modulation of AMPA Receptors

    Directory of Open Access Journals (Sweden)

    Sana A. Shaikh

    2016-10-01

    Full Text Available Fast excitatory synaptic signaling in the mammalian brain is mediated by AMPA-type ionotropic glutamate receptors. In neurons, AMPA receptors co-assemble with auxiliary proteins, such as stargazin, which can markedly alter receptor trafficking and gating. Here, we used luminescence resonance energy transfer measurements to map distances between the full-length, functional AMPA receptor and stargazin expressed in HEK293 cells and to determine the ensemble structural changes in the receptor due to stargazin. In addition, we used single-molecule fluorescence resonance energy transfer to study the structural and conformational distribution of the receptor and how this distribution is affected by stargazin. Our nanopositioning data place stargazin below the AMPA receptor ligand-binding domain, where it is well poised to act as a scaffold to facilitate the long-range conformational selection observations seen in single-molecule experiments. These data support a model of stargazin acting to stabilize or select conformational states that favor activation.

  16. Lysophospholipid receptors in drug discovery.

    Science.gov (United States)

    Kihara, Yasuyuki; Mizuno, Hirotaka; Chun, Jerold

    2015-05-01

    Lysophospholipids (LPs), including lysophosphatidic acid (LPA), sphingosine 1-phospate (S1P), lysophosphatidylinositol (LPI), and lysophosphatidylserine (LysoPS), are bioactive lipids that transduce signals through their specific cell-surface G protein-coupled receptors, LPA1-6, S1P1-5, LPI1, and LysoPS1-3, respectively. These LPs and their receptors have been implicated in both physiological and pathophysiological processes such as autoimmune diseases, neurodegenerative diseases, fibrosis, pain, cancer, inflammation, metabolic syndrome, bone formation, fertility, organismal development, and other effects on most organ systems. Advances in the LP receptor field have enabled the development of novel small molecules targeting LP receptors for several diseases. Most notably, fingolimod (FTY720, Gilenya, Novartis), an S1P receptor modulator, became the first FDA-approved medicine as an orally bioavailable drug for treating relapsing forms of multiple sclerosis. This success is currently being followed by multiple, mechanistically related compounds targeting S1P receptor subtypes, which are in various stages of clinical development. In addition, an LPA1 antagonist, BMS-986020 (Bristol-Myers Squibb), is in Phase 2 clinical development for treating idiopathic pulmonary fibrosis, as a distinct compound, SAR100842 (Sanofi) for the treatment of systemic sclerosis and related fibrotic diseases. This review summarizes the current state of drug discovery in the LP receptor field. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. In vivo phosphorylation of progesterone receptors in the T47D sub co human breast cancer cell line

    Energy Technology Data Exchange (ETDEWEB)

    Sheridan, P.L.

    1989-01-01

    We have had evidence indicating that human progesterone receptors (PR) are phosphoproteins, and used metabolic labeling with ({sup 35}S)methionine and ({sup 32}P)orthophosphate to study the synthesis, structure, and phosphorylation of PR in T47D{sub co} human breast cancer cells, a cell line extremely rich for PR. Human PR exist as two independent hormone-binding proteins; B-receptors which are triplets in SDS-gels (M{sub r} 114, 117, and 120 kDa), and A-receptors that are a single band (94 kDa). The work presented here documents that human A- and B-receptors are phosphorylated on serine residues in the untransformed state, with phosphate being incorporated into all three bands of the B-proteins. However, a brief ({sup 35}S)methionine pulse shows that both A and B are synthesized as singlets of 94 and 114 kDa, respectively. The B-triplet is formed post-translationally by slow phosphorylation. B-triplet formation, or maturation, can be reversed by treatment with calf alkaline phosphatase or stabilized by the presence of phosphatase inhibitors. Additional ({sup 35}S)labeling studies in the presence of progestins demonstrate that receptors that are 15 min old are able to bind hormone and transform to the tight nuclear binding state.

  18. Nuclear receptors outside the nucleus: extranuclear signalling by steroid receptors

    Science.gov (United States)

    Levin, Ellis R.; Hammes, Stephen R.

    2017-01-01

    Steroid hormone receptors mediate numerous crucial biological processes and are classically thought to function as transcriptional regulators in the nucleus. However, it has been known for more than 50 years that steroids evoke rapid responses in many organs that cannot be explained by gene regulation. Mounting evidence indicates that most steroid receptors in fact exist in extranuclear cellular pools, including at the plasma membrane. This latter pool, when engaged by a steroid ligand, rapidly activates signals that affect various aspects of cellular biology. Research into the mechanisms of signalling instigated by extranuclear steroid receptor pools and how this extranuclear signalling is integrated with responses elicited by nuclear receptor pools provides novel understanding of steroid hormone signalling and its roles in health and disease. PMID:27729652

  19. Do dispositivo da sexualidade ao dispositivo da biotecnologia

    Directory of Open Access Journals (Sweden)

    Laura Belluzzo de Campos Silva

    2015-12-01

    Full Text Available Resumo No livro “A vontade de saber”, onde definiu o que chamou de dispositivo da sexualidade, Foucault deixou entrever que talvez outro dispositivo já estivesse em vias de se compor. Os avanços recentes no campo da biotecnologia molecular reabrem a discussão sobre as bases biológicas do comportamento, acenando com a possibilidade de novas formas de intervenção e com a de seu uso para fins comerciais. Partindo dessas idéias, este trabalho visa discutir que contribuições o conceito de biopoder pode trazer em relação aos recentes avanços da biotecnologia e cartografar algumas linhas que compõem esse novo dispositivo, que poderíamos chamar de biotecnológico.

  20. Sustentabilidade e Serra da Cantareira : o descarte da morte

    OpenAIRE

    Antonio Paulo Barea Coutinho

    2005-01-01

    Resumo: A tese apresenta o desenvolvimento desta questão: se sustentabilidade, promessa de manutenção da vida, é algo que ainda não temos, o que hoje poderia colocar um fim à vida na Terra. Ao localizar na Segunda Guerra Mundial o aparecimento da ameça à vida, com o nazismo e as bombas atômicas lançadas sobre Hiroxima e Nagasáki, torna-se importante apontar no discurso da sustentabilidade o que nele se esconde. A ação do estado e a formulação de políticas públicas, local privilegiado nas prop...

  1. Epistemologias da igualdade: Entrevistada - Magali da Silva Almeida

    OpenAIRE

    Souza, Djonatan Kaic Ribeiro de; Ortegal, Leonardo Rodrigues

    2018-01-01

    Magali da Silva Almeida, professora do curso de Serviço Social da UFBA, é reconhecida nacionalmente como um dos principais nomes do debate sobre questão racial no Serviço Social, e como uma das pioneiras dos estudos sobre população negra na profissão. Sua atuação é reconhecida nos espaços do movimento negro brasileiro, Magali é também memória viva dos processos de aproximação entre o Serviço Social e a questão racial, em seus aspectos políticos, culturais e epistemológicos. Atua na defesa da ...

  2. Da "quimica" da erva nos saberes popular e cientifico

    OpenAIRE

    Fatima Teresa Braga Branquinho

    1999-01-01

    Resumo: A investigação sobre a cultura das ervas entre moradores de um centro urbano como o Rio de Janeiro, em feiras-livres de diferentes bairros, no Mercadão de Madureira e numa favela da periferia revelou um dos modos como a sociedade se relaciona com a natureza. As práticas de cura com ervas estudadas - produto e resumo de intercâmbios, relações culturais e valores - têm no conceito de "química" da erva sua expressão mais precisa na descrição dos entrevistados. A "química" da erva implica...

  3. Taste receptors for umami: the case for multiple receptors.

    Science.gov (United States)

    Chaudhari, Nirupa; Pereira, Elizabeth; Roper, Stephen D

    2009-09-01

    Umami taste is elicited by many small molecules, including amino acids (glutamate and aspartate) and nucleotides (monophosphates of inosinate or guanylate, inosine 5'-monophosphate and guanosine-5'-monophosphate). Mammalian taste buds respond to these diverse compounds via membrane receptors that bind the umami tastants. Over the past 15 y, several receptors have been proposed to underlie umami detection in taste buds. These receptors include 2 glutamate-selective G protein-coupled receptors, mGluR4 and mGluR1, and the taste bud-expressed heterodimer T1R1+T1R3. Each of these receptors is expressed in small numbers of cells in anterior and posterior taste buds. The mGluRs are activated by glutamate and certain analogs but are not reported to be sensitive to nucleotides. In contrast, T1R1+T1R3 is activated by a broad range of amino acids and displays a strongly potentiated response in the presence of nucleotides. Mice in which the Grm4 gene is knocked out show a greatly enhanced preference for umami tastants. Loss of the Tas1r1 or Tas1R3 genes is reported to depress but not eliminate neural and behavioral responses to umami. When intact mammalian taste buds are apically stimulated with umami tastants, their functional responses to umami tastants do not fully resemble the responses of a single proposed umami receptor. Furthermore, the responses to umami tastants persist in the taste cells of T1R3-knockout mice. Thus, umami taste detection may involve multiple receptors expressed in different subsets of taste cells. This receptor diversity may underlie the complex perception of umami, with different mixtures of amino acids, peptides, and nucleotides yielding subtly distinct taste qualities.

  4. Taste receptors for umami: the case for multiple receptors1234

    Science.gov (United States)

    Pereira, Elizabeth; Roper, Stephen D

    2009-01-01

    Umami taste is elicited by many small molecules, including amino acids (glutamate and aspartate) and nucleotides (monophosphates of inosinate or guanylate, inosine 5′-monophosphate and guanosine-5′-monophosphate). Mammalian taste buds respond to these diverse compounds via membrane receptors that bind the umami tastants. Over the past 15 y, several receptors have been proposed to underlie umami detection in taste buds. These receptors include 2 glutamate-selective G protein–coupled receptors, mGluR4 and mGluR1, and the taste bud–expressed heterodimer T1R1+T1R3. Each of these receptors is expressed in small numbers of cells in anterior and posterior taste buds. The mGluRs are activated by glutamate and certain analogs but are not reported to be sensitive to nucleotides. In contrast, T1R1+T1R3 is activated by a broad range of amino acids and displays a strongly potentiated response in the presence of nucleotides. Mice in which the Grm4 gene is knocked out show a greatly enhanced preference for umami tastants. Loss of the Tas1r1 or Tas1R3 genes is reported to depress but not eliminate neural and behavioral responses to umami. When intact mammalian taste buds are apically stimulated with umami tastants, their functional responses to umami tastants do not fully resemble the responses of a single proposed umami receptor. Furthermore, the responses to umami tastants persist in the taste cells of T1R3-knockout mice. Thus, umami taste detection may involve multiple receptors expressed in different subsets of taste cells. This receptor diversity may underlie the complex perception of umami, with different mixtures of amino acids, peptides, and nucleotides yielding subtly distinct taste qualities. PMID:19571230

  5. Desenvolvimento e validação de métodos analíticos para determinação do cloridrato de epinastina em comprimidos revestidos

    OpenAIRE

    Daniela Dal Molim Ghisleni

    2006-01-01

    O cloridrato de epinastina é um agente não sedativo, antagonista H1 da histamina, utilizado no tratamento da asma ou como anti-histamínico, comercializado no Brasil na forma farmacêutica comprimido revestido com o nome de Talerc ®. Embora, seja um medicamento amplamente comercializado não há referências relativas aos métodos de análise da forma farmacêutica. Este trabalho teve como objetivos o desenvolvimento e a validação de métodos analíticos para o controle de qualidade do cloridrato de ep...

  6. Publicidade e ética: um estudo da construção da imagem da mulher

    Directory of Open Access Journals (Sweden)

    Elizabeth Moraes Gonçalves

    2010-02-01

    Full Text Available O texto propõe uma reflexão sobre a ética da responsabilidade na publicidade veiculada nas revistas Claudia e Nova. Trata-se de uma pesquisa descritiva, resultante da leitura dos anúncios selecionados, subsidiada por teóricos da Análise do Discurso da linha francesa, que busca averiguar como a mulher é representada. Constatou-se que no contexto da sociedade contemporânea o retrato da mulher como sedutora ainda está presente, mesmo que em vários momentos ela apareça como protagonista de sua própria vida.

  7. Rapid mineralocorticoid receptor trafficking.

    Science.gov (United States)

    Gekle, M; Bretschneider, M; Meinel, S; Ruhs, S; Grossmann, C

    2014-03-01

    The mineralocorticoid receptor (MR) is a ligand-dependent transcription factor that physiologically regulates water-electrolyte homeostasis and controls blood pressure. The MR can also elicit inflammatory and remodeling processes in the cardiovascular system and the kidneys, which require the presence of additional pathological factors like for example nitrosative stress. However, the underlying molecular mechanism(s) for pathophysiological MR effects remain(s) elusive. The inactive MR is located in the cytosol associated with chaperone molecules including HSP90. After ligand binding, the MR monomer rapidly translocates into the nucleus while still being associated to HSP90 and after dissociation from HSP90 binds to hormone-response-elements called glucocorticoid response elements (GREs) as a dimer. There are indications that rapid MR trafficking is modulated in the presence of high salt, oxidative or nitrosative stress, hypothetically by induction or posttranslational modifications. Additionally, glucocorticoids and the enzyme 11beta hydroxysteroid dehydrogenase may also influence MR activation. Because MR trafficking and its modulation by micro-milieu factors influence MR cellular localization, it is not only relevant for genomic but also for nongenomic MR effects. Copyright © 2013 Elsevier Inc. All rights reserved.

  8. Steroid receptors in osteoblasts.

    Science.gov (United States)

    Yoshioka, T; Sato, B; Matsumoto, K; Ono, K

    1980-05-01

    Using the whole-cell incubation system at 37 degrees C, the specific bindings for 3H-dexamethasone, 3H-estradiol-17 beta, 3H-dihydrotestosterone and 3H-R5020 were measured in the purified, putative osteoblasts isolated from fetal rat calvaria by collagenase digestion. More than 90% of the purified cells contained intense alkaline phosphatase activity. The specific binding for 3H-dexamethasone with high affinity and low capacity was demonstrated in the isolated osteoblasts. Most of the binding was found in the nuclear fraction, indicating nucler binding of the 3H-dexamethasone-receptor complex. The apparent dissociation constant (Kd) for 3H-dexamethasone was estimated to be 3.3 x 10(-9)M and the number of binding sites was calculated to be 65 fmol/ml (4 x 10(6) cells) or 9,750 binding sites per cell. High salt: sucrose gradient analysis of nuclear extracts revealed a radioactive 4.0 S peak. These results indicate that the purified osteoblasts are among the target cells for glucocorticoids. On the other hand, the specific bindings for 3H-estradiol-17 beta and 3H-dihydrotestosterone were not detectable in the isolated osteoblasts, which suggests that estrogens and androgens act on osteoblasts only indirectly.

  9. Recent advances in the development of dopamine D3 receptor antagonists: a medicinal chemistry perspective.

    Science.gov (United States)

    Micheli, Fabrizio

    2011-07-04

    Dopamine (DA) D(3) receptor antagonism might play a significant role in different therapeutic areas. A high number of preclinical studies on DA D(3) receptor antagonists have shown efficacy in animal models of Parkinson's disease, schizophrenia and drug dependence. This Review covers the activities of medicinal chemists in this field over the last ten years towards the identification of truly selective compounds. Both primary and patent literature is reviewed here. Since the original discoveries, a clear trend towards the optimization of the developability properties of the new scaffold has clearly emerged with time, from both academic and industrial researchers. Examples of advanced leads from academia and industry are described. The latest potential therapeutic applications are reported too. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Efeitos da acupuntura no tratamento da ansiedade: revisao integrativa

    OpenAIRE

    Goyatá, Sueli Leiko Takamatsu; Avelino, Carolina Costa Valcanti; Santos, Sérgio Valverde Marques dos; Souza Junior, Deusdete Inácio de; Gurgel, Maria Dorise Simão Lopes; Terra, Fábio de Souza

    2016-01-01

    RESUMO Objetivo: avaliar as evidências científicas disponíveis na literatura sobre os efeitos da acupuntura no tratamento da ansiedade e a qualidade desses estudos. Método: revisão integrativa, realizada nas bases/bancos de dados CINAHL, LILACS, PUBMEDPICO, SciELO, The Cochrane Library, no período entre 2001 a 2014. Os descritores anxiety, acupuncture therapy, acupuncture e anxiety disorders foram combinados entre si para garantir a ampla busca de estudos primários. Resultados: dos 514 art...

  11. Do dispositivo da sexualidade ao dispositivo da biotecnologia

    OpenAIRE

    Silva, Laura Belluzzo de Campos

    2015-01-01

    Resumo No livro “A vontade de saber”, onde definiu o que chamou de dispositivo da sexualidade, Foucault deixou entrever que talvez outro dispositivo já estivesse em vias de se compor. Os avanços recentes no campo da biotecnologia molecular reabrem a discussão sobre as bases biológicas do comportamento, acenando com a possibilidade de novas formas de intervenção e com a de seu uso para fins comerciais. Partindo dessas idéias, este trabalho visa discutir que contribuições o conceito de biopoder...

  12. Quantitative receptor radioautography in the study of receptor-receptor interactions in the nucleus tractus solitarii

    Directory of Open Access Journals (Sweden)

    Fior-Chadi D.R.

    1998-01-01

    Full Text Available The nucleus tractus solitarii (NTS in the dorsomedial medulla comprises a wide range of neuropeptides and biogenic amines. Several of them are related to mechanisms of central blood pressure control. Angiotensin II (Ang II, neuropeptide Y (NPY and noradrenaline (NA are found in the NTS cells, as well as their receptors. Based on this observation we have evaluated the modulatory effect of these peptide receptors on a2-adrenoceptors in the NTS. Using quantitative receptor radioautography, we observed that NPY and Ang II receptors decreased the affinity of a2-adrenoceptors for their agonists in the NTS of the rat. Cardiovascular experiments agreed with the in vitro data. Coinjection of a threshold dose of Ang II or of the NPY agonists together with an ED50 dose of adrenergic agonists such as NA, adrenaline and clonidine counteracted the depressor effect produced by the a2-agonist in the NTS. The results provide evidence for the existence of an antagonistic interaction between Ang II at1 receptors and NPY receptor subtypes with the a2-adrenoceptors in the NTS. This receptor interaction may reduce the transduction over the a2-adrenoceptors which can be important in central cardiovascular regulation and in the development of hypertension

  13. Menthol Enhances Nicotine Reward-Related Behavior by Potentiating Nicotine-Induced Changes in nAChR Function, nAChR Upregulation, and DA Neuron Excitability

    OpenAIRE

    Henderson, Brandon J.; Wall, Teagan R.; Henley, Beverley M.; Kim, Charlene H.; McKinney, Sheri; Lester, Henry A.

    2017-01-01

    Understanding why the quit rate among smokers of menthol cigarettes is lower than non-menthol smokers requires identifying the neurons that are altered by nicotine, menthol, and acetylcholine. Dopaminergic (DA) neurons in the ventral tegmental area (VTA) mediate the positive reinforcing effects of nicotine. Using mouse models, we show that menthol enhances nicotine-induced changes in nicotinic acetylcholine receptors (nAChRs) expressed on midbrain DA neurons. Menthol plus nicotine upregulates...

  14. Allosteric modulation of chemoattractant receptors

    Directory of Open Access Journals (Sweden)

    Maria Candida Cesta

    2016-05-01

    Full Text Available Chemoattractants control selective leukocyte homing via interactions with a dedicated family of related GPCR. Emerging evidence indicates that the signalling activity of these receptors, as for other GPCR, is influenced by allosteric modulators, which interact with the receptor in a binding site distinct from the binding site of the endogenous agonist and modulate the receptor signalling activity in response to the orthosteric ligand. Allosteric modulators have a number of potential advantages over orthosteric agonists/antagonists as therapeutic agents and offer unprecedented opportunities to identify extremely selective drug leads. Here we resume evidence of allosterism in the context of chemoattractant receptors, discussing in particular its functional impact on functional selectivity and probe/concentration dependence of orthosteric ligands activities.

  15. Sialic Acid Receptors of Viruses.

    Science.gov (United States)

    Matrosovich, Mikhail; Herrler, Georg; Klenk, Hans Dieter

    2015-01-01

    Sialic acid linked to glycoproteins and gangliosides is used by many viruses as a receptor for cell entry. These viruses include important human and animal pathogens, such as influenza, parainfluenza, mumps, corona, noro, rota, and DNA tumor viruses. Attachment to sialic acid is mediated by receptor binding proteins that are constituents of viral envelopes or exposed at the surface of non-enveloped viruses. Some of these viruses are also equipped with a neuraminidase or a sialyl-O-acetyl-esterase. These receptor-destroying enzymes promote virus release from infected cells and neutralize sialic acid-containing soluble proteins interfering with cell surface binding of the virus. Variations in the receptor specificity are important determinants for host range, tissue tropism, pathogenicity, and transmissibility of these viruses.

  16. Nuclear Receptor Signaling Atlas (NURSA)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Nuclear Receptor Signaling Atlas (NURSA) is designed to foster the development of a comprehensive understanding of the structure, function, and role in disease...

  17. Insulin receptor signaling in cones

    National Research Council Canada - National Science Library

    Rajala, Ammaji; Dighe, Radhika; Agbaga, Martin-Paul; Anderson, Robert E; Rajala, Raju V S

    2013-01-01

    .... To date there are no studies on the insulin receptor signaling in cones; however, mRNA levels of IR signaling proteins are significantly higher in cone-dominant neural retina leucine zipper (Nrl...

  18. Striatal dopamine D2/3 receptor-mediated neurotransmission in major depression: Implications for anhedonia, anxiety and treatment response.

    Science.gov (United States)

    Peciña, Marta; Sikora, Magdalena; Avery, Erich T; Heffernan, Joseph; Peciña, Susana; Mickey, Brian J; Zubieta, Jon-Kar

    2017-10-01

    Dopamine (DA) neurotransmission within the brain's reward circuit has been implicated in the pathophysiology of depression and in both, cognitive and pharmacological mechanisms of treatment response. Still, a direct relationship between measures of DA neurotransmission and reward-related deficits in patients with depression has not been demonstrated. To gain insight into the symptom-specific alterations in the DA system in patients with depression, we used positron emission tomography (PET) and the D 2/3 receptor-selective radiotracer [ 11 C]raclopride in twenty-three non-smoking un-medicated Major Depressive Disorder (MDD) patients and sixteen healthy controls (HC). We investigated the relationship between D 2/3 receptor availability and baseline measures of depression severity, anxiety, anhedonia, and cognitive and pharmacological mechanisms of treatment response. We found that, compared to controls, patients with depression showed greater D 2/3 receptor availability in several striatal regions, including the bilateral ventral pallidum/nucleus accumbens (vPAL/NAc), and the right ventral caudate and putamen. In the depressed sample, D 2/3 receptor availability in the caudal portion of the ventral striatum (NAc/vPAL) correlated with higher anxiety symptoms, whereas D 2/3 receptor availability in the rostral area of the ventral striatum correlated negatively with the severity of motivational anhedonia. Finally, MDD non-remitters showed greater baseline anxiety, greater D 2/3 availability in the NAc/vPAL, and greater placebo-induced DA release in the bilateral NAc. Our results demonstrate abnormally high D 2/3 receptor availability in the ventral striatum of patients with MDD, which seem to be associated with comorbid anxiety symptoms and lack of response to antidepressants. Copyright © 2017 Elsevier B.V. and ECNP. All rights reserved.

  19. Serotonin 2A receptor regulation of striatal neuropeptide gene expression is selective for tachykinin, but not enkephalin neurons following dopamine depletion.

    Science.gov (United States)

    Basura, G J; Walker, P D

    2001-08-15

    Serotonin (5-HT) 2A receptor-mediated regulation of striatal preprotachykinin (PPT) and preproenkephalin (PPE) mRNAs was studied in adult rodents that had been subjected to near-total dopamine (DA) depletion as neonates. Two months following bilateral 6-hydroxydopamine (6-OHDA) lesion, PPT mRNA levels decreased 59-73% across dorsal subregions of the rostral and caudal striatum while PPE transcripts increased 61-94%. Four hours after a single injection of the serotonin 2A/2C receptor agonist, (+/-)-1-(2,5-Dimethoxy-4-iodophenyl)-2-aminopropane (DOI; 1 mg/kg), PPT mRNA expression was significantly increased in DA-depleted rats across all dorsal subregions of the rostral and caudal striatum as compared to 6-OHDA-treated animals alone. In the intact rat, DOI did not influence PPT mRNA levels in the rostral striatum, but did raise expression in the caudal striatum where 5-HT2A receptors are prominent. DOI did not regulate PPE mRNA levels in any striatal sub-region of the intact or DA-depleted rat. Prior administration of the 5-HT2A/2C receptor antagonist, ritanserin (1 mg/kg) or the 5-HT2A receptor antagonist, ketanserin (1 mg/kg) completely blocked the DOI-induced increases in striatal PPT mRNA in both lesioned and intact animals. The ability of ketanserin to produce identical results as ritanserin suggests that 5-HT2A receptor-mediated regulation is selectively strengthened within tachykinin neurons of the rostral striatum which are suppressed by DA depletion. The selectivity suggests that 5-HT2A receptor upregulation following DA depletion is capable of regulating tachykinin biosynthesis without influencing enkephalin expression in striatal output neurons.

  20. History of retinoic acid receptors.

    Science.gov (United States)

    Benbrook, Doris M; Chambon, Pierre; Rochette-Egly, Cécile; Asson-Batres, Mary Ann

    2014-01-01

    The discovery of retinoic acid receptors arose from research into how vitamins are essential for life. Early studies indicated that Vitamin A was metabolized into an active factor, retinoic acid (RA), which regulates RNA and protein expression in cells. Each step forward in our understanding of retinoic acid in human health was accomplished by the development and application of new technologies. Development cDNA cloning techniques and discovery of nuclear receptors for steroid hormones provided the basis for identification of two classes of retinoic acid receptors, RARs and RXRs, each of which has three isoforms, α, β and ɣ. DNA manipulation and crystallographic studies revealed that the receptors contain discrete functional domains responsible for binding to DNA, ligands and cofactors. Ligand binding was shown to induce conformational changes in the receptors that cause release of corepressors and recruitment of coactivators to create functional complexes that are bound to consensus promoter DNA sequences called retinoic acid response elements (RAREs) and that cause opening of chromatin and transcription of adjacent genes. Homologous recombination technology allowed the development of mice lacking expression of retinoic acid receptors, individually or in various combinations, which demonstrated that the receptors exhibit vital, but redundant, functions in fetal development and in vision, reproduction, and other functions required for maintenance of adult life. More recent advancements in sequencing and proteomic technologies reveal the complexity of retinoic acid receptor involvement in cellular function through regulation of gene expression and kinase activity. Future directions will require systems biology approaches to decipher how these integrated networks affect human stem cells, health, and disease.

  1. Gene da Leptina em Ruminantes - Leptin Gene in Ruminants - Gen de leptina en rumiantes

    OpenAIRE

    Dias Salman, Ana Karina; Bermal Cost,a Raphae; Giachetto Poliana Fernanda

    2007-01-01

    ResumoA descoberta da leptina, um hormônio responsável pela regulação do consumo e do metabolismo energético, renovou o interesse sobre o estudo do controle homeostático do metabolismo energético. Sabe-se agora que o tecido adiposo branco não é apenas um tecido de reserva de energia, mas é também o maior sítio de produção da leptina, uma proteína com ação hormonal que na circulação sangüínea se liga a receptores específicos e no cérebro ativam o centro da saciedade sinalizando a quantidade de...

  2. Terapia cognitivo-comportamental da fobia social

    OpenAIRE

    Ito,Lígia M; Roso,Miréia C; Tiwari,Shilpee; Kendall,Philip C; Asbahr,Fernando R

    2008-01-01

    OBJETIVO: Este artigo revisa aspectos relevantes da fobia social e os estágios de tratamento através da terapia cognitivo-comportamental em crianças, adolescentes e adultos. MÉTODO: A partir do banco de dados Medline, realizou-se revisão da literatura publicada a respeito do tratamento da fobia social por meio da terapia cognitivo-comportamental. RESULTADOS: Revisão da literatura sugere que a fobia social é uma condição prevalente e crônica, caracterizada por inibição social e timidez excessi...

  3. Biochemical characterization of rotavirus receptors in MA104 cells.

    Science.gov (United States)

    Guerrero, C A; Zárate, S; Corkidi, G; López, S; Arias, C F

    2000-10-01

    We have tested the effect of metabolic inhibitors, membrane cholesterol depletion, and detergent extraction of cell surface molecules on the susceptibility of MA104 cells to infection by rotaviruses. Treatment of cells with tunicamycin, an inhibitor of protein N glycosylation, blocked the infectivity of the SA-dependent rotavirus RRV and its SA-independent variant nar3 by about 50%, while the inhibition of O glycosylation had no effect. The inhibitor of glycolipid biosynthesis d, l-threo-1-phenyl-2-decanoylamino-3-morpholino-1-propanol (PDMP) blocked the infectivity of RRV, nar3, and the human rotavirus strain Wa by about 70%. Sequestration of cholesterol from the cell membrane with beta-cyclodextrin reduced the infectivity of the three viruses by more than 90%. The involvement of N-glycoproteins, glycolipids, and cholesterol in rotavirus infection suggests that the virus receptor(s) might be forming part of lipid microdomains in the cell membrane. MA104 cells incubated with the nonionic detergent octyl-beta-glucoside (OG) showed a ca. 60% reduction in their ability to bind rotaviruses, the same degree to which they became refractory to infection, suggesting that OG extracts the potential virus receptor(s) from the cell surface. Accordingly, when preincubated with the viruses, the OG extract inhibited the virus infectivity by more than 95%. This inhibition was abolished when the extract was treated with either proteases or heat but not when it was treated with neuraminidase, indicating the protein nature of the inhibitor. Two protein fractions of around 57 and 75 kDa were isolated from the extract, and these fractions were shown to have rotavirus-blocking activity. Also, antibodies to these fractions efficiently inhibited the infectivity of the viruses in untreated as well as in neuraminidase-treated cells. Five individual protein bands of 30, 45, 57, 75, and 110 kDa, which exhibited virus-blocking activity, were finally isolated from the OG extract. These proteins

  4. ESTUDO DA EFICIÊNCIA DA PASTEURIZAÇÃO DA POLPA DE TAPEREBÁ (SPONDIAS MOMBIN

    Directory of Open Access Journals (Sweden)

    C. T. R. M. BASTOS

    2008-12-01

    Full Text Available

    O taperebá (Spondias mombim é uma pequena drupa elipsóide, de cor amarelo alaranjado, com casca fi na que pode ser facilmente rompida, tornando o fruto susceptível à contaminação por ação de agentes externos. Estudou-se a pasteurização da polpa de taperebá, visando estabelecer condições simples e efi cientes de conservação a temperatura ambiente. Parâmetros microbiológicos (enumeração de microrganismos mesófílos aeróbios e pesquisa de coliformes a 45°C, químicos (teor de vitamina C, enzimáticos (atividade da peroxidase – POD e colorimétricos (colorimetria tristimulus foram utilizados como variáveis de resposta. Em bancada, foram testados diferentes tempos (1 a 300 s e temperaturas (70ºC a 90ºC de tratamento térmico, não tendo sido observado efeito estatisticamente signifi cativo (p < 0,05 sobre as contagens de microrganismos mesófi los aeróbios, coliformes a 45°C e sobre a cor da polpa. Em escala piloto, realizou-se a pasteurização da polpa a 85°C por 3 minutos, sendo avaliados parâmetros de qualidade do produto durante 14 dias de manutenção a 40°C, sob iluminação artifi cial, e realizados testes sensoriais. A redução da contagem de microrganismos mesófi los aeróbios e coliformes a 45°C, para níveis aceitáveis pela legislação brasileira, a manutenção da cor e os índices de aceitação da polpa confi rmaram a efi ciência do tratamento térmico. Não se observou atividade da POD na polpa pasteurizada, devendo o controle de qualidade do produto ser feito com base nos parâmetros microbiológicos e de cor da polpa.

  5. Receptor antibodies as novel therapeutics for diabetes

    DEFF Research Database (Denmark)

    Ussar, Siegfried; Vienberg, Sara Gry; Kahn, C Ronald

    2011-01-01

    Antibodies to receptors can block or mimic hormone action. Taking advantage of receptor isoforms, co-receptors, and other receptor modulating proteins, antibodies and other designer ligands can enhance tissue specificity and provide new approaches to the therapy of diabetes and other diseases....

  6. Receptor-targeted metalloradiopharmaceuticals. Final technical report

    Energy Technology Data Exchange (ETDEWEB)

    Green, Mark A.

    2000-03-22

    Copper (II) and platinum (II) coordination complexes were prepared and characterized. These complexes were designed to afford structural homology with steroidal and non-steroidal estrogens for possible use as receptor-targeted radiopharmaceuticals. While weak affinity for the estrogen receptor was detectable, none would appear to have sufficient receptor-affinity for estrogen-receptor-targeted imaging or therapy.

  7. Dopamine enhances duodenal epithelial permeability via the dopamine D5 receptor in rodent.

    Science.gov (United States)

    Feng, X-Y; Zhang, D-N; Wang, Y-A; Fan, R-F; Hong, F; Zhang, Y; Li, Y; Zhu, J-X

    2017-05-01

    The intestinal barrier is made up of epithelial cells and intercellular junctional complexes to regulate epithelial ion transport and permeability. Dopamine (DA) is able to promote duodenal epithelial ion transport through D1-like receptors, which includes subtypes of D1 (D1 R) and D5 (D5 R), but whether D1-like receptors influence the duodenal permeability is unclear. FITC-dextran permeability, short-circuit current (ISC ), Western blot, immunohistochemistry and ELISA were used in human D5 R transgenic mice and hyperendogenous enteric DA (HEnD) rats in this study. Dopamine induced a downward deflection in ISC and an increase in FITC-dextran permeability of control rat duodenum, which were inhibited by the D1-like receptor antagonist, SCH-23390. However, DA decreased duodenal transepithelial resistance (TER), an effect also reversed by SCH-23390. A strong immunofluorescence signal for D5 R, but not D1 R, was observed in the duodenum of control rat. In human D5 R knock-in transgenic mice, duodenal mucosa displayed an increased basal ISC with high FITC-dextran permeability and decreased TER with a lowered expression of tight junction proteins, suggesting attenuated duodenal barrier function in these transgenic mice. D5 R knock-down transgenic mice manifested a decreased basal ISC with lowered FITC-dextran permeability. Moreover, an increased FITC-dextran permeability combined with decreased TER and tight junction protein expression in duodenal mucosa were also observed in HEnD rats. This study demonstrates, for the first time, that DA enhances duodenal permeability of control rat via D5 R, which provides new experimental and theoretical evidence for the influence of DA on duodenal epithelial barrier function. © 2016 Scandinavian Physiological Society. Published by John Wiley & Sons Ltd.

  8. O panorama das Drogas no México: da margem da sociedade ao centro da cultura

    Directory of Open Access Journals (Sweden)

    Diana Palaversich

    2013-12-01

    Full Text Available O artigo destaca o percurso das manifestações culturais ligadas ao tráfico de drogas no México, de um lugar marginal, de subcultura, na sociedade mexicana das décadas de 1970 e 1980, expressas principalmente através dos narcocorridos e do narcocine, para um lugar no mainstream cultural mexicano, desde o início do século 21, com destaque especial para a narcoliteratura. O aumento da violência, provocado pela guerra ao narcotráfico, produz uma proliferação da temática nos meios de comunicação e se reflete em áreas da cultura como as artes plásticas e a literatura, produzindo um novo tipo de expressão artística ou narrativa, que tanto pode ser oportunista e contribuir para a banalização da violência do narcotráfico como ser crítica e narrar o impacto individual e coletivo do tráfico de drogas, narrar a desenfreada e violenta realidade mexicana sem cair no estilo da imprensa marrom, do folclore ou dos lugares comuns dos romances de ação.

  9. Cultura da Convergência

    Directory of Open Access Journals (Sweden)

    Rogério Christofoletti

    2008-12-01

    Full Text Available Três idéias já seriam suficientes para que a leitura de “Cultura da Convergência”, de Henry Jenkins, interessasse a jornalistas e pesquisadores da área: a convergência midiática como um processo cultural; o fortalecimento de uma economia afetiva que orienta consumidores de bens simbólicos e criadores midiáticos; a expansão de formas narrativas transmidiáticas.

  10. Cinco discursos da digitalidade audiovisual

    Directory of Open Access Journals (Sweden)

    Gerbase, Carlos

    2001-01-01

    Full Text Available Michel Foucault ensina que toda fala sistemática - inclusive aquela que se afirma “neutra” ou “uma desinteressada visão objetiva do que acontece” - é, na verdade, mecanismo de articulação do saber e, na seqüência, de formação de poder. O aparecimento de novas tecnologias, especialmente as digitais, no campo da produção audiovisual, provoca uma avalanche de declarações de cineastas, ensaios de acadêmicos e previsões de demiurgos da mídia.

  11. CILADAS DA DIFERENÇA

    Directory of Open Access Journals (Sweden)

    Antônio Flávio Pierucci

    1990-12-01

    Full Text Available Este artigo procura analisar os efeitos perversos da apropriação pela esquerda de um tema definidor das tradições de direita, a saber, a diferença. Com base no caso Sears (EUA e no caso Le Pen (França, o autor aponta para as armadilhas racistas e sexistas presentes nos discursos que focalizam e enfatizam a diferença, sobretudo num período histórico de reemergência dos conservadorismos que, por sua vez, se apropriam do argumento da diferença, dirigindo-o contra os próprios movimentos de esquerda.

  12. Processo de trabalho da enfermagem

    OpenAIRE

    Gonçalves, Leonor

    2007-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina, Centro de Ciências da Saúde. Programa de Pós-graduação em Enfermagem Trata-se de um estudo qualitativo, na perspectiva do materialismo histórico e dialético, com objetivo de analisar os elementos qualitativos do processo de trabalho que são imprescindíveis na definição dos parâmetros de dimensionamento da força de trabalho de enfermagem, em unidade de internação clínico-cirúrgica. O estudo justifica-se porque um dos grandes problem...

  13. Nucleus accumbens neurotransmission and effort-related choice behavior in food motivation: effects of drugs acting on dopamine, adenosine, and muscarinic acetylcholine receptors.

    Science.gov (United States)

    Nunes, Eric J; Randall, Patrick A; Podurgiel, Samantha; Correa, Mercè; Salamone, John D

    2013-11-01

    Mesolimbic dopamine (DA) is a critical component of the brain circuitry regulating behavioral activation and effort-related processes. Although nucleus accumbens (NAc) DA depletions or antagonism leave aspects of appetite and primary food motivation intact, rats with impaired DA transmission reallocate their instrumental behavior away from food-reinforced tasks with high response requirements, and instead select less effortful food-seeking behaviors. Previous work showed that adenosine A2A antagonists can reverse the effects of DA D2 antagonists on effort-related choice, and that stimulation of adenosine A2A receptors produces behavioral effects that are similar to those induced by DA antagonism. The present review summarizes the literature on the role of NAc DA and adenosine in effort-related processes, and also presents original data on the effects of local stimulation of muscarinic acetylcholine receptors in NAc core. Local injections of the muscarinic agonist pilocarpine directly into NAc core produces shifts in effort-related choice behavior similar to those induced by DA antagonism or A2A receptor stimulation, decreasing lever pressing but increasing chow intake in rats responding on a concurrent fixed ratio/chow feeding choice task. In contrast, injections into a neostriatal control site dorsal to the NAc were ineffective. The actions of pilocarpine on this task were attenuated by co-administration of the muscarinic antagonist scopolamine. Thus, drugs that act on DA, adenosine A2A, and muscarinic receptors regulate effort-related choice behavior, which may have implications for the treatment of psychiatric symptoms such as psychomotor slowing, fatigue or anergia that can be observed in depression and other disorders. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. Expression of GABAergic receptors in mouse taste receptor cells.

    Directory of Open Access Journals (Sweden)

    Margaret R Starostik

    Full Text Available BACKGROUND: Multiple excitatory neurotransmitters have been identified in the mammalian taste transduction, with few studies focused on inhibitory neurotransmitters. Since the synthetic enzyme glutamate decarboxylase (GAD for gamma-aminobutyric acid (GABA is expressed in a subset of mouse taste cells, we hypothesized that other components of the GABA signaling pathway are likely expressed in this system. GABA signaling is initiated by the activation of either ionotropic receptors (GABA(A and GABA(C or metabotropic receptors (GABA(B while it is terminated by the re-uptake of GABA through transporters (GATs. METHODOLOGY/PRINCIPAL FINDINGS: Using reverse transcriptase-PCR (RT-PCR analysis, we investigated the expression of different GABA signaling molecules in the mouse taste system. Taste receptor cells (TRCs in the circumvallate papillae express multiple subunits of the GABA(A and GABA(B receptors as well as multiple GATs. Immunocytochemical analyses examined the distribution of the GABA machinery in the circumvallate papillae. Both GABA(A-and GABA(B- immunoreactivity were detected in the peripheral taste receptor cells. We also used transgenic mice that express green fluorescent protein (GFP in either the Type II taste cells, which can respond to bitter, sweet or umami taste stimuli, or in the Type III GAD67 expressing taste cells. Thus, we were able to identify that GABAergic receptors are expressed in some Type II and Type III taste cells. Mouse GAT4 labeling was concentrated in the cells surrounding the taste buds with a few positively labeled TRCs at the margins of the taste buds. CONCLUSIONS/SIGNIFICANCE: The presence of GABAergic receptors localized on Type II and Type III taste cells suggests that GABA is likely modulating evoked taste responses in the mouse taste bud.

  15. The Sigma-2 Receptor and Progesterone Receptor Membrane Component 1 are Different Binding Sites Derived From Independent Genes

    Directory of Open Access Journals (Sweden)

    Uyen B. Chu

    2015-11-01

    Full Text Available The sigma-2 receptor (S2R is a potential therapeutic target for cancer and neuronal diseases. However, the identity of the S2R has remained a matter of debate. Historically, the S2R has been defined as (1 a binding site with high affinity to 1,3-di-o-tolylguanidine (DTG and haloperidol but not to the selective sigma-1 receptor ligand (+-pentazocine, and (2 a protein of 18–21 kDa, as shown by specific photolabeling with [3H]-Azido-DTG and [125I]-iodoazido-fenpropimorph ([125I]-IAF. Recently, the progesterone receptor membrane component 1 (PGRMC1, a 25 kDa protein, was reported to be the S2R (Nature Communications, 2011, 2:380. To confirm this identification, we created PGRMC1 knockout NSC34 cell lines using the CRISPR/Cas9 technology. We found that in NSC34 cells devoid of or overexpressing PGRMC1, the maximum [3H]-DTG binding to the S2R (Bmax as well as the DTG-protectable [125I]-IAF photolabeling of the S2R were similar to those of wild-type control cells. Furthermore, the affinities of DTG and haloperidol for PGRMC1 (KI = 472 μM and 350 μM, respectively, as determined in competition with [3H]-progesterone, were more than 3 orders of magnitude lower than those reported for the S2R (20–80 nM. These results clarify that PGRMC1 and the S2R are distinct binding sites expressed by different genes.

  16. No Tempo da camisolinha, um narrador da experiência

    OpenAIRE

    Almeida, Laura Beatriz Fonseca de [UNESP

    2003-01-01

    Leitura analítica do conto Tempo da camisolinha, extraído do livro Contos novos, de Mário de Andrade, visando a configurar as artimanhas de um narrador-protagonista que, ao rememorar as experiências de sua iniciação para a vida, promove uma profunda análise das sinceridades cabotinas do homem.

  17. Efeitos da acupuntura no tratamento da ansiedade: revisao integrativa

    Directory of Open Access Journals (Sweden)

    Sueli Leiko Takamatsu Goyatá

    2016-06-01

    Full Text Available RESUMO Objetivo: avaliar as evidências científicas disponíveis na literatura sobre os efeitos da acupuntura no tratamento da ansiedade e a qualidade desses estudos. Método: revisão integrativa, realizada nas bases/bancos de dados CINAHL, LILACS, PUBMEDPICO, SciELO, The Cochrane Library, no período entre 2001 a 2014. Os descritores anxiety, acupuncture therapy, acupuncture e anxiety disorders foram combinados entre si para garantir a ampla busca de estudos primários. Resultados: dos 514 artigos, 67 foram selecionados para leitura na íntegra e 19 incluídos. Desses, 11 apresentaram forte nível de evidência. Dos seis artigos de estudos clínicos randomizados, cinco apresentaram qualidade classificada como razoável. Dois estudos utilizaram acupunturistas enfermeiros para a aplicação da intervenção. Os resultados mostram efeitos positivos e estatisticamente significativos do uso da acupuntura para tratamento de indivíduos com ansiedade. Conclusão: a acupuntura parece ser um tratamento promissor para a ansiedade, no entanto, há necessidade de melhorar a qualidade metodológica das pesquisas nessa temática.

  18. Rentabilidade na semeadura cruzada da cultura da soja

    Directory of Open Access Journals (Sweden)

    Paulo R. A. Silva

    2015-03-01

    Full Text Available O plantio cruzado da soja consiste em semear a área em duas passadas de modo que a segunda fique perpendicular à primeira, formando um tabuleiro de xadrez. Desta forma, o objetivo do trabalho foi avaliar a produtividade e os custos de produção da cultura da soja quando semeada em diferentes arranjos de semeadura cruzada. O experimento foi realizado nas safras 2011/2012 e 2012/2013, em área cultivada em sistema de plantio direto. O delineamento experimental foi em blocos casualizados com 5 tratamentos e 8 repetições. Os tratamentos foram: semeadura em linhas paralelas com adubação e população de plantas recomendada; semeadura cruzada com população e adubo em dobro; semeadura cruzada com população recomendada e adubo em dobro; semeadura cruzada com população em dobro e adubação recomendada; semeadura cruzada com população de plantas e adubo recomendado. Os resultados mostraram maior produtividade para o tratamento de semeadura cruzada com população de plantas em dobro e adubo recomendado; apesar disto, a semeadura convencional em linhas paralelas apresenta maior receita líquida do que a semeadura cruzada da soja sendo, então, mais rentável para o produtor.

  19. Nuclear Receptors, RXR, and the Big Bang.

    Science.gov (United States)

    Evans, Ronald M; Mangelsdorf, David J

    2014-03-27

    Isolation of genes encoding the receptors for steroids, retinoids, vitamin D, and thyroid hormone and their structural and functional analysis revealed an evolutionarily conserved template for nuclear hormone receptors. This discovery sparked identification of numerous genes encoding related proteins, termed orphan receptors. Characterization of these orphan receptors and, in particular, of the retinoid X receptor (RXR) positioned nuclear receptors at the epicenter of the "Big Bang" of molecular endocrinology. This Review provides a personal perspective on nuclear receptors and explores their integrated and coordinated signaling networks that are essential for multicellular life, highlighting the RXR heterodimer and its associated ligands and transcriptional mechanism. Copyright © 2014 Elsevier Inc. All rights reserved.

  20. Nuclear Receptors, RXR & the Big Bang

    Science.gov (United States)

    Evans, Ronald M.; Mangelsdorf, David J.

    2014-01-01

    Summary Isolation of genes encoding the receptors for steroids, retinoids, vitamin D and thyroid hormone, and their structural and functional analysis revealed an evolutionarily conserved template for nuclear hormone receptors. This discovery sparked identification of numerous genes encoding related proteins, termed orphan receptors. Characterization of these orphan receptors, and in particular of the retinoid X receptor (RXR), positioned nuclear receptors at the epicenter of the “Big Bang” of molecular endocrinology. This review provides a personal perspective on nuclear receptors and explores their integrated and coordinated signaling networks that are essential for multi-cellular life, highlighting the RXR heterodimer and its associated ligands and transcriptional mechanism. PMID:24679540

  1. Efeito agudo da suplementacao da cafeina no desempenho da forca muscular e alteracoes cardiovasculares durante o treino de forca

    National Research Council Canada - National Science Library

    Materko, W; Santos, E.L

    2011-01-01

    A proposta do presente estudo foi avaliar o efeito agudo da cafeina no desempenho da forca muscular, paralelamente a possiveis alteracoes hemodinamicas ao longo de uma sessao de treino de forca muscular...

  2. Dopamine receptor-mediated regulation of neuronal “clock” gene expression

    Science.gov (United States)

    Imbesi, Marta; Yildiz, Sevim; Arslan, Ahmet Dirim; Sharma, Rajiv; Manev, Hari; Uz, Tolga

    2009-01-01

    Using transgenic mice model (i.e., “clock” knockouts), clock transcription factors have been suggested as critical regulators of dopaminergic behaviors induced by drugs of abuse. Moreover, it has been shown that systemic administration of psychostimulants, such as cocaine and methamphetamine regulate the striatal expression of clock genes. However, it is not known whether dopamine receptors mediate these regulatory effects of psychostimulants at the cellular level. Primary striatal neurons in culture express dopamine receptors as well as clock genes and have been successfully used in studying dopamine receptor functioning. Therefore, we investigated the role of dopamine receptors on neuronal clock gene expression in this model using specific receptor agonists. We found an inhibitory effect on the expression of mClock and mPer1 genes with the D2-class (i.e., D2/D3) receptor agonist quinpirole. We also found a generalized stimulatory effect on the expression of clock genes mPer1, mClock, mNPAS2, and mBmal1 with the D1-class (i.e., D1) receptor agonist SKF38393. Further, we tested whether systemic administration of dopamine receptor agonists causes similar changes in striatal clock gene expression in vivo. We found quinpirole-induced alterations in mPER1 protein levels in the mouse striatum (i.e., rhythm shift). Collectively, our results indicate that the DA receptor system may mediate psychostimulant-induced changes in clock gene expression. Using striatal neurons in culture as a model, further research is needed to better understand how dopamine signaling modulates the expression dynamics of clock genes (i.e., intracellular signaling pathways) and thereby influences neuronal gene expression, neuronal transmission, and brain functioning. PMID:19017537

  3. ( sup 125 I)Iodoazidococaine, a photoaffinity label for the haloperidol-sensitive sigma receptor

    Energy Technology Data Exchange (ETDEWEB)

    Kahoun, J.R.; Ruoho, A.E. (Univ. of Wisconsin, Madison (United States))

    1992-02-15

    A carrier-free radioiodinated cocaine photoaffinity label, (-)-3-({sup 125}I)iodo-4-azidococaine (({sup 125}I)IACoc), has been synthesized and used as a probe for cocaine-binding proteins. Photoaffinity labeling with 0.5 nM ({sup 125}I)IACoc resulted in selective derivatization of a 26-kDa polypeptide with the pharmacology of a sigma receptor in membranes derived from whole rat brain, rat liver, and human placenta. ({sup 125}I)IACoc labeling of the 26-kDa polypeptide was also inhibited by 10 {mu}M imipramine, amitriptyline, fluoxetine, benztropine, and tetrabenazine. The size of the ({sup 125}I)I-ACoc-labeled proteins is consistent with the size of proteins photolabeled in guinea pig brain and liver membranes by using the sigma photolabel azido-({sup 3}H)DTG. Kinetic analysis of ({sup 125}I)IACoc binding to rat liver microsomes revealed two sites with K{sub d} values of 19 and 126 pM, respectively. The presence or absence of proteolytic inhibitors during membrane preparation did not alter the size of the photolabeled sigma receptor, indicating that the 26-kDa polypeptide was not derived from a larger protein. In summary, ({sup 125}I)IACoc is a potent and highly specific photoaffinity label for the haloperidol-sensitive sigma receptor and will be useful for its biochemical and molecular characterization.

  4. Efeito da urina de vaca no estado nutricional da alface

    Directory of Open Access Journals (Sweden)

    Nelson Licínio C. de Oliveira

    2010-08-01

    Full Text Available Existem diversos relatos da utilização da urina de vaca em hortaliças, todavia sua eficácia carece de comprovação. Objetivou-se avaliar o efeito da urina de vaca no estado nutricional da alface. O experimento foi constituído de 12 tratamentos, esquema de parcelas subdivididas, em blocos ao acaso, com quatro repetições. Nas parcelas foram alocadas as vias de aplicação (solo ou foliar e nas subparcelas as concentrações das soluções (0,00; 0,25; 0,50; 0,75; 1,00 e 1,25% v/v. Aplicou-se 60 mL de solução/planta, divididos em cinco aplicações de 5; 5; 10; 20 e 20 mL/planta, aos 7, 14, 21, 28 e 35 após o transplante, respectivamente. Durante o ciclo avaliou-se o índice SPAD e na colheita a massa da matéria seca de cabeça (MSCA e os teores de N, P, K, Ca, Mg, S, Na, Zn, Fe, Mn, Cu e B na matéria seca das folhas (MSF, caule (MSC e raízes (MSR. Em ambas as vias de aplicação o índice SPAD apresentou incremento linear às concentrações e resposta quadrática ao longo do tempo. A MSCA teve comportamento linear às concentrações, com aumento de 25,9 e 35,4% nas aplicações via foliar e solo, respectivamente. Não houve efeito de concentrações sobre teores de nutrientes na MSF e MSC. Na MSR, via solo, os teores de P e K apresentaram pontos de máximo enquanto Fe e Mn de mínimo; o Na apresentou incremento linear às concentrações via foliar. Os efeitos da urina sobre o crescimento da alface provavelmente são devidos a fatores outros que não somente a quantidade de nutrientes veiculados nas soluções.

  5. Ação direta da aldosterona em cardiomiócitos de rato.

    OpenAIRE

    Araújo, Carolina Morais

    2011-01-01

    Muitos estudos têm abordado a via conhecida como não genômica da aldosterona. Estes trabalhos mostram um grande número de atividades fisiológicas desse hormônio, que não envolvem o mecanismo clássico para receptores MR, no qual, ocorre a translocação do complexo hormônio-receptor ao núcleo. Ensaios realizados em culturas primárias de cardiomiócitos de ratos, na presença do inibidor do receptor MR, demonstraram aumento de AMPc e Ca2+ nas células tratadas com aldosterona quando comparados ao se...

  6. Prognostic Value of Estrogen Receptor alpha and Progesterone Receptor Conversion in Distant Breast Cancer Metastases

    NARCIS (Netherlands)

    Hoefnagel, Laurien D. C.; Moelans, Cathy B.; Meijer, S. L.; van Slooten, Henk-Jan; Wesseling, Pieter; Wesseling, Jelle; Westenend, Pieter J.; Bart, Joost; Seldenrijk, Cornelis A.; Nagtegaal, Iris D.; Oudejans, Joost; van der Valk, Paul; van Gils, Carla H.; van der Wall, Elsken; van Diest, Paul J.

    2012-01-01

    BACKGROUND: Changes in the receptor profile of primary breast cancers to their metastases (receptor conversion) have been described for the estrogen receptor alpha (ER alpha) and progesterone receptor (PR). The purpose of this study was to evaluate the impact of receptor conversion for ER alpha and

  7. Analise da termoterapia transuretral por microondas no tratamento da hiperplasia benigna da prostata

    OpenAIRE

    Pedro Luiz Macedo Cortado

    1997-01-01

    Resumo: A hiperplasia benigna da próstata (HBP) é uma condição anátomo-patológica que se traduz por alterações clínicas, morfológicas e funcionais do trato urinário, sendo estimado que um terço de todos os homens necessitará de um procedimento cirúgico para aliviar a sintomatologia secundária à HBP. Até hoje, o melhor método para tratamento é o cirúrgico, através da ressecção endoscópica da próstata porém, as taxas de morbidade e mortalidade não são desprezíveis, bem como o alto custo das cir...

  8. A new family of insect tyramine receptors

    DEFF Research Database (Denmark)

    Cazzamali, Giuseppe; Klærke, Dan Arne; Grimmelikhuijzen, Cornelis J P

    2005-01-01

    in the genomic databases from the malaria mosquito Anopheles gambiae and the honeybee Apis mellifera. These four tyramine or tyramine-like receptors constitute a new receptor family that is phylogenetically distinct from the previously identified insect octopamine/tyramine receptors. The Drosophila tyramine...... receptor is, to our knowledge, the first cloned insect G protein-coupled receptor that appears to be fully specific for tyramine....

  9. Toll-like receptors in neonatal sepsis.

    LENUS (Irish Health Repository)

    O'Hare, Fiona M

    2013-06-01

    Toll-like receptors are vital transmembrane receptors that initiate the innate immune response to many micro-organisms. The discovery of these receptors has improved our understanding of host-pathogen interactions, and these receptors play an important role in the pathogenesis of multiple neonatal conditions such as sepsis and brain injury. Toll-like receptors, especially TLRs 2 and 4, are associated with necrotizing enterocolitis, periventricular leukomalacia and sepsis.

  10. Modelagem da Lagoa da Pampulha: uma ferramenta para avaliar o impacto da bacia hidrográfica na dinâmica do fitoplâncton

    Directory of Open Access Journals (Sweden)

    Talita Fernanda das Graças Silva

    2016-03-01

    Full Text Available RESUMO No processo de urbanização, o aumento na proporção de superfícies impermeabilizadas e as mudanças no uso do solo são responsáveis por maiores volumes e velocidades do escoamento superficial, refletindo em uma maior capacidade de arraste e em um maior aporte de nutrientes nos corpos d'água receptores. O objetivo deste trabalho foi implementar uma ferramenta matemática capaz de reproduzir o impacto de mudanças na bacia hidrográfica sobre a dinâmica do fitoplâncton em um lago urbano. Neste artigo são apresentados o desenvolvimento e os resultados de um modelo integrado constituído de um modelo hidrológico, para simular vazões escoadas em uma bacia hidrográfica, e de um modelo hidrodinâmico e ecológico, para simular a biomassa fitoplanctônica em um corpo d'água urbano. A Lagoa da Pampulha (Belo Horizonte, Minas Gerais, escolhida como estudo de caso, foi intensamente monitorada, assim como sua bacia de drenagem, entre outubro de 2011 e junho de 2013. Os dados obtidos foram utilizados para calibrar e validar ambos os modelos. Os resultados obtidos com o modelo hidrológico mostraram-se coerentes com as medidas realizadas em campo (o coeficiente de Nash variou entre 0,70 e 0,88. O modelo da lagoa representou corretamente a evolução da comunidade fitoplanctônica (erro médio absoluto normalizado: 0,25-0,42 e o coeficiente de Pearson: 0,82-0,89; p<0,0001. O monitoramento e a modelagem da lagoa mostraram que a proliferação de cianobactérias é bastante perturbada pelas desestratificações térmicas que ocorrem na lagoa em virtude de eventos meteorológicos. A ferramenta de simulação desenvolvida possui potencial para avaliar diferentes cenários de mudança das condições climáticas e das características da bacia, podendo auxiliar na gestão dos corpos d'água situados em meio urbano.

  11. A identidade à flor da pele: etnografia da prática da tatuagem na contemporaneidade

    Directory of Open Access Journals (Sweden)

    Andrea Lissett Pérez

    2006-04-01

    Full Text Available No presente artigo, realiza-se uma descrição etnográfica da prática da tatuagem na contemporaneidade, a partir de uma perspectiva que prioriza as noções da prática, das interações e das experiências vividas durante o processo de ser tatuado. A reflexão tenta reconstruir uma visão total da prática da tatuagem que abrange o mundo subjetivo e as dinâmicas sociais como partes constitutivas desse ato. Entre as idéias conclusivas estão, de um lado, o surgimento de uma nova normalidade estética e vivencial no seio da sociedade ocidental e, de outro, a configuração de uma nova subjetividade, a dos "tatuados", como um processo interativo, inovador, emotivo e reflexivo, em que o corpo se converte em uma forma de expressão e construção do sujeito.This article provides a descriptive account of contemporary tattooing, based on a perspective that prioritizes the notion of practice, as well as the interactions and experiences involved in the process of being tattooed. The analysis attempts to rebuild a holistic view of tattooing, combining subjective processes and social dynamics as equally constitutive parts of this activity. Among the conclusions reached are: (a the emergence of tattooing as a new aesthetic norm and a lived experience at the heart of the western society; and (b the configuration of a new subjectivity, the ‘tattooed,’ as an interactive, innovative, emotional and reflexive process in which the body is converted into a form of expressing and constructing the subject.

  12. Phenobarbital and Insulin Reciprocate Activation of the Nuclear Receptor Constitutive Androstane Receptor through the Insulin Receptor.

    Science.gov (United States)

    Yasujima, Tomoya; Saito, Kosuke; Moore, Rick; Negishi, Masahiko

    2016-05-01

    Phenobarbital (PB) antagonized insulin to inactivate the insulin receptor and attenuated the insulin receptor downstream protein kinase B (AKT)-forkhead box protein O1 and extracellular signal-regulated kinase 1/2 signals in mouse primary hepatocytes and HepG2 cells. Hepatic AKT began dephosphorylation in an early stage of PB treatment, and blood glucose levels transiently increased in both wild-type and constitutive androstane receptor (CAR) knockout (KO) mice. On the other hand, blood glucose levels increased in wild-type mice, but not KO mice, in later stages of PB treatment. As a result, PB, acting as an insulin receptor antagonist, elicited CAR-independent increases and CAR-dependent decreases of blood glucose levels at these different stages of treatment, respectively. Reciprocally, insulin activation of the insulin receptor repressed CAR activation and induction of its target CYP2B6 gene in HepG2 cells. Thus, PB and insulin cross-talk through the insulin receptor to regulate glucose and drug metabolism reciprocally. Copyright © 2016 by U.S. Government work not protected by U.S. copyright.

  13. Characterization of a single-chain T-cell receptor expressed in Escherichia coli.

    Science.gov (United States)

    Hoo, W F; Lacy, M J; Denzin, L K; Voss, E W; Hardman, K D; Kranz, D M

    1992-05-15

    Despite progress in defining the nature of major histocompatibility complex products that are recognized by the T-cell antigen receptor, the binding properties and structure of the receptor have not been solved. The primary problem has been the difficulty in obtaining sufficient quantities of active receptor. In this report we show that a single-chain T-cell receptor gene can be expressed in Escherichia coli. The protein consists of the variable (V) regions of the alpha and beta chains (V alpha and V beta) encoded by the cytotoxic T-lymphocyte clone 2C (a H-2b anti-H-2d alloreactive cell line) linked by a 25-amino acid flexible peptide. Solubilized extracts that contain the 27-kDa V alpha 3V beta 8 protein are positive in solid-phase immunoassays with the anti-V beta 8 antibody KJ16 and the anti-clonotypic antibody 1B2. Approximately 1% of the protein can be specifically purified on a 1B2-conjugated column. These results indicate that a fraction of the protein is able to fold into a native conformation and that single-chain proteins should be useful not only as immunogens for eliciting anti-T-cell receptor antibodies but in the study of T-cell receptor structure and function.

  14. O panorama das Drogas no México: da margem da sociedade ao centro da cultura

    OpenAIRE

    Diana Palaversich

    2013-01-01

    O artigo destaca o percurso das manifestações culturais ligadas ao tráfico de drogas no México, de um lugar marginal, de subcultura, na sociedade mexicana das décadas de 1970 e 1980, expressas principalmente através dos narcocorridos e do narcocine, para um lugar no mainstream cultural mexicano, desde o início do século 21, com destaque especial para a narcoliteratura. O aumento da violência, provocado pela guerra ao narcotráfico, produz uma proliferação da temática nos meios de comunicação e...

  15. TEMPERATURA CORPORAL: PLANEJAMENTO DA ASSISTÊNCIA DE ENFERMAGEM NA VERIFICAÇÃO DA TEMPERATURA; NO ATENDIMENTO DA FEBRE E DA HIPERTERMIA MALIGNA

    Directory of Open Access Journals (Sweden)

    Thelma Leite de Araújo

    Full Text Available O presente estudo aborda o planejamento da assistência de enfermagem na verificação da temperatura, na escolha do instrumento de medida; no atendimento ao paciente com febre e com hipertermia maligna.

  16. Leonardo da Vinci and the Downburst.

    Science.gov (United States)

    Gedzelman, Stanley David

    1990-05-01

    Evidence from the drawings, experiments, and writings of Leonardo da Vinci are presented to demonstrate that da Vinci recognized and, possibly, discovered the downburst and understood its associated airflow. Other early references to vortex flows resembling downbursts are mentioned.

  17. TEMPERATURA CORPORAL: PLANEJAMENTO DA ASSISTÊNCIA DE ENFERMAGEM NA VERIFICAÇÃO DA TEMPERATURA; NO ATENDIMENTO DA FEBRE E DA HIPERTERMIA MALIGNA

    OpenAIRE

    Thelma Leite de Araújo; Ana Cristina Mancussi e Faro; María Teresa Cicero Laganá

    1992-01-01

    O presente estudo aborda o planejamento da assistência de enfermagem na verificação da temperatura, na escolha do instrumento de medida; no atendimento ao paciente com febre e com hipertermia maligna.

  18. Tratamento da dor em queimados

    Directory of Open Access Journals (Sweden)

    Rodrigo José Alencar de Castro

    2013-02-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Apesar dos avanços, ainda é observado manejo analgésico inadequado dos pacientes com queimaduras. O objetivo desta revisão foi coletar dados sobre tratamento da dor em queimados. CONTEÚDO: Foi feita revisão sobre os mecanismos de dor, avaliação do paciente com queimadura e o tratamento farmacológico e não farmacológico. CONCLUSÕES: O manejo da dor em pacientes vítimas de queimaduras ainda é um desafio por parte da equipe multiprofissional. A avaliação frequente e contínua da resposta apresentada pelo paciente é muito importante, tendo em vista os vários momentos por que passa o paciente internado em decorrência de uma queimadura, além de uma terapêutica combinada com medicações analgésicas e medidas não farmacológicas. Entender a complexidade de alterações fisiopatológicas, psicológicas e bioquímicas apresentadas por um paciente em tratamento de queimadura é o primeiro passo para alcançar o sucesso no seu manejo analgésico.

  19. Mulheres da Norô

    Directory of Open Access Journals (Sweden)

    Flavia Liberman

    Full Text Available O projeto Cartografias femininas: ações territoriais junto às mulheres da região noroeste de Santos realiza diferentes ações em uma região que apresenta vulnerabilidade social e ambiental na cidade de Santos. Envolvendo docentes e estudantes de diferentes cursos de graduação da área da saúde da Universidade Federal de São Paulo, campus Baixada Santista, teve como resultado uma Exposição Fotográfica itinerante cujas imagens explicitam um processo de construção de vínculos com as participantes. A fotógrafa Nice Gonçalvez, do Instituto Arte no Dique, acompanhou e fotografou momentos desta experiência, oferecendo-nos um material delicado que retrata seus rostos, corpos, detalhes e expressividades. Esta exposição ofereceu, às mulheres, uma oportunidade de reconhecerem-se como protagonistas ativas e fortes em todo o processo, tornando-as visíveis para além das fronteiras de suas casas, de seu bairro ou, mesmo, de sua região.

  20. Proteinase-activated receptors (PARs) – focus on receptor-receptor-interactions and their physiological and pathophysiological impact

    Science.gov (United States)

    2013-01-01

    Proteinase-activated receptors (PARs) are a subfamily of G protein-coupled receptors (GPCRs) with four members, PAR1, PAR2, PAR3 and PAR4, playing critical functions in hemostasis, thrombosis, embryonic development, wound healing, inflammation and cancer progression. PARs are characterized by a unique activation mechanism involving receptor cleavage by different proteinases at specific sites within the extracellular amino-terminus and the exposure of amino-terminal “tethered ligand“ domains that bind to and activate the cleaved receptors. After activation, the PAR family members are able to stimulate complex intracellular signalling networks via classical G protein-mediated pathways and beta-arrestin signalling. In addition, different receptor crosstalk mechanisms critically contribute to a high diversity of PAR signal transduction and receptor-trafficking processes that result in multiple physiological effects. In this review, we summarize current information about PAR-initiated physical and functional receptor interactions and their physiological and pathological roles. We focus especially on PAR homo- and heterodimerization, transactivation of receptor tyrosine kinases (RTKs) and receptor serine/threonine kinases (RSTKs), communication with other GPCRs, toll-like receptors and NOD-like receptors, ion channel receptors, and on PAR association with cargo receptors. In addition, we discuss the suitability of these receptor interaction mechanisms as targets for modulating PAR signalling in disease. PMID:24215724

  1. A LINGUAGEM TÉCNICA DA ECONOMIA

    Directory of Open Access Journals (Sweden)

    Tânia Pitombo de Oliveira

    2011-07-01

    Full Text Available Monografia de linguística que trata da linguagem de jornal dentro da área econômica. Focaliza essencialmente o léxico da linguagem técnica desta área de interesse, de um artigo de jornal. Elaborada para a disciplina de Linguística V, Departamento de Letras, Centro de Ciências Humanas, Letras e Artes da Universidade Estadual de Maringá, em 1985.

  2. A Reforma Da Previdência

    OpenAIRE

    Wilson Cano

    2015-01-01

    Mesa Redonda Assistência e Previdência: Caminhos e tendências no XX Ciclo de Debates do Serviço Social do Hospital das Clínicas da UNICAMP. Expositores: Professor Dr. Wilson Cano do Instituto de Economia da UNICAMP e Professora Dra. Maria Carmelita YazbeK Coordenadora da Pós-Graduação em Serviço Social da PUC São Paulo.

  3. Mutation G805R in the transmembrane domain of the LDL receptor gene causes familial hypercholesterolemia by inducing ectodomain cleavage of the LDL receptor in the endoplasmic reticulum

    Directory of Open Access Journals (Sweden)

    Thea Bismo Strøm

    2014-01-01

    Full Text Available More than 1700 mutations in the low density lipoprotein receptor (LDLR gene have been found to cause familial hypercholesterolemia (FH. These are commonly divided into five classes based upon their effects on the structure and function of the LDLR. However, little is known about the mechanism by which mutations in the transmembrane domain of the LDLR gene cause FH. We have studied how the transmembrane mutation G805R affects the function of the LDLR. Based upon Western blot analyses of transfected HepG2 cells, mutation G805R reduced the amounts of the 120 kDa precursor LDLR in the endoplasmic reticulum. This led to reduced amounts of the mature 160 kDa LDLR at the cell surface. However, significant amounts of a secreted 140 kDa G805R-LDLR ectodomain fragment was observed in the culture media. Treatment of the cells with the metalloproteinase inhibitor batimastat largely restored the amounts of the 120 and 160 kDa forms in cell lysates, and prevented secretion of the 140 kDa ectodomain fragment. Together, these data indicate that a metalloproteinase cleaved the ectodomain of the 120 kDa precursor G805R-LDLR in the endoplasmic reticulum. It was the presence of the polar Arg805 and not the lack of Gly805 which led to ectodomain cleavage. Arg805 also prevented γ-secretase cleavage within the transmembrane domain. It is conceivable that introducing a charged residue within the hydrophobic membrane lipid bilayer, results in less efficient incorporation of the 120 kDa G805R-LDLR in the endoplasmic reticulum membrane and makes it a substrate for metalloproteinase cleavage.

  4. Utilidad del Test de Liberación de Histamina en el Diagnóstico y Control Evolutivo de la Alergia Alimentaria en Niños.

    OpenAIRE

    Guisado Rasco, María Cinta

    2017-01-01

    La alergia alimentaria, como hemos comentado en la Introducción al tema, ha sido un problema infravalorado en la infancia, tanto por la diversidad de los alimentos implicados en ella, como por la variedad de su sintomatología clínica y la complejidad de las pruebas de laboratorio existentes, ya que por sí misma ninguna de ellas son diagnósticas de esta patología. Destacamos también la importancia de identificar a los niños con riesgo...

  5. ESTATUTO PARADOXAL DA PELE E CULTURA CONTEMPORÂNEA: da porosidade à pele-teflon

    National Research Council Canada - National Science Library

    Maria Cristina Franco Ferraz

    2014-01-01

    ... das superfícies e a um horror por oposições dicotômicas. Possibilta avaliar as implicações do fechamento da porosidade da pele em formas de sociabilidade estimuladas na cultura da imagem, da exibição...

  6. Sonhos atrás da porta

    Directory of Open Access Journals (Sweden)

    Tatiana Ramminger

    Full Text Available Este artigo é inspirado nas aulas do mestrado de Psicologia Social e Institucional da UFCRS. A partir da autobiografia de L.F. Barros - "Memórias do Delírio - Confissões de um Esquizofrênico", permito-me uma releitura da psicopatologia, à luz de dois "loucos" pensadores: Foucault e Nietzsche.

  7. Historicidade da filosofia em Hegel e Heidegger

    Directory of Open Access Journals (Sweden)

    Christian Iber

    2017-02-01

    Full Text Available Gostaria de discutir, em forma de teses, a temática da historicidade da filosofia em contraste e na sua divergência em Hegel e Heidegger. Diferente do historicismo, que não soluciona o problema da historicidade da filosofia, porque ele dissolve tendencialmente a filosofia na história da filosofia e não coloca em especial a questão da verdade, Hegel e Heidegger desenvolvem uma teoria genuinamente filosófica da história da filosofia do interesse filosófico pela verdade. Esse interesse genuinamente filosófico pela verdade segue do seu conceito respectivo de filosofia, que inclui em ambos uma posição crítica à Modernidade. Ambos os pensadores não são apenas pensadores modernos, mas também pensadores críticos da Modernidade, de uma Modernidade que entrou no estado de uma autorreflexão. Em Hegel e Heidegger, a filosofia da história da filosofia é ao mesmo tempo a chave para uma filosofia crítica de Modernidade da história.

  8. Purinergic Receptors in Ocular Inflammation

    Directory of Open Access Journals (Sweden)

    Ana Guzman-Aranguez

    2014-01-01

    Full Text Available Inflammation is a complex process that implies the interaction between cells and molecular mediators, which, when not properly “tuned,” can lead to disease. When inflammation affects the eye, it can produce severe disorders affecting the superficial and internal parts of the visual organ. The nucleoside adenosine and nucleotides including adenine mononucleotides like ADP and ATP and dinucleotides such as P1,P4-diadenosine tetraphosphate (Ap4A, and P1,P5-diadenosine pentaphosphate (Ap5A are present in different ocular locations and therefore they may contribute/modulate inflammatory processes. Adenosine receptors, in particular A2A adenosine receptors, present anti-inflammatory action in acute and chronic retinal inflammation. Regarding the A3 receptor, selective agonists like N6-(3-iodobenzyl-5′-N-methylcarboxamidoadenosine (CF101 have been used for the treatment of inflammatory ophthalmic diseases such as dry eye and uveoretinitis. Sideways, diverse stimuli (sensory stimulation, large intraocular pressure increases can produce a release of ATP from ocular sensory innervation or after injury to ocular tissues. Then, ATP will activate purinergic P2 receptors present in sensory nerve endings, the iris, the ciliary body, or other tissues surrounding the anterior chamber of the eye to produce uveitis/endophthalmitis. In summary, adenosine and nucleotides can activate receptors in ocular structures susceptible to suffer from inflammatory processes. This involvement suggests the possible use of purinergic agonists and antagonists as therapeutic targets for ocular inflammation.

  9. Drug-driven AMPA receptor redistribution mimicked by selective dopamine neuron stimulation.

    Directory of Open Access Journals (Sweden)

    Matthew T C Brown

    2010-12-01

    Full Text Available Addictive drugs have in common that they cause surges in dopamine (DA concentration in the mesolimbic reward system and elicit synaptic plasticity in DA neurons of the ventral tegmental area (VTA. Cocaine for example drives insertion of GluA2-lacking AMPA receptors (AMPARs at glutamatergic synapes in DA neurons. However it remains elusive which molecular target of cocaine drives such AMPAR redistribution and whether other addictive drugs (morphine and nicotine cause similar changes through their effects on the mesolimbic DA system.We used in vitro electrophysiological techniques in wild-type and transgenic mice to observe the modulation of excitatory inputs onto DA neurons by addictive drugs. To observe AMPAR redistribution, post-embedding immunohistochemistry for GluA2 AMPAR subunit was combined with electron microscopy. We also used a double-floxed AAV virus expressing channelrhodopsin together with a DAT Cre mouse line to selectively express ChR2 in VTA DA neurons. We find that in mice where the effect of cocaine on the dopamine transporter (DAT is specifically blocked, AMPAR redistribution was absent following administration of the drug. Furthermore, addictive drugs known to increase dopamine levels cause a similar AMPAR redistribution. Finally, activating DA VTA neurons optogenetically is sufficient to drive insertion of GluA2-lacking AMPARs, mimicking the changes observed after a single injection of morphine, nicotine or cocaine.We propose the mesolimbic dopamine system as a point of convergence at which addictive drugs can alter neural circuits. We also show that direct activation of DA neurons is sufficient to drive AMPAR redistribution, which may be a mechanism associated with early steps of non-substance related addictions.

  10. Drug-driven AMPA receptor redistribution mimicked by selective dopamine neuron stimulation.

    Science.gov (United States)

    Brown, Matthew T C; Bellone, Camilla; Mameli, Manuel; Labouèbe, Gwenael; Bocklisch, Christina; Balland, Bénédicte; Dahan, Lionel; Luján, Rafael; Deisseroth, Karl; Lüscher, Christian

    2010-12-31

    Addictive drugs have in common that they cause surges in dopamine (DA) concentration in the mesolimbic reward system and elicit synaptic plasticity in DA neurons of the ventral tegmental area (VTA). Cocaine for example drives insertion of GluA2-lacking AMPA receptors (AMPARs) at glutamatergic synapes in DA neurons. However it remains elusive which molecular target of cocaine drives such AMPAR redistribution and whether other addictive drugs (morphine and nicotine) cause similar changes through their effects on the mesolimbic DA system. We used in vitro electrophysiological techniques in wild-type and transgenic mice to observe the modulation of excitatory inputs onto DA neurons by addictive drugs. To observe AMPAR redistribution, post-embedding immunohistochemistry for GluA2 AMPAR subunit was combined with electron microscopy. We also used a double-floxed AAV virus expressing channelrhodopsin together with a DAT Cre mouse line to selectively express ChR2 in VTA DA neurons. We find that in mice where the effect of cocaine on the dopamine transporter (DAT) is specifically blocked, AMPAR redistribution was absent following administration of the drug. Furthermore, addictive drugs known to increase dopamine levels cause a similar AMPAR redistribution. Finally, activating DA VTA neurons optogenetically is sufficient to drive insertion of GluA2-lacking AMPARs, mimicking the changes observed after a single injection of morphine, nicotine or cocaine. We propose the mesolimbic dopamine system as a point of convergence at which addictive drugs can alter neural circuits. We also show that direct activation of DA neurons is sufficient to drive AMPAR redistribution, which may be a mechanism associated with early steps of non-substance related addictions.

  11. Early-Life Social Isolation Stress Increases Kappa Opioid Receptor Responsiveness and Downregulates the Dopamine System.

    Science.gov (United States)

    Karkhanis, Anushree N; Rose, Jamie H; Weiner, Jeffrey L; Jones, Sara R

    2016-08-01

    Chronic early-life stress increases vulnerability to alcoholism and anxiety disorders during adulthood. Similarly, rats reared in social isolation (SI) during adolescence exhibit augmented ethanol intake and anxiety-like behaviors compared with group housed (GH) rats. Prior studies suggest that disruption of dopamine (DA) signaling contributes to SI-associated behaviors, although the mechanisms underlying these alterations are not fully understood. Kappa opioid receptors (KORs) have an important role in regulating mesolimbic DA signaling, and other kinds of stressors have been shown to augment KOR function. Therefore, we tested the hypothesis that SI-induced increases in KOR function contribute to the dysregulation of NAc DA and the escalation in ethanol intake associated with SI. Our ex vivo voltammetry experiments showed that the inhibitory effects of the kappa agonist U50,488 on DA release were significantly enhanced in the NAc core and shell of SI rats. Dynorphin levels in NAc tissue were observed to be lower in SI rats. Microdialysis in freely moving rats revealed that SI was also associated with reduced baseline DA levels, and pretreatment with the KOR antagonist nor-binaltorphimine (nor-BNI) increased DA levels selectively in SI subjects. Acute ethanol elevated DA in SI and GH rats and nor-BNI pretreatment augmented this effect in SI subjects, while having no effect on ethanol-stimulated DA release in GH rats. Together, these data suggest that KORs may have increased responsiveness following SI, which could lead to hypodopaminergia and contribute to an increased drive to consume ethanol. Indeed, SI rats exhibited greater ethanol intake and preference and KOR blockade selectively attenuated ethanol intake in SI rats. Collectively, the findings that nor-BNI reversed SI-mediated hypodopaminergic state and escalated ethanol intake suggest that KOR antagonists may represent a promising therapeutic strategy for the treatment of alcohol use disorders, particularly

  12. Chemogenomics Knowledgebased Polypharmacology Analyses of Drug Abuse Related G-Protein Coupled Receptors and Their Ligands

    Directory of Open Access Journals (Sweden)

    Xiang-Qun eXie

    2014-02-01

    Full Text Available Drug abuse (DA and addiction is a complex illness, broadly viewed as a neurobiological impairment with genetic and environmental factors that influence its development and manifestation. Abused substances can disrupt the activity of neurons by interacting with many proteins, particularly G-protein coupled receptors (GPCRs. A few medicines that target the central nervous system (CNS can also modulate DA related proteins, such as GPCRs, which can act in conjunction with the controlled psychoactive substance(s and increase side effects. To fully explore the molecular interaction networks that underlie DA and to effectively modulate the GPCRs in these networks with small molecules for DA treatment, we built a drug-abuse domain specific chemogenomics knowledgebase (DA-KB to centralize the reported chemogenomics research information related to DA and CNS disorders in an effort to benefit researchers across a broad range of disciplines. We then focus on the analysis of GPCRs as many of them are closely related with drug abuse. Their distribution in human tissues was also analyzed for the study of side effects caused by abused drugs. We further implement our computational algorithms/tools to explore DA targets, DA mechanisms and pathways involved in polydrug addiction and to explore polypharmacological effects of the GPCR ligands. Finally, the polypharmacology effects of GPCR-targeted medicines for drug abuse treatment were investigated and such effects can be exploited for the development of drugs with polypharmacophore for drug abuse intervention. The chemogenomics database and the analysis tools will help us better understand the mechanism of drugs abuse and facilitate to design new medications for system pharmacotherapy of drug abuse.

  13. Fases da história da fotografia e a questão da aura, segundo Walter Benjamin

    Directory of Open Access Journals (Sweden)

    Orlando José Ribeiro de Oliveira

    2014-07-01

    Full Text Available Este artigo aborda as fases da história da fotografia propostas por Walter Benjamin, no ensaio Pequena História da Fotografia, e discute as transformações que atingiram a obra de arte na modernidade, à luz do conceito de aura. A periodização estabelecida por Benjamin - apogeu, declínio, revitalização - é ilustrada com trabalhos dos fotógrafos referidos pelo autor no texto em que visa à “compreensão real da essência da arte fotográfica”.

  14. História da fisioterapia em Portugal: da origem a 1966

    OpenAIRE

    Fonseca, João Pedro da

    2012-01-01

    Mestrado em Fisioterapia. Em 1851, Gleich usa pela primeira vez o termo de Fisioterapia. Surge num momento em que a arte de curar o campo médico, procurava corresponder à necessidade que a sociedade tinha de cuidados de saúde mais eficazes. A área médica procurou a exclusividade da ginástica, da aplicação da mecanoterapia, da electroterapia, da massagem e da hidroterapia. O termo Fisioterapeuta surge em Portugal em 1918 e Serviço de Fisioterapia em 1917 num Instituto da Casa Pia de Lisboa ...

  15. A receptor for infectious and cellular prion protein

    Directory of Open Access Journals (Sweden)

    V.R. Martins

    1999-07-01

    Full Text Available Prions are an unconventional form of infectious agents composed only of protein and involved in transmissible spongiform encephalopathies in humans and animals. The infectious particle is composed by PrPsc which is an isoform of a normal cellular glycosyl-phosphatidylinositol (GPI anchored protein, PrPc, of unknown function. The two proteins differ only in conformation, PrPc is composed of 40% a helix while PrPsc has 60% ß-sheet and 20% a helix structure. The infection mechanism is trigged by interaction of PrPsc with cellular prion protein causing conversion of the latter's conformation. Therefore, the infection spreads because new PrPsc molecules are generated exponentially from the normal PrPc. The accumulation of insoluble PrPsc is probably one of the events that lead to neuronal death. Conflicting data in the literature showed that PrPc internalization is mediated either by clathrin-coated pits or by caveolae-like membranous domains. However, both pathways seem to require a third protein (a receptor or a prion-binding protein either to make the connection between the GPI-anchored molecule to clathrin or to convert PrPc into PrPsc. We have recently characterized a 66-kDa membrane receptor which binds PrPc in vitro and in vivo and mediates the neurotoxicity of a human prion peptide. Therefore, the receptor should have a role in the pathogenesis of prion-related diseases and in the normal cellular process. Further work is necessary to clarify the events triggered by the association of PrPc/PrPsc with the receptor.

  16. Da ordem. Da cidade. Da literatura: personagens à beira do "ruim do mundo"

    Directory of Open Access Journals (Sweden)

    Eliana Kuster

    2007-12-01

    Full Text Available As grandes cidades estão doentes. Seus sintomas: a quebra da sociabilidade e a irrupção rotineira da violência. Diante disso, ecoa na sociedade um clamor por ordem. No mesmo momento em que a polícia põe a tropa na rua, os literatos criam personagens que dão voz à sensação crescente de que a cidade está deixando de ser uma referência à constituição das identidades urbanas. É a partir da literatura, em especial da obra do escritor Rubem Fonseca, que iremos perscrutar as possibilidades apresentadas pela cidade para o convívio humano.The great cities are sick. Its indications: the sociability in addition and the routine irruption of the violence. Ahead of this, a outcry for order echoes in the society. At the same moment where the policy goes to the street, the writers create personages who give voice to the increasing sensation of that the city is leaving of being a reference to the constitution of the urban identities. It is from literature, in special of the writer Rubem Fonseca, that we will go to investigate the possibilities presented for the city for the human conviviality.

  17. Uterine epithelial morphology and progesterone receptors in a mifepristone-treated viviparous lizard Pseudemoia entrecasteauxii (Squamata: Scincidae) during gestation.

    Science.gov (United States)

    Biazik, Joanna M; Parker, Scott L; Murphy, Christopher R; Thompson, Michael B

    2012-03-01

    Structural and functional changes to the uterus associated with maintenance of pregnancy are controlled primarily by steroid hormones such as progesterone. We tested the hypothesis that progesterone regulates uterine structural changes during pregnancy in the viviparous skink, Pseudemoia entrecasteauxii, by treating pregnant females with the progesterone receptor antagonist mifepristone at different stages of pregnancy. Expression and distribution of progesterone receptor was determined using Western blot and immunohistochemistry. During early pregnancy, mifepristone treatment resulted in altered uterine epithelial cell surface morphology and high embryo mortality, but did not affect females at mid and late stages of pregnancy. Females treated with mifepristone in early pregnancy exhibited abnormal uterine epithelial cell morphology such as lateral blebbing and presence of wide gaps between cells indicating loss of intercellular attachment. Chorioallantoic membranes of the embryo were not affected by mifepristone treatment. Two isoforms (55 kDa and 100 kDa) of progesterone receptor were identified using immunoblots and both isoforms were localized to the nucleus of uterine epithelial cells. The 55 kDa isoform was expressed throughout pregnancy, whereas the 100 kDa isoform was expressed during mid and especially late pregnancy. In P. entrecasteauxii, mifepristone may prevent successful embryo attachment in early pregnancy through its effects on uterine epithelial cells but may have little effect on pregnancy once the maternal-embryo structural relationship is established. © 2011 WILEY PERIODICALS, INC.

  18. Estudo de tochas de plasma atraves da teoria da similaridade

    OpenAIRE

    Pablo Jenner Paredez Angeles

    2003-01-01

    Resumo: Nesta tese foram obtidas equações generalizadas para a característica tensão-corrente de umatocha de plasma de arco não transferido e de uma tocha de plasma de arco transferido, utilizando o método da Teoria da Similaridade. Para a tocha de arco não transferido, os dados experimentais foram obtidos para ar como gás plasmagênico e na faixa de correntes de 10 a 295 A. Para a tocha de arco transferido, os dados foram obtidos para argônio e faixa de correntes de 300 a 1500 A. A tocha de a...

  19. Uso da fluoxetina no tratamento da tricotilomania felina

    Directory of Open Access Journals (Sweden)

    Sousa Marlos Gonçalves

    2004-01-01

    Full Text Available A tricotilomania ou alopecia psicogênica felina é uma dermatopatia de origem psicogênica, decorrente da lambedura compulsiva do pelame, realizada pelo gato em situações de estresse. Tal distúrbio decorre de alterações neuro-hormonais e pode associar-se à introdução de novos animais e/ou crianças no ambiente. Além de mudanças de manejo e atitude para com o animal, sugere-se o emprego de ansiolíticos no tratamento da doença. A fluoxetina foi utilizada no tratamento de cinco gatos domésticos com tricotilomania, apresentando inibição do comportamento de lambedura, com repilação após dois a três meses de terapia.

  20. Contribution of non-genetic factors to dopamine and serotonin receptor availability in the adult human brain

    DEFF Research Database (Denmark)

    Borg, J; Cervenka, S; Kuja-Halkola, R

    2016-01-01

    the regulation of receptor and transporter density levels. This lack of knowledge obscures interpretation of differences in protein availability reported in psychiatric patients. In this study, we used positron emission tomography (PET) in a twin design to estimate the relative contribution of genetic...... receptor. Heritability, shared environmental effects and individual-specific non-shared effects were estimated for regional D2/3 and 5-HT1A receptor availability in projection areas. We found a major contribution of genetic factors (0.67) on individual variability in striatal D2/3 receptor binding......The dopamine (DA) and serotonin (5-HT) neurotransmission systems are of fundamental importance for normal brain function and serve as targets for treatment of major neuropsychiatric disorders. Despite central interest for these neurotransmission systems in psychiatry research, little is known about...

  1. Interaction of purified bovine brain A1-adenosine receptors with guanine nucleotide-binding proteins of human platelet membranes following reconstitution.

    Science.gov (United States)

    Munshi, R; Linden, J

    1990-08-01

    A1-adenosine receptors and associated guanine nucleotide-binding proteins (G proteins) have been co-purified from bovine cerebral cortex by agonist affinity chromatography [J. Biol. Chem. 264:14853-14859 (1989)]. In this study we have reconstituted purified bovine brain A1 receptors into human platelet membranes that contain A2- but no detectable A1-adenosine receptors. The recovery of reconstituted receptors was assessed from the binding of the antagonist radioligand [125I]3-(4-amino-3-iodo)phenethyl-1-propyl-8-cyclopentyl-xanthine and ranged from 32 to 84%. Coupling of reconstituted A1 receptors to platelet G proteins was evaluated by measurement of the high affinity binding of an agonist radioligand, 125I-aminobenzyladenosine, to receptor-G protein complexes and by stereospecific photoaffinity labeling of a 35,000-Da receptor polypeptide with the agonist photoaffinity label 125I-azidobenzyladenosine. Fifty percent of receptors reconstituted into platelet membranes bound agonists with high affinity, indicative of coupling to platelet G proteins. Reconstituted A1 receptors bound various ligands with affinities characteristic of A1 receptors of bovine brain. Although platelets contain both pertussis toxin-sensitive and -insensitive G proteins, reconstituted high affinity agonist binding was almost completely abolished by treatment of platelet membranes with guanosine 5'-3-O-(thio)triphosphate, pertussis toxin, N-ethylmaleimide, or heparin. Following reconstitution, A1 receptors could be resolubilized in complexes with platelet G proteins. The data suggest that marked species differences in the binding affinity of ligands to adenosine receptors result from differences in the receptors rather than membrane structure or G proteins and, further, that A1 receptors couple selectively and tightly to pertussis toxin-sensitive G proteins.

  2. O papel da geografia em face da crise ambiental

    Directory of Open Access Journals (Sweden)

    RAQUEL DEZIDÉRIO SOUTO

    Full Text Available resumo Diante da crise ambiental atual, diversas disciplinas científicas têm se voltado para sua análise, a fim de apontar soluções para dirimir ou minimizar os danos ambientais e sociais causados pelas atividades econômicas e por outros tipos de fatores de pressão ambiental. Este artigo propõe-se inicialmente a mostrar sucintamente como mudou a visão geográfica predominante no mundo ocidental a respeito da relação entre as populações humanas e o ambiente. Uma mudança de visão que foi reflexo das mudanças que estavam em curso na geografia como um todo, resguardadas as diferenças entre os países. Discute-se ainda que a crise ambiental é uma crise do conhecimento, como afirmam cada vez mais autores. Este texto culmina com as virtudes e limitações da geografia na busca desse entendimento, no intuito de colaborar para seu avançar.

  3. Newton da Costa e a Filosofia da Quase-Verdade

    Directory of Open Access Journals (Sweden)

    Décio Krause

    2009-08-01

    Full Text Available This paper intends to introduce the three issues of Principia which will appear in a sequel honoring Newton da Costa’s 80th birthday. Instead of presenting the papers one by one, as it is common in presentations such as this one, we have left the papers speak by themselves, and instead we have preferred to present to the Brazilian readers, specialty to our students, some aspects of Newton da Costa’s conception of science and of the scientific activity, grounded on the concept of quasi-truth, which he contributed to develop in a rigorous way. Da Costa is known as one of the founding fathers of paraconsistent logic, but his contributions go also to the foundations of physics, theoretical computation, model theory, algebraic logic, lattice theory, applications of non-classical logics to law and technology, etc. But perhaps his main contribution was to provide a basis for the birth of a school of logic in our country (Brazil, serving as teacher and inspiring new researchers for generations. It is a pleasure to have had so enthusiastic acceptation from the editors of Principia to organize these volumes. I would like to thank the contributors and the editors of Principia, specially Prof. Cezar Mortari for his help in organizing the issue.

  4. Síndrome da imobilidade no idoso

    OpenAIRE

    Quintela, José Miguel de Resende Franco

    2015-01-01

    Trabalho final de mestrado integrado em Medicina, apresentado à Faculdade de Medicina da Universidade de Coimbra. Introdução Neste artigo procurou-se rever de forma didática e elucidativa estudos realizados no âmbito da geriatria e assim promover um conhecimento mais aprofundado e sistemático da temática do síndrome da imobilidade no indivíduo idoso. O síndrome da imobilidade é então uma entidade cada vez mais presente na sociedade atual devido ao envelhecimento populacional verificado sob...

  5. Variabilidade da produtividade e da qualidade do café em três municípios da Zona da Mata Mineira

    OpenAIRE

    Cerqueira, Elder Sânzio Aguiar

    2008-01-01

    Objetivou-se com este trabalho analisar a variabilidade da produtividade e da qualidade da cafeicultura familiar da região de Viçosa. Para isso, foram caracterizadas áreas de pequena produção de café de montanha; levantou-se o perfil gerencial dos produtores das áreas selecionadas; desenvolveu-se um sistema de acompanhamento de atividades para pequenos produtores realizarem o manejo localizado; criou-se um sistema com base em técnicas de SIG para auxiliar o gerenciamento da cafeicultura famil...

  6. Industrialização da celebridade

    Directory of Open Access Journals (Sweden)

    Camila Barros

    2013-12-01

    Full Text Available Através de relatos descritivos acerca de personagens históricos, o texto percorre os 250 anos da história das celebridades. Entre o sociopolítico e a esfera do sentimento, a figura da celebridade nasce para uma identificação distante, que nos ensina como estar em sociedade. No decorrer dos capítulos, o autor demonstra como foi construída a “indústria da celebridade”, como a fama deslocou-se do renome para o glamour e como esses atores sociais contribuem para a manutenção da ordem social.

  7. Post-training dopamine receptor agonists and antagonists affect memory storage in mice irrespective of their selectivity for D1 or D2 receptors.

    Science.gov (United States)

    Castellano, C; Cestari, V; Cabib, S; Puglisi-Allegra, S

    1991-11-01

    Post-training administration of the selective D1 and D2 agonists SKF 38393 and LY 171555 dose-dependently facilitated retention of an inhibitory avoidance response in mice, while the selective D1 or D2 antagonists SCH 23390 and (-)sulpiride produced an impairment of retention. These effects are not to be ascribed to a nonspecific action of the drugs on retention performance, as the latencies during the retention test of those mice that had not received a footshock during the training were not increased by the post-training drug administration. The effects on retention performance induced by DA agonists and antagonists seem to be due to an effect on memory consolidation, since they have been observed when drugs were given at short, but not at long, periods of time after training. These results showing a similar role of D1 and D2 receptor types on memory storage appear not to be consistent with a body of neuropharmacological, neurophysiological, and behavioral evidence pointing to a different functional role of these types of DA receptors. This discrepancy is discussed in terms of possible involvement of different brain systems, peripheral systems, or possible second messenger processes activated by the two receptor types and leading to similar effects on memory processes.

  8. Down-regulation of BnDA1, whose gene locus is associated with the seeds weight, improves the seeds weight and organ size in Brassica napus.

    Science.gov (United States)

    Wang, Jie-Li; Tang, Min-Qiang; Chen, Sheng; Zheng, Xiang-Feng; Mo, Hui-Xian; Li, Sheng-Jun; Wang, Zheng; Zhu, Ke-Ming; Ding, Li-Na; Liu, Sheng-Yi; Li, Yun-Hai; Tan, Xiao-Li

    2017-08-01

    Brassica napus L. is an important oil crop worldwide and is the main raw material for biofuel. Seed weight and seed size are the main contributors to seed yield. DA1 (DA means big in Chinese) is an ubiquitin receptor and negatively regulates seed size. Down-regulation of AtDA1 in Arabidopsis leads to larger seeds and organs by increasing cell proliferation in integuments. In this study, BnDA1 was down-regulated in B. napus by over expressed of AtDA1R358K , which is a functional deficiency of DA1 with an arginine-to-lysine mutation at the 358th amino acid. The results showed that the biomass and size of the seeds, cotyledons, leaves, flowers and siliques of transgenic plants all increased significantly. In particular, the 1000 seed weight increased 21.23% and the seed yield per plant increased 13.22% in field condition. The transgenic plants had no negative traits related to yield. The candidate gene association analysis demonstrated that the BnDA1 locus was contributed to the seeds weight. Therefore, our study showed that regulation of DA1 in B. napus can increase the seed yield and biomass, and DA1 is a promising target for crop improvement. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

  9. Nuclear tristetraprolin acts as a corepressor of multiple steroid nuclear receptors in breast cancer cells

    Directory of Open Access Journals (Sweden)

    Tonatiuh Barrios-García

    2016-06-01

    Full Text Available Tristetraprolin (TTP is a 34-kDa, zinc finger-containing factor that in mammalian cells acts as a tumor suppressor protein through two different mechanisms. In the cytoplasm TTP promotes the decay of hundreds of mRNAs encoding cell factors involved in inflammation, tissue invasion, and metastasis. In the cell nucleus TTP has been identified as a transcriptional corepressor of the estrogen receptor alpha (ERα, which has been associated to the development and progression of the majority of breast cancer tumors. In this work we report that nuclear TTP modulates the transactivation activity of progesterone receptor (PR, glucocorticoid receptor (GR and androgen receptor (AR. In recent years these steroid nuclear receptors have been shown to be of clinical and therapeutical relevance in breast cancer. The functional association between TTP and steroid nuclear receptors is supported by the finding that TTP physically interacts with ERα, PR, GR and AR in vivo. We also show that TTP overexpression attenuates the transactivation of all the steroid nuclear receptors tested. In contrast, siRNA-mediated reduction of endogenous TTP expression in MCF-7 cells produced an increase in the transcriptional activities of ERα, PR, GR and AR. Taken together, these results suggest that the function of nuclear TTP in breast cancer cells is to act as a corepressor of ERα, PR, GR and AR. We propose that the reduction of TTP expression observed in different types of breast cancer tumors may contribute to the development of this disease by producing a dysregulation of the transactivation activity of multiple steroid nuclear receptors.

  10. Análise de incertezas e inversão conjunta para aprimoramento da modelagem crustal

    OpenAIRE

    Moreira, Lucas Paes

    2013-01-01

    O objetivo deste trabalho é apresentar duas novas metodologias para aprimorar a modelagem crustal usando inversão conjunta de múltiplos dados geofísicos. O primeiro método proposto é a análise das incertezas da inversão conjunta da função do receptor e dispersão de ondas superficiais. Inversões conjuntas destes dois grupos de dados estão se tornando populares devido à capacidade de reduzir a não-unicidade em modelos de velocidades de ondas sísmicas. No entanto, as incertezas dos modelos calib...

  11. Biossensores salivares: estado da arte

    OpenAIRE

    Cantiga, Filipa Alexandra Martins

    2015-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz Enquadramento: A análise do fluído salivar tem sido alvo de investigação nos últimos anos com o objetivo validar técnicas de identificação e doseamento de biomarcadores com valor de diagnóstico dado que a utilização da saliva para análises em detrimento do sangue traz vantagens claras. Objetivo: Esta monografia tem como objetivo reunir informação atual sobre a aplicação de biossensores salivar...

  12. Aspectos incomuns da paracoccidioidomicose infantil

    Directory of Open Access Journals (Sweden)

    Achiléa Lisboa Bittencourt

    1987-12-01

    Full Text Available São relatados dois casos de paracoccidioidomicose (PCM infantil. Em um deles, a principal manifestação da doença foi tumoração abdominal, simulando linfoma maligno não Hodgkin. O outro apresentou acentuado envolvimento articular, com ruptura da cápsula. Representam o segundo e terceiro casos de PCM infantil observados na Bahia, ambos procedentes de áreas urbanas.The authors present two cases of infantil para-coccidioidomycosis. In one case the main presentation was an abdominal mass that mimicked non- Hodgkin lymphoma. In the other case the child had a joint swelling with rupture of the capsule and the clinical diagnosis was piogenic arthritis. They represent the second and third cases of infantile paracoccidioidomycosis observed in the state of Bahia, all coming from urban areas.

  13. PARA UMA FENOMENOLOGIA DA JUVENTUDE

    Directory of Open Access Journals (Sweden)

    Frei Bernardino Leers

    2013-03-01

    Full Text Available Esta reflexão foi escrita por um homem idoso que para a delicadeza francesa é quase um homem da terceira idade, mas para os jovens é um velho. Por que é que tal homem se interessa pela juventude de hoje e quer pensar sobre esta juventude de que não faz parte e com cujos movimentos teve apenas alguns contatos?(1.

  14. Sobre uma teoria da expectativa

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Cagliari

    2016-08-01

    Full Text Available O presente trabalho apresenta como se pode ter uma teoria semântica cognitiva da ideia de expectativa encontrada no processo de comunicação linguística. Encontra-se essa ideia comumente em conversas, diálogos, em textos orais e literários, o que a caracteriza como um fato semântico de uso muito comum. Uma análise geral mostra que a ideia de expectativa é muito mais importante para os estudos semânticos e discursivos do que se costuma pensar. Uma análise mais profunda mostra que a linguagem precisa da ideia de expectativa como motivador seu uso. Desse modo, a expectativa está na base de todo processo de comunicação linguístico. As línguas dispõem de muitas palavras e expressões que introduzem uma expectativa na comunicação, como a própria palavra expectativa, expressões como eu acho que... e até estruturas sintática e prosódicas como uma pergunta. A expectativa pode estar na mente do falante ou na mente do ouvinte ou na mente de todas as pessoas envolvidas numa comunicação linguística. A expectativa pode ser também uma noção estabelecida formalmente através de regras ou de costumes na sociedade. A formulação de uma teoria da expectativa tornou-se mais viável com o desenvolvimento da semântica cognitiva nas últimas décadas. A noção de frame é, talvez, a que melhor explique a expectativa.Palavras-chave: Expectativa. Comunicação. Frame. Linguística Cognitiva.

  15. 1992: a redescoberta da Natureza

    Directory of Open Access Journals (Sweden)

    Milton Santos

    1992-04-01

    Full Text Available Com a presença do homem sobre a Terra, a natureza está, sempre, sendo redescoberta, com a criação da natureza social. É a história de uma rutura progressiva entre o homem e o entorno, acelerada pela mecanização. Mediante a tecnociência, a natureza artificializada alcança seu estágio supremo, onde a natureza e o homem tornam-se reciprocramente hostis. Com a globalização da economia, da política e da cultura, não há mais relações totalizantes entre a sociedade e o meio. A natureza tecnicizada se impõe como algo abstrato, exigindo um discurso. A questão do meio ambiente é um aspecto dessa evolução e reclama um estudo abrangente, para permitir uma correta interpretação. Para alcançar essa interpretação, a universidade deve fugir dos raciocínios técnicos e conformistas e enfrentar o entendimento do mundo como um todo.With man on Earth, Nature is being permanently rediscovered through the creation of social nature. The progressive rupture between man and his surrounding is quickened by mechanization. More recently, with globalization of economy, politics and culture, there are no longer totalizing relations between society and environment. Through technoscience, nature and man become reciprocally hostile. Tecnicized nature emerges as an abstraction that demands a discourse. Environmental problems are only an aspect of this evolution, and ask for a comprehensive approach, in order to reach its correct interpretation. University must fly away from technical and conformicist reasonning and face the understanding of the world as a whole.

  16. A travessia da escrita machadiana

    Directory of Open Access Journals (Sweden)

    Ruth Silviano Brandão

    2000-03-01

    Full Text Available A narração machadiana constrói-se de uma maneira tal que se pode falar de determinadas posições do sujeito da enunciação em relação a seus fantasmas. Assim, é possível pensar num trajeto que se pode chamar de travessia exatamente pelas modificações ocorridas na escritade Machado de Assis até o Memorial de Aires.

  17. Methamphetamine induces dopamine D1 receptor-dependent endoplasmic reticulum stress-related molecular events in the rat striatum.

    Directory of Open Access Journals (Sweden)

    Subramaniam Jayanthi

    Full Text Available Methamphetamine (METH is an illicit toxic psychostimulant which is widely abused. Its toxic effects depend on the release of excessive levels of dopamine (DA that activates striatal DA receptors. Inhibition of DA-mediated neurotransmission by the DA D1 receptor antagonist, SCH23390, protects against METH-induced neuronal apoptosis. The initial purpose of the present study was to investigate, using microarray analyses, the influence of SCH23390 on transcriptional responses in the rat striatum caused by a single METH injection at 2 and 4 hours after drug administration. We identified 545 out of a total of 22,227 genes as METH-responsive. These include genes which are involved in apoptotic pathways, endoplasmic reticulum (ER stress, and in transcription regulation, among others. Of these, a total of 172 genes showed SCH23390-induced inhibition of METH-mediated changes. Among these SCH23390-responsive genes were several genes that are regulated during ER stress, namely ATF3, HSP27, Hmox1, HSP40, and CHOP/Gadd153. The secondary goal of the study was to investigate the role of DA D1 receptor stimulation on the expression of genes that participate in ER stress-mediated molecular events. We thus used quantitative PCR to confirm changes in the METH-responsive ER genes identified by the microarray analyses. We also measured the expression of these genes and of ATF4, ATF6, BiP/GRP78, and of GADD34 over a more extended time course. SCH23390 attenuated or blocked METH-induced increases in the expression of the majority of these genes. Western blot analysis revealed METH-induced increases in the expression of the antioxidant protein, Hmox1, which lasted for about 24 hours after the METH injection. Additionally, METH caused DA D1 receptor-dependent transit of the Hmox1 regulator protein, Nrf2, from cytosolic into nuclear fractions where the protein exerts its regulatory functions. When taken together, these findings indicate that SCH23390 can provide

  18. Two dopamine receptors play different roles in phase change of the migratory locust

    Directory of Open Access Journals (Sweden)

    Xiaojiao eGuo

    2015-03-01

    Full Text Available The migratory locust, Locusta migratoria, shows remarkable phenotypic plasticity at behavioral, physiological, and morphological levels in response to fluctuation in population density. Our previous studies demonstrated that dopamine (DA and the genes in the dopamine metabolic pathway mediate phase change in Locusta. However, the functions of different dopamine receptors in modulating locust phase change have not been fully explored. In the present study, DA concentration in the brain increased during crowding and decreased during isolation. The expression level of dopamine receptor 1 (Dop1 increased from 1 h to 4 h of crowding, but remained unchanged during isolation. Injection of Dop1 agonist SKF38393 into the brains of solitary locusts promoted gregarization, induced conspecific attraction-response and increased locomotion. RNAi knockdown of Dop1 and injection of antagonist SCH23390 in gregarious locusts induced solitary behavior, promoted the shift to repulsion-response and reduced locomotion. By contrast, the expression level of dopamine receptor 2 (Dop2 gradually increased during isolation, but remained stable during crowding. During the isolation of gregarious locusts, injection of Dop2 antagonist S(–-sulpiride or RNAi knockdown of Dop2 inhibited solitarization, maintained conspecific attraction-response and increased locomotion; by comparison, the isolated controls displayed conspecific repulsion-response and weaker motility. Activation of Dop2 in solitary locusts through injection of agonist, R(−-TNPA, did not affect their behavioral state. Thus, DA-Dop1 signaling in the brain of Locusta induced the gregariousness, whereas DA-Dop2 signaling mediated the solitariness. Our study demonstrated that Dop1 and Dop2 modulated locust phase change in two different directions. Further investigation of Locusta Dop1 and Dop2 functions in modulating phase change will improve our understanding of the molecular mechanism underlying phenotypic

  19. Emerging GLP-1 receptor agonists

    DEFF Research Database (Denmark)

    Lund, Asger; Knop, Filip K; Vilsbøll, Tina

    2011-01-01

    Introduction: Recently, glucagon-like peptide-1 receptor (GLP-1R) agonists have become available for the treatment of type 2 diabetes. These agents exploit the physiological effects of GLP-1, which is able to address several of the pathophysiological features of type 2 diabetes. GLP-1R agonists...

  20. Osteopontin interaction with integrin receptors

    DEFF Research Database (Denmark)

    Kläning, Eva

    Osteopontin is a negatively charged and unstructured protein that is found in many types of tissue in humans. Osteopontin can interact with many different types of cells via interaction with integrins, which are a particular class of receptors expressed on the cellular surface. Via contact...... with integrins, osteopontin can affect cellular behaviour in both normal and disease-related contexts....

  1. Chemokine receptors in allergic diseases.

    Science.gov (United States)

    Castan, L; Magnan, A; Bouchaud, G

    2017-05-01

    Under homeostatic conditions, as well as in various diseases, leukocyte migration is a crucial issue for the immune system that is mainly organized through the activation of bone marrow-derived cells in various tissues. Immune cell trafficking is orchestrated by a family of small proteins called chemokines. Leukocytes express cell-surface receptors that bind to chemokines and trigger transendothelial migration. Most allergic diseases, such as asthma, rhinitis, food allergies, and atopic dermatitis, are generally classified by the tissue rather than the type of inflammation, making the chemokine/chemokine receptor system a key point of the immune response. Moreover, because small antagonists can easily block such receptors, various molecules have been developed to suppress the recruitment of immune cells during allergic reactions, representing potential new drugs for allergies. We review the chemokines and chemokine receptors that are important in asthma, food allergies, and atopic dermatitis and their respectively developed antagonists. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  2. Excitatory amino acid receptor antagonists

    DEFF Research Database (Denmark)

    Johansen, T N; Frydenvang, Karla Andrea; Ebert, B

    1997-01-01

    We have previously shown that (RS)-2-amino-2-(5-tert-butyl-3-hydroxyisoxazol-4-yl)acetic acid (ATAA) is an antagonist at N-methyl-D-aspartic acid (NMDA) and (RS)-2-amino-3-(3-hydroxy-5-methylisoxazol-4-yl)propionic acid (AMPA) receptors. We have now resolved ATAA via diastereomeric salt formation...

  3. Cannabinoid receptor localization in brain

    Energy Technology Data Exchange (ETDEWEB)

    Herkenham, M.; Lynn, A.B.; Little, M.D.; Johnson, M.R.; Melvin, L.S.; de Costa, B.R.; Rice, K.C. (National Institute of Mental Health, Bethesda, MD (USA))

    1990-03-01

    (3H)CP 55,940, a radiolabeled synthetic cannabinoid, which is 10-100 times more potent in vivo than delta 9-tetrahydrocannabinol, was used to characterize and localize a specific cannabinoid receptor in brain sections. The potencies of a series of natural and synthetic cannabinoids as competitors of (3H)CP 55,940 binding correlated closely with their relative potencies in several biological assays, suggesting that the receptor characterized in our in vitro assay is the same receptor that mediates behavioral and pharmacological effects of cannabinoids, including human subjective experience. Autoradiography of cannabinoid receptors in brain sections from several mammalian species, including human, reveals a unique and conserved distribution; binding is most dense in outflow nuclei of the basal ganglia--the substantia nigra pars reticulata and globus pallidus--and in the hippocampus and cerebellum. Generally high densities in forebrain and cerebellum implicate roles for cannabinoids in cognition and movement. Sparse densities in lower brainstem areas controlling cardiovascular and respiratory functions may explain why high doses of delta 9-tetrahydrocannabinol are not lethal.

  4. Are olfactory receptors really olfactive?

    DEFF Research Database (Denmark)

    Giorgi, Franco; Maggio, Roberto; Bruni, Luis Emilio

    2011-01-01

    Any living organism interacts with and responds specifically to environmental molecules by expressing specific olfactory receptors. This specificity will be first examined in causal terms with particular emphasis on the mechanisms controlling olfactory gene expression, cell-to-cell interactions a...

  5. Characterization of angiogenin receptors on bovine brain capillary endothelial cells.

    Science.gov (United States)

    Chamoux, M; Dehouck, M P; Fruchart, J C; Spik, G; Montreuil, J; Cecchelli, R

    1991-04-30

    The mitogenic effect of bovine milk angiogenin was studied on bovine brain capillary and aortic endothelial cells, smooth muscle cells and fibroblasts. The proliferation of only bovine brain capillary endothelial cells was detected at concentrations ranging from 10 to 1,000 ng/ml, with a maximum effect at 100 ng/ml. This mitogenic activity may be correlated with a specific binding of angiogenin which was demonstrated only to bovine brain capillary endothelial cells. [125I]-labeled angiogenin binding was time and concentration dependent and saturable. Scatchard analyses of binding data showed evidence of a single class of binding sites with an apparent dissociation constant of 5.10(-10)M. The molecular mass of the angiogenin receptor (49 kDa) was determined by ligand blotting.

  6. Brain-derived neurotrophic factor controls cannabinoid CB1 receptor function in the striatum.

    Science.gov (United States)

    De Chiara, Valentina; Angelucci, Francesco; Rossi, Silvia; Musella, Alessandra; Cavasinni, Francesca; Cantarella, Cristina; Mataluni, Giorgia; Sacchetti, Lucia; Napolitano, Francesco; Castelli, Maura; Caltagirone, Carlo; Bernardi, Giorgio; Maccarrone, Mauro; Usiello, Alessandro; Centonze, Diego

    2010-06-16

    The role of brain-derived neurotrophic factor (BDNF) in emotional processes suggests an interaction with the endocannabinoid system. Here, we addressed the functional interplay between BDNF and cannabinoid CB(1) receptors (CB(1)Rs) in the striatum, a brain area in which both BDNF and CB(1)s play a role in the emotional consequences of stress and of rewarding experiences. BDNF potently inhibited CB(1)R function in the striatum, through a mechanism mediated by altered cholesterol metabolism and membrane lipid raft function. The effect of BDNF was restricted to CB(1)Rs controlling GABA-mediated IPSCs (CB(1)R(GABA)), whereas CB(1)Rs modulating glutamate transmission and GABA(B) receptors were not affected. The action of BDNF on CB(1)R(GABA) function was tyrosine kinase dependent and was complete even after receptor sensitization with cocaine or environmental manipulations activating the dopamine (DA)-dependent reward system. In mice lacking one copy of the BDNF gene (BDNF(+/-)), CB(1)R(GABA) responses were potentiated and were preserved from the action of haloperidol, a DA D(2) receptor (D(2)R) antagonist able to fully abolish CB(1)R(GABA) function in rewarded animals. Haloperidol also enhanced BDNF levels in the striatum, suggesting that this neurotrophin may act as a downstream effector of D(2)Rs in the modulation of cannabinoid signaling. Accordingly, 5 d cocaine exposure both reduced striatal BDNF levels and increased CB(1)R(GABA) activity, through a mechanism dependent on D(2)Rs. The present study identifies a novel mechanism of CB(1)R regulation mediated by BDNF and cholesterol metabolism and provides some evidence that DA D(2)R-dependent modulation of striatal CB(1)R activity is mediated by this neurotrophin.

  7. Evolution of neurotransmitter receptor systems.

    Science.gov (United States)

    Venter, J C; di Porzio, U; Robinson, D A; Shreeve, S M; Lai, J; Kerlavage, A R; Fracek, S P; Lentes, K U; Fraser, C M

    1988-01-01

    The presence of hormones, neurotransmitters, their receptors and biosynthetic and degradative enzymes is clearly not only associated with the present and the recent past but with the past several hundred million years. Evidence is mounting which indicates substantial conservation of protein structure and function of these receptors and enzymes over these tremendous periods of time. These findings indicate that the evolution and development of the nervous system was not dependent upon the formation of new or better transmitter substances, receptor proteins, transducers and effector proteins but involved better utilization of these highly developed elements in creating advanced and refined circuitry. This is not a new concept; it is one that is now substantiated by increasingly sophisticated studies. In a 1953 article discussing chemical aspects of evolution (Danielli, 1953) Danielli quotes Medawar, "... endocrine evolution is not an evolution of hormones but an evolution of the uses to which they are put; an evolution not, to put it crudely, of chemical formulae but of reactivities, reaction patterns and tissue competences." To also quote Danielli, "In terms of comparative biochemistry, one must ask to what extent the evolution of these reactivities, reaction patterns and competences is conditional upon the evolution of methods of synthesis of new proteins, etc., and to what extent the proteins, etc., are always within the synthetic competence of an organism. In the latter case evolution is the history of changing uses of molecules, and not of changing synthetic abilities." (Danielli, 1953). Figure 4 outlines a phylogenetic tree together with an indication of where evidence exists for both the enzymes that determine the biosynthesis and metabolism of the cholinergic and adrenergic transmitters and their specific cholinergic and adrenergic receptors. This figure illustrates a number of important points. For example, the evidence appears to show that the transmitters

  8. Activation of Serotonin 2C Receptors in Dopamine Neurons Inhibits Binge-like Eating in Mice.

    Science.gov (United States)

    Xu, Pingwen; He, Yanlin; Cao, Xuehong; Valencia-Torres, Lourdes; Yan, Xiaofeng; Saito, Kenji; Wang, Chunmei; Yang, Yongjie; Hinton, Antentor; Zhu, Liangru; Shu, Gang; Myers, Martin G; Wu, Qi; Tong, Qingchun; Heisler, Lora K; Xu, Yong

    2017-05-01

    Neural networks that regulate binge eating remain to be identified, and effective treatments for binge eating are limited. We combined neuroanatomic, pharmacologic, electrophysiological, Cre-lox, and chemogenetic approaches to investigate the functions of 5-hydroxytryptamine (5-HT) 2C receptor (5-HT2CR) expressed by dopamine (DA) neurons in the regulation of binge-like eating behavior in mice. We showed that 5-HT stimulates DA neural activity through a 5-HT2CR-mediated mechanism, and activation of this midbrain 5-HT→DA neural circuit effectively inhibits binge-like eating behavior in mice. Notably, 5-HT medications, including fluoxetine, d-fenfluramine, and lorcaserin (a selective 5-HT2CR agonist), act on 5-HT2CRs expressed by DA neurons to inhibit binge-like eating in mice. We identified the 5-HT2CR population in DA neurons as one potential target for antibinge therapies, and provided preclinical evidence that 5-HT2CR agonists could be used to treat binge eating. Copyright © 2016 Society of Biological Psychiatry. Published by Elsevier Inc. All rights reserved.

  9. Mechanism for the activation of glutamate receptors

    Science.gov (United States)

    Scientists at the NIH have used a technique called cryo-electron microscopy to determine a molecular mechanism for the activation and desensitization of ionotropic glutamate receptors, a prominent class of neurotransmitter receptors in the brain and spina

  10. Roles of xenobiotic receptors in vascular pathophysiology.

    Science.gov (United States)

    Xiao, Lei; Zhang, Zihui; Luo, Xiaoqin

    2014-01-01

    The pregnane X receptor (PXR) and constitutive androstane receptor (CAR), 2 closely related and liver-enriched members of the nuclear receptor superfamily, and aryl hydrocarbon receptor (AhR), a nonnuclear receptor transcription factor (TF), are major receptors/TFs regulating the expression of genes for the clearance and detoxification of xenobiotics. They are hence defined as "xenobiotic receptors". Recent studies have demonstrated that PXR, CAR and AhR also regulate the expression of key proteins involved in endobiotic responses such as the metabolic homeostasis of lipids, glucose, and bile acid, and inflammatory processes. It is suggested that the functions of PXR, CAR and AhR may be closely implicated in the pathogeneses of metabolic vascular diseases, such as hyperlipidemia, atherogenesis, and hypertension. Therefore, manipulation of the activities of these receptors may provide novel strategies for the treatment of vascular diseases. Here, we review the pathophysiological roles of PXR, CAR and AhR in the vascular system.

  11. Da onda da gestão da qualidade a uma filosofia da qualidade da gestão: Balanced Scorecard promovendo mudanças

    Directory of Open Access Journals (Sweden)

    Andréa Cavalcanti Correia Lima

    2004-06-01

    Full Text Available No final da década de 80 a Gestão da Qualidade Total (GQT era apresentada como capaz de resolver todos os problemas e atender a todas as necessidades da gestão das organizações. Buscando solucionar problemas de gestão não equacionados pela GQT, muitas organizações começam a adotar o Balanced Scorecard (BSC. Uma questão ainda não discutida com profundidade no mundo acadêmico é a viabilidade de integração desses dois modelos. O presente artigo discute a possibilidade de integração dessas duas ferramentas, verificando as melhorias que podem alcançar, principalmente no gerenciamento da estratégia da organização. Assim sendo, realizou-se estudo de caso no Caesar Park Hotel Fortaleza (CPHF, empresa que vêm adotando com sucesso os dois modelos. A pesquisa revela que é possível integrar os princípios da GQT com os do BSC, à medida que os fundamentos de ambos se complementam, sendo assim a utilização conjunta das ferramentas propicia melhor gerenciamento da estratégia da organização.In recent years, many organizations have been managed according to the principles of Total Quality Management (TQM, which became known around the globe in the 1980's, when looking for explanations for the so-called "Japanese miracle". TQM was presented as being capable of solving all problems and attending to all company management needs, a stage that seems outdated now. In the search for a model that would allow them to analyze and follow up the implementation of organizational strategies, without remaining limited to Quality indicators, many companies started to adopt the Balanced Scorecard (BSC. Companies using TQM question whether it is viable together with the BSC. In order to contribute to a solution to this question, this article discusses the possibility of aligning these two tools. Therefore, a case study was carried out at the Caesar Park Hotel Fortaleza, a company that implanted TQM in 1997 and started to adopt the BSC in 2000. The

  12. O problema da legitimidade da História da Filosofia

    Directory of Open Access Journals (Sweden)

    Martial Guéroult

    1968-09-01

    Full Text Available A legitimidade da história da filosofia é periodicamente colocada em dúvida. Essa dúvida se inspira, essencialmente, quase sempre nos mesmos sentimentos: sentimento ingênuo de que a filosofia se assemelhe à ciência, e que, como a única ciência válida é sempre a mais recente, a única filosofia válida deveria ser também a mais recente; sentimento ingênuo de que qualquer filosofia só é possível pe-la negação, até mesmo pela ignorância das doutrinas passadas, visto que ela parte do ato livre de uma reflexão autônoma mais ou menos genial .

  13. Benzodiazepine receptor antagonists for hepatic encephalopathy

    DEFF Research Database (Denmark)

    Als-Nielsen, B; Gluud, L L; Gluud, C

    2004-01-01

    Hepatic encephalopathy may be associated with accumulation of substances that bind to a receptor-complex in the brain resulting in neural inhibition. Benzodiazepine receptor antagonists may have a beneficial effect on patients with hepatic encephalopathy.......Hepatic encephalopathy may be associated with accumulation of substances that bind to a receptor-complex in the brain resulting in neural inhibition. Benzodiazepine receptor antagonists may have a beneficial effect on patients with hepatic encephalopathy....

  14. Imaging of human epidermal growth factor receptor type 2 expression with 18F-labeled affibody molecule ZHER2:2395 in a mouse model for ovarian cancer.

    NARCIS (Netherlands)

    Heskamp, S.; Laverman, P.; Rosik, D.; Boschetti, F.; Graaf, W.T.A. van der; Oyen, W.J.G.; Laarhoven, H.W.M. van; Tolmachev, V.; Boerman, O.C.

    2012-01-01

    Affibody molecules are small (7 kDa) proteins with subnanomolar targeting affinity. Previous SPECT studies in xenografts have shown that the Affibody molecule (111)In-DOTA-Z(HER2)(:2395) can discriminate between high and low human epidermal growth factor receptor type 2 (HER2)-expressing tumors,

  15. Imaging of human epidermal growth factor receptor type 2 expression with 18F-labeled affibody molecule ZHER2:2395 in a mouse model for ovarian cancer

    NARCIS (Netherlands)

    Heskamp, Sandra; Laverman, Peter; Rosik, Daniel; Boschetti, Frederic; van der Graaf, Winette T. A.; Oyen, Wim J. G.; van Laarhoven, Hanneke W. M.; Tolmachev, Vladimir; Boerman, Otto C.

    2012-01-01

    Affibody molecules are small (7 kDa) proteins with subnanomolar targeting affinity. Previous SPECT studies in xenografts have shown that the Affibody molecule (111)In-DOTA-Z(HER2)(:2395) can discriminate between high and low human epidermal growth factor receptor type 2 (HER2)-expressing tumors,

  16. Takifugu rubripes cation independent mannose 6-phosphate receptor: Cloning, expression and functional characterization of the IGF-II binding domain.

    Science.gov (United States)

    A, Ajith Kumar; Nadimpalli, Siva Kumar

    2018-01-31

    Mannose 6-phosphate/IGF-II receptor mediated lysosomal clearance of insulin-like growth factor-II is significantly associated with the evolution of placental mammals. The protein is also referred to as the IGF-II receptor. Earlier studies suggested relatively low binding affinity between the receptor and ligand in prototherian and metatherian mammals. In the present study, we cloned the IGF-II binding domain of the early vertebrate fugu fish and expressed it in bacteria. A 72000Da truncated receptor containing the IGF-II binding domain was obtained. Analysis of this protein (covering domains 11-13 of the CIMPR) for its affinity to fish and human IGF-II by ligand blot assays and ELISA showed that the expressed receptor can specifically bind to both fish and human IGF-II. Additionally, a peptide-specific antibody raised against the region of the IGF-II binding domain also was able to recognize the IGF-II binding regions of mammalian and non-mammalian cation independent MPR protein. These interactions were further characterized by Surface Plasma resonance support that the receptor binds to fish IGF-II, with a dissociation constant of 548nM. Preliminary analysis suggests that the binding mechanism as well as the affinity of the fish and human receptor for IGF-II may have varied according to different evolutionary pressures. Copyright © 2018. Published by Elsevier B.V.

  17. The corneal epithelium: clinical relevance of cytokine-mediated responses to maintenance of corneal health O epitélio da córnea: relevância clínica das respostas mediadas por citocinas para manter a saúde da córnea

    Directory of Open Access Journals (Sweden)

    PS Reinach

    2008-12-01

    Full Text Available We review the growth factor receptor-mediated cell signaling events that induce the responses required for the maintenance of corneal epithelial health. Our focus is to show how such responses contribute to sustaining corneal transparency and deturgescence, so basic to the pathogenesis of corneal diseases. Furthermore, we point out how alterations of receptor-mediated control of these responses account for losses in corneal transparency. In particular, the roles of growth factors in the mediation of normal corneal function, including epithelial cell proliferation, prevention of compromise of the barrier function of the cornea, and maintenance of normal renewal processes are discussed in relation to clinical entities involving the cornea.Revimos os eventos de sinalização celular mediados por receptores de fatores de crescimento, usados para manter a saúde do epitélio da córnea. O objetivo é mostrar como essas respostas contribuem para manter a transparência e a deturgescência da córnea, críticos na patogênese das doenças da córnea. Mais ainda, enfatizamos como alterações no controle mediado por receptor dessas respostas contribuem na transparência da córnea. Especificamente, o papel dos fatores de crescimento na mediação do controle funcional normal da córnea, incluindo proliferação epitelial, prevenção da quebra da função de barreira, manutenção do processo de renovação são discutidos em relação às entidades clínicas envolvidas na córnea.

  18. The substance P/NK-1 receptor system: NK-1 receptor antagonists ...

    Indian Academy of Sciences (India)

    The substance P (SP)/neurokinin (NK)-1 receptor system plays an important role in cancer. SP promotes the proliferation of tumour cells, angiogenesis and the migration of tumour cells. We review the involvement of SP, the NK-1 receptor and NK-1 receptor antagonists in cancer. Tumour cells overexpress NK-1 receptors, ...

  19. Repeated blockade of mineralocorticoid receptors, but not of glucocorticoid receptors impairs food rewarded spatial learning

    NARCIS (Netherlands)

    Douma, B. R.; Korte, S. M.; Buwalda, B.; La Fleur, S. E.; Bohus, B.; Luiten, P. G.

    1998-01-01

    Corticosteroids from the adrenal cortex influence a variety of behaviours including cognition, learning and memory. These hormones act via two intracellular receptors, the mineralo-corticoid receptor (MR) and the glucocorticoid receptor (GR). These two receptor types display a high concentration and

  20. Repeated blockade of mineralocorticoid receptors, but not of glucocorticoid receptors impairs food rewarded spatial learning

    NARCIS (Netherlands)

    Douma, BRK; Korte, SM; Buwalda, B; la Fleur, SE; Bohus, B; Luiten, PGM

    Corticosteroids from the adrenal cortex influence a variety of behaviours including cognition, learning and memory. These hormones act via two intracellular receptors, the mineralo-corticoid receptor (MR) and the glucocorticoid receptor (GR). These two receptor types display a high concentration and

  1. Investimento no capital humano da AP, factor essencial na resolução da crise

    OpenAIRE

    Rato, Helena; Silva, Matilde Gago da

    2011-01-01

    Becker e outros cientistas das ciências humanas levaram ao desenvolvimento da teoria do capital humano. O desenvolvimento da sociedade do conhecimento e as TIC reforçaram o reconhecimento da importância do capital humano. Contudo, os países da sociedade do conhecimento enfrentam uma ameaça de retrocesso, devido ao desajuste dos indicadores do desempenho macroeconómico e à dificuldade de mensuração do investimento em capital humano. A resolução da crise actual exige que o capital humano da Adm...

  2. Angiotensin receptors in the cardiovascular system

    NARCIS (Netherlands)

    Wagenaar, L.J.; Voors, AA; Buikema, H; van Gilst, WH

    2002-01-01

    The angiotensin II receptors mediate the effects of the renin-angiotensin system, which has an important role in cardiovascular (patho)physiology. Four types of angiotensin receptors are known, of which the type 1 (AT,) and the type 2 (AT(2)) receptors are the most important. Stimulation of the AT,

  3. The brain mineralocorticoid receptor and stress resilience

    NARCIS (Netherlands)

    ter Heegde, Freija; De Rijk, Roel H.; Vinkers, Christiaan H.

    Stress exposure activates the HPA-axis and results in the release of corticosteroids which bind to two receptor types in the brain: the mineralocorticoid receptor (MR) and the glucocorticoid receptor (GR). While the role of the GR in stress reactivity has been extensively studied, the MR has

  4. Muscarinic receptors and drugs in cardiovascular medicine

    NARCIS (Netherlands)

    van Zwieten, P. A.; Doods, H. N.

    1995-01-01

    The parasympathetic system and its associated muscarinic receptors have been the subject of a renaissance of interest for the following two main reasons: (1) the association of endothelial muscarinic receptors and the nitric oxide (NO) pathway; (2) the discovery of several muscarinic receptor

  5. Cloning of partial putative gonadotropin hormone receptor ...

    Indian Academy of Sciences (India)

    Keywords. Glycoprotein hormone receptor; gonadotropin receptor; Labeo rohita; luteinizing hormone receptor; mariner transposon; PCR cloning. Abstract. A search for the presence of mariner-like elements in the Labeo rohita genome by polymerase chain reaction led to the amplification of a partial DNA sequence coding ...

  6. COMPUTATIONAL DESIGN OF RECEPTOR SELECTIVE TRAIL VARIANTS

    NARCIS (Netherlands)

    van der Sloot, Almer M.; Szegezdi, Eva; Reis, Carlos R.; Tur, Vicente; Quax, Wim J.; Samali, Afshin; Serrano, Luis; Wallach, D; Kovalenko, A; Feldman, M

    2011-01-01

    Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) is a potential anticancer drug that selectively induces apoptosis in a variety of cancer cells by interacting with death receptors DR4 and DR5. TRAIL can also bind to decoy receptors (DcR1, DcR2, and osteoprotegerin receptor) that

  7. Sensing intracellular pathogens-NOD-like receptors

    NARCIS (Netherlands)

    Rietdijk, Svend T.; Burwell, Timothy; Bertin, John; Coyle, Anthony J.

    2008-01-01

    The innate immune system uses different molecules that sense pathogen associated molecular patterns. These include Toll-like receptors (TLRs), RIG-1-like receptors (RLRs) and the NOD-like receptors (NLRs). The NLRs, consisting of more than 20 related family members, are present in the cytosol and

  8. Receptor conversion in distant breast cancer metastases

    NARCIS (Netherlands)

    Hoefnagel, L.D.C.

    2013-01-01

    The routine pathological work-up of breast cancer includes the evaluation of the estrogen receptor (ERα), progesterone receptor (PR) and human epidermal growth factor receptor 2 (HER2) which reveals biological information about the tumour as well as provides predictive biomarkers regarding hormonal

  9. Chapter 8. Activation mechanisms of chemokine receptors

    DEFF Research Database (Denmark)

    Jensen, Pia C; Rosenkilde, Mette M

    2009-01-01

    , more research has to be done in this field. Chemokine receptors are interesting tools in this matter. First, the chemokine system has a high degree of promiscuity that allows several chemokines to target one receptor in different ways, as well as a single chemokine ligand to target several receptors...

  10. Characterization of the receptor for platelet-derived growth factor on human fibroblasts. Demonstration of an intimate relationship with a 185,000-Dalton substrate for the platelet-derived growth factor-stimulated kinase.

    Science.gov (United States)

    Heldin, C H; Ek, B; Rönnstrand, L

    1983-08-25

    The receptor for platelet-derived growth factor (PDGF) on human foreskin fibroblasts has been characterized. The molecular weight of the PDGF-receptor complex was estimated by affinity labeling techniques to about 200,000, as determined by sodium dodecyl sulfate-gel electrophoresis performed under reducing conditions. Subtraction of the Mr of reduced PDGF (18,000 to 15,000) gives a Mr for the receptor proper of 185,000 (+/- 10,000). The mobility in sodium dodecyl sulfate-gel electrophoresis was similar whether or not reducing agents were present, suggesting that the receptor may be a single chain protein. The hydrodynamic size of the 125I-PDGF-receptor complex after solubilization with Triton X-100, corresponded to a Mr of approximately 320,000, as determined by gel chromatography. Subtraction of the Mr contributions from Triton X-100 and PDGF, respectively, gives a Mr of approximately 200,000 for the receptor itself, an estimate in good agreement with the value obtained from the affinity-labeling experiments. Several lectins were analyzed for their ability to inhibit binding of 125I-PDGF to its receptor. It was found that wheat germ agglutinin and a lectin from Crotalaria juncea were effective inhibitors and that their inhibitory effects could be neutralized by N-acetylglucosamine and galactose, respectively, suggesting that the receptor contains these sugars. The properties of the receptor were compared with those of a 185,000-Da component, being the major substrate for the membrane-bound PDGF-stimulated kinase. It was found that the 185,000-Da component behaved similar to the PDGF receptor in sodium dodecyl sulfate-gel electrophoresis, performed with or without reducing agents present. Further, the 185,000-Da component co-eluted with the PDGF receptor on a Sepharose 6B column, and had affinity for the same lectins that inhibited the binding of 125I-PDGF to its receptor. Finally, the 185,000-Da component had affinity for PDGF immobilized on Sepharose beads

  11. Efeito colateral da quimioterapia e o papel da enfermagem

    OpenAIRE

    Lopes Matoso, Leonardo Magela; Universidade Potiguar - UnP, Campus Mossoró.; Duarte De Rosário, Sâmara Sirdenia; Universidade do Rio Grande do Norte (UERN).

    2014-01-01

    O objetivo deste artigo é avaliar a partir da percepção das mulheres que realizam quimioterapia, as estratégias de cuidados utilizadas pela equipe de enfermagem na redução e/ou alívio dos efeitos colaterais causados pelo tratamento quimioterápico. Trata-se de um estudo de natureza descritiva, exploratória, com abordagem predominantemente qualitativa. A coleta de dados ocorreu no período de novembro a dezembro de 2012, através de um roteiro de entrevista semiestruturado. Os dados qualitativos ...

  12. Infertilidade: um novo campo da Psicologia da saúde

    OpenAIRE

    Farinati,Débora Marcondes; Rigoni,Maisa dos Santos; Müller,Marisa Campio

    2006-01-01

    Segundo dados da Organização Mundial de Saúde, estima-se que entre 60 e 80 milhões de pessoas em todo o mundo enfrentem dificuldades para levar a cabo seu projeto de paternidade e maternidade em algum momento de suas vidas. Desejar ter filhos mas se deparar com uma impossibilidade nesse processo produz uma ampla gama de sentimentos, tais como medo, ansiedade, tristeza, frustração, desvalia e vergonha, desencadeando por vezes quadros importantes de estresse. A situação de infertilidade pode pr...

  13. Interaction proteomics reveals brain region-specific AMPA receptor complexes

    NARCIS (Netherlands)

    Chen, N.; Pandya, N.J.; Koopmans, F.T.W.; Castelo-Szekelv, V.; van der Schors, R.C.; Smit, A.B.; Li, K.W.

    2014-01-01

    Fast excitatory synaptic transmission in the brain is mediated by glutamate acting on postsynaptic AMPA receptors. Recent studies have revealed a substantial number of AMPA receptor auxiliary proteins, which potentially contribute to the regulation of AMPA receptor trafficking, subcellular receptor

  14. Muscarinic acetylcholine M4 receptors play a critical role in oxotremorine-induced DARPP-32 phosphorylation at threonine 75 in isolated medium spiny neurons.

    Science.gov (United States)

    Liu, Liqun; Huang, Yuqi; Huang, Qing; Zhao, Zhe; Yu, Jianqiang; Wang, Liyun

    2017-05-01

    Dopamine- and cAMP-regulated phosphoprotein of 32 kDa (DARPP-32) play essential roles in dopamine (DA) transmission in the striatum. It is suggested that a link exists between muscarinic acetylcholine receptors (mAChRs) and DA/DARPP-32 signaling, but the molecular mechanisms mediating this relationship have not been elucidated. The predominant mAChRs subtypes in the striatum are M1 and M4. In this study, we investigated the functions of these two receptors, particularly M4, in regulating cAMP production and DARPP-32 phosphorylation in rat striatal medium spiny neurons (MSNs). We used time-resolved fluorescence resonance energy transfer, immunofluorescence confocal microscopy, and western blot assays. In cultured intact MSNs, we confirmed that muscarinic M1 and M4 receptors were highly expressed. Notably, M4 receptors were co-expressed with D1 receptors in only a portion of the cultured MSNs. The nonselective muscarinic agonist oxotremorine M (OX) slightly enhanced cAMP production, but this effect was independent of M1 or M4 receptors. However, OX directly participated in DARPP-32 phosphorylation, phosphorylating DARPP-32 at Thr75 (the CDK5 site) and concomitantly de-phosphorylating DARPP-32 at Thr34 (the PKA site) in virtually cultured MSNs, whereas APO phosphorylated DARPP-32 at both Thr34 and Thr75. The OX-induced time-dependent increase in DARPP-32 phosphorylation at Thr75 was accompanied by increased p35 and CDK5 activity. Specifically, elevated immunoreactivity for phospho-DARPP-32-Thr75 and p35 was detected in M4 receptor-expressing MSNs. Both genetic knockdown and pharmacologic inhibition of M4 receptors with MT3, an M4 receptor-selective antagonist, decreased the OX-induced DARPP-32-Thr75 phosphorylation in MSNs. These results indicate that the M4 muscarinic receptor plays a critical role in modulating phosphorylation of DARPP-32-Thr75 in MSNs. The results suggest that M4 receptor activation acts antagonistically with dopamine D1-like receptors within

  15. Purification and molecular characterization of the cardiac beta-adrenergic receptor

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, D.A.; Venter, J.C.; Fraser, C.M.

    1986-05-01

    The porcine ventricle cardiac beta-adrenergic receptor (..beta..AR) is predominantly of the ..beta../sub 2/ subtype. Sucrose density gradient purified porcine ventricle membranes exhibit a high ..beta..AR density of 1 pmol per mg and a K/sub d/ for /sup 125/I-iodocyanopindolol of 180 pM. Digitonin solubilized receptor exhibits ligand binding characteristics identical to those of membrane bound receptor. Stability studies indicate that the solubilized cardiac ..beta..AR has a t/sub 1/2/ of 92 hours. Solubilized receptor is stabilized by occupation with antagonists. Isoelectric focusing indicates a pI = 5.0, in agreement with results obtained for both ..beta../sub 1/AR and ..beta../sub 2/AR isolated from other sources. The cardiac ..beta../sub 1/AR has been purified to homogeneity by affinity chromatography and size exclusion HPLC (2 TSK 2000, 1 TSK 3000). Autoradiograms of purified, radioiodinated receptor preparations subjected to SDS-PAGE revealed a single band with an apparent subunit molecular mass (M/sub r/) of 68 kDa. This subunit M/sub r/ was confirmed in membranes photoaffinity labeled with /sup 125/I-iodocyanopindolol diazirine. A single band was specifically labeled, as evidenced by blocking of photoincorporation by (-) and (+) propranolol with typical ..beta..AR stereoselectivity.

  16. Structural Disorder in the Complex of Human Pregnane X Receptor and the Macrolide Antibiotic Rifampicin

    Energy Technology Data Exchange (ETDEWEB)

    Chrencik, Jill E.; Orans, Jillian; Moore, Linda B.; Xue, Yu; Peng, Li; Collins, Jon L.; Wisely, G. Bruce; Lambert, Millard H.; Kliewer, Steven A.; Redinbo, Matthew R. (U. of Texas-SMED); (UNC)

    2010-07-13

    The human nuclear xenobiotic receptor, pregnane X receptor (PXR), detects a variety of structurally distinct endogenous and xenobiotic compounds and controls expression of genes central to drug and cholesterol metabolism. The macrolide antibiotic rifampicin, a front-line treatment for tuberculosis, is an established PXR agonist and, at 823 Da, is one of the largest known ligands for the receptor. We present the 2.8 {angstrom} crystal structure of the ligand-binding domain of human PXR in complex with rifampicin. We also use structural and mutagenesis data to examine the origins of the directed promiscuity exhibited by the PXRs across species. Three structurally flexible loops adjacent to the ligand-binding pocket of PXR are disordered in this crystal structure, including the 200-210 region that is part of a sequence insert novel to the promiscuous PXRs relative to other members of the nuclear receptor superfamily. The 4-methyl-1-piperazinyl ring of rifampicin, which would lie adjacent to the disordered protein regions, is also disordered and not observed in the structure. Taken together, our results indicate that one wall of the PXR ligand-binding cavity can remain flexible even when the receptor is in complex with an activating ligand. These observations highlight the key role that structural flexibility plays in PXR's promiscuous response to xenobiotics.

  17. Oxytocin and vasopressin receptor gene polymorphisms: role in social and psychiatric traits.

    Directory of Open Access Journals (Sweden)

    Mauricio eAspé Sánchez

    2016-01-01

    Full Text Available Oxytocin (OXT and arginine-vasopressin (AVP are two phylogenetically conserved neuropeptides that have been implicated in a wide range of social behaviors. Although a large body of research, ranging from rodents to humans, has reported on the effects of OXT and AVP administration on affiliative and trust behaviors, and has highlighted the genetic contributions of OXT and AVP receptor polymorphisms to both social behaviors and to diseases related to social deficits, the consequences of peptide administration on psychiatric symptoms, and the impact of receptor polymorphisms on receptor function, are still unclear. Despite the exciting advances that these reports have brought to social neuroscience, they remain preliminary and suffer from the problems that are inherent to monogenetic linkage and association studies. As an alternative, some studies are using polygenic approaches, and consider the contributions of other genes and pathways, including those involving DA, 5-HT, and reelin, in addition to OXT and AVP; a handful of report are also using genome-wide association studies.This review summarizes findings on the associations between OXT and AVP receptor polymorphism, social behavior, and psychiatric diseases. In addition, we discuss reports on the interactions of OXT and AVP receptor genes and genes involved in other pathways (like those

  18. The GPCR membrane receptor, DopEcR, mediates the actions of both dopamine and ecdysone to control sex pheromone perception in an insect

    Directory of Open Access Journals (Sweden)

    Antoine eAbrieux

    2014-09-01

    Full Text Available Olfactory information mediating sexual behavior is crucial for reproduction in many animals, including insects. In male moths, the macroglomerular complex of the primary olfactory center, the antennal lobe (AL is specialized in the treatment of information on the female-emitted sex pheromone. Evidence is accumulating that modulation of behavioral pheromone responses occurs through neuronal plasticity via the action of hormones and/or catecholamines. We recently showed that a G-protein-coupled receptor (GPCR, AipsDopEcR, with its homologue known in Drosophila for its double affinity to the main insect steroid hormone 20-hydroxyecdysone (20E, and dopamine (DA, present in the ALs, is involved in the behavioral response to pheromone in the moth, Agrotis ipsilon. Here we tested the role of AipsDopEcR as compared to nuclear 20E receptors in central pheromone processing combining receptor inhibition with intracellular recordings of AL neurons. We show that the sensitivity of AL neurons for the pheromone in males decreases strongly after AipsDopEcR-dsRNA injection but also after inhibition of nuclear 20E receptors. Moreover we tested the involvement of 20E and DA in the receptor-mediated behavioral modulation in wind tunnel experiments, using ligand applications and receptor inhibition treatments. We show that both ligands are necessary and act on AipsDopEcR-mediated behavior. Altogether these results indicate that the GPCR membrane receptor, AipsDopEcR, controls sex pheromone perception through the action of both 20E and DA in the central nervous system, probably in concert with 20E action through nuclear receptors.

  19. Regulação do IRS-2 e da AKT em modelos animais de resistencia a insulina

    OpenAIRE

    Fernanda Alvarez Rojas

    2001-01-01

    Resumo: A insulina, ao se ligar à subunidade a de seu receptor heterotetramérico, dá inicio a uma série de ações imediatas e tardias, metabólicas e promotoras de crescimento. Tais eventos ocorrem através da estimulação da subunidade ~transmembrana do receptor, que se autofosforila e ativa a fosforilação de substratos endógenos intracelulares. Estas proteínas quando fosforiladas podem se unir a proteínas com porção SH2, como a PI 3- quinase. Uma etapa distal a estas associações é a fosforilaç...

  20. Interaction of NMDA receptor and pacemaking mechanisms in the midbrain dopaminergic neuron.

    Directory of Open Access Journals (Sweden)

    Joon Ha

    Full Text Available Dopamine neurotransmission has been found to play a role in addictive behavior and is altered in psychiatric disorders. Dopaminergic (DA neurons display two functionally distinct modes of electrophysiological activity: low- and high-frequency firing. A puzzling feature of the DA neuron is the following combination of its responses: N-methyl-D-aspartate receptor (NMDAR activation evokes high-frequency firing, whereas other tonic excitatory stimuli (α-amino-3-hydroxyl-5-methyl-4-isoxazolepropionate receptor (AMPAR activation or applied depolarization block firing instead. We suggest a new computational model that reproduces this combination of responses and explains recent experimental data. Namely, somatic NMDAR stimulation evokes high-frequency firing and is more effective than distal dendritic stimulation. We further reduce the model to a single compartment and analyze the mechanism of the distinct high-frequency response to NMDAR activation vs. other stimuli. Standard nullcline analysis shows that the mechanism is based on a decrease in the amplitude of calcium oscillations. The analysis confirms that the nonlinear voltage dependence provided by the magnesium block of the NMDAR determine its capacity to elevate the firing frequency. We further predict that the moderate slope of the voltage dependence plays the central role in the frequency elevation. Additionally, we suggest a repolarizing current that sustains calcium-independent firing or firing in the absence of calcium-dependent repolarizing currents. We predict that the ether-a-go-go current (ERG, which has been observed in the DA neuron, is the best fit for this critical role. We show that a calcium-dependent and a calcium-independent oscillatory mechanisms form a structure of interlocked negative feedback loops in the DA neuron. The structure connects research of DA neuron firing with circadian biology and determines common minimal models for investigation of robustness of oscillations

  1. Activation of Neuropeptide FF Receptors by Kisspeptin Receptor Ligands

    Science.gov (United States)

    2010-01-01

    Kisspeptin is a member of the RFamide neuropeptide family that is implicated in gonadotropin secretion. Because kisspeptin-GPR54 signaling is implicated in the neuroendocrine regulation of reproduction, GPR54 ligands represent promising therapeutic agents against endocrine secretion disorders. In the present study, the selectivity profiles of GPR54 agonist peptides were investigated for several GPCRs, including RFamide receptors. Kisspeptin-10 exhibited potent binding and activation of neuropeptide FF receptors (NPFFR1 and NPFFR2). In contrast, short peptide agonists bound with much lower affinity to NPFFRs while showing relatively high selectivity toward GPR54. The possible localization of secondary kisspeptin targets was also demonstrated by variation in the levels of GnRH release from the median eminence and the type of GPR54 agonists used. Negligible affinity of the reported NPFFR ligands to GPR54 was observed and indicates the unidirectional cross-reactivity between both ligands. PMID:24900254

  2. Expression of thromboxane A2 receptor gene and thromboxane A2 synthase in bovine corpora lutea.

    Science.gov (United States)

    Lei, Z M; Rao, C V; Chakraborty, C

    1992-08-01

    Studies were undertaken to investigate the expression of thromboxane (TXA2) receptor gene, from mRNA to functional receptor protein in terms of ligand binding, along with the cellular and subcellular distribution of the enzyme that catalyzes the formation of the ligand for the receptors. Bovine corpora lutea contained a single TXA2 receptor mRNA transcript of 2.8 kb. All the cell types in bovine corpora lutea contained immunoreactive TXA2 synthase, TXB2, TXA2 receptor transcripts, and receptor protein that bound the TXA2 antagonist 9,11-dimethylmethano-11,12-methano-16 (3-iodo-4-hydroxyphenyl)-13-14-dihydro-13-aza-15 alpha beta-omega-tetranor TXA2. The large luteal cells (20-35 microns) contained more receptor transcripts, receptor protein, and immunoreactive TXA2 synthase than did the small luteal cells (12-19 microns), luteal blood vessels, and nonluteal cells (7-12 microns). After correction for the cellular area differences, small luteal cells were seen to contain more receptor protein than did large luteal cells and nonluteal cells. All the cells showed an increase of TXA2 receptors and catalytically active TXA2 synthase from mid-luteal phase to early pregnancy, suggesting the possibility that TXA2 could be a luteotropic eicosanoid. Bovine lung homogenates (a positive control), bovine luteal plasma membranes-mitochondria-lysosomes fraction, rough-smooth endoplasmic reticulum-Golgi fraction, and highly purified nuclei contained 65-kDa immunoreactive protein, presumably representing TXA2 synthase. In addition, the luteal fractions, but not bovine lung, contained other small and large molecular-size immunoreactive proteins. Immunogold electron microscopy showed that immunoreactive TXA2 synthase was present primarily in plasma membranes, rough endoplasmic reticulum, nuclear membranes, and chromatin; and immunoreactive TXB2 was present primarily in different-size vesicles and nuclear chromatin. In summary, the present studies demonstrate for the first time that

  3. AAV serotypes have distinctive interactions with domains of the cellular receptor AAVR.

    Science.gov (United States)

    Pillay, Sirika; Zou, Wei; Cheng, Fang; Puschnik, Andreas S; Meyer, Nancy L; Ganaie, Safder S; Deng, Xuefeng; Wosen, Jonathan E; Davulcu, Omar; Yan, Ziying; Engelhardt, John F; Brown, Kevin E; Chapman, Michael S; Qiu, Jianming; Carette, Jan E

    2017-07-05

    Adeno-associated virus (AAV) entry is determined by its interactions with specific surface glycans and proteinaceous receptor(s). Adeno-associated virus receptor (AAVR; also named KIAA0319L) is an essential cellular receptor required for the transduction of vectors derived from multiple AAV serotypes including the evolutionary distant serotypes, AAV2 and AAV5. Here, we further biochemically characterize the AAV-AAVR interaction and define the domains within the ectodomain of AAVR that facilitate this interaction. Using a virus overlay assay, it was previously shown that the major AAV2 binding protein in membrane preparations of human cells corresponds to a glycoprotein with a 150-kDa molecular mass. By establishing a purification procedure, performing further protein separation through two-dimensional electrophoresis and utilizing mass spectrometry, we now show that this glycoprotein is identical to AAVR. While we find that AAVR is N-linked glycosylated, this glycosylation is not a strict requirement for AAV2 binding or functional transduction. Using a combination of genetic complementation with deletion constructs and viral overlay assays with individual domains, we find that AAV2 functionally interacts predominantly with the second Ig-like PKD repeat domain (PKD2) present in the ectodomain of AAVR. By contrast, AAV5 interacts primarily through the first, most membrane distal, PKD domain (PKD1) of AAVR to promote transduction. Furthermore, other AAV serotypes including AAV1 and 8 require a combination of PKD1 and PKD2 for optimal transduction. These results suggest that despite their shared dependence on AAVR as a critical entry receptor, different AAV serotypes have evolved distinctive interactions with the same receptor.IMPORTANCE Over the past decade, AAV vectors have emerged as leading gene delivery tools for therapeutic applications and biomedical research. Yet, fundamental aspects of the AAV life cycle, including how AAV interacts with host cellular factors

  4. Adeno-associated Virus (AAV) Serotypes Have Distinctive Interactions with Domains of the Cellular AAV Receptor

    Science.gov (United States)

    Pillay, Sirika; Zou, Wei; Cheng, Fang; Puschnik, Andreas S.; Meyer, Nancy L.; Ganaie, Safder S.; Deng, Xuefeng; Wosen, Jonathan E.; Davulcu, Omar; Yan, Ziying; Engelhardt, John F.; Brown, Kevin E.; Chapman, Michael S.

    2017-01-01

    ABSTRACT Adeno-associated virus (AAV) entry is determined by its interactions with specific surface glycans and a proteinaceous receptor(s). Adeno-associated virus receptor (AAVR) (also named KIAA0319L) is an essential cellular receptor required for the transduction of vectors derived from multiple AAV serotypes, including the evolutionarily distant serotypes AAV2 and AAV5. Here, we further biochemically characterize the AAV-AAVR interaction and define the domains within the ectodomain of AAVR that facilitate this interaction. By using a virus overlay assay, it was previously shown that the major AAV2 binding protein in membrane preparations of human cells corresponds to a glycoprotein with a molecular mass of 150 kDa. By establishing a purification procedure, performing further protein separation by two-dimensional electrophoresis, and utilizing mass spectrometry, we now show that this glycoprotein is identical to AAVR. While we find that AAVR is an N-linked glycosylated protein, this glycosylation is not a strict requirement for AAV2 binding or functional transduction. Using a combination of genetic complementation with deletion constructs and virus overlay assays with individual domains, we find that AAV2 functionally interacts predominantly with the second Ig-like polycystic kidney disease (PKD) repeat domain (PKD2) present in the ectodomain of AAVR. In contrast, AAV5 interacts primarily through the first, most membrane-distal, PKD domain (PKD1) of AAVR to promote transduction. Furthermore, other AAV serotypes, including AAV1 and -8, require a combination of PKD1 and PKD2 for optimal transduction. These results suggest that despite their shared dependence on AAVR as a critical entry receptor, different AAV serotypes have evolved distinctive interactions with the same receptor. IMPORTANCE Over the past decade, AAV vectors have emerged as leading gene delivery tools for therapeutic applications and biomedical research. However, fundamental aspects of the AAV life

  5. Soluble Extracellular Domain of Death Receptor 5 Inhibits TRAIL-Induced Apoptosis by Disrupting Receptor-Receptor Interactions.

    Science.gov (United States)

    Vunnam, Nagamani; Lo, Chih Hung; Grant, Benjamin D; Thomas, David D; Sachs, Jonathan N

    2017-09-15

    Dysregulation of tumor necrosis factor (TNF) receptor signaling is a key feature of various inflammatory disorders. Current treatments for TNF-related diseases function either by sequestering ligand or blocking ligand-receptor interactions, which can cause dangerous side effects by inhibiting the receptors that are not involved in the disease condition. Thus, alternate strategies that target receptor-receptor interactions are needed. We hypothesized that the soluble extracellular domain (ECD) of long isoform of death receptor 5 (DR5) could block endogenous receptor assembly, mimicking the biological effect of decoy receptors that lack the death domain to trigger apoptosis. Using live-cell fluorescence resonance energy transfer studies, we demonstrated that soluble ECD disrupts endogenous DR5-DR5 interactions. Cell viability assays were used to demonstrate the complete inhibition of TNF-related apoptosis-inducing ligand (TRAIL)-induced apoptosis by the ECD, although TRAIL is still able to bind to the receptor. Importantly, we used mutagenesis to prove that the inhibition of TRAIL-induced apoptosis by the ECD predominantly comes from the disruption of DR5 oligomerization and not ligand sequestration. Inhibition of death receptor activation should have important therapeutic applications in diseases such as nonalcoholic fatty liver disease. More generally, this approach should be generalized to enable the inhibition of other TNF receptor signaling mechanisms that are associated in a wide range of clinical conditions. Copyright © 2017. Published by Elsevier Ltd.

  6. Serotonin 2A receptor mRNA levels in the neonatal dopamine-depleted rat striatum remain upregulated following suppression of serotonin hyperinnervation.

    Science.gov (United States)

    Basura, G J; Walker, P D

    1999-08-05

    Sixty days after bilateral dopamine (DA) depletion (>98%) with 6-hydroxydopamine (6-OHDA) in neonatal rats, serotonin (5-HT) content doubled and 5-HT(2A) receptor mRNA expression rose 54% within the rostral striatum. To determine if striatal 5-HT(2A) receptor mRNA upregulation is dependent on increased 5-HT levels following DA depletion, neonatal rats received dual injections of 6-OHDA and 5,7-dihydroxytryptamine (5,7-DHT) which suppressed 5-HT content by approximately 90%. In these 6-OHDA/5,7-DHT-treated rats, striatal 5-HT(2A) receptor mRNA expression was still elevated (87% above vehicle controls). Comparative analysis of 5-HT(2C) receptor mRNA expression yielded no significant changes in any experimental group. These results demonstrate that upregulated 5-HT(2A) receptor biosynthesis in the DA-depleted rat is not dependent on subsequent 5-HT hyperinnervation. Copyright 1999 Elsevier Science B.V.

  7. EFEITOS DA LARGURA DA FAIXA DE CAPINA NA CULTURA DA MAMONA

    Directory of Open Access Journals (Sweden)

    EDISON MARTINS PAULO

    1997-01-01

    Full Text Available Estudou-se a influência de diferentes larguras de faixas de controle de plantas daninhas sobre a altura, o número de racemos e a produção de grãos da mamoneira (Ricinus communis L. var. IAC-80, objetivando-se determinar a área vegetada entre as linhas de plantio. Os experimentos foram desenvolvidos em Adamantina, na Estação Experimental de Agronomia da Alta Paulista do Instituto Agronômico (IAC, nos anos agrícolas 1989/90, 1990/91 e 1991/92. O delineamento estatístico adotado foi o de blocos ao acaso com quatro repetições e oito tratamentos. Os tratamentos consistiram em faixas com 0,0; 0,5; 1,0; 1,5; 2,0; 2,5 e 3,0 m de largura capinadas ao longo da linha de plantio e mantidas sempre livres de plantas daninhas; além dessas, mateve-se uma faixa de 1,0 m de largura e mesmo procedimento, na qual a comunidade infestante das entrelinhas era roçada manual- mente sempre que a altura média de 0,3 m era atingida. Concluiu-se que faixas de capina menores do que 1,0 m aplicadas sobre a linha de plantio da cultura diminuíram a produção de grãos, o número de racemos e a altura da mamoneira.Three experiments were carried out in Adamantina at the Experimental Station of Agronomy of Alta Paulista, Instituto Agronômico (IAC, State of São Paulo, Brazil, on a Dark Red Latosol during 1989-1992, in order to study the effects of different row widths covered by weeds on the yield, height and number of racemes of IAC-80 castor bean cultivar. Hoed rows of 0.0, 0.5, 1.0, 1.5, 2.0, 2.5 and 3.0 m wide were studied. An extra treatment had the entire plot covered with weeds mantained at 0.3 m height. The row space used was 3.0 x 1.0 m and the plots were 9.0 x 5.0 m. The experiment was set in a randomized complete block design with four replications. Hoeing row width of 1.0 m or less reduced raceme emission, plant height and seed yields.

  8. Gene expression of endothelin receptors in replaced rheumatic mitral stenotic valves Expressão gênica de receptores de endotelina em valvas mitrais reumáticas estenóticas substituídas

    Directory of Open Access Journals (Sweden)

    Sydney Correia Leão

    2012-12-01

    Full Text Available OBJECTIVES: Rheumatic fever is a highly prevalent disease in Brazil, and it poses a major public health problem. It is the leading cause of acquired heart disease in childhood and adolescence. The aim of this study was to evaluate the gene expression of ET-3 and its receptors, in replaced rheumatic mitral valves. METHODS: We studied the gene expression of endothelin-3 (ET-3 and its receptors, endothelin receptor A and endothelin receptor B (ETr-A and ETr-B, in the rheumatic mitral valves of 17 patients who underwent valve replacement surgery. The samples also underwent a histological analysis. RESULTS: Our data showed that almost all patients, regardless of individual characteristics such as gender or age, expressed the endothelin receptor genes, but did not express the genes for ET-3. In quantitative analysis, the ETr-A/GAPDH mean ratio was 33.04 ± 18.09%; while the ETr-B/GAPDH mean ratio was 114.58 ± 42.30%. Regarding histopathological individual features, the frequency of fibrosis is 100%, 88.23% of mononuclear infiltrate, 52.94% of neovascularization, 58.82% of calcification and absence of ossification. CONCLUSION: The presence of receptors ETr-A and ETr-B in rheumatic mitral valves suggests its interaction with the system of circulating endothelins, particularly ETr-B (known for acting in the removal of excess endothelin detected in a greater proportion, which could explain the lack of expression of endothelin in rheumatic mitral valve, process to be elucidated.OBJETIVOS: A febre reumática é uma doença altamente prevalente no Brasil, e representa um importante problema de saúde pública. É a principal causa de cardiopatia adquirida na infância e adolescência. O objetivo deste estudo foi avaliar a expressão gênica de ET-3 e seus receptores, em valvas mitrais reumáticas substituídas. Métodos: Estudamos a expressão gênica de endotelina-3 (ET-3 e de seus receptores, receptor da endotelina A e receptor da endotelina B (ETr-A e

  9. Antagonistas de los receptores glutamatérgicos NMDA en el tratamiento del dolor crónico NMDA glutamatergic receptor antagonists for the management of chronic pain

    OpenAIRE

    F. Neira; J.L. Ortega

    2004-01-01

    Los receptores NMDA están asociados con los procesos de aprendizaje y memoria, el desarrollo y la plasticidad neural, así como con los estados de dolor agudo y crónico. Intervienen en el inicio y mantenimiento de la sensibilización central asociada a daño o inflamación de los tejidos periféricos. El glutamato es el principal aminoácido excitatorio del SNC, puede participar en los procesos de transmisión nociceptiva a nivel espinal, siendo el principal responsable de la transmisión sináptica r...

  10. Characterization of CB1 cannabinoid receptor immunoreactivity in postmortem human brain homogenates.

    Science.gov (United States)

    De Jesús, M López; Sallés, J; Meana, J J; Callado, L F

    2006-06-30

    The CB1 cannabinoid receptor (CB1) is the predominant type of cannabinoid receptor in the CNS, in which it displays a unique anatomical distribution and is present at higher densities than most other known seven transmembrane domain receptors. Nevertheless, as with almost all seven transmembrane domain receptors, the tertiary and quaternary structure of this receptor is still unknown. Studies of CB1 in rat cerebral tissue are scarce, and even less is known regarding the expression of CB1 in the human brain. Thus, the aim of the present work was to characterize CB1 expression in membranes from postmortem human brain using specific antisera raised against this protein. Western blot analysis of P1 and P2 fractions, and crude plasma membrane preparations from the prefrontal cortex showed that CB1 migrated as a 60 kDa monomer under reducing conditions. These data were confirmed by blotting experiments carried out with human U373MG astrocytoma cells as a positive control for CB1 expression and wild-type CHO cells as negative control. In addition, when proteins were solubilized in the absence of dithiothreitol, the anti-human CB1 antiserum detected a new band migrating at around 120 kDa corresponding in size to a putative CB1 dimer. This band was sensitive to reducing agents (50 mM dithiothreitol) and showed sodium dodecylsulphate stability, suggesting the existence of disulfide-linked CB1 dimers in the membrane preparations. Important differences in the anatomical distribution of CB1 were observed with regard to that described previously in monkey and rat; in the human brain, CB1 levels were higher in cortex and caudate than in the cerebellum.

  11. Characterization of a tyramine receptor type 2 from hemocytes of rice stem borer, Chilo suppressalis.

    Science.gov (United States)

    Wu, Shun-Fan; Xu, Gang; Ye, Gong-Yin

    2015-04-01

    Calcium acts as a second messenger in many cell types, including insect hemocytes. Intracellular calcium level has a definite role in innate and adaptive immune signaling. Biogenic amines such as octopamine (OA), tyramine (TA), dopamine (DA) and serotonin (5-HT) play various important physiological roles in insects by activating distinct G-protein-coupled receptors (GPCRs) that share a putative seven transmembrane domain structure. OA and 5-HT have been shown that can mediate insect hemocytic immune reactions to infections and invasions. Here, we showed that TA increase hemocyte spreading in the rice stem borer, Chilo suppressalis. Furthermore, we cloned a cDNA encoding a tyramine receptor type 2 from the hemocytes in the C. suppressalis, viz., CsTA2, which shares high sequence similarity to members of the invertebrate tyramine receptor family. The CsTA2 receptor was stably expressed in human embryonic kidney (HEK) 293 cells, and its ligand response has been examined. Receptor activation with TA induced a dose-dependent increase in intracellular Ca(2+) concentration ([Ca(2+)]i) in cells, with an EC50 value of 18.7±5.3 nM, whereas OA, DA, 5-HT and other potential agonists did not have this response. The mRNA is present in various tissues including nerve cord, hemocytes, fat body, midgut, Malpighian tubules, and epidermis in the larval stage. Western blot analysis and immunohistochemistry assay displayed that CsTA2 was detected and presented on hemocytes. We also showed that TA induced Ca(2+) release from the hemocytes of C. suppressalis. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Sigma 1 receptor modulation of G-protein-coupled receptor signaling: potentiation of opioid transduction independent from receptor binding.

    Science.gov (United States)

    Kim, Felix J; Kovalyshyn, Ivanka; Burgman, Maxim; Neilan, Claire; Chien, Chih-Cheng; Pasternak, Gavril W

    2010-04-01

    sigma Ligands modulate opioid actions in vivo, with agonists diminishing morphine analgesia and antagonists enhancing the response. Using human BE(2)-C neuroblastoma cells that natively express opioid receptors and human embryonic kidney (HEK) cells transfected with a cloned mu opioid receptor, we now demonstrate a similar modulation of opioid function, as assessed by guanosine 5'-O-(3-[(35)S]thio)triphosphate ([(35)S]GTP gamma S) binding, by sigma(1) receptors. sigma Ligands do not compete opioid receptor binding. Administered alone, neither sigma agonists nor antagonists significantly stimulated [(35)S]GTP gamma S binding. Yet sigma receptor selective antagonists, but not agonists, shifted the EC(50) of opioid-induced stimulation of [(35)S]GTP gamma S binding by 3- to 10-fold to the left. This enhanced potency was seen without a change in the efficacy of the opioid, as assessed by the maximal stimulation of [(35)S]GTP gamma S binding. sigma(1) Receptors physically associate with mu opioid receptors, as shown by coimmunoprecipitation studies in transfected HEK cells, implying a direct interaction between the proteins. Thus, sigma receptors modulate opioid transduction without influencing opioid receptor binding. RNA interference knockdown of sigma(1) in BE(2)-C cells also potentiated mu opioid-induced stimulation of [(35)S]GTP gamma S binding. These modulatory actions are not limited to mu and delta opioid receptors. In mouse brain membrane preparations, sigma(1)-selective antagonists also potentiated both opioid receptor and muscarinic acetylcholine receptor-mediated stimulation of [(35)S]GTP gamma S binding, suggesting a broader role for sigma receptors in modulating G-protein-coupled receptor signaling.

  13. Characterization of Streptococcus sanguis molecular receptors for Streptococcus mutans binding molecules

    Directory of Open Access Journals (Sweden)

    Deby Kania Tri Putri

    2016-12-01

    Full Text Available Background: Dental caries is a major problem in oral cavity. If dental caries causes cavity, the structure of dental hard tissue will not be reversible because of damage in the structure of the hard tissue. The early pathogenesis mechanism of dental caries is an adhesion interaction between cariogenic Streptococcus mutans microorganisms and tooth surface pellicles. The attachment involves a specific molecular component interaction between the bacterial complement molecules and the surface of the host. Streptococcus sanguis as a dominant ecology at the beginning of bacterial plaque aggregation will colonize the tooth surface earlier than S. mutans. The surface of bacterial cells can express some adesin. The bacteria also can express receptors for adhesins of other bacteria. Specific receptors for adhesions of S. Mutans bacteria are not only found in the pellicles, but also present in pioneer bacteria, such as S. sanguis. Adhesion between those bacteria is called as coagregation. Purpose: This study aimed to analyze the characterization of Streptococcus sanguis molecular receptors for Streptococcus mutans binding molecules. Method: This study used a sonication method for protein isolation of S. mutans and S. sanguis bacterial biofilms, as well as electrophoresis method using 12 % SDS-PAGE gel and Western Blot analysis. Result: Results of the protein profile analysis of S. mutans biofilms using 12% SDS-PAGE showed that there were 17 bands, each of which molecular weights was 212, 140, 81, 65, 61, 48, 45, 44, 40, 39, 33 , 25, 23, 19, 17, 12, and 11 kDa. On the other hand, results of the protein profile analysis of S. sanguis biofilms using 12% SDS-PAGE showed that there were 15 bands, each of which molecular weight was 130, 85, 65, 61, 48, 46, 40, 37, 29, 25, 23, 21, 17, 15, and 12 kDa. And, results of the analysis of S. sanguis receptor molecules using Western blot showed that there were three bands, each of which molecular weight was 130, 85, and

  14. [The insuline receptor: structure and function].

    Science.gov (United States)

    De Meyts, P

    2005-01-01

    About 35 years after the first in vitro studies of the insulin receptor, considerable progress has been accomplished in the structural biology of the insulin-receptor interaction, and of the receptor tyrosine kinase family in general. This brief review attempts to assemble the various pieces of the puzzle, despite the lack of a detailed crystallographic structure of the insulin-receptor complex, and to establish a model that explains the mechanism of receptor activation, its negative cooperativity, and the triggering of intracellular signalling pathways.

  15. PODER DA VOZ EM MEDEIA

    Directory of Open Access Journals (Sweden)

    Tércia Montenegro Lemos

    2016-01-01

    Full Text Available Este artigo se debruça sobre a peça teatral Medeia, de Eurípides, vista em diálogo com algumas de suas retextualizações forjadas ao longo dos tempos, incluindo-se em nosso corpus de análise a obra Medée, do dramaturgo francês Jean Anouilh, e Gota d’água, peça brasileira criada por Chico Buarque e Paulo Pontes. Partindo do trabalho de Romilly (1975, buscamos demonstrar como tragédia e retórica são interdependentes na composição das citadas obras, sobretudo pela carga dramática das falas das personagens. Para tanto, estabelecemos um diálogo entre a retórica antiga e o moderno conceito de etos, tal como a Análise do discurso de linha francesa o entende. A categoria do etos contribui de modo importante para estabelecer fronteiras entre as variantes literárias do mito e possibilita reflexões sobre os procedimentos de intertextualidade adotados. Após as análises, observamos como o investimento da enunciação se expõe através do poder da voz nas versões de Medeia, criando um poderoso efeito psicológico para compor o perfil da protagonista.Palavras-chave: Tragédia; Retórica; Análise do discurso.

  16. Poder da voz em MEDEIA

    Directory of Open Access Journals (Sweden)

    Tércia Montenegro Lemos

    2016-01-01

    Full Text Available Este artigo se debruça sobre a peça teatral Medeia, de Eurípides, vista em diálogo com algumas de suas retextualizações forjadas ao longo dos tempos, incluindo-se em nosso corpus de análise a obra Medée, do dramaturgo francês Jean Anouilh, e Gota d’água, peça brasileira criada por Chico Buarque e Paulo Pontes. Partindo do trabalho de Romilly (1975, buscamos demonstrar como tragédia e retórica são interdependentes na composição das citadas obras, sobretudo pela carga dramática das falas das personagens. Para tanto, estabelecemos um diálogo entre a retórica antiga e o moderno conceito de etos, tal como a Análise do discurso de linha francesa o entende. A categoria do etos contribui de modo importante para estabelecer fronteiras entre as variantes literárias do mito e possibilita reflexões sobre os procedimentos de intertextualidade adotados. Após as análises, observamos como o investimento da enunciação se expõe através do poder da voz nas versões de Medeia, criando um poderoso efeito psicológico para compor o perfil da protagonista.Palavras-chave: Tragédia; Retórica; Análise do discurso.

  17. A lamin B receptor in the nuclear envelope

    Energy Technology Data Exchange (ETDEWEB)

    Worman, H.J.; Yuan, J.; Blobel, G.; Georgatos, S.D. (Rockefeller Univ., New York, NY (USA))

    1988-11-01

    Using a solution binding assay, the authors show that purified {sup 125}I-labeled lamin B binds in a saturable and specific fashion to lamin-depleted avian erythrocyte nuclear membranes with a K{sub d} of {approx} 0.2 {mu}M. This binding is significantly greater than the binding of {sup 125}I-labeled lamin A and is competitively inhibited by unlabeled ligand. They demonstrate that a 58-kDa integral membrane protein (p58) is a lamin B receptor by virtue of its abundance in the nuclear envelope and association with {sup 125}I-labeled lamin B in ligand blotting assays. Specific antibodies raised against p58 recognize one protein in isolated nuclei and partially block {sup 125}I-labeled lamin B binding to lamin-depleted nuclear membranes. Cell fractionation and indirect immunofluorescence microscopy show that p58 is located in the periphery of the nucleus. This protein may serve as a membrane attachment site for the nuclear lamina by acting as a specific receptor for lamin B.

  18. A lamin B receptor in the nuclear envelope.

    Science.gov (United States)

    Worman, H J; Yuan, J; Blobel, G; Georgatos, S D

    1988-11-01

    Using a solution binding assay, we show that purified 125I-labeled lamin B binds in a saturable and specific fashion to lamin-depleted avian erythrocyte nuclear membranes with a Kd of approximately 0.2 microM. This binding is significantly greater than the binding of 125I-labeled lamin A and is competitively inhibited by unlabeled ligand. We demonstrate that a 58-kDa integral membrane protein (p58) is a lamin B receptor by virtue of its abundance in the nuclear envelope and association with 125I-labeled lamin B in ligand blotting assays. Specific antibodies raised against p58 recognize one protein in isolated nuclei and partially block 125I-labeled lamin B binding to lamin-depleted nuclear membranes. Cell fractionation and indirect immunofluorescence microscopy show that p58 is located in the periphery of the nucleus. This protein may serve as a membrane attachment site for the nuclear lamina by acting as a specific receptor for lamin B.

  19. Receptor-Heteromer Investigation Technology and its application using BRET

    OpenAIRE

    Johnstone, Elizabeth K. M.; Pfleger, Kevin D.G.

    2012-01-01

    Receptor heteromerization has the potential to alter every facet of receptor functioning, leading to new pharmacological profiles with increased signaling diversity and regulation from that of the monomeric receptor, or indeed receptor homomer. An understanding of the molecular consequences of receptor heteromerization will provide new insights into the physiology and pathology mediated by receptors, expanding the possibilities for pharmacological discovery. Particularly advantageous approach...

  20. Agentes antitumorais inibidores da angiogênese: modelos farmacofóricos para inibidores da integrina anb3 Angiogenesis inhibitors antitumor agents: pharmacophore models to anb3 antagonists

    Directory of Open Access Journals (Sweden)

    Thais Horta Álvares da Silva

    2007-03-01

    Full Text Available O câncer é, atualmente, uma das principais causas de morte no mundo. A angiogênese, formação de novos vasos capilares a partir de células endoteliais, é essencial para vários processos fisiopatológicos, tais como o desenvolvimento e a disseminação dos tumores. As integrinas são uma família de receptores de superfície que estão envolvidos na angiogênese, na qual a integrina anb3 exerce papel importante. Os antagonistas da integrina anb3 têm efeitos diretos na prevenção do crescimento, angiogênese e metástase tumorais. A avaliação in vitro frente à integrina anb3 de coleções de ciclopeptídeos levou a compostos muito ativos e seletivos. Antagonistas não-peptídicos da integrina anb3 também foram planejados e sintetizados. A partir da determinação da estrutura tridimensional da integrina anb3 complexada com um inibidor, tornou-se possível o planejamento racional de ligantes com alta afinidade. Além disto, estes estudos permitiram a validação e o refinamento de modelo farmacofórico para os inibidores da integrina anb3.Cancer is one of the leading causes of death. Angiogenesis, the growth of new blood vessels, is essential for tumor development and spreading. Integrins are a family of surface receptors that are involved in angiogenesis. The anb3 integrin plays an important role in tumor angiogenesis. anb3 inhibitors have direct effects to prevent tumor metastases, growth and angiogenesis. In vitro screening of cyclic peptide libraries led to highly active and anb3-selective compounds. Non-peptidic anb3 antagonists were also designed and synthesized. The crystal structure of the anb3 integrin in complex with RGD ligant allowed structure-based rational design of ligands and validation of pharmacophore model to anb3 antagonists.

  1. Tertiary and quaternary structure of lung beta-adrenergic receptors

    Energy Technology Data Exchange (ETDEWEB)

    Fraser, C.M.; Venter, J.C.

    1986-05-01

    Guinea pig lung beta/sub 2/-adrenergic receptors (..beta..AR)specifically labeled with a photoaffinity probe, (/sup 125/I)-iodocyanopindolol diazirine, have a molecular mass (M/sub r/) of 68 kDa on SDS-PAGE. When labeled ..beta..AR are subjected to limited proteolysis in the membrane, water soluble fragments of M/sub r/ = 43, 30, 27 and 25 kDA are produced. These data indicate that over 50 percent of the ..beta..AR protrudes from the membrane into the extracellular space. Purification of ..beta..AR by sequential chromatography on alprenolol-Sepharose, DEAE-Sepharose and size exclusion HPLC indicates that the ..beta..AR is extracted from membranes as an oligomeric complex. Two peaks of ..beta..AR that correspond to apparent molecular weights of 370,000 (t=36 min) and 170,000 (t=43 min) elute from HPLC columns. Radioiodination of these fractions and analysis by SDS-PAGE indicates that peak 36 contains ..beta..AR (68 kDa) purified to homogeneity; peak 43 contains ..beta..AR plus other proteins. If ..beta..AR from DEAE columns are allowed to stand at 4/sup 0/C for 7 days prior to HPLC purification, all ..beta..AR elute in peak 43. These data suggest that ..beta..AR are isolated from membranes as dissociable oligomeric complexes. Target size analysis (TSA) of intact ..beta..AR in situ supports the idea of ..beta..AR oligomers. Application of TSA to ..beta..AR indicates that the ..beta..AR has a functional molecular size of 124,000 daltons in the membrane and 270,000 daltons when solubilized with digitonin.

  2. A procura do belo e da verdade

    OpenAIRE

    Tavares, Cristina Azevedo, 1956-

    2012-01-01

    Contém: 1:Paidéia. 2:Da teoria da arte à representação do corpo. 3: O mundo medieval, as ideias estéticas e a medicina. 4: Os tratados, programa e método. Berengário da Capri e a beleza humanista: o corpo de Apolo como esplendor do conhecimento. Vesalius: a fronteira do natural e do ideal

  3. O corpo como suporte da Arte

    Directory of Open Access Journals (Sweden)

    Beatriz Ferreira Pires

    Full Text Available Este artigo se baseia na Dissertação de Mestrado da autora – que é arquiteta e artista plástica – elaborada junto ao Instituto de Artes da Unicamp. Nele, nos é apresentado uma visão sobre a prática da Body Modification relacionando-a com aspectos inconscientes, oníricos, lúdicos e sexuais.

  4. Rawls, Hegel e o liberalismo da liberdade

    OpenAIRE

    Ramos, Cesar Augusto

    2005-01-01

    Este artigo procura examinar a avaliação de Rawls acerca de alguns aspectos da filosofia política de Hegel. Rawls interpreta Hegel como um liberal de mente moderadamente reformista, e seu liberalismo é um importante exemplar na história do liberalismo da liberdade. Pretendemos, primeiramente, examinar o estatuto do liberalismo de Hegel, particularmente a questão da liberdade individual. Em segundo lugar, apresentamos alguns aspectos do entendimento de Rawls acerca deste liberalismo. A plausib...

  5. Significados culturais da asma infantil

    OpenAIRE

    Frota,Mirna Albuquerque; Martins,Mariana Cavalcante; Santos,Rita de Cássia Andrade Neiva

    2008-01-01

    OBJETIVO: Analisar os significados culturais da asma infantil com origem na mãe-cuidadora. PROCEDIMENTOS METODOLÓGICOS: Pesquisa qualitativa realizada em 2004, no município de Fortaleza, CE. Foi utilizada a observação participante com abordagem etnográfica e entrevistas com sete mães acompanhantes de seus filhos em unidade de emergência hospitalar. Os significados das falas das mães foram identificados utilizando-se a técnica de análise temática. ANÁLISE DOS RESULTADOS: Foram identificadas du...

  6. O design da marca Colcci

    OpenAIRE

    Melo Filho, álvaro de

    2010-01-01

    Na contemporaneidade, o design da marca se configura em sua complexidade, onde a marca, seus simbolos, valores, imagem, produtos, pontos de venda, comunicação, merchandising e o relacionamento com o cliente estão imbricados em um trabalho com objetivo único: o de proporcionar os significados, funcionais e emocionais, que serão traduzidos por um grupo de pessoas que compartilham o mesmo código. A marca, portanto, fornece mais que a simples identificação de um produto, serviço ou empresa; ela s...

  7. O PAPEL DA ÁFRICA NA NOVA ROTA DA SEDA MARÍTIMA

    Directory of Open Access Journals (Sweden)

    Diego Pautasso

    2017-01-01

    Full Text Available O objetivo do presente artigo é analisar o lugar da África na construção da Nova Rota da Seda Marítima. Este é justamente um dos vetores do ambicioso projeto chinês de integração da Ásia, Europa e África, lançada em 2013 sob título de Iniciativa OBOR (One Belt, One Road. Na medida que os desafios da reconstrução nacional são superados, a China torna-se mais assertiva e dá forma à sua estratégia de inserção mundial. Nesse sentido, a Nova Rota da Seda agrega os objetivos centrais da diplomacia da China para o século XXI, reservando à África a condição de trampolim para que o projeto se torne global.

  8. Visoes do lector in fabula: teorias da interpretacao, da recepcao e do consumo midiatico

    National Research Council Canada - National Science Library

    Albano da Costa, Sebastiao Guilherme

    2011-01-01

    .... Nesse percurso, remonta-se as acepcoes filosoficas, especialmente a Hermeneutica, passa-se pela Teoria da Recepcao e aporta-se na Teoria da Consumo, o que orienta o estudo para uma remissao constante...

  9. Differences in the interaction of acetylcholine receptor antibodies with receptor from normal, denervated and myasthenic human muscle.

    OpenAIRE

    Lefvert, A. K.

    1982-01-01

    The interaction of acetylcholine receptor antibodies with different kinds of human skeletal muscle receptor was investigated. The reaction of most receptor antibodies was strongest with receptor from a patient with myasthenia gravis and with receptor from denervated muscle. Results obtained with these receptors were well correlated. The binding of most receptor antibodies to receptor from functionally normal muscle was much weaker and also qualitatively different. In a few patients with moder...

  10. Regulation of AMPA receptor lateral movements

    Science.gov (United States)

    Borgdorff, Aren J.; Choquet, Daniel

    2002-06-01

    An essential feature in the modulation of the efficacy of synaptic transmission is rapid changes in the number of AMPA (α-amino-3-hydroxy-5-methyl-4-isoxazole propionic acid) receptors at post-synaptic sites on neurons. Regulation of receptor endo- and exocytosis has been shown to be involved in this process. Whether regulated lateral diffusion of receptors in the plasma membrane also participates in receptor exchange to and from post-synaptic sites remains unknown. We analysed the lateral mobility of native AMPA receptors containing the glutamate receptor subunit GluR2 in rat cultured hippocampal neurons, using single-particle tracking and video microscopy. Here we show that AMPA receptors alternate within seconds between rapid diffusive and stationary behaviour. During maturation of neurons, stationary periods increase in frequency and length, often in spatial correlation with synaptic sites. Raising intracellular calcium, a central element in synaptic plasticity, triggers rapid receptor immobilization and local accumulation on the neuronal surface. We suggest that calcium influx prevents AMPA receptors from diffusing, and that lateral receptor diffusion to and from synaptic sites acts in the rapid and controlled regulation of receptor numbers at synapses.

  11. Biochemical enrichment and biophysical characterization of a taste receptor for L-arginine from the catfish, Ictalurus puntatus

    Directory of Open Access Journals (Sweden)

    Spielman Andrew I

    2004-07-01

    Full Text Available Abstract Background The channel catfish, Ictalurus punctatus, is invested with a high density of cutaneous taste receptors, particularly on the barbel appendages. Many of these receptors are sensitive to selected amino acids, one of these being a receptor for L-arginine (L-Arg. Previous neurophysiological and biophysical studies suggested that this taste receptor is coupled directly to a cation channel and behaves as a ligand-gated ion channel receptor (LGICR. Earlier studies demonstrated that two lectins, Ricinus communis agglutinin I (RCA-I and Phaseolus vulgaris Erythroagglutinin (PHA-E, inhibited the binding of L-Arg to its presumed receptor sites, and that PHA-E inhibited the L-Arg-stimulated ion conductance of barbel membranes reconstituted into lipid bilayers. Results Both PHA-E and RCA-I almost exclusively labeled an 82–84 kDa protein band of an SDS-PAGE of solubilized barbel taste epithelial membranes. Further, both rhodamine-conjugated RCA-I and polyclonal antibodies raised to the 82–84 kDa electroeluted peptides labeled the apical region of catfish taste buds. Because of the specificity shown by RCA-I, lectin affinity was chosen as the first of a three-step procedure designed to enrich the presumed LGICR for L-Arg. Purified and CHAPS-solubilized taste epithelial membrane proteins were subjected successively to (1, lectin (RCA-I affinity; (2, gel filtration (Sephacryl S-300HR; and (3, ion exchange chromatography. All fractions from each chromatography step were evaluated for L-Arg-induced ion channel activity by reconstituting each fraction into a lipid bilayer. Active fractions demonstrated L-Arg-induced channel activity that was inhibited by D-arginine (D-Arg with kinetics nearly identical to those reported earlier for L-Arg-stimulated ion channels of native barbel membranes reconstituted into lipid bilayers. After the final enrichment step, SDS-PAGE of the active ion channel protein fraction revealed a single band at 82–84 kDa

  12. Leiomioma da bexiga simulando neoplasia do úraco

    OpenAIRE

    Cabral-Ribeiro, J; Sousa, L; C Silva; Garcia, P.; Mendes, V.,; Ribeiro dos Santos, A

    2002-01-01

    As neoplasias de origem mesenquimatosa da bexiga são raras. Os leiomiomas representam a neoplasia mesenquimatosa benigna mais frequente da bexiga compreendendo de 0.2 a 0.5% de todos os tumores vesicais. A apresentação clínica é extremamente variável dependendo sobretudo da localização do tumor (intramural, extramural ou submucoso). Apresentamos um caso clínico de um leiomioma de localização ao nível da cúpula/superfície anterior de bexiga, de crescimento extramural que simulo...

  13. Quem tem medo da angústia?

    Directory of Open Access Journals (Sweden)

    Vera Lopes Besset

    Full Text Available Este texto insere-se na discussão atual no Grupo de Trabalho “Psicopatologia e Psicanálise”, da Anpepp, sobre o tema da angústia. Nesse sentido, traz a questão da evitação da angústia no contemporâneo, sobretudo a que se observa entre os próprios psicanalistas, às vezes muito ávidos das soluções oferecidas por uma psiquiatria atual ancorada nos novos e eficazes medicamentos.

  14. Por uma arte no mundo da vida

    Directory of Open Access Journals (Sweden)

    Rachel Costa

    2016-12-01

    Full Text Available O artigo visa debater a análise colocada por Jacinto Lageira no texto “As razões do agir, contribuição a uma poética da ação”. O debate se estabelece no que concerne ao problema da autonomia da arte e suas consequências, tendo em vista a necessidade de pensar possibilidades contemporâneas para a experiência estética que pressuponham o mundo material. Isso é realizado a partir da teoria dos gestos do filósofo Vilém Flusser.

  15. Georg Simmel e a "sociologia da pobreza"

    Directory of Open Access Journals (Sweden)

    Anete B. L. Ivo

    Full Text Available O artigo apresenta os principais aspectos tratados no livro Les Pauvres [1907], de Georg Simmel, sobre os pobres e apobreza. O autor parte das relações intersubjetivas da obrigação da dádiva, no ato de dar/receber, avançando em proposições teóricas mais amplas, como: as relações entre a ética, a moral e a sociedade; a articulação entre o particular e o geral com base na posição de dependência dos pobres frente à coletividade; a passagem da noção abstrata da pobreza às formas regulatórias da assistência e sua objetivação social na forma de instituições públicas e/ou privadas da assistência. Ao final o autor estabelece algumas conexões entre a análise de Simmel e a perspectiva contemporânea da teoria da dádiva em relaçãoà proteção social, especialmente sobre a renda mínima de cidadania. Ao analisar a situação da pobreza, Simmel encaminha, no plano teórico e analítico, uma fecunda análise sobre a estruturação social.

  16. Usos da ruralidade na arquitectura paisagista

    OpenAIRE

    Xavier, Sandra

    2013-01-01

    Procurarei pensar os projectos e o processo de trabalho do arquitecto paisagista João Gomes da Silva através do conceito de objectificação da cultura de Richard Handler. João Gomes da Silva segue a escola de arquitectura paisagista fundada por Francisco Caldeira Cabral e inclui frequentemente tipologias rurais, como elementos representativos da identidade do lugar, em jardins públicos e privados, em espaços públicos e urbanos. Influenciado pelo arquitecto Álvaro Siza Vieira e, através dele, p...

  17. A morte da culpa na responsabilidade contratual

    OpenAIRE

    Marcos Jorge Catalan

    2011-01-01

    Esta pesquisa tem, por hipótese, a morte da culpa na responsabilidade contratual e, por objeto, aferir se o aludido elemento subjetivo pode (ou não) ser suprimido da arquitetura jurídica da responsabilidade contratual. Vale resgatar que, se é certo não sem vozes em sentido oposto que, em muitos momentos, o direito contratual não reservou papel algum à culpa, em outros tantos instantes, na visão da doutrina majoritária, ela continua a brilhar como em seus momentos de maior esplendor. A tese ...

  18. Targeting nuclear receptors with marine natural products.

    Science.gov (United States)

    Yang, Chunyan; Li, Qianrong; Li, Yong

    2014-01-27

    Nuclear receptors (NRs) are important pharmaceutical targets because they are key regulators of many metabolic and inflammatory diseases, including diabetes, dyslipidemia, cirrhosis, and fibrosis. As ligands play a pivotal role in modulating nuclear receptor activity, the discovery of novel ligands for nuclear receptors represents an interesting and promising therapeutic approach. The search for novel NR agonists and antagonists with enhanced selectivities prompted the exploration of the extraordinary chemical diversity associated with natural products. Recent studies involving nuclear receptors have disclosed a number of natural products as nuclear receptor ligands, serving to re-emphasize the translational possibilities of natural products in drug discovery. In this review, the natural ligands of nuclear receptors will be described with an emphasis on their mechanisms of action and their therapeutic potentials, as well as on strategies to determine potential marine natural products as nuclear receptor modulators.

  19. Targeting Nuclear Receptors with Marine Natural Products

    Directory of Open Access Journals (Sweden)

    Chunyan Yang

    2014-01-01

    Full Text Available Nuclear receptors (NRs are important pharmaceutical targets because they are key regulators of many metabolic and inflammatory diseases, including diabetes, dyslipidemia, cirrhosis, and fibrosis. As ligands play a pivotal role in modulating nuclear receptor activity, the discovery of novel ligands for nuclear receptors represents an interesting and promising therapeutic approach. The search for novel NR agonists and antagonists with enhanced selectivities prompted the exploration of the extraordinary chemical diversity associated with natural products. Recent studies involving nuclear receptors have disclosed a number of natural products as nuclear receptor ligands, serving to re-emphasize the translational possibilities of natural products in drug discovery. In this review, the natural ligands of nuclear receptors will be described with an emphasis on their mechanisms of action and their therapeutic potentials, as well as on strategies to determine potential marine natural products as nuclear receptor modulators.

  20. Receptor arrays optimized for natural odor statistics

    CERN Document Server

    Zwicker, David; Brenner, Michael P

    2016-01-01

    Natural odors typically consist of many molecules at different concentrations. It is unclear how the numerous odorant molecules and their possible mixtures are discriminated by relatively few olfactory receptors. Using an information-theoretic model, we show that a receptor array is optimal for this task if it achieves two possibly conflicting goals: (i) each receptor should respond to half of all odors and (ii) the response of different receptors should be uncorrelated when averaged over odors presented with natural statistics. We use these design principles to predict statistics of the affinities between receptors and odorant molecules for a broad class of odor statistics. We also show that optimal receptor arrays can be tuned to either resolve concentrations well or distinguish mixtures reliably. Finally, we use our results to predict properties of experimentally measured receptor arrays. Our work can thus be used to better understand natural olfaction and it also suggests ways to improve artificial sensor...

  1. Molecular determinants of NMDA receptor internalization.

    Science.gov (United States)

    Roche, K W; Standley, S; McCallum, J; Dune Ly, C; Ehlers, M D; Wenthold, R J

    2001-08-01

    Although synaptic AMPA receptors have been shown to rapidly internalize, synaptic NMDA receptors are reported to be static. It is not certain whether NMDA receptor stability at synaptic sites is an inherent property of the receptor, or is due to stabilization by scaffolding proteins. In this study, we demonstrate that NMDA receptors are internalized in both heterologous cells and neurons, and we define an internalization motif, YEKL, on the distal C-terminus of NR2B. In addition, we show that the synaptic protein PSD-95 inhibits NR2B-mediated internalization, and that deletion of the PDZ-binding domain of NR2B increases internalization in neurons. This suggests an involvement for PSD-95 in NMDA receptor regulation and an explanation for NMDA receptor stability at synaptic sites.

  2. Taste Receptors: Regulators of Sinonasal Innate Immunity

    Science.gov (United States)

    Carey, Ryan M.; Adappa, Nithin D.; Palmer, James N.; Lee, Robert J.

    2016-01-01

    Taste receptors in the oral cavity guide our preferences for foods, preventing toxic ingestions and encouraging proper nutrient consumption. More recently, expression of taste receptors has been demonstrated in other locations throughout the body, including the airway, gastrointestinal tract, pancreas, and brain. The extent and specific roles of extraoral taste receptors are largely unknown, but a growing body of evidence suggests that taste receptors in the airway serve a critical role in sensing bacteria and regulating innate immunity. This review will focus on the function of bitter and sweet taste receptors in the human airway, with particular emphasis on T2R38, a bitter taste receptor found in sinonasal ciliated cells, and the bitter and sweet receptors found on specialized sinonasal solitary chemosensory cells. The importance of these novel taste receptor‐immune circuits in the human airway and their clinical relevance in airway disease will also be reviewed. PMID:27819057

  3. Neurosteroid regulation of GABAA receptors

    Science.gov (United States)

    Smith, Sheryl S.; Shen, Hui; Gong, Qi Hua; Zhou, Xiangping

    2007-01-01

    Neurosteroids, such as the progesterone metabolite 3α-OH-5α[β]-pregnan-20-one (THP or [allo]pregnanolone), function as potent positive modulators of the GABAA receptor (GABAR) when acutely administered. However, fluctuations in the circulating levels of this steroid at puberty, across endogenous ovarian cycles, during pregnancy or following chronic stress produce periods of prolonged exposure and withdrawal, where changes in GABAR subunit composition may occur as compensatory responses to sustained levels of inhibition. A number of laboratories have demonstrated that both chronic administration of THP as well as its withdrawal transiently increase expression of the α4 subunit of the GABAR in several areas of the central nervous system (CNS) as well as in in vitro neuronal systems. Receptors containing this subunit are insensitive to benzodiazepine (BDZ) modulation and display faster deactivation kinetics, which studies suggest underlie hyperexcitability states. Similar increases in α4 expression are triggered by withdrawal from other GABA-modulatory compounds, such as ethanol and BDZ, suggesting a common mechanism. Other studies have reported puberty or estrous cycle-associated increases in δ-GABAR, the most sensitive target of these steroids which underlies a tonic inhibitory current. In the studies reported here, the effect of steroids on inhibition, which influence anxiety state and seizure susceptibility, depend not only on the subunit composition of the receptor but also on the direction of Cl- current generated by these target receptors. The effect of neurosteroids on GABAR function thus results in behavioral outcomes relevant for pubertal mood swings, premenstrual dysphoric disorder and catamenial epilepsy, which are due to fluctuations in endogenous steroids. PMID:17512983

  4. Functional Characterization of Odorant Receptors

    Science.gov (United States)

    1994-02-07

    benzaldehyde, will then be expressed and functionally characterized in Sf9 insect cells using a baculovirus expression system. a. Construction and...Preferential expression of the Drosophila rutabaga gene in mushroom bodies, neural centers for learning in insects . Neuron 9, 619-627. Helfand, S. L...containing G-protein linked receptor that couples a novel odorant binding domain consisting of the 1-15 moiety (and perhaps part of the adrenaline

  5. Developmental changes in human dopamine neurotransmission: cortical receptors and terminators

    Directory of Open Access Journals (Sweden)

    Rothmond Debora A

    2012-02-01

    Full Text Available Abstract Background Dopamine is integral to cognition, learning and memory, and dysfunctions of the frontal cortical dopamine system have been implicated in several developmental neuropsychiatric disorders. The dorsolateral prefrontal cortex (DLPFC is critical for working memory which does not fully mature until the third decade of life. Few studies have reported on the normal development of the dopamine system in human DLPFC during postnatal life. We assessed pre- and postsynaptic components of the dopamine system including tyrosine hydroxylase, the dopamine receptors (D1, D2 short and D2 long isoforms, D4, D5, catechol-O-methyltransferase, and monoamine oxidase (A and B in the developing human DLPFC (6 weeks -50 years. Results Gene expression was first analysed by microarray and then by quantitative real-time PCR. Protein expression was analysed by western blot. Protein levels for tyrosine hydroxylase peaked during the first year of life (p O-methyltransferase (p = 0.024 were significantly higher in neonates and infants as was catechol-O-methyltransferase protein (32 kDa, p = 0.027. In contrast, dopamine D1 receptor mRNA correlated positively with age (p = 0.002 and dopamine D1 receptor protein expression increased throughout development (p Conclusions We find distinct developmental changes in key components of the dopamine system in DLPFC over postnatal life. Those genes that are highly expressed during the first year of postnatal life may influence and orchestrate the early development of cortical neural circuitry while genes portraying a pattern of increasing expression with age may indicate a role in DLPFC maturation and attainment of adult levels of cognitive function.

  6. Serotonin 5-HT2 receptor interactions with dopamine function: implications for therapeutics in cocaine use disorder.

    Science.gov (United States)

    Howell, Leonard L; Cunningham, Kathryn A

    2015-01-01

    Cocaine exhibits prominent abuse liability, and chronic abuse can result in cocaine use disorder with significant morbidity. Major advances have been made in delineating neurobiological mechanisms of cocaine abuse; however, effective medications to treat cocaine use disorder remain to be discovered. The present review will focus on the role of serotonin (5-HT; 5-hydroxytryptamine) neurotransmission in the neuropharmacology of cocaine and related abused stimulants. Extensive research suggests that the primary contribution of 5-HT to cocaine addiction is a consequence of interactions with dopamine (DA) neurotransmission. The literature on the neurobiological and behavioral effects of cocaine is well developed, so the focus of the review will be on cocaine with inferences made about other monoamine uptake inhibitors and releasers based on mechanistic considerations. 5-HT receptors are widely expressed throughout the brain, and several different 5-HT receptor subtypes have been implicated in mediating the effects of endogenous 5-HT on DA. However, the 5-HT2A and 5-HT2C receptors in particular have been implicated as likely candidates for mediating the influence of 5-HT in cocaine abuse as well as to traits (e.g., impulsivity) that contribute to the development of cocaine use disorder and relapse in humans. Lastly, new approaches are proposed to guide targeted development of serotonergic ligands for the treatment of cocaine use disorder. Copyright © 2014 by The American Society for Pharmacology and Experimental Therapeutics.

  7. Panorama da Cadeia Produtiva da Suinocultura no Estado de Mato Grosso

    OpenAIRE

    Karine Medeiros Anunciato; Nelson Leitão Paes

    2016-01-01

    O presente estudo tem como objetivo geral descrever a cadeia produtiva da suinocultura no estado de Mato Grosso. A metodologia utilizada buscou detalhar a cadeia produtiva da suinocultura através de dados fornecidos da pesquisa de campo da ACRISMAT realizada em 2010, aplicada diretamente com 81 produtores e 09 frigoríficos. Em complemento foram entrevistados representantes de cooperativas deste segmento, no ano de 2014. A ACRISMAT considerou como amostra as microrregiões com maior representat...

  8. A divisão da cristandade: da reforma protestante à era do iluminismo - Book review

    OpenAIRE

    Claudia Danielle Andrade Ritz

    2016-01-01

    Livro:DAWSON, Christopher. A divisão da cristandade: Da reforma protestante à era do iluminismo. São Paulo: É Realizações Editora, 2014.  BookDAWSON, Christopher. A divisão da cristandade: da reforma protestante à era do iluminismo. São Paulo: É Realizações Editora, 2014. 368p. ISBN 978-85-8033-167-7

  9. A new family of insect tyramine receptors.

    Science.gov (United States)

    Cazzamali, Giuseppe; Klaerke, Dan A; Grimmelikhuijzen, Cornelis J P

    2005-12-16

    The Drosophila Genome Project database contains a gene, CG7431, annotated to be an "unclassifiable biogenic amine receptor." We have cloned this gene and expressed it in Chinese hamster ovary cells. After testing various ligands for G protein-coupled receptors, we found that the receptor was specifically activated by tyramine (EC(50), 5x10(-7)M) and that it showed no cross-reactivity with beta-phenylethylamine, octopamine, dopa, dopamine, adrenaline, noradrenaline, tryptamine, serotonin, histamine, and a library of 20 Drosophila neuropeptides (all tested in concentrations up to 10(-5) or 10(-4)M). The receptor was also expressed in Xenopus oocytes, where it was, again, specifically activated by tyramine with an EC(50) of 3x10(-7)M. Northern blots showed that the receptor is already expressed in 8-hour-old embryos and that it continues to be expressed in all subsequent developmental stages. Adult flies express the receptor both in the head and body (thorax/abdomen) parts. In addition to the Drosophila tyramine receptor gene, CG7431, we found another closely related Drosophila gene, CG16766, that probably also codes for a tyramine receptor. Furthermore, we annotated similar tyramine-like receptor genes in the genomic databases from the malaria mosquito Anopheles gambiae and the honeybee Apis mellifera. These four tyramine or tyramine-like receptors constitute a new receptor family that is phylogenetically distinct from the previously identified insect octopamine/tyramine receptors. The Drosophila tyramine receptor is, to our knowledge, the first cloned insect G protein-coupled receptor that appears to be fully specific for tyramine.

  10. DMPD: Signal transduction by the lipopolysaccharide receptor, Toll-like receptor-4. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 15379975 Signal transduction by the lipopolysaccharide receptor, Toll-like receptor... Signal transduction by the lipopolysaccharide receptor, Toll-like receptor-4. PubmedID 15379975 Title Signa...l transduction by the lipopolysaccharide receptor, Toll-like receptor-4. Authors

  11. Influência da decorticação vertebral na neoformação dos tecidos da interface do enxerto ósseo Influence of vertebral decortication on tissue neoformation at bone graft interface

    Directory of Open Access Journals (Sweden)

    Fabiano Ricardo Tavares Canto

    2010-01-01

    Full Text Available OBJETIVO: Determinar a influência da decorticação dos elementos posteriores da coluna vertebral na integração do enxerto ósseo, considerando a avaliação quantitativa e qualitativa dos tecidos (ósseo, cartilaginoso e fibroso da interface entre o leito receptor e o enxerto ósseo. MÉTODOS: Foram utilizados 24 ratos Wistar, divididos em dois grupos de acordo com a realização da decorticação do leito receptor do enxerto. Foi utilizado enxerto autólogo derivado dos processos espinhosos das duas primeiras vértebras lombares. A neoformação tecidual na interface entre o leito receptor e seu enxerto ósseo foi avaliada após três semanas por meio de análise histomorfométrica. RESULTADOS: No grupo de animais com o leito receptor decorticado a média da porcentagem de osso neoformado foi de 40%±6,1, e 7,7%± 3,5 no grupo não decorticado (p=0,0001. A média da porcentagem de formação do tecido cartilaginoso no grupo decorticado foi de 7,2%±3,5, no não decorticado de 10,9%±5,6 (p=0,1123. A formação de tecido fibroso no grupo decorticado apresentou média de 8,6%±3,9 e no não decorticado e 24%±10,1, (p=0,0002. CONCLUSÕES: A decorticação acelerou o processo histológico da integração do enxerto ósseo. Ocorrendo maior produção de tecido ósseo neoformado e predomínio da ossificação do tipo intramembranosa no grupo de animais nos quais a decorticação foi realizada.OBJECTIVE: To determine the influence of vertebral posterior elements decortication in bone graft integration, considering a qualitative and quantitative evaluation of the (bone, cartilaginous, and fibrous tissues in the interface between the receptor bed and the bone graft. METHODS: Twenty-four Wistar rats were divided into two groups according to the decortication of the bone graft receptor bed. Autologous bone graft from the first and second lumbar vertebrae were used. The new tissue formation in the interface between the receptor bed and its bone graft

  12. Oficinas da cidade em Fortaleza

    Directory of Open Access Journals (Sweden)

    Cordeiro Andréa Carla de Filgueiras

    2002-01-01

    Full Text Available Este artigo trata do relato de uma experiência de intervenção focal com crianças na cidade de Fortaleza, na qual se procurou, através de discussões em grupo, possibilitar a construção e a re-construção das experiências destes sujeitos na cidade. Partiu-se da premissa que viver hoje na cidade contemporânea requer do sujeito orientação crítica para que ele se situe frente às demandas do viver coletivo. Três momentos de discussão foram focalizados: a reflexão sobre a experiência vivida na cidade; a imaginação sobre as possibilidades deste viver; e a discussão sobre o vivido e o desejado, visando a uma re-construção possível da cidade. As crianças mostraram capacidade de analisar criticamente sua experiência na cidade, apontando os aspectos que, do seu ponto de vista, tornam o viver na cidade particularmente difícil para elas. Mostraram, também, capacidade de indicar caminhos coletivos que suavizariam a tarefa de viver na cidade grande, principalmente quando não se é adulto, e sim criança.

  13. Actinomicose da Mama em Gestante

    Directory of Open Access Journals (Sweden)

    Mottola Jr Juvenal

    2001-01-01

    Full Text Available A actinomicose mamária é doença inflamatória rara, com poucos casos descritos na literatura. Pode ser primária da mama quando resultante de traumas na pele e papila mamária, e, secundária, quando de origem toracopleural. Sua apresentação clínica é variável, devendo ser diferenciada das doenças mais comuns, dentre elas as mastites e também as neoplasias, como o carcinoma inflamatório. Seu diagnóstico é realizado pela cultura da secreção, com a identificação das colônias de Actinomyces sp. Seu tratamento é a drenagem, quando indicada, a antibioticoterapia endovenosa e manutenção oral por tempo prolongado. Os autores relatam caso de abscesso retromamário por Actinomyces sp. em gestante de 12 semanas que apresentava tumoração mamária expansiva na mama esquerda.

  14. Da cultura e da fé no pensamento de Arnaldo de Pinho

    OpenAIRE

    Gama, Manuel

    2012-01-01

    Análise do pensamento de Arnaldo Pinho à volta de um círculo temático central: o problema da cultura, a dimensão da fé e a inter-relação entre ambas, ou seja, a expressão da fé na cultura atual

  15. ESTUDO DA PASTEURIZAÇÃO DA POLPA DE MURUCI

    Directory of Open Access Journals (Sweden)

    A. C. A. PELAIS

    2008-12-01

    Full Text Available

    Estudou-se o processo de pasteurização da polpa de muruci (Byrsonima crassifolia e avaliou-se a vida-de-prateleira do produto. Não foi detectada atividade para as enzimas peroxidase e polifenoloxidase na polpa in natura. Primeiramente, foram realizados testes, em escala de bancada, em três temperaturas (70, 80 e 90°C e três tempos (1, 60 e 300 segundos. A variação da cor (colorimetria tristimulus, as contagens de bactérias mesófilas totais e de fungos (bolores e leveduras foram as variáveis de resposta. Todos os tratamentos destruíram os fungos e reduziram a carga bacteriana. A temperatura de pasteurização provocou variação signifi cativa nos parâmetros de cor b* e L*, porém em pequena escala (menor que 1%. Em um segundo momento, a polpa foi submetida à pasteurização, em escala piloto, utilizando processo hot fi ll. Foram testadas duas temperaturas (80 e 90°C, sem e com adição de conservante. Amostras do produto, após pasteurização, foram armazenadas a 25°C, por 120 dias. Os tratamentos foram efi cientes em relação às variáveis avaliadas, em todas as condições aplicadas; estando os produtos aptos para consumo, de acordo com a legislação brasileira. As coordenadas de cor L*, a* e b* sofreram variação signifi cativa (p < 0,05 durante o armazenamento, com diminuição média de 10% de b* e L*. A pasteurização da polpa de muruci, sem adição de conservante, mostrou-se apropriada para produção em pequena escala.

  16. Receptores GPS para georreferenciamento da variabilidade espacial de atributos do solo

    OpenAIRE

    Rosalen, David L; Rodrigues, Marcos S; Chioderoli, Carlos A; Brandão, Flavia J. C; Siqueira, Diego S

    2011-01-01

    The characterization of the spatial variability of soil attributes is essential to support agricultural practices in a sustainable manner. The use of geostatistics to characterize spatial variability of these attributes, such as soil resistance to penetration (RP) and gravimetric soil moisture (GM) is now usual practice in precision agriculture. The result of geostatistical analysis is dependent on the sample density and other factors according to the georeferencing methodology used. Thus, th...

  17. A cirurgia da endomiocardiofibrose revisitada

    Directory of Open Access Journals (Sweden)

    Carlos R. MORAES

    1998-04-01

    Full Text Available Entre dezembro de 1977 e dezembro de 1997, 83 doentes com endomiocardiofibrose (EMF foram submetidos a decorticação endocárdica e substituição ou reparo das valvas atrioventriculares. Sessenta e seis (79,6% eram do sexo feminino e 17 (20,4% do masculino, variando as idades de 4 a 59 anos (média 31. Trinta e sete (44,5% pacientes tinham doença biventricular, 34 (41% apenas do ventrículo direito e 12 (14,5% apresentavam EMF limitada ao ventrículo esquerdo. Todos estavam na classe funcional III ou IV da classificação da New York Heart Association. Sessenta e oito (81,9% pacientes sobreviveram à operação e foram seguidos por período de tempo que variou de um mês a 17 anos. O tempo total de seguimento foi de 6.290 pacientes/meses (média: 92 meses. Houve 15 óbitos tardios, mas em 6 a causa não esteve relacionada à doença de base. Quatro (5,8% doentes apresentaram recidiva da fibrose e foram reoperados; em 6 (8,8% apareceu fibrose no outro ventrículo. Cinco (7,3% pacientes foram reoperados, seja para retroca de prótese valvular, seja para substituir a valva preservada na primeira operação. Somente 24 (45% dos atuais 53 sobreviventes estão em classe funcional I ou II. A curva de sobrevida actuarial, incluindo a mortalidade operatória, revelou que a probabilidade de sobrevida, 17 anos após a operação, é de 55%. Conclui-se que o tratamento cirúrgico da EMF deve ser considerado um procedimento paliativo porque a operação não impede a progressão da doença. Mesmo assim a operação é recomendada em pacientes com EMF e sintomas de insuficiência cardíaca, visto ser a única forma de tratamento.Eighty-three patients with endomyocardial fibrosis (EMF underwent endocardial decortication and atrioventricular valve replacement or repair between December, 1977, and December, 1997. There were 66 (79.6% female and 17 (20.4% male patients, ranging in age from 4 to 59 years (mean, 31. Thirty-seven (44.5% had biventricular disease

  18. O momento da saída do abrigo por causa da maioridade: a voz dos adolescentes

    Directory of Open Access Journals (Sweden)

    Ana Laura Moraes Martinez

    2008-12-01

    Full Text Available O que significa para um adolescente crescer num abrigo? E o que significa para ele ter que deixá-lo por causa da maioridade legal? Na tentativa de compreender essas questões, a presente pesquisa foi construída junto com dois adolescentes que vivenciavam a saída do abrigo, após terem permanecido na instituição por 12 anos. Partindo de uma perspectiva histórico-cultural, utilizou-se para a construção do corpus, observações participantes, entrevistas com os adolescentes e equipe técnica, além de produções narrativas de um dos adolescentes. O eixo norteador da análise foram os sentidos produzidos sobre a saída do abrigo. Entre os apontamentos finais, verificou-se a ausência de práticas sistemáticas de auxílio aos adolescentes no enfrentamento da saída e a existência de atuações individualizadas, permeadas pelos estereótipos construídos pela instituição. Enquanto um dos adolescentes (o adolescente ativo construiu arranjos próprios para sua saída, o outro (o adolescente problema foi intensamente tutelado pela instituição nesse processo de desligamento.

  19. Semelhança e verossimilhança: horizontes da narrativa etnográfica

    Directory of Open Access Journals (Sweden)

    João de Pina Cabral

    2003-04-01

    Full Text Available Este ensaio se desenvolve a partir da noção de que uma condição indispensável para a comunicação é que o emissor e o receptor, por um lado, aceitem que são semelhantes e, por outro, partilhem de um contexto de semelhança. Esta semelhança estabelece os parâmetros de avaliação da mensagem. Assim, a semelhança é condição da verossimilhança. Estas considerações, inspiradas em uma leitura da obra de Donald Davidson, são usadas neste texto para abordar algumas das implicações culturais do fenômeno da tradução (visto à luz do conceito quiniano de "indeterminação", assim como da prática etnográfica. Como exemplo, recorre-se à proto-etnografia quinhentista de Duarte Barbosa - tornada famosa pela sua descrição dos Nayar.This essay starts out from the notion that an indispensable condition for communication is that the sender and receiver (a accept they are similar, and (b share a context of similarity. This similarity sets the parameters for the message’s evaluation. Thus similarity is a condition of verisimilitude. Inspired by Donald Davidson’s work, the text makes use of his above ideas as a means of approaching some of the cultural implications of both the phenomenon of translation (seen in the light of the Quinean concept of ‘indeterminacy’ and the practice of ethnography. As an example, the essay turns to Duarte Barbosa’s 16th century proto-ethnography, made famous by his description of the Nayar.

  20. Complex GABAB receptor complexes: how to generate multiple functionally distinct units from a single receptor

    Directory of Open Access Journals (Sweden)

    Chanjuan eXU

    2014-02-01

    Full Text Available The main inhibitory neurotransmitter, GABA, acts on both ligand-gated and G protein-coupled receptors, the GABAA/C and GABAB receptors, respectively. The later play important roles in modulating many synapses, both at the pre- and post-synaptic levels, and are then still considered as interesting targets to treat a number of brain diseases, including addiction. For many years, several subtypes of GABAB receptors were expected, but cloning revealed only two genes that work in concert to generate a single type of GABAB receptor composed of two subunits. Here we will show that the signaling complexity of this unit receptor type can be largely increased through various ways, including receptor stoichiometry, subunit isoforms, membrane expression and localization, crosstalk with other receptors or interacting proteins. These recent data revealed how complexity of a receptor unit can be increased, observation that certainly are not unique to the GABAB receptor.