Directory of Open Access Journals (Sweden)
Laksmindra Fitria
2017-06-01
Full Text Available Darah merupakan komponen penting karena menunjukkan kondisi fisiologis individu. Oleh karena itu darah menjadi salah satu parameter pokok dalam penelitian praklinik/ biomedik. Hematologi merupakan ilmu yang mempelajari kondisi sel-sel darah perifer dalam kondisi normal maupun patologis. Parameter pemeriksaan hematologis yang rutin dilakukan antara lain profil eritrosit dan leukosit. Sampel darah yang diterima kadangkala tidak langsung diperiksa karena berbagai alasan. Untuk menjaga supaya kondisinya tidak rusak, maka sampel darah ditambah antikoagulan dan disimpan di dalam lemari pendingin selama beberapa jam hingga beberapa hari. Penelitian ini bertujuan untuk mempelajari profil eritrosit dan leukosit pada sampel darah tikus (Rattus norvegicus Berkenhout, 1769 Galur Wistar yang sehat/normal dengan antikoagulan EDTA atau Heparin dan variasi waktu penyimpanan (0, 6, 18, 24, dan 48 jam. Untuk pembahasan lebih lanjut, data dianalisis secara statistik berdasarkan ANOVA two-factor (P0,05. Disimpulkan bahwa pemeriksaan profil hematologis yang terbaik adalah menggunakan darah tanpa antikoagulan namun harus langsung dilakukan segera setelah sampel diperoleh (sebelum darah mengalami koagulasi. Apabila tidak memungkinkan, maka dapat digunakan EDTA atau Heparin, dan jenis antikoagulan harus dijelaskan dalam pelaporannya. Pemeriksaan darah dengan antikoagulan hendaknya juga tetap dilakukan segera setelah sampel diterima (tidak ditunda.
Directory of Open Access Journals (Sweden)
Alysson Fonseca
2015-04-01
Abstract. We studied the main species of ants associated with carcasses of Rattus norvegicus (Berkenhout during the decomposition process, in different seasons in a savannah area. In each of the four seasons a carcass was disposed in the field and we installed around it five pitfall traps. Ants were collected from the tray containing the carcass and from the traps daily, until the end of decomposition in each season. Ants belonging to twenty-three species, with 63.85% of the total individuals collected in the traps and the rest directly in the trays, were sampled. The presence of predatory and nectarivorous species were registered. The scarcity of available resources in the environment in the dry season possibly makes the carcasses important food sources, explaining the higher richness of active species near the trays (collected in the pitfall traps. This increased activity is also reflected in a higher number of species and individuals in the carcasses. The opposite also seems to occur once in the autumn, end of wet season, we observed lower abundance of ants in the carcasses. The presence of ants on carcasses throughout all stages of the decomposition process and in all seasons of the year highlighted the importance of the association between representatives of this taxon and carcasses in Cerrado environments.
Vitamin K requirement in Danish anticoagulant-resistant Norway rats (Rattus norvegicus)
DEFF Research Database (Denmark)
Markussen, Mette D.; Heiberg, Ann-Charlotte; Nielsen, Robert
2003-01-01
Norway rats, Rattus norvegicus, Denmark, anticoagulant rodenticide resistance, vitamin K requirement......Norway rats, Rattus norvegicus, Denmark, anticoagulant rodenticide resistance, vitamin K requirement...
Franssen, Frits; Swart, Arno; van Knapen, Frans|info:eu-repo/dai/nl/070114749; van der Giessen, Joke
2016-01-01
BACKGROUND: Rattus norvegicus (brown rat) and Rattus rattus (black rat) are known carriers of bacteria, viruses, and parasites of zoonotic and veterinary importance. Moreover, rats may play a role in the transmission of muscle larvae of the zoonotic nematode Trichinella spiralis to farm animals. We
Yusuf Wachidah Yuiwarti, Enny; Rini Saraswati, Tyas; Kusdiyantini, Endang
2018-05-01
Virgin coconut oil (VCO) and olive oil are edible oil containing an antioxidant that can prevent free radicals in Rattus rattus norvegicus hypoglycemic due to the damage of pancreatic beta cell after alloxan injection. Virgin coconut oil and olive oil are fatty acids when being consumed will affect lipid metabolism particularly HDL, LDL and cholesterol in serum. This research aims to determine the effect of VCO and Olive oil on cholesterol levels in hyperglycemic rats. Research materials were twenty male Rattus rattus norvegicus. Randomized Factorial Design was used in four treatment groups including P1(control), P2 (mice injected with alloxan), P3 (mice injected with alloxan plus 0.1 ml/BW of each VCO and vitamin E) and P4 (mice injected with alloxan plus 0.1 ml/BW of each olive oil and vitamin E. Each treatment was replicated 5 times. Feed and water were provided adlibitum for four weeks. The result showed that there was no significant difference in the level of HDL serum across the treatments, but P4 had a significantly higher LDL than the other treatments. Moreover, total cholesterol was significantly increased in P4 compared to the other groups. It can be concluded that olive oil could increase the level of cholesterol and LDL in serum, while VCO did not increase the level of cholesterol and LDL so VCO more potential to maintain cholesterol in hyperglycemic Rattus rattus norvegicus.
Pelealu, Delano; Tendean, Lydia; Wantouw, Benny
2015-01-01
: Tribulus terrestris dikenal sebagai bahan yang dapat memperbaiki kualitas sperma. Salah satu jenis jamu yang diproduksi di Indonesia mengandung Tribulus terrestris Penelitian ini bertujuan untuk mengetahui pengaruh jamu dengan Tribulus terrestris terhadap konsentrasi, motilitas, dan morfologi spermatozoa tikus wistar jantan (Rattus norvegicus). Penelitian ini menggunakan metode eksperimental. Sampel 9 ekor tikus wistar jantan (Rattus norvegicus) dibagi menjadi 3 kelompok yakni, kelompok P0 ...
Directory of Open Access Journals (Sweden)
Mara Cagnin
1987-07-01
Full Text Available Abstract Some of the most relevant aspects of the feeding behaviour of the rat (Rattus norvegicus, Berkenhout, 1769 were examined with particular interest in the data collected on wild rats and in natural environments. The rat is considered as an omnivore and generalist species, but both in the wild and in the laboratory marked individual differences were recorded in food preferences and diet spectrum, which probably allow the natural populations to exploit a great number of habitat resources. A number of causes were identified as responsible of these differences: early pup differentiation; mother's and conspecifics' influences, etc. The importance of animal food in the rat diet is also variable. The diet of non-commensal rat colonies was examined with special reference to the predatory behaviour, which is a common habit in natural populations; furthermore the insorgence of "local traditions" such as the Mollusc predation was considered. The hypothesis of social transmission of this feeding habit, widespread in the Po river Basin and Delta, was discussed and confirmed. The hoarding behaviour, well studied under laboratory conditions, was rarely recorded in the wild. It is supposed to be a useful mechanism that the rat uses to cope with particular conditions (e.g. surplus of food, lactating females but this species cannot be defined as a "natural hoarder". The degree of neophobia is variable in populations that interact with man and it is practically absent in non-commensal populations. This confirms that it is a defensive strategy resulting from the commensal habit of the rat and not a fixed behavioural characteristic of this rodent species. The stealing of food between animals, kleptoparasitism, was frequently observed in confined rat groups in laboratory but rarely described in the wild. It is compared with the "worker-parasite" relationship supposed to be a kind of division of labour. The most important components of
Directory of Open Access Journals (Sweden)
Widyasri Prananingrum
2010-12-01
Full Text Available Background: Pulpal perforation care with direct pulp capping in the case of reversible pulpitis due to mechanical trauma was performed with chitosan which has the ability to facilitate migration, proliferation, and progenitor cell differentiation. Purpose: The purpose of this study was to determine the increasing number of odontoblast-like cells in direct pulp capping dental care of Rattus norvegicus using chitosan for seven and fourteen days. Methods: Samples were molars of male Rattus norvegicus strain wistar, aged between 8–16 weeks, divided into two treatment groups, namely group I given chitosan and group II as a control group given Ca(OH2. Those Rattus norvegicus’ occlusal molar teeth were prepared with class I cavity, and then chitosan and Ca(OH2 were applied as the pulp capping materials. Afterwards, glasss ionomer cement type IX was used as a restoration material. Their teeth and jaw were then cut on the seventh day and the fourteenth day. Next, histopathological examination was carried out to observe the odontoblast like cells. All data were then analyzed by t test. Degree of confidence obtained, finally, was 95%. Results: The results obtained showed that the significant differences of odontoblast like cells on the seventh day observation was 0.001 (p = 0.001, and on the fourteenth day observation was 0.002 (p = 0.002. Conclusion: The number of odontoblast-like cells in direct pulp capping dental care of rattus norvegicus using chitosan is higher than the one using Ca(OH2 for seven and fourteen days.Latar belakang: Perawatan perforasi pulpa pada kasus pulpitis reversible karena trauma mekanis bur dilakukan direct pulp capping dengan cara pemberian bahan secara topikal pada daerah perforasi. Kitosan memiliki kemampuan untuk memfasilitasi migrasi, proliferasi dan diferensiasi sel progenitor pulpa. Tujuan: Tujuan penelitian ini adalah untuk menentukan jumlah peningkatan odontoblas-like cell pada perawatan direct pulp capping gigi
Directory of Open Access Journals (Sweden)
Dalva A. de Mello
1968-06-01
Full Text Available L'auíeur a vérifié la susceptibilité de deux espèces de rongeurs domestiques de la ville de Recife. Etat du Pernambuco, R. norvegicus et Rattus rattus frugivurus, les comparant aux souris albinos de la souche "Swiss" avec deux souches de P. pestis dont une était isolée au municipe d'Exu, Etat du Pernambuco âenommée PEXU 19 et Vautre provenante du Venezuela dite RANGEL. Les deux espèces de rongeurs ont montré une resistence modérée par rapport aux deux souches de P. pestis tandis que les souris ont révélé d'être hautement susceptibles.
Parasitological surveillance in a rat (Rattus norvegicus) colony in São Paulo Zoo animal house
Chagas, Carolina Romeiro Fernandes; Gonzalez, Irys Hany Lima; Favoretto, Samantha Mesquita; Ramos, Patrícia Locosque
Rattus norvegicus (Mammalia: Rodentia) is a widespread and synanthropic rodent, broadly used in medical experiments. It can also be used for feeding captive animals in zoos. Parasitological surveys are important to guarantee the health of both the animals and the staff responsible for their management. The aim of this study was to identify intestinal parasites of Rattus norvegicus offered as food to captive animals from São Paulo Zoo, and demonstrate the importance of sanitary hurdling, disease control and biosecurity. The identified protozoan parasites were Eimeria sp., Entamoeba sp., Spironucleus sp., Giardia sp., Tritrichomonas sp., Chilomastix sp., unidentified cysts and non-sporulated coccidians oocysts (Isospora/Eimeria). The following helminths were found: Syphacia muris, Rodentolepis nana and Aspiculuris tetraptera.
Nicotine supplementation blocks oocyte maturation in Rattus norvegicus
Directory of Open Access Journals (Sweden)
Meitria Syahadatina Noor
2013-08-01
Full Text Available Background Indonesia has the third largest tobacco consumption in the world after China and India. Nicotine as the main component of cigarette smoke has negative effects on the reproductive system, such as oocyte maturation, ovulation, and fertilization, and increasing the diploidy of oocytes. The goal of this research was to evaluate the effect of nicotine on oocyte maturation in Rattus norvegicus. Methods This was an experimental study with post test only control group design. The subjects were 40 rats selected homogenously and randomly. They were divided into a control group (receiving carboxy-methyl-cellulose sodium and 3 treatment groups (I-III receiving nicotine subcutaneously for 7 days at dosages of 21 mg/kgBW, 41 kg/kgBW and 84/kgBW, respectively. The observations comprised oocyte maturation stage, viz. germinal vesicle (GV, germinal vesicle breakdown (GVBD, metaphase I and metaphase II. Data were analyzed by one-way Anova with á=0.05, followed by Tukey’s HSD test. Results One-way Anova showed significant differences in oocyte maturation in all groups. Tukey’s HSD test showed that for GV, the differing groups were control and I, control and II, I and III. For GVBD, the differing groups were control and I, I and II, I and III. For metaphase I, the differing groups were control with I, II, and III, I and II, I and III. For metaphase II, the differing groups were control versus I, II, and III, I and II, I and III. Conclusion Low dose of nicotine is capable of affecting oocyte maturation in Rattus norvegicus.
Moreira, V L C; Giese, E G; Melo, F T V; Simões, R O; Thiengo, S C; Maldonado, A; Santos, J N
2013-01-01
Angiostrongylus cantonensis, the rat lungworm, is one etiological agent of eosinophilic meningoencephalitis in humans. This zoonosis is frequently found in Asia and, more recently, in North America, Caribbean Island and northeastern of South America. Until now, research of A. cantonensis in southern, southeastern and northeastern regions of Brazil has been found natural infections only terrestrial and freshwater intermediate snail hosts (Achatina fulica, Sarasinula marginata, Subulina octona, Bradybaena similaris and Pomacea lineate). In this study, we examined the occurrence of helminthes in the synantropic rodents Rattus rattus and Rattus norvegicus in northern Brazil, focusing on the role of these species as vertebrate hosts of A. cantonensis and A. fulica as intermediate host have found natural. Thirty specimens of R. rattus and twelve of R. norvegicus were collected in the Guamá and Jurunas neighborhoods of the city of Belém, in the Brazilian state of Pará, of which almost 10% harbored adult worms in their pulmonary arteries. Sympatric A. fulica were found to be infected by L(3) larvae, which experimental infection confirmed to be A. cantonensis. Natural infection of snails and rodents with A. cantonensis was confirmed through morphological and morphometrical analyses of adults and larvae using light microscopy, scanning electron microscopy and molecular sequences of partial Cytochrome Oxidase subunit I. Phylogenetic analyses showed that A. cantonensis isolated from Pará, Brazil is similar to Japan isolate; once these specimens produced a single haplotype with high bootstrap support with Rio de Janeiro isolate. This study confirms that A. cantonensis is now endemic in northern Brazil, and that R. rattus and R. norvegicus act as natural definitive hosts, and A. fulica as the intermediate host of the parasite in this region. Copyright © 2012 Elsevier B.V. All rights reserved.
Prananingrum, Widyasri
2010-01-01
Background: Pulpal perforation care with direct pulp capping in the case of reversible pulpitis due to mechanical trauma was performed with chitosan which has the ability to facilitate migration, proliferation, and progenitor cell differentiation. Purpose: The purpose of this study was to determine the increasing number of odontoblast-like cells in direct pulp capping dental care of Rattus norvegicus using chitosan for seven and fourteen days. Methods: Samples were molars of male Rattus norve...
Directory of Open Access Journals (Sweden)
Norollah Pakdel
2013-06-01
Full Text Available Parasitic infections of rodents can compromise scientific research as well as the health of the animals and humans. Based on previous studies, infection rate of parasitic helminths is different in various regions of Iran. The current survey was aimed to determine endoparasitic helminths infection in 138 trapped rodents of Kermanshah county, Iran. Mice and rats were trapped using metal snares from January to October 2011 and euthanized. Rodents included 110 Mus musculus (79.00%, 23 Rattus norvegicus (17.00%, and five Rattus rattus (4.00%. The gastrointestinal and respiratory tracts were removed and examined to identify parasitic helminths. The results indicated that 42.02% of examined rodents were infected with eight helminths species, i.e. Trichuris muris (14.49%, Syphacia obvelata (13.76%, Syphacia muris (2.89%, Aspicularis tetrapetra (5.07%, Heterakis spumosa (5.07%, Capillaria hepatica eggs (3.62%, Hyminolepis diminuta (12.30%, and Cystisercus fasciolaris, the larva of Taenia teanieformis (4.34%. Given the results of this study, we concluded that examined rodents were more infected with nematodes than other helminths. As rodents are usually infected with a number of zoonotic parasites, hence control of these animals has an important role in safeguarding public health.
Sa'adah, Noor Nailis; Purwani, Kristanti Indah; Nurhayati, Awik Puji Dyah; Ashuri, Nova Maulidina
2017-06-01
Diet of high lipids cause hyperlipidemia, which marked by an increase of total cholesterols, triglycerides, LDL-C, and decreasing of HDL-C. Hyperlipidemia lead the occurrence of atherosclerosis, one of factors that trigger cardiovascular disease, as hypertention; coronary heart and stroke. Parijoto (M. speciosa) is endemic plants in Asia with a distribution center in Malaysia, Indonesia and Philippines. Parijoto contain phytochemical components such as flavonoids, saponins and kardenolin. Flavonoid potensial as an antioxidants and can improve the hyperlipidemia condition. This study was aimed to determine lipid profiles and atherogenic index of hyperlipidemic Wistar rats (R. norvegicus Berkenhout, 1769) which given the methanolic extract of Parijoto (M. speciosa). The research was done with pre and post test randomized control group design. Rats were given a mixture of duck yolk and reused cooking oil (1:1) orally as much as 1% of body weight (BW) for 30 days. After hyperlipidemia achieved, rats were divided into 5 group: normal rats, hyperlipidemic rats, hyperlipidemic rats were given the methanolic extract of Parijoto (M. speciosa) 500 mg/kg, 1000 mg/kg, and 1500 mg/kg BW. Blood samples were collected when rats in hyperlipidemia conditions and after treatment with the methanolic extract of Parijoto (M. speciosa) for 30 days. The data of total cholesterol, HDL-Cholesterol, LDL-Cholesterol level, and atherogenic index were analyzed using ANOVA followed by Tukey test at 5% significance level. The result showed that giving of methanolic extract of Parijoto (M. speciosa) in hyperlipidemic rats reduced the total cholesterol, LDL-Cholesterol levels, and increased of HDL-cholesterol levels significantly (p<0.01), so atherogenic index reduced significantly too (p<0.01). Total cholesterol and LDL-Cholesterol levels were positively correlated with the atherogenic index, whereas HDL-cholesterol levels were negatively correlated with the atherogenic index.
Directory of Open Access Journals (Sweden)
andri ani
2018-03-01
Full Text Available Perubahan pola demografi di negara maju dan negara berkembang, angka kejadian infertilitas di negara maju dilaporkan sekitar 5%-8% dan di negara berkembang sekitar 30%.WHO memperkirakan sekitar 8%-10% atau sekitar 50-80 juta pasangan suami istri di seluruh dunia mengalami masalah infertilitas, sehingga membuat infertilitas menjadi masalah mendesak. Untuk itu diperlukan pengendalian infertilitas, salah satunya adalah kewaspadaan perubahan gaya hidup, perubahan ini juga mempengaruhi pola konsumsi makanan dengan lebih banyak mengkonsumsi jenis makanan cepat saji yang banyak mengandung zat aditif (penyedap rasa. Penelitian ini bertujuan untuk mengetahui pengaruh pemberian monosodium glutamate terhadap kadar hormon estradiol dan kadar hormon progesteron pada tikus putih betina ( Rattus norvegicus .Penelitian ini menggunakan metode pendekatan post test only control group design, terhadap tikus putih betina dengan berat 200 – 250 gr. Sampel terdiri dari 24 ekor tikus yang dibagi 4 kelompok yaitu kelompok kontrol ( K , perlakuan I, II dan III . Kelompok perlakuan diberikan monosodium glutamat dengan dosis masing-masing : 45 mg, 54 mg dan 63 mg setiap hari diberikan peroral yang dilarutkan dengan aquabides 2 ml selama 20 hari yang dimulai pada awal fase proestrus. Setelah 20 hari perlakuan tikus di korbankan dan diambil darahnya. Pemeriksaan kadar hormone estradiol dan progesteron menggunakan Elisa Spectrophotometer. Kemudian hasilnya dianalisa dengan menggunakan One Way ANOVA dan dilanjutkan dengan uji Multiple Comparison jenis Bonferroni.Hasil penelitian pemberian monosodium glutamat dengan dosis 45 mg/ ekor/ hari, 54 mg/ekor/ hari dan 63 mg/ ekor /hari dapat menurunkan kadar hormon estradiol tikus putih betina (Rattus norvegicus secara signifikan. Dan pemberian monosodium glutamate dengan dosis 45 mg/ ekor/ hari dapat menurunkan kadar hormon progesteron tikus putih betina (Rattus norvegicus walaupun tidak berpengaruh secara signifikan , dan pada
High prevalence of Leptospira spp. in sewer rats (Rattus norvegicus)
DEFF Research Database (Denmark)
Krøjgaard, L H; Villumsen, S; Markussen, M D K
2009-01-01
Earlier studies on the ecology of leptospirosis in temperate regions focused mainly on free-ranging rats in rural areas. Here we report on the occurrence of Leptospira spp. in Rattus norvegicus living in sewers in a suburban area in Copenhagen, Denmark. In 2006-2007, about 30 rats were captured...... in sewers at each of six different locations. Rat kidneys were screened by PCR for pathogenic Leptospira spp. In one location no infected rats were found, whereas the prevalence in the remaining five locations ranged between 48% and 89%. Micro-agglutination tests showed that serogroup Pomona, Sejroe...
BIRD’S NEST EXTRACT CREAM: TREATMENT FOR PERINEAL WOUND IN RATTUS NORVEGICUS
Herlina Ofiwijayanti; Syarief Thaufik Hidayat; Nur Khafidhoh
2017-01-01
Background: Perineal rupture occurs almost in all the first labor and not infrequently in the next labor. Complex perineal wounds are at risk for non healing and infection. Objective: This study aims to determine the effect of bird’s nest extract on perineal wound healing on rattus norvegicus. Methods: This was a randomised posttest only group design conducted in October 2016 at Animal Laboratory Unit of Diponegoro University, Semarang. There were 30 samples recruited in this study, div...
TIKUS RIUL (Rattus norvegicus Berkenhout, 1769
Directory of Open Access Journals (Sweden)
Dian Indra Dewi
2012-11-01
Full Text Available Tikus riul telah menyebabkan lebih banyak kematian jika dibandingkan dengan semua perang dalam sejarah. Rat-borne diseases diperkirakan telah menewaskan banyak orang dalam 1000 tahun terakhir. Mereka merupakan ancaman bagi kesehatan masyarakat. Mereka menjadi hospes dari kutu dan pinjal yang dapat menyebabkan pes, trichinosus, tularemia, infeksi penyakit kuning, demam tifus endemik, ratbite fever, dan beberapa penyakit berbahaya.
Directory of Open Access Journals (Sweden)
Ratih Mega Septiasari
2018-01-01
Full Text Available Diabetes during pregnancy can be divided into pregestational diabetes and gestational diabetes. The risk of fetal Diabetes Mellitus pregestational (DMpG patients can be either macrosomia or low birth weight. The purpose of this study was to investigate the differences in the administration effect of insulin and Zingiber officinale extract on birth weight of Rattus norvegicus pregestational diabetes mellitus model. This research is an experimental research using post test only control group design. Samples contained 30 pregnant Rattus norvegicus and divided into 5 groups, where K0 (negative control group and K1 (positive control group given aquadest 1cc, K2 given insulin 1IU, K3 given ginger extract 500mg/ kg BW, K4 given insulin 1IU and ginger extract 500mg/ kg BW. Treatment was administered during the first 16 days of pregnancy. On the 17th day, the rats were terminated and then the birth weight was measured with the scale. Data analysis using One-way ANOVA test followed by Tamhane test. The results showed that there was a difference of birth weight in the insulin treatment group and ginger extract treatment group (p-value = 0,037 < α =0,05. The conclusion of this study was Zingiber officinale can be used as a single therapy or combination with insulin of Rattus norvegicus pregestational diabetes mellitus model.
Behavioral changes in Rattus norvegicus coinfected by Toxocara canis and Toxoplasma gondii
Directory of Open Access Journals (Sweden)
Maisa Leite de Queiroz
2013-02-01
Full Text Available Using an elevated plus maze apparatus and an activity cage, behavioral changes in Rattus norvegicus concomitantly infected by Toxocara canis and Toxoplasma gondii were studied, during a period of 120 days. Rats infected by Toxocara canis or Toxoplasma gondii showed significant behavioral changes; however, in the group coinfected by both parasites a behavioral pattern similar to that found in the group not infected was observed thirty days after infection, suggesting the occurrence of modulation in the behavioral response.
Anatomía del Hígado de la Rata Wistar (Rattus norvegicus)
Möller Bredo, Richard; Vazquez Odo, Noelia
2011-01-01
La rata de laboratorio (Rattus norvegicus albinus) ha sido usada como modelo para investigaciones médicas, biológicas y moleculares, desde hace mucho tiempo. Es interesante el hecho de que no existen descripciones detalladas de la anatomía del hígado y sus ligamentos que lo fijan a la pared. El objetivo de este trabajo es definir en forma clara y acorde a los principios de la Nomina Anatomica Veterinaria el hígado y sus medios de unión en esta especie de mamífero de laboratorio. Se utilizaron...
Directory of Open Access Journals (Sweden)
Isabel E. Gómez Villafañe
2004-12-01
Full Text Available We have studied the prevalence of Trichinella spiralis, Leptospira spp. and Salmonella spp. in rats and opossums that inhabit poultry farms of Exaltación de la Cruz, Buenos Aires, Argentina, to determine the potential sanitary risk for humans that are in contact with these animals. The study was carried out on 48 poultry farms between spring 1999 and winter 2001. The study of opossums began in winter 2000. During the study period we captured 152 Rattus norvegicus, 3 Rattus rattus, 16 Didelphis albiventris and 1 Lutreolina crassicaudata. We have registered the presence of rats and opossums in 70% and 27% of the studied farms, respectively. The percentage of farms with rats was independent of the presence or absence of pigs. We did not detect the presence of Leptospira spp. and Trichinella spiralis in any individual. We detected the presence of Salmonella Enteritidis in one Rattus norvegicus and one Didelphis albiventris. According to our results, the rats and opossums of poultry farms may not report a risk factor in the transmission of Trichinella and Leptospira under the present conditions; but the detection of Salmonella Enteritidis in rats as well as in opossums suggests the idea of applying prophylactics measurements on poultry farms.A prevalência de Trichinella spiralis, Leptospira spp. e Salmonella spp. foi estudada em ratos e gambás que habitam granjas avícolas da região de Exaltación de la Cruz, Buenos Aires, Argentina, com o objetivo de determinar o potencial risco sanitário para pessoas que ficam em contato com esses animais. O estudo foi realizado entre a primavera de 1999 e o inverno de 2001 em 48 granjas avícolas. O estudo em gambás iniciou-se no inverno de 2000. Foram capturados 152 Rattus norvegicus, 3 Rattus rattus, 16 Didelphis albiventris e 1 Lutreolina crassicaudata. Registrou-se a presença de ratos e de gambás em 70% e 27% das granjas estudadas, respectivamente. A percentagem de granjas com ratos foi independente da
Directory of Open Access Journals (Sweden)
Afrida Wira Surya Rizqi
2014-03-01
Full Text Available Cardiovascular disease is a disease that causes the most deaths in the world. One of its main risk factor is triglyceride levels which make the emergence of plaque in coronary artery. Statin as an option drug in reducing triglyceride levels apparently reported to cause myopathy and kidney failure when used in a long term. Natural product like red dragon fruit began to be developed as a safer alternative. The content of various substances such as niacin, vitamin C and fiber in it useful as antihypertriglyceridemia. This study aims to determine the effect of red dragon fruit (Hylocereus polyrhizus juice to the decrease of triglyceride levels in hyperlipidemic white rats (Rattus norvegicus. This study was an experimental study with pre and post test with control group design. The subjects were 24 male experimental animals (Rattus norvegicus were divided into 4 groups: one positive control group given simvastatin 0.18 mg/ 200 gram of weight and three groups treated with red dragon fruit juice doses of 3.6; 5.4 and 7.2 gram/ 200 gram of weight. Then, data were analyzed escriptively with One-Way ANOVA test using SPSS 16.0 for Windows. Results with descriptive analysis obtained that mean of positive control’s pre-test triglyceride level was 104.80 mg/ dl and treatment groups I, II and III respectively 108.15 mg/ dl, 106.47 mg/ dl and 107.43 mg/ dl whereas positive control’s post-test triglyceride level was 51.09 mg/ dl and for the treatment groups were 94.64 mg /dl, 71.01 mg/ dl and 58.75 mg/ dl. One Way ANOVA test obtained p <0.05 which indicated the difference between the treatment of various doses of red dragon fruit juice to white rats’ triglyceride levels. Based on that, means there is the effect of various doses of red dragon fruit (Hylocereus polyrhizus juice to the decrease of triglyceride levels in hyperlipidemic white rats (Rattus norvegicus.
Directory of Open Access Journals (Sweden)
Pedro Marcos Linardi
1985-09-01
Full Text Available Indices pulicidianos, anoplurianos e acarianos, globais e específicos foram determinados para os ectoparasitos de Rattus norvegicus norvegicus capturados em zona urbana de Belo Horizonte, Minas Gerais, Brasil, no período de junho de 1980 a setembro de 1982. Tendo-se em vista os valores limites ou críticos atribuídos aos índices pulicidianos, sobretudo ao índice "cheopis" e propostos por diversos autores como medida complementar de vigilância epidemiológica para peste bubônica, a comunidade de Belo Horizonte poderia ter estado exposta a esta infecção, uma vez que os índices globais anuais de 0,3 a 2,4 e a pulga prevalente foi Xenopsylla cheopis (99,2%, com os maiores índices coincidindo com o final da estação seca-fria. Em duas ocasiões, a comunidade poderia ter permanecido altamente exposta à infecção, já que os índices-limites tolerados foram suplantados: 8,8 (outubro 1980 e 6,2 (setembro 1982. Sugere-se que medidas profiláticas como anti-ratização e desinsetização sejam eficazmente aplicadas ao final da estação seca-fria, ou anteriormente à chegada das chuvas, sendo sucedidas pela desratização. Informações sobre índices anoplurianos e acarianos são importantes para que se possa, no exclusivas de roedoresThe total and specific indices of fleas, lice and mites were determined for ectoparasites on Rattus norvegicus norvegicus capture in urban areas of Belo Horizonte, Minas state, Brazil, from June 1980 to September 1982. In view of the limiting or critical values attributed to flea indices above all the [quot ]cheopis[quot ] index, proposed by several authors as a complementary measure for bubonic plague surveillance, the community of Belo Horizonte would have been exposed to this infection. The annual total indices ranged from 0.3 to 2.4 and the prevalent flea was Xenopsylla cheopis (99.2%, with the highest indices coinciding with the late dry-cool season. On two occasions, in this period, the community would
LANZA, Andrea; PETTORALI, Michela; BALDI, Alfonso; SPUGNINI, Enrico P.
2017-01-01
Two male rats (Rattus norvegicus; 18 and 24 months old), were referred for treatment of large masses located in the axillary area. Following total body radiography and hematological and serum biochemical analysis, the rats were anesthetized, and the masses were surgically removed. Both lesions were diagnosed as mammary carcinoma based on histopathological diagnosis. The tumor beds were treated with two sessions of electrochemotherapy (ECT), two weeks apart. ECT involved cisplatin administrati...
Noble, N A; Tanaka, K R
1979-01-01
1. A major locus with two alleles is responsible for large differences in erythrocyte 2,3-diphosphoglycerate (DPG) levels in Rattus norvegicus. Blood from homozygous High-DPG, homozygous Low-DPG and heterozygous animals was used to measure blood indices and red cell enzyme activities. 2. Significant differences between groups were found in DPG levels, white blood cell counts and hemoglobin levels. 3. The results suggest that none of the red cell enzymes assayed is structurally or quantitatively different in the three groups.
Hu, Jun-Jie; Meng, Yu; Guo, Yan-Mei; Liao, Jie-Ying; Song, Jing-Ling
2012-06-01
Transmission experiments were performed to elucidate the life cycle of Sarcocystis zuoi found in Norway rats ( Rattus norvegicus ) in China. Two king rat snakes ( Elaphe carinata ) fed sarcocysts from the muscles of 4 naturally infected Norway rats shed sporocysts measuring 10.8 ± 0.7 × 8.0 ± 0.7 µm, with a prepatent period of 8-9 days. Sporocysts from the intestine of 2 experimentally infected king rat snakes were given to the laboratory Sprague-Dawley (SD) rats ( R. norvegicus ) and Kunming (KM) mice ( Mus musculus ). Microscopic sarcocysts developed in the skeletal muscles of SD rats. No sarcocysts were observed in KM mice. Characters of ultrastructure and molecule of sarcocysts from SD rats were confirmed as S. zuoi . Our results indicate that king rat snake is the definitive host of S. zuoi .
Directory of Open Access Journals (Sweden)
Tania Saskianti
2018-04-01
Full Text Available Background: Alveolar bone defects in children still have a high incidence. Conventional bone graft technique that has been used as a defect therapy is still not effective, so new techniques with tissue engineering approach are needed. Bone Morphogenetic Protein 4 (BMP4 as one of the indicators of osteogenic differentiation has not been widely studied, especially in the transplantation with combination of Stem Cells from Human Exfoliated Deciduous (SHED and carbonate apatite. Aim and Objectives: This research aimed to determine the expression of BMP4 after SHED and carbonate apatite transplantation on Rattus norvegicus. Material and Methods: The combinations of SHED and carbonate apatite were transplanted on alveolar bone defects of 4 rats (Rattus norvegicus as the treatment groups and another 4 rats were transplanted with carbonate apatite as the control groups. After 21 days, staining with Hematoxylin Eosin (HE and Immunohistochemistry (IHC BMP4 was performed. Results: BMP4 expression in the treatment groups was significantly higher when compared to the control groups. Discussion: Carbonate apatite has low crystallization rate and high osteoconductivity that produce more osteoblasts and increased BMP4 expression. Conclusion: The transplantation of SHED and carbonate apatite increased BMP4 expression as an indicator of osteogenic differentiation in rats.
Directory of Open Access Journals (Sweden)
Fabiana de Oliveira Lara-Silva
2014-01-01
Full Text Available In the present study we surveyed the fauna of phlebotomine sand flies and small mammals in peridomestic areas from a Brazilian municipality where the American cutaneous leishmaniasis (ACL is endemic. A total of 608 female phlebotomine sand flies were captured during nine months in 2009 and 2010. Seven different species were represented with 60% of them being Lutzomyia intermedia and Lu. whitmani, both incriminated vectors of ACL. Lu. longipalpis, a proven vector of visceral leishmaniasis (VL was also captured at high proportion (12.8%. Genomic DNA analysis of 136 species-specific pools of female sand flies followed by molecular genotyping showed the presence of Leishmania infantum DNA in two pools of Lu. longipalpis. The same Leishmania species was found in one blood sample from Rattus norvegicus among 119 blood and tissue samples analysed. This is the first report of Le. infantum in R. norvegicus in the Americas and suggests a possible role for this rodent species in the zoonotic cycle of VL. Our study coincided with the reemergence of VL in Governador Valadares.
Urban population genetics of slum-dwelling rats (Rattus norvegicus) in Salvador, Brazil
Kajdacsi, Brittney; Costa, Federico; Hyseni, Chaz; Porter, Fleur; Brown, Julia; Rodrigues, Gorete; Farias, Helena; Reis, Mitermeyer G.; Childs, James E.; Ko, Albert I.; Caccone, Adalgisa
2013-01-01
Throughout the developing world, urban centers with sprawling slum settlements are rapidly expanding and invading previously forested ecosystems. Slum communities are characterized by untended refuse, open sewers, and overgrown vegetation, which promote rodent infestation. Norway rats (Rattus norvegicus), are reservoirs for epidemic transmission of many zoonotic pathogens of public health importance. Understanding the population ecology of R. norvegicus is essential to formulate effective rodent control strategies, as this knowledge aids estimation of the temporal stability and spatial connectivity of populations. We screened for genetic variation, characterized the population genetic structure, and evaluated the extent and patterns of gene flow in the urban landscape using 17 microsatellite loci in 146 rats from 9 sites in the city of Salvador, Brazil. These sites were divided between three neighborhoods within the city spaced an average of 2.7 km apart. Surprisingly, we detected very little relatedness among animals trapped at the same site and found high levels of genetic diversity, as well as structuring across small geographic distances. Most FST comparisons among sites were statistically significant, including sites Salvador, linked to the heterogeneous urban landscape. Future rodent control measures need to take into account the spatial and temporal linkage of rat populations in Salvador, as revealed by genetic data, to develop informed eradication strategies. PMID:24118116
PREDICTORS OF TRYPANOSOMA LEWISI IN RATTUS NORVEGICUS FROM DURBAN, SOUTH AFRICA.
Archer, Colleen Edith; Schoeman, M Corrie; Appleton, Christopher Charles; Mukaratirwa, Samson; Hope, Karen J; Matthews, Glenda Beverly
2018-03-16
This study investigated associations between Trypanosoma lewisi; Xenopsylla cheopis, a common cyclical vector of T. lewisi; Polyplax spinulosa, a reported mechanical vector; and Laelaps ecidnina and L. lamborni, two rodent mites of Rattus norvegicus in Durban. Three hundred and seventy nine R. norvegicus were live-trapped at 48 sites in 4 locality types of Durban during a one year period. Rats were euthanized, cardiac blood was taken to check for hemoparasites and ectoparasites were removed for identification. Parasite species richness was higher in pups (2.11) and juveniles (1.02) than adults (0.87). Most rats in the study harbored 1 or 2 of the 5 parasites examined. Rats with trypanosomes and fleas were more prevalent in the city center and harbor, and juveniles were most affected. Rats with lice were more prevalent in informal settlements and urban/peri-urban areas and pups had the highest infestations. There was a significant positive association between rats with fleas and trypanosomes and a negative association between rats with lice and trypanosomes. Location and rat age were significant predictors of T. lewisi, X. cheopis and P. spinulosa. Mites showed no strong associations with trypanosomes. Ectoparasite associations are possibly habitat and life-cycle related. We conclude that Durban's city center, which offers rats harborage, an unsanitary environment and availability of food, is a high transmission area for fleas and trypanosomes, and consequently, a potential public health risk.
Silva, Aleksandro Schafer da; Tochetto, Camila; Zanette, Régis Adriel; Pierezan, Felipe; Rissi, Daniel Ricardo; Santurio, Janio Morais; Monteiro, Silvia Gonzalez
2008-01-01
Este estudo teve como objetivo avaliar o efeito do aceturato de diminazeno e do dipropionato de imidocarb no controle da infecção por Trypanosoma evansi em ratos (Rattus norvegicus) infectados experimentalmente. Cinqüenta e quatro ratos machos foram inoculados via intraperitonial com 104 tripomastigotas de T. evansi/animal. Os ratos foram monitorados diariamente por meio de esfregaço sanguíneo periférico. No momento em que se observassem oito protozoários por campo microscópico de 1000x, era ...
Energy Technology Data Exchange (ETDEWEB)
Wuenschmann, S. [Internationales Hochschulinstitut Zittau (Germany). Lehrstuhl fuer Umweltverfahrenstechnik; Hochschule fuer Technik, Wirtschaft und Sozialwesen Zittau/Goerlitz (FH), Zittau (Germany). Fachbereich Mathematik/Naturwissenschaften; Oehlmann, J. [J. W. Goethe-Univ. Frankfurt, Zoologisches Inst., Frankfurt/M. (Germany); Delakowitz, B. [Hochschule fuer Technik, Wirtschaft und Sozialwesen Zittau/Goerlitz (FH), Zittau (Germany). Fachbereich Mathematik/Naturwissenschaften; Markert, B. [Internationales Hochschulinstitut Zittau (Germany). Lehrstuhl fuer Umweltverfahrenstechnik
2001-07-01
The objective of the current attempt was to investigate the suitability of wild-living rats (Rattus norvegicus) as a passive bioindicator using quantitative determinations of 12 chemical elements in different organs taken from rats which were caught in the Zoological Garden of Zittau. Aside from the determinations of so-called background levels, the focus of interest was with accumulations of certain elements within the organs depending on either sex or age of the rats. There were different affinities of the elements towards certain organs. Because of apparent sex and age-related differences in element concentrations and accumulation features, a well-planned sampling strategy for the use of rats as possible passive bioindicators is indeed required. The consideration of element distribution patterns within the organ system of Rattus norvegicus (based on body burden calculations (in part 2 of this work)) allows an effective use of the rat for purposes of integrative monitoring. (orig.) [German] Durch die Quantifizierung von 12 chemischen Elementen im Organsystem von wildlebenden Ratten (Rattus norvegicus) aus dem Tierpark Zittau (Sachsen) sollte die Eignung dieser Spezies als passiver Bioindikator untersucht werden. Neben der Ermittlung von sogenannten Hintergrundkonzentrationen standen insbesondere Fragen zur geschlechts- und altersspezifischen Akkumulation einzelner Elemente im Organsystem von Rattus norvegicus im Vordergrund. Spezifisch zeigten dabei einzelne Elemente unterschiedliche Affinitaeten zu den entsprechenden Geweben und Organen. Insbesondere die hierbei ermittelten geschlechts- und altersspezifischen Charakteristika einzelner Elemente macht eine detaillierte Ausarbeitung einer Beprobungsstrategie fuer den spaeteren Einsatz als passiver Bioindikator zwingend. Unter Beruecksichtigung des durch die Berechnung des Body Burden (Koerperlast) im 2. Teil der Arbeit ermittelten typischen Verteilungsmusters einzelner Elemente ist Rattus norvegicus zum
The effect of fluoride on the serum level of calcium in the rat (Rattus norvegicus
Directory of Open Access Journals (Sweden)
Fočak M.
2012-01-01
Full Text Available The effect of fluoride on the calcium level in serum was analyzed in the laboratory rat Rattus norvegicus. The control group consisted of 10, and the experimental group of 15 animals. In the experimental group, fluoride at a concentration of 3 mg/100 g body weight of rats was intramuscularly injected into the musculus gluteus maximus. The concentration of calcium was measured by the CPC method. The average serum calcium concentration was 2.46 mmol/l, with female rats having higher values of serum calcium than male rats. Fluoride caused the reduction of calcium concentration in serum (p<0.05; the reduction was significantly expressed in female rats (p<0.000.
Directory of Open Access Journals (Sweden)
Keshaw Tiwari
2018-03-01
Full Text Available Aim: Giardia is a serious zoonotic parasite, which causes diarrheal disease in humans and animals including rodents. The purpose of this study was to estimate the prevalence of Giardia spp. in brown rats (Rattus norvegicus in Grenada. Materials and Methods: Intestinal contents from 99 and serum samples from 169 brown rats (R. norvegicus from Grenada were collected. These samples were examined for the Giardia coproantigens using Cryptosporidium/Giardia Quik Chek assay (Tech lab® Inc., USA, and the serum was screened through an enzyme-linked immunosorbent assay (ELISA test kit for Giardia antibody (anti-GD ELISA kit (MyBioSource, San Diego, CA, USA. Results: Giardia coproantigens were positive in 17.17% (95% confidence interval [CI]; 10.33-26.06% rats, whereas 55% (95% CI: 47.20-62.68 were positive with serum antibodies (anti-GD to Giardia. Conclusion: The prevalence of Giardia spp. in brown rats in Grenada was moderate based on the presence of coproantigens in the intestinal contents and antibody in serum. The findings of Giardia infections and prevalence in brown rats will help veterinarians and physicians to better plan diagnostic and preventative strategies. This is the first report of prevalence of Giardia in brown rats in Grenada.
Food Neophobia in Wild Rats (Rattus norvegicus Inhabiting a Changeable Environment-A Field Study.
Directory of Open Access Journals (Sweden)
Klaudia Modlinska
Full Text Available Food neophobia is a reaction to novel food observed in many animal species, particularly omnivores, including Rattus norvegicus. A neophobic reaction is typically characterised by avoidance of novel food and the necessity to assess both its potential value and toxicity by the animal. It has been hypothesised that this reaction is not observed in rats inhabiting a changeable environment with a high level of variability with regard to food and food sources. This study was conducted in such changeable conditions and it aims to demonstrate the behaviour of wild rats R. norvegicus in their natural habitat. The rats were studied in a farm setting, and the experimental arena was demarcated by a specially constructed pen which was freely accessible to the rats. At regular intervals, the rats were given new flavour- and smell-altered foods, while their behaviour was video-recorded. The results obtained in the study seem to confirm the hypothesis that rats inhabiting a highly changeable environment do not exhibit food neophobia. The observed reaction to novel food may be connected with a reaction to a novel object to a larger extent than to food neophobia. The value of the results obtained lies primarily in the fact that the study was conducted in the animals' natural habitat, and that it investigated their spontaneous behaviours.
Directory of Open Access Journals (Sweden)
Teguh Budipitojo
2016-06-01
Full Text Available Obesity is one of major nutritional problems in the world. Obesity is very dangerous, especially when concentrated in the abdomen, because it is closely linked to various diseases such as diabetes, hypertension, heart disease, which can to causing death. This study aims to identify the nature and distribution of ghrelin on gastric endocrine cells in the obese rat (Rattus norvegicus by using immunohistochemical techniques. The results will strengthen the understanding of the role and function of ghrelin as an alternative therapeutic target on obesity. The research used gastric tissues of ten obese and control rats which were stained with avidin-biotin-peroxidase complex method of immunohistochemistry. The results showed the existence of two types of ghrelin-producing cells (open and closed types on the gastric mucosa of control rats, and only one type of ghrelin producing cells (open type in obese rats. The intensity of ghrelin immunoreactive positive cells was detected weak in obese rats, but very strong in control rats. Ghrelin endocrine cells mainly distributed in the basal part of the gastric mucosa of the fundus parts, with a very small number in obese rats, but highly abundant in control rats. This study confirmed the decrease of the ghrelin synthesis and secretion in obese rat (Rattus norvegicus at the cellular level. The decrease of ghrelin synthesis is characterized by a reduction on the number of ghrelin producing cells, the disappearance of the close type of ghrelin producing cells, and the low activity of protein synthesis in the ghrelin producing cells. Ghrelin endocrine cells distributed mainly in the basal part of the gastric mucosa, especially in the fundus parts.
Directory of Open Access Journals (Sweden)
Afrida Wira Surya Rizqi
2014-09-01
Results with descriptive analysis obtained that mean of positive control’s pre-test triglyceride level was 104.80 mg/ dl and treatment groups I, II and III respectively 108.15 mg/ dl, 106.47 mg/ dl and 107.43 mg/ dl whereas positive control’s post-test triglyceride level was 51.09 mg/ dl and for the treatment groups were 94.64 mg /dl, 71.01 mg/ dl and 58.75 mg/ dl. One Way ANOVA test obtained p <0.05 which indicated the difference between the treatment of various doses of red dragon fruit juice to white rats’ triglyceride levels. Based on that, means there is the effect of various doses of red dragon fruit (Hylocereus polyrhizus juice to the decrease of triglyceride levels in hyperlipidemic white rats (Rattus norvegicus.
Directory of Open Access Journals (Sweden)
Biviana Andrea Duque
2012-12-01
Full Text Available Introducción. Rattus norvegicus cumple un papel epidemiológico en el mantenimiento y dispersión de agentes zoonóticos bacterianos, virales y parasitarios de interés en salud pública. La presencia de infección por helmintos en especies Rattus cercanas a poblaciones expuestas en condiciones ambientales propicias, puede convertirse en un factor de riesgo de transmisión. Objetivo. Reportar la frecuencia de infección con Capillaria hepatica y formas larvarias de Taenia taeniaeformis en ratas silvestres (R. norvegicus capturadas en una zona urbana de Medellín. Materiales y métodos. Se capturaron 254 ejemplares de R. norvegicus. Los hígados de 54 ejemplares que presentaron lesión hepática macroscópica durante la necropsia, fueron examinados por histopatología convencional. Resultados. La frecuencia de infección por C. hepatica fue de 20,1 % (51/254. Seis hígados fueron también positivos para larvas de T. taeniaeformis con una frecuencia de 2,4 % (6/254. Los hígados infestados con C. hepatica exhibían parásitos en el estadio adulto o juvenil y huevos ovalados conopérculos bipolares, asociados con hepatitis granulomatosa leve a moderada multifocal y acompañada por infiltrado leucocitario. Se observaron lesiones granulomatosas en resolución y fibrosis residual o calcificada que contenía huevos. Donde se encontraron cisticercos de T. taeniaeformis, el hallazgo más frecuente fueron quistes hepáticos que contenían larvas, y lesiones inflamatorias y fibróticas. Conclusión. Estos resultados indican que helmintos de potencial zoonótico circulan en R. norvegicus de ambientes urbanos. Debe investigarse la verdadera distribución de estos parásitos, para determinar el riesgo potencial que corren las poblaciones animales y humanas expuestas a adquirir este tipo de infecciones. doi: http://dx.doi.org/10.7705/biomedica.v32i4.442
2013-06-01
elevated frame to detect vertical rears, as well as differentiate small ( stereotypic ) movements from large movements. Motor activity was measured in a...Laboratory Animals V.3.3.1. Genus / Species Rattus norvegicus V.3.3.2. Strain / Stock 62 Distribution A: Approved for public release...horizontal movement and to differentiate small ( stereotypic ) movements from large movements, and a second frame was elevated above the ground level frame
Rovaina Laureano Doyle
2006-01-01
Este trabalho objetivou verificar os achados laboratoriais e histológicos da infecção experimental por Trypanosoma (Trypanozoon) evansi (Steel, 1885) Balbiani, 1888, em ratos (Rattus norvegicus) da linhagem Wistar, testando a eficácia de três medicamentos. Foram utilizados 40 ratos, divididos em quatro grupos de 10 cada, sendo cada grupo composto por 5 machos e cinco fêmeas, os quais foram tratados com três quimioterápicos distintos após a detecção de parasitemia superior a oit...
Silva,Aleksandro Schafer da; Tochetto,Camila; Zanette,Régis Adriel; Pierezan,Felipe; Rissi,Daniel Ricardo; Santurio,Janio Morais; Monteiro,Silvia Gonzalez
2008-01-01
Este estudo teve como objetivo avaliar o efeito do aceturato de diminazeno e do dipropionato de imidocarb no controle da infecção por Trypanosoma evansi em ratos (Rattus norvegicus) infectados experimentalmente. Cinqüenta e quatro ratos machos foram inoculados via intraperitonial com 104 tripomastigotas de T. evansi/animal. Os ratos foram monitorados diariamente por meio de esfregaço sanguíneo periférico. No momento em que se observassem oito protozoários por campo microscópico de 1000x, era ...
DEFF Research Database (Denmark)
Markussen, Mette Drude; Heiberg, Ann-Charlotte; Alsbo, Carsten
2007-01-01
To examine the role of xenobiotic relevant genes in bromadiolone resistance in wild Norway rats (Rattus norvegicus) we compared the constitutive liver gene expression and expression upon bromadiolone administration in bromadiolone resistant and anticoagulant susceptible female rats using a LNA...... expressed in resistant than susceptible rats upon bromadiolone exposure. To establish how bromadiolone affected xenobiotic gene expression in the two strains we compared bromadiolone expression profiles to saline profiles of both strains. Bromadiolone mediated significant up-regulation of Cyp2e1 and Cyp3a3...... expression in the resistant rats whereas the rodenticide conferred down-regulation of Cyp2e1, Cyp3a3 and Gpox1 and induction of Cyp2c12 expression in susceptible rats. Cyp2c13 and Cyp3a2 expression were markedly suppressed in both strains upon treatment. This suggests that xenobiotic relevant enzymes play...
Directory of Open Access Journals (Sweden)
Dini Ariani
2013-07-01
Full Text Available Background: Enteral nutrition is nutrition used to fulfill the needs of nutrition entirely and as the supplement for malnutrition patient. In a certain condition of a patient, this nutrition is usually given in the form of liquid. Local material foods such as tempeh, rice, mung bean, and ganyong have adequate nutrition, therefore they are suitable for being used as main raw materials in the making of enteral nutrition. Objective: To know the influence of feeding enteral nutrition formulated with local food material toward malnutrition white rats (Rattus norvegicus of which the parameters are iron (Fe, hemoglobin (Hb level and weight. Method: This research used Completely Random Design (CRD. Twenty-seven of malnutrition male white rats were divided into 3 groups of treatment with 9 repetitions for each group of the treatment. Group A was given enteral nutrition diet of formula A (tempeh, rice, and mung bean as the main raw material, group B was given enteral nutrition diet of formula B (tempeh, rice, mung bean, and ganyong as the main raw material, and group C (as the positive control was given commercial enteral nutrition. The daily giving of enteral nutrition is 20 g/day during 30 days. The analysis of Fe and Hb level and the measurement of weight firstly were done before the treatment is given. The next measurement was conducted in 15th day and 31st day. Statistical analysis used ANOVA test dan DMRT of significance 5%. Results: The result showed that the treatment of the enteral nutrition feeding of formula B was more optimal than formula A in terms of the way to increase the level of Hb and Fe. Those two components will give positive effect toward the increasing of the weight of malnutrition white rats (Rattus norvegicus. Conclusion: The enteral nutrition of formula B is more proper to be developed as the main material of making enteral food in order to treat the malnutrition.
Directory of Open Access Journals (Sweden)
Sérgio V Santos
2009-09-01
Full Text Available Toxocara cati is a common feline parasite transmitted by the ingestion of embryonated eggs, by the transmammary route or by predation of paratenic hosts harbouring third-stage larvae in their bodies. In the present study, the larval distribution of T. cati in tissues and organs of Rattus norvegicus experimentally infected with 300 embryonated eggs was analysed. Third-stage larvae were recovered from livers, lungs, kidneys, eyes, brains and carcasses of infected rats, following tissue digestion with HCl 0.5% for 24 h at 37°C. Some differences from the known larval distribution of Toxocara canisin the same rodent species were found.
Laimeheriwa, Chornelia
2014-01-01
This study aimed to test the effect of ethanol extract Lidah Mertua leaves (Sansevieria trifasciata Prain) to decrease blood sugar levels of white male wistar (Rattus norvegicus L.) who induced sucrose. This type of research laboratory experiments using a Complete Randomized Design methods. Animal testing of this experiments is a white 15 rat males totaled are divided into 5 groups. The five groups which are a negative control group given a solution of CMC 0,5%, a positive control group was g...
International Nuclear Information System (INIS)
Omotoso, O.T.; Sanya, B.T.
2007-01-01
Laboratory rat Rattus norvegicus. fed on poultry growers mash plus additional protein supplements and some heavy metals, was studied for the growth and the haematological parameters. All the dietary supplements resulted in an increase in the growth of the rats. The rats, fed on growers mash and prawn meal showed the best growth within 7 weeks. Effects of diets were significantly, correlated at 0.01 level. Weight loss was recorded in case of all heavy Metal-laced diets, however, calcium sulphate-laced diets resulted in an increase in growth. Mercurous chloride was the most toxic salt which resulted in the greatest weight loss. Haematological analysis of rats revealed that RBC/sub s/ were higher in the case of heavy metal-laced diets than heavy metal-free diets. Generally, RBC counts were higher in females than in males within a group. Fish meal and prawn meal feeding. (author)
Directory of Open Access Journals (Sweden)
Ilma Soraya
2017-08-01
Full Text Available Introduction: Periodontitis is a condition of inflammation of the tooth supporting tissues generally caused by bacteria Phorphyromonas gingivalis (Pg. and is usually characterized by the occurrence of the alveolar bone resorption. Matrix metalloproteinase-2 (MMP-2 is an enzyme that plays an important role in inflammatory conditions. All-trans retinoic acid (ATRA is a metabolite of vitamin A which plays a role in healing the inflamed tissue and maintain the immune system. The purpose of this study was to determine the effect of ATRA on the expression of MMP-2 in mouse models Rattus norvegicus of periodontitis. Methods: Experimental laboratory by using post test only with control group design. This study used 25 male Wistar mice (Rattus norvegicus that divided into 5 groups. Group 1 (G1 is a group of healthy mice, group 2 (G2 is a group of sick mice as induced periodontitis without treatment, group 3 (G3 is a group of periodontitis mice treated with 5 mg/kg dose of ATRA, group 4 (G4 is a group of periodontitis mice treated with 10 mg/kg dose of ATRA, group 5 (G5 is a group of periodontitis mice treated with 20 mg/kg dose of ATRA. Periodontitis induction was induced by Pg. bacteria every 3 days for 28 days and followed by administration of ATRA for 7 days. Expression of MMP-2 from gingival tissues and periodontal ligament was obtained by immunohistochemical methods. Results were analyzed using the Shapiro-Wilk Test and Mann-Whitney Test. Results: The results showed there were significant differences in the positive area of MMP-2 and MMP-2 color intensity (p < 0.05 between groups. Conclusion: ATRA dose of 20 mg/kg is the most effective dose in inhibiting the expression of MMP-2 in mice models of periodontitis when compared with the dose on other groups.
Directory of Open Access Journals (Sweden)
Julio Campos Florián
2013-12-01
Full Text Available The present study aimed to demonstrate the hypolipidemic activity of aqueous extract of leaves of breadfruit, Artocarpus altilis, in a model of acute hyperlipidemia induced with triton X-305, using Rattus norvegicus specimens males, mean weight 204.5 g, who were orally administered 0.05 g/100g and 0.2 g/100 g of aqueous extract of A. altilis; included a negative control group received physiological saline and hyperlipidemic positive control group. After 24 hours of administering the treatments were made measurements of the concentrations of serum cholesterol and triglycerides. Found significant reductions (p < 0.01 in both cholesterol and triglyceride levels relative to the positive control group. We also found a significant difference (p < 0.01 between triglyceride concentrations of the animals treated with both doses of the aqueous extract of A. altilis. Conclude that the aqueous extract from the leaves of A. altilis has hypolipidemic effect at the doses tested for the model of hyperlipidemia induced with triton X-305.
Julio Campos Florián
2013-01-01
La presente investigación tuvo como objetivo demostrar la actividad hipolipidémica del extracto acuoso de las hojas del árbol del pan, Artocarpus altilis, en un modelo de hiperlipidemia aguda inducida con tritón X-305, utilizando como especímenes Rattus norvegicus machos, peso promedio 204,5 g, a los que se les administró por vía oral 0,05 g/100 g y 0,2 g/100 g del extracto acuoso de A. altilis; se incluyó un grupo control negativo que recibió solución salina fisiológica y un grupo control po...
International Nuclear Information System (INIS)
Coto Valverde, Daniel Esteban
2010-01-01
The expression levels of cIAP genes and cMET were determined in liver tissues with and without neoplasm of the organism Rattus norvegicus, for prevention, diagnosis and treatment of hepatocellular carcinoma. The technique of reaction Polymerase Chain in real time (qPCR), is used to obtain the expression, of both genes cIAP and cMET, and this has decreased in neoplastic samples compared to samples not affected. The expression of these genes has been analyzed in samples with neoplastic formations, but treated with an anti-tumor agent. The expression has presented an increase of the cMET gene, unlike the cIAP gene, which has decreased its expression. Perform statistical analysis has been impossible because the number of samples used has been reduced. The results obtained differ with those expected theoretically. (author) [es
Directory of Open Access Journals (Sweden)
Michael A. Tabak
2015-01-01
Full Text Available Non-native rats (Rattus spp. threaten native island species worldwide. Efforts to eradicate them from islands have increased in frequency and become more ambitious in recent years. However, the long-term success of some eradication efforts has been compromised by the ability of rats, particularly Norway rats (Rattus norvegicus which are good swimmers, to recolonize islands following eradications. In the Falkland Islands, an archipelago in the South Atlantic Ocean, the distance of 250 m between islands (once suggested as the minimum separation distance for an effective barrier to recolonization has shown to be insufficient. Norway rats are present on about half of the 503 islands in the Falklands. Bird diversity is lower on islands with rats and two vulnerable passerine species, Troglodytes cobbi (the only endemic Falkland Islands passerine and Cinclodes antarcticus, have greatly reduced abundances and/or are absent on islands with rats. We used logistic regression models to investigate the potential factors that may determine the presence of Norway rats on 158 islands in the Falkland Islands. Our models included island area, distance to the nearest rat-infested island, island location, and the history of island use by humans as driving variables. Models best supported by data included only distance to the nearest potential source of rats and island area, but the relative magnitude of the effect of distance and area on the presence of rats varied depending on whether islands were in the eastern or western sector of the archipelago. The human use of an island was not a significant parameter in any models. A very large fraction (72% of islands within 500 m of the nearest potential rat source had rats, but 97% of islands farther than 1,000 m away from potential rat sources were free of rats.
Directory of Open Access Journals (Sweden)
Ni Kadek Laura Sastrawan
2016-03-01
Full Text Available Penelitian ini bertujuan untuk mengetahui perbedaan kecepatan kesembuhan luka insisi pada tikus putih (Rattus norvegicus yang diberikan obat deksametason dan asam mefenamat ditinjau dari gambaran makroskopik dan mikroskopik. Tiga puluh ekor tikus putih jantan dengan berat 150-200 gram dibagi menjadi tiga perlakuan, yang diinsisi pada daerah linea alba dengan panjang insisi dua cm dengan kedalaman hingga menembus peritoneum. Penelitian menggunakan Rancangan Acak Lengkap (RAL. Pengamatan makroskopik dilakukan setiap hari selama 14 hari. Pada hari ketujuh dan hari ke14, lima ekor tikus dari semua kelompok dieutanasi, kemudian kulit hingga peritoneum lokasi luka insisi dikoleksi untuk pemeriksaan histopatologis. Hasil pemeriksaan makroskopik dianalis secara deskriptif dan pemeriksaan histopatologis dianalisis menggunakan uji Non Parametrik. Hasil pemeriksaan makroskopik dan mikroskopik menunjukan bahwa tikus perlakuan III memberikan efek kesembuhan luka lebih cepat dibandingkan tikus perlakuan II dan tikus perlakuan I karena efek dari peradangan terjadi lebih sedikit (minimal dan kerapatan kolagen yang lebih padat.
Donayre Ramirez, Marjorie Raquel; Carrasco Montañez, Daniel Diomedes
2013-01-01
El presente trabajo se desarrolló en el laboratorio de Química Analítica de la Universidad Nacional de la Amazonía Peruana (UNAP) y en el Instituto de Medicina Tradicional (IMET) de la Ciudad de !quitos - Perú. Se evaluó la actividad hipoglucemiante de los extractos, etanólico y metanólico de raíz, tallo y hoja de Physalis angulata (Linneo) "mullaca", en ratas albinas machos Rattus norvegicus cepa Holtzman, previa inducción de un estado de hiperglicemia con alloxano al 5% (125mg/kg de masa co...
A Two-Year Ecological Study of Norway Rats (Rattus norvegicus) in a Brazilian Urban Slum.
Panti-May, Jesús A; Carvalho-Pereira, Ticiana S A; Serrano, Soledad; Pedra, Gabriel G; Taylor, Josh; Pertile, Arsinoê C; Minter, Amanda; Airam, Vladimir; Carvalho, Mayara; Júnior, Nivison N; Rodrigues, Gorete; Reis, Mitermayer G; Ko, Albert I; Childs, James E; Begon, Mike; Costa, Federico
2016-01-01
The Norway or brown rat (Rattus norvegicus) is among the most ubiquitous of rodents. However, the lack of studies describing Norway rat populations from tropical areas have limited our understanding regarding their demography and seasonal dynamics. In this study, we describe seasonal pattern in the abundance, reproductive parameters, and morphometrics of Norway rat populations in Salvador, Brazil. Rodents were trapped over four seasonal trapping periods (2013-2014) from three valleys. A total of 802 Norway rats were trapped over the course of the study over 7653 trap-nights. Norway rat abundance was high, but there was no significant differences between seasons. The reproductive parameters (e.g. frequency of pregnant and lactating females) did not show statistical differences between seasons. Female rats collected in the rainy season were heavier and older than females from the dry season. Salvador rats had a high incidence of pregnancy and birth rate (estimated birth rate of 79 young per year) compared to previous studies. The information generated is critical for the understanding of the ecology of Norway rat, the main reservoir of Leptospira in Salvador. However, future studies examining the effect of rodent control programs aimed at reducing populations, and determining rates of recovery, will further clarify our understanding of population dynamics.
Structure of the GH1 domain of guanylate kinase-associated protein from Rattus norvegicus
International Nuclear Information System (INIS)
Tong, Junsen; Yang, Huiseon; Eom, Soo Hyun; Chun, ChangJu; Im, Young Jun
2014-01-01
Graphical abstract: - Highlights: • The crystal structure of GKAP homology domain 1 (GH1) was determined. • GKAP GH1 is a three-helix bundle connected by short flexible loops. • The predicted helix α4 associates weakly with the helix α3, suggesting dynamic nature of the GH1 domain. - Abstract: Guanylate-kinase-associated protein (GKAP) is a scaffolding protein that links NMDA receptor-PSD-95 to Shank–Homer complexes by protein–protein interactions at the synaptic junction. GKAP family proteins are characterized by the presence of a C-terminal conserved GKAP homology domain 1 (GH1) of unknown structure and function. In this study, crystal structure of the GH1 domain of GKAP from Rattus norvegicus was determined in fusion with an N-terminal maltose-binding protein at 2.0 Å resolution. The structure of GKAP GH1 displays a three-helix bundle connected by short flexible loops. The predicted helix α4 which was not visible in the crystal structure associates weakly with the helix α3 suggesting dynamic nature of the GH1 domain. The strict conservation of GH1 domain across GKAP family members and the lack of a catalytic active site required for enzyme activity imply that the GH1 domain might serve as a protein–protein interaction module for the synaptic protein clustering
Low prevalence of human enteropathogenic Yersinia spp. in brown rats (Rattus norvegicus in Flanders.
Directory of Open Access Journals (Sweden)
Lieze Oscar Rouffaer
Full Text Available Brown rats (Rattus norvegicus have been identified as potential carriers of Yersinia enterocolitica and Y. pseudotuberculosis, the etiological agents of yersiniosis, the third most reported bacterial zoonosis in Europe. Enteropathogenic Yersinia spp. are most often isolated from rats during yersiniosis cases in animals and humans, and from rats inhabiting farms and slaughterhouses. Information is however lacking regarding the extent to which rats act as carriers of these Yersinia spp.. In 2013, 1088 brown rats across Flanders, Belgium, were tested for the presence of Yersinia species by isolation method. Identification was performed using MALDI-TOF MS, PCR on chromosomal- and plasmid-borne virulence genes, biotyping and serotyping. Yersinia spp. were isolated from 38.4% of the rats. Of these, 53.4% were designated Y. enterocolitica, 0.7% Y. pseudotuberculosis and 49.0% other Yersinia species. Two Y. enterocolitica possessing the virF-, ail- and ystA-gene were isolated. Additionally, the ystB-gene was identified in 94.1% of the other Y. enterocolitica isolates, suggestive for biotype 1A. Three of these latter isolates simultaneously possessed the ail-virulence gene. Significantly more Y. enterocolitica were isolated during winter and spring compared to summer. Based on our findings we can conclude that brown rats are frequent carriers for various Yersinia spp., including Y. pseudotuberculosis and (human pathogenic Y. enterocolitica which are more often isolated during winter and spring.
Structure of the GH1 domain of guanylate kinase-associated protein from Rattus norvegicus
Energy Technology Data Exchange (ETDEWEB)
Tong, Junsen; Yang, Huiseon [College of Pharmacy, Chonnam National University, Gwangju 500-757 (Korea, Republic of); Eom, Soo Hyun [School of Life Sciences, Steitz Center for Structural Biology, and Department of Chemistry, Gwangju Institute of Science and Technology, Gwangju 500-712 (Korea, Republic of); Chun, ChangJu, E-mail: cchun1130@jnu.ac.kr [College of Pharmacy, Chonnam National University, Gwangju 500-757 (Korea, Republic of); Im, Young Jun, E-mail: imyoungjun@jnu.ac.kr [College of Pharmacy, Chonnam National University, Gwangju 500-757 (Korea, Republic of)
2014-09-12
Graphical abstract: - Highlights: • The crystal structure of GKAP homology domain 1 (GH1) was determined. • GKAP GH1 is a three-helix bundle connected by short flexible loops. • The predicted helix α4 associates weakly with the helix α3, suggesting dynamic nature of the GH1 domain. - Abstract: Guanylate-kinase-associated protein (GKAP) is a scaffolding protein that links NMDA receptor-PSD-95 to Shank–Homer complexes by protein–protein interactions at the synaptic junction. GKAP family proteins are characterized by the presence of a C-terminal conserved GKAP homology domain 1 (GH1) of unknown structure and function. In this study, crystal structure of the GH1 domain of GKAP from Rattus norvegicus was determined in fusion with an N-terminal maltose-binding protein at 2.0 Å resolution. The structure of GKAP GH1 displays a three-helix bundle connected by short flexible loops. The predicted helix α4 which was not visible in the crystal structure associates weakly with the helix α3 suggesting dynamic nature of the GH1 domain. The strict conservation of GH1 domain across GKAP family members and the lack of a catalytic active site required for enzyme activity imply that the GH1 domain might serve as a protein–protein interaction module for the synaptic protein clustering.
Directory of Open Access Journals (Sweden)
van Hooft Pim
2011-02-01
Full Text Available Abstract Background South Africa's long and extensive trade activity has ensured ample opportunities for exotic species introduction. Whereas the rich biodiversity of endemic southern African fauna has been the focus of many studies, invasive vertebrates are generally overlooked despite potential impacts on biodiversity, health and agriculture. Genetic monitoring of commensal rodents in South Africa which uncovered the presence of Rattus tanezumi, a South-East Asian endemic not previously known to occur in Africa, provided the impetus for expanded studies on all invasive Rattus species present. Results To this end, intensified sampling at 28 South African localities and at one site in Swaziland, identified 149 Rattus specimens. Cytochrome b gene sequencing revealed the presence of two R. tanezumi, seven Rattus rattus and five Rattus norvegicus haplotypes in south Africa. Phylogenetic results were consistent with a single, recent R. tanezumi introduction and indicated that R. norvegicus and R. rattus probably became established following at least two and three independent introductions, respectively. Intra- and inter-specific diversity was highest in informal human settlements, with all three species occurring at a single metropolitan township site. Rattus norvegicus and R. rattus each occurred sympatrically with Rattus tanezumi at one and five sites, respectively. Karyotyping of selected R. rattus and R. tanezumi individuals identified diploid numbers consistent with those reported previously for these cryptic species. Ordination of bioclimatic variables and MaxEnt ecological niche modelling confirmed that the bioclimatic niche occupied by R. tanezumi in south Africa was distinct from that occupied in its naturalised range in south-east Asia suggesting that factors other than climate may influence the distribution of this species. Conclusions This study has highlighted the value of genetic typing for detecting cryptic invasive species, providing
Directory of Open Access Journals (Sweden)
Chelsea G Himsworth
Full Text Available Leptospira interrogans is a bacterial zoonosis with a worldwide distribution for which rats (Rattus spp. are the primary reservoir in urban settings. In order to assess, monitor, and mitigate the risk to humans, it is important to understand the ecology of this pathogen in rats. The objective of this study was to characterize the ecology of L. interrogans in Norway rats (Rattus norvegicus in an impoverished inner-city neighborhood of Vancouver, Canada.Trapping was performed in 43 city blocks, and one location within the adjacent port, over a 12 month period. Kidney samples were tested for the presence of L. interrogans using PCR and sequencing. A multivariable model was built to predict L. interrogans infection status in individual rats using season and morphometric data (e.g., weight, sex, maturity, condition, etc. as independent variables. Spatial analysis was undertaken to identify clusters of high and low L. interrogans prevalence. The prevalence of L. interrogans varied remarkably among blocks (0-66.7%, and spatial clusters of both high and low L. interrogans prevalence were identified. In the final cluster-controlled model, characteristics associated with L. interrogans-infection in rats included weight (OR = 1.14, 95% CI = 1.07-1.20, increased internal fat (OR = 2.12, 95% CI = 1.06-4.25, and number of bite wounds (OR = 1.20, 95% CI = 0.96-1.49.Because L. interrogans prevalence varied with weight, body fat, and bite wounds, this study suggests that social structure and interactions among rats may influence transmission. The prevalence and distribution of L. interrogans in rats was also highly variable even over a short geographic distance. These factors should be considered in future risk management efforts.
DEFF Research Database (Denmark)
Markussen, Mette Drude; Heiberg, Ann-Charlotte; Fredholm, Merete
2007-01-01
Anticoagulant agents, such as warfarin and bromadiolone, are used to control populations of Norway rats (Rattus norvegicus). The anticoagulants compromise the blood-coagulation process by inhibiting the vitamin K2,3 epoxide reductase enzyme complex (VKOR). Mutations in the VKORC1 gene, encoding...... (with an Y139C-VKORC1 mutation), we compared VKORC1 and calumenin liver gene expression between resistant and anticoagulant-susceptible rats upon saline and bromadiolone-administration. Additionally, we established the effect of bromadiolone on VKORC1 and calumenin expression in the two rat strains....... Bromadiolone had no effect on gene expression in resistant rats but significantly induced calumenin expression in susceptible rats. Calumenin expression was similar between resistant and susceptible rats upon saline administration but two-fold lower in resistant rats upon bromadiolone-treatment. These results...
Sivakumar, Valsala; Sivakumar, S
2004-12-01
Combating heart disease is one of the challenging problems of biomedical science today. Towards this goal an indigenous preparation 'Trikatu' (a herbal combination containing Piper longum (fruit), Piper nigrum (fruit) and Zingiber officinale (rhizome) dry powder) was fed to normal and cholesterol fed male Rattus norvegicus to ascertain its efficacy as a hypolipidaemic agent. Its effects on body weight, blood and tissue (aortic, cardiac and hepatic) lipids--total, free and esterified cholesterol, low density lipoprotein(LDL) and high density lipoprotein(HDL) cholesterol, triglycerides and phospholipids--and the atherogenic index were measured. It was found that 'Trikatu' by virtue of its ability to reduce triglycerides and LDL cholesterol and to increase HDL cholesterol can reduce the risk of hyperlipidaemia and atherosclerosis. Hence 'Trikatu' can be used as a potent hypolipidaemic agent and it can reduce the atherosclerosis associated with a high fat diet. 2004 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
C. Sumantri
2012-04-01
Full Text Available Falsification of the origin of livestock meat and its processed with rat meat is a problem that must be overcome to ensure food safety. One way that is often used to detect forgeries by using cytochrome b gene as a marker. The purpose of this study was to create a specific primer derived from cytochrome b sequences in rat (Rattus norvegicus as the DNA marker to detect any contamination of rat meat on fresh livestock meat and its processed meat products. Meatballs were made from beef meat with the addition of rat 1%-25%, and the meatballs were obtained from traditional markets. DNA extraction was conducted from seven species (goat, chicken, cattle, sheep, pig, horse, and rat by using phenol-chloroform. The highest success rate in detecting the presence of rat meat in a mixture of beef meatballs at concentration of 15% was 100%. The specific fragment of cytochrome b gene in R. norvegicus has no similarity with the cytochrome b gene from six other species, so it can be used as molecular markers to detect the presence of rat meat contamination in the processed of meat products. Amplified fragment length for goats, chickens, cattle, sheep, pigs, horses, and rats 157, 227, 274, 331, 398, 439 and 603 bp respectively. The amplification of cytochrome b gene in seven species of animals with different fragment length indicated the specificity of cytochrome b gene sequences among species.
Metagenomic Screening of Urban Rattus Norvegicus for Virus and Pathogens
DEFF Research Database (Denmark)
Hansen, Thomas Arn
the way for increasing rates of pathogen discovery and identification, thereby enabling faster containment of wildlife vectors. In this thesis, I have used metagenomics to assess the virome and resistome of the wild urban R. norvegicus. Many new potential viruses are discovered through virome analyses......; including the first known R. norvegicus associated polyomavirus, a novel papillomavirus, several circular ssDNA viruses and some cardioviruses. The resistome analyses on these samples reveals many shared as well as location-specific antibiotic resistance genes, but there is a clear selection for vancomycin...
Vancomycin gene selection in the microbiome of urban Rattus norvegicus from hospital environment
DEFF Research Database (Denmark)
Arn Hansen, Thomas; Joshi, Tejal; Larsen, Anders Rhod
2016-01-01
Widespread use of antibiotics has resulted in selection pressure on genes that make bacteria non-responsive to antibiotics. These antibiotic-resistant bacteria are currently a major threat to global health. There are various possibilities for the transfer of antibiotic resistance genes. It has be....... norvegicus microbiome, potentially driven by the outflow of antibiotics and antibiotic-resistant bacteria into the wastewater systems. Carriage of vancomycin resistance may suggest that R. norvegicus is acting as a reservoir for possible transmission to the human population....
Directory of Open Access Journals (Sweden)
LINTAL MUNA
2011-11-01
Full Text Available Muna L, Astirin OP, Sugiyarto. 2011. Uji teratogenik ekstrak Pandanus conoideus varietas buah kuning terhadap perkembangan embrio tikus putih (Rattus norvegicus. Bioteknologi 8: 65-77. Penelitiian ini betujuan untuk mengkaji pengaruh pemberian ekstrak Pandanus conoideus Lam. var. buah kuning terhadap persentase fetus hidup, kematian intrauterus, berat dan panjang fetus, keadaan morfologi fetus, serta struktur skeleton fetus tikus putih. Dalam penelitian ini diggunakan 25 tikus bunting yang dibagi menjadi lima kelompok secara acak, sehingga masing-masing kelompok terdiri dari lima ekor tikus. Setiap kelompok diberi dosis yang berbeda. P1 (kontrol diberi 1 mL minyak wijen, P2 , P3, P4 dan P5 diberi ekstrak masing-masing: 0,02 mL, 0,04 mL, 0,08 mL dan 0,16 mL. Ekstrak tersebut diberikan secara oral pada kebuntingan hari ke 5 sampai hari ke 17 (fase organogenesis. Pengamatan dilakukan pada hari ke 18 dengan cara bedah sesar untuk menggambil fetus dari uterus. Morfologi fetu s diamati setelah fetus dikeluarkan dari uterus, sedangkan untuk pengamatan struktur skeleton dibuat preparat wholemount dengan pewarnaan ganda Alcian blue dan Allizarrin Red-S. Hasil percobaan diianalisis dengan ANAVA satu jalur. Hasil penelitiann menunjukkan bahwa pemberian ekstrak tidak berpengaruh terhadap persentase fetus hidup, kematian intrauterus, serta berat dan panjang fetus (P≥0,05. Pemberian ekstrak pada induk mengakibatkan kecacatan skeleton (lordosis fetus pada dosis 0,16 mL dan menghambat osifikasi fetus.
Directory of Open Access Journals (Sweden)
Fitria Rahmitasari
2016-12-01
Full Text Available Background: In the field of dentistry, alveolar bone damage can be caused by periodontal disease, traumatic injury due to tooth extraction, cyst enucleation, and tumor surgery. One of the ways to regenerate the bone defect is using graft scaffold. Thus, combination of chitosan and collagen can stimulate osteogenesis. Purpose: The aim of this study was to examine the potential of chitosan combined with chicken shank collagen on bone defect regeneration process. Method: Twelve Rattus norvegicus were prepared as animal models in this research. A bone defect was intentionally created at both of the right and left femoral bones of the models. Next, 24 samples were divided into four groups, namely Group 1 using chitosan – collagen scaffold (50:50, Group 2 using chitosan collagen-scaffold (80:20, Group 3 using chitosan scaffold only, and Control Group using 3% CMC-Na. On 14th day, those animals were sacrificed, and histopathological anatomy examination was conducted to observe osteoclast cells. In addition, immunohistochemistry examination was also performed to observe RANKL expressions. Result: There was a significant difference in RANKL expressions among the groups, except between Group 3 using chitosan scaffold only and control group (p value > 0.05. The highest expression of RANKL was found in Group 1 with chitosan – collagen scaffold (50:50, followed by Group 2 with chitosan-collagen scaffold (80:20. Moreover, there was also a significant difference in osteoclast generation, except between Group 1 using chitosan – collagen scaffold (50:50 and Group 2 using chitosan-collagen scaffold (80:20, p value 0.05. Less osteoclast was found in the groups using chitosan – collagen scaffold (Group 1 and Group 2. Conclusion: Combination of chitosan and chicken shank collagen scaffold can improve regeneration process of bone defect in Rattus novergicus animals through increasing of RANKL expressions, and decreasing of osteoclast.
Energy Technology Data Exchange (ETDEWEB)
Wuenschmann, S. [Internationales Hochschulinstitut Zittau, Lehrstuhl Umweltverfahrenstechnik, Zittau (Germany); Hochschule Zittau/Goerlitz, Fachbereich Mathematik/Naturwissenschaften, Zittau (Germany); Oehlmann, J. [J.W. Goethe-Univ. Frankfurt, Zoologisches Inst., Frankfurt/M. (Germany); Delakowitz, B. [Hochschule Zittau/Goerlitz, Fachbereich Mathematik/Naturwissenschaften, Zittau (Germany); Markert, B. [Internationales Hochschulinstitut Zittau, Lehrstuhl Umweltverfahrenstechnik, Zittau (Germany)
2002-07-01
Background concentrations of eleven elements in tissues and organs of wild-living rats (Rattus norvegicus) obtained from a region (Euroregion Neisse, around the trilateral border region of Germany, Poland and the Czech Republic) distinguished by low to intermediate levels of environmental contaminations are given in part I of this work. In order to identify the most important depot compartments for certain elements, a body burden method was applied. Differences of affinity due to sex and age of analyzed rats are discussed, as are the suitability of specific organs and tissues with regard to bioaccumulation measurements concerning metals. The principal depot compartments for the heavy metals Cu, Mn, Cd, (in adult rats) and Tl are the liver and kidneys, whereas the elements Ni, Sr, Pb (for adult animals) and Ti are more affinitively to bones. Co and Zn displayed a more pronounced affinity towards tissues of the bones and liver. The analysis revealed large differences in Cd and Pb distributions both among young and adult rats, and with respect to sexes. It can be concluded that the distribution of the elements investigated in this study in free-living rats agrees with that in man, except for that of Ni. The above agreement gives proof of the possibility to use depot organs of rats for bioindication which was already mentioned in part I of this work. (Sex and age-related quantification of Al, As, Cd, Co, Cu, Mn, Ni, Pb, Sr, Ti, Tl and Zn in liver, heart, lung, kidney, muscle, brain and bones and establishment of distribution patterns'). (orig.) [German] Die in Teil I quantifizierten Hintergrundkonzentrationen von 11 Elementen in Geweben und Organen wildlebender Ratten (Rattus norvegicus) aus einem gering bis maessig belasteten Untersuchungsgebiet (Euroregion Neisse) werden im 2. Teil fuer die Berechnung ihres relativen Beitrags zur Gesamtkoerperbelastung (Koerperlast oder Bodyburden) verwendet, um bevorzugte Depotkompartimente fuer die untersuchten Elemente
Directory of Open Access Journals (Sweden)
Dini Hardini
2006-12-01
Full Text Available Egg containing long chain unsaturated fatty acids is a functional food, because it is highly nutritious and could prevent diseases, (omega 3 and 6 such as coronary heart attack. The research was aimed to measure the change of egg cholesterol content during proceesing: frying, oiless frying and boiling and their influence to the blood plasma cholesterol of normal and hypercholesterolemia rat. Seven treatments of egg yolk were frying at 170°C for 3 min (welldone = GM, and 1min (half medium fried = GSM using deep fryer , oilless frying at 70°C for10 min (fried = TM, and 6 min (half fried = TSM using Teflon pan, and boiling at 100°C for 10’ (boiled = RM dan 4 min (half boiled = RSM using pan provided with thermoregulator and a fresh omega egg as a control. The Completely randomized design was apllied for 4 weeks research period. The data from different treatments were analyzed by Orthogonal Contrast. Fifty 2 months old male rats Rattus norvegicus L. separated in 2 groups; normal and hypercholesterolemia (blood cholesterol > 200 mg dl-1. The rats were placed in individual cage, fed 15 g h-1 day-1 and water drinking ad libitum. The ration was composed of 90% basal commercial feed BR II and 10% egg yolk was given to each animal at 20% of live weight. Factorial 2 x 7 of completely randomized design was applied. The data were analyzed by ANOVA and Duncan’s Multiple Range Test. Processsing method of egg affected to cholesterol content of egg, The lowest and the highest cholesterol contents were observed in TSM (0.30 g/100g and GM (0.37 g/100g, respectively. Biological test using Rattus norvegicus L rat showed that either fresh and processed long chain fatty acid egg decreased plasma cholesterol. The highest and the lowest decreases of cholesterol content were found in the group consumed RSM (8.64% and GM (1.77% for normal rat; and control (46.3% followed by RSM (44.53% and GM (24.86%, respectively. To maintain normal cholesterol and decrease
2016-08-30
60th Medical Group (AMC), Travis AFB, CA INSTITUTIONAL ANIMAL CARE AND USE COMMITTEE (IACUC) FINAL REPORT SUMMARY (Please !ml all information. Use...Technicians and Investigators using Common Laboratory Animal Species, including: Mice (Mus muscu/us), Rats (Rattus norvegicus), Hamsters (Mesocricetus auratus...DATE: 14 November 2016 FUNDING SOURCE: SG O&M funds LAST TRIENNIAL REVISION DATE: 15 October 2015 1. RECORD OF ANIMAL USAGE: Animal Species: Total
Directory of Open Access Journals (Sweden)
Putranty Widha Nugraheni
2017-09-01
Full Text Available Uric acid is the end product of purine degradation. When uric acid levels exceed normal limits, it will build up and cause hyperuricemia. Allopurinol is one of the most effective and common medicine for hyperuricemia, but it brings serious side effects, therefore it is needed alternative therapy for hyperuricemia. One plant that may be expected to low uric acid levels is green tea (Camellia sinensis L., that contains many antioxidants polyphenols, especially flavonoids. Flavonoid has strong antioxidant properties, act as free radical and metal scavengers, and also xanthine oxidase (XOD inhibitors. This study investigates the potential of green tea using various doses of 150 mg/kg, 300 mg/kg, and 600 mg/kg of body weight in 24 white male rats (Rattus norvegicus Wistar strain that has been received high purine diet in 60 consecutive days. This study used DHBSA methods to measure uric acid levels in blood serum and urine that excreted 8 hours before surgery. Green tea extract that contains polyphenol can inhibit XOD activities, therefore, it leads to decrease uric acid level in blood and increase the excretion through urine by modulating urate gene transporter. A therapy with 600 mg/kg body weight of GTE is the most effective dose to decrease uric acid levels in serum and to increase excretion of exceeding uric acid significantly (p < 0.01, from One Way ANOVA and Tukey analysis.
Directory of Open Access Journals (Sweden)
Cecília Sandra Nunes Morais
2003-10-01
Full Text Available Foram estudadas quatro fontes lipídicas (óleo de soja, óleo de canola, azeite de oliva e gordura suína em dois níveis na dieta (7 e 14%, verificando a influência do consumo dessas fontes lipídicas sobre algumas frações lipídicas do sangue de ratos. Assim, oito grupos de ratos machos da linhagem Wistar (Rattus norvegicus foram alimentados ad libitum por 56 dias com oito dietas distintas contendo as fontes e níveis citados de lipídios. As dosagens de colesterol total e triacilgliceróis no soro foram realizadas pelo método colorimétrico/enzimático utilizando "kit" comercial específico. O colesterol em HDL foi determinado por precipitação dos quilomícrons, VLDL e LDL, utilizando também "kit" específico. O aumento de lipídios na dieta para 14% elevou os valores de colesterol total, HDL-colesterol e LDL+VLDL-colesterol séricos, quando a fonte foi a gordura suína. Com 14% de lipídios na dieta, os menores valores de triacilgliceróis séricos foram observados nas fontes lipídicas óleo de soja e canola, com valores de 76,09 e 84,42 mg/dL, respectivamente.Four fat sources (soybean oil, canola oil, olive oil, swine fat were evaluated with regard to their influence, at two levels in the diet (7 and 14%, on some fat fractions in rats' blood. Thus, eight groups of Wistar rat (Rattus norvegicus males were ad libitum fed eight different diets, containing the fat and level reported, for 56 days. The dosages of total serum cholesterol and thriacylglicerols were performed by the colorimetric/enzymatic method utilizing a commercial specific kit. The HDL cholesterol was determined by precipitation of kilomicra (VLDL and LDL by utilizing also a specific kit. The increase of fat in the diet to 14% raised the total cholesterol contents, serum HDL cholesterol and LDL + VLDL cholesterol when the source was swine fat. With 14% of fat in the diet, the lowest values of serum triacylglycerols were found for the fat sources soybean and canola oils
Aboriginal and invasive rats of genus Rattus as hosts of infectious agents.
Kosoy, Michael; Khlyap, Lyudmila; Cosson, Jean-Francois; Morand, Serge
2015-01-01
From the perspective of ecology of zoonotic pathogens, the role of the Old World rats of the genus Rattus is exceptional. The review analyzes specific characteristics of rats that contribute to their important role in hosting pathogens, such as host-pathogen relations and rates of rat-borne infections, taxonomy, ecology, and essential factors. Specifically the review addresses recent taxonomic revisions within the genus Rattus that resulted from applications of new genetic tools in understanding relationships between the Old World rats and the infectious agents that they carry. Among the numerous species within the genus Rattus, only three species-the Norway rat (R. norvegicus), the black or roof rat (R. rattus), and the Asian black rat (R. tanezumi)-have colonized urban ecosystems globally for a historically long period of time. The fourth invasive species, R. exulans, is limited to tropical Asia-Pacific areas. One of the points highlighted in this review is the necessity to discriminate the roles played by rats as pathogen reservoirs within the land of their original diversification and in regions where only one or few rat species were introduced during the recent human history.
Yin, Baofa; Gu, Chen; Lu, Yi; Hegab, Ibrahim M.; Yang, Shengmei; Wang, Aiqin; Wei, Wanhong
2017-08-01
Prey species show specific adaptations that allow recognition, avoidance, and defense against predators. This study was undertaken to investigate the processing of a chronic, life-threatening stimulus to Norway rats ( Rattus norvegicus). One hundred forty-four Norway rats were tested by repeated presentation of cat urine for 1 h at different days in a defensive withdrawal apparatus. Rats exposed to urine for short periods showed significantly larger defensive behavioral and medial hypothalamic c-fos messenger RNA (mRNA) responses than other groups. These defensive responses habituated shortly after the presentation of cat urine. Serum levels of adrenocorticotropic hormone and corticosterone increased significantly when animals were repeatedly exposed to cat urine. However, the hormonal responses took longer to habituate than the behavioral and molecular responses did. We conclude that the behavioral and c-fos mRNA responses are "primed" for habituation to repeated exposures to cat urine, while the hormonal responses show "resistance." The results support our hypothesis that the strongest anti-predator responses at three levels would occur during short-term exposure to cat urine and that these responses would subsequently disappear on prolonged exposure. This study assists understanding the way in which the different levels of defensive responses are integrated and react during chronic stress.
Directory of Open Access Journals (Sweden)
Aleksandro Schafer da Silva
2008-08-01
Full Text Available Este estudo teve como objetivo avaliar o efeito do aceturato de diminazeno e do dipropionato de imidocarb no controle da infecção por Trypanosoma evansi em ratos (Rattus norvegicus infectados experimentalmente. Cinqüenta e quatro ratos machos foram inoculados via intraperitonial com 104 tripomastigotas de T. evansi/animal. Os ratos foram monitorados diariamente por meio de esfregaço sanguíneo periférico. No momento em que se observassem oito protozoários por campo microscópico de 1000x, era iniciado o tratamento com as drogas (dia zero. O estudo foi dividido em dois protocolos terapêuticos e os fármacos foram administrados via intramuscular. O primeiro protocolo foi aplicado nos grupos A, B, C e D e o segundo protocolo nos grupos E, F, G e H. O grupo controle foi identificado como grupo I, não medicados. No primeiro protocolo, os ratos receberam uma dose única dos fármacos no dia zero e sempre que se observasse T. evansi na circulação periférica. No segundo protocolo, os roedores receberam as mesmas doses, no entanto, por cinco dias consecutivos. No primeiro protocolo, os dois princípios ativos não apresentaram eficácia curativa, ocorrendo reincidência da parasitemia após alguns dias do tratamento. No segundo protocolo, o aceturato de diminazeno eliminou a forma tripomastigota da circulação e os ratos foram eutanasiados após 90 dias do início do tratamento. Os roedores tratados com dipropionato de imidocarb apresentaram recidiva da infecção após 30 dias. Na histopatologia não se observou alteração renal e hepática relacionada à doença ou aos medicamentos testados. Com base nos resultados, foi concluído que o aceturato de diminazeno, quando administrado por cinco dias consecutivos, é efetivo no tratamento da tripanossomose em ratos.The aim of this study was to evaluate the efficacy of diminazene aceturate and imidocarb dipropionate in the control of Trypanosoma evansi infection in rats (Rattus norvegicus
Directory of Open Access Journals (Sweden)
Sri Retno Dwi Ariani
2010-06-01
Full Text Available The aim of this research is to know about if the guava (Psidium guajava L. leaf methanol extract on 10.5 mg/mL and 21.0 mg/mL dossages indicate a positive test as contraception antifertility to white mice (Rattus norvegicus. The sample is guava leaf from Mungkid, Magelang Central of Java Indonesia. The animals experiment are the white mice on 140-300 g for female, 200-250 g for male and about 3 months of age in average. The steps of this research are : (1 preparing sample, i.e. washing, drying on to indirect sunlight and make the sample into powder, (2 isolation the guava leaf powder in soxhlet instrument with hexane, (3 evaporation the sample with rotary evaporator until guava leaf hexane extract produced, (4 maseration the sample with methanol, (5 evaporation the sample with rotary evaporator until guava leaf methanol extract produced, (6 conducting contraception antifertility activity test to guave leaf methanol extract on 10.5 mg/mL and 21.0 mg/mL dossages to mice white. The results of this research are guava leaf methanol extract on 10.5 mg/mL and 21.0 mg/mL dossages indicate a negative contraception antifertility test to white mice but in these dossages have indicated that an antiimplantation effect (the total natality of fetus is less than the total implantation site in mice white. Keywords: Guava leaf, contraseption antifertility, methanol extract, white mice, implantation
Walker, R; Carvalho-Pereira, T; Serrano, S; Pedra, G; Hacker, K; Taylor, J; Minter, A; Pertile, A; Panti-May, A; Carvalho, M; Souza, F N; Nery, N; Rodrigues, G; Bahiense, T; Reis, M G; Ko, A I; Childs, J E; Begon, M; Costa, F
2017-01-01
Urban slum environments in the tropics are conducive to the proliferation and the spread of rodent-borne zoonotic pathogens to humans. Calodium hepaticum (Brancroft, 1893) is a zoonotic nematode known to infect a variety of mammalian hosts, including humans. Norway rats (Rattus norvegicus) are considered the most important mammalian host of C. hepaticum and are therefore a potentially useful species to inform estimates of the risk to humans living in urban slum environments. There is a lack of studies systematically evaluating the role of demographic and environmental factors that influence both carriage and intensity of infection of C. hepaticum in rodents from urban slum areas within tropical regions. Carriage and the intensity of infection of C. hepaticum were studied in 402 Norway rats over a 2-year period in an urban slum in Salvador, Brazil. Overall, prevalence in Norway rats was 83% (337/402). Independent risk factors for C. hepaticum carriage in R. norvegicus were age and valley of capture. Of those infected the proportion with gross liver involvement (i.e. >75% of the liver affected, a proxy for a high level intensity of infection), was low (8%, 26/337). Sixty soil samples were collected from ten locations to estimate levels of environmental contamination and provide information on the potential risk to humans of contracting C. hepaticum from the environment. Sixty percent (6/10) of the sites were contaminated with C. hepaticum. High carriage levels of C. hepaticum within Norway rats and sub-standard living conditions within slum areas may increase the risk to humans of exposure to the infective eggs of C. hepaticum. This study supports the need for further studies to assess whether humans are becoming infected within this community and whether C. hepaticum is posing a significant risk to human health.
Directory of Open Access Journals (Sweden)
GABRIEL LOBOS
2005-03-01
Full Text Available Realizamos un estudio que incluyó muestreos y prospecciones en un gradiente latitudinal en Chile continental para determinar la presencia y ausencia de roedores murinos introducidos, particularmente Mus musculus, Rattus rattus y R. norvegicus en áreas naturales o silvestres a lo largo de Chile. Además se analizó el riesgo epidemiológico que representan estas especies en el marco de un estudio sobre el virus Hanta. Los resultados mostraron que M. musculus rara vez es recolectado en áreas naturales. Sin embargo, las dos especies de Rattus han invadido ampliamente la región mediterránea chilena. Las regiones desérticas, los ambientes de alturas y las regiones australes, serían biótopos restringidos para estos invasores. Desde una perspectiva epidemiológica, la presencia del virus Hanta (variedades Andes y Seoul en Rattus es un elemento que demuestra que las especies invasoras además de generar impactos ecológicos, pueden ocasionar problemas económicos y de salud pública. La fragilidad de los ecosistemas mediterráneos determina que la presencia de especies exóticas constituya un elemento de alto riesgo para la conservación del patrimonio natural del país. Probablemente, la conservación de áreas naturales constituye la mejor herramienta para enfrentar a estas especies exóticasWe conducted a latitudinal study in natural areas of continental Chile to evaluate the occurrence of the introduced murine rodents Mus musculus, Rattus rattus and R. norvegicus. Furthermore, we evaluated the epidemiological risk of these species as part of an ongoing study on Hantavirus. The results allowed us to conclude that M. musculus occurs rarely in natural environments. However, the two species of Rattus have widely invaded the mediterranean region of Chile. Desert, altitudinal and high latitude regions seem to be restricted areas for these invasive rodents. From an epidemiological perspective, the occurrence of Hantavirus in Rattus (Andes and Seoul
NCBI nr-aa BLAST: CBRC-MEUG-01-1124 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MEUG-01-1124 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-111 52% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-1354 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-1354 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-137 78% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-1135 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUR-01-1135 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-171 87% ...
NCBI nr-aa BLAST: CBRC-MLUC-01-0792 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MLUC-01-0792 ref|NP_001094111.1| melatonin receptor 1B [Rattus norvegicus] gb|EDL78429.1| melatonin... receptor 1B [Rattus norvegicus] dbj|BAH03530.1| melatonin receptor 1b [Rattus norvegicus] NP_001094111.1 1e-156 75% ...
NCBI nr-aa BLAST: CBRC-STRI-01-2918 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-STRI-01-2918 ref|NP_001094111.1| melatonin receptor 1B [Rattus norvegicus] gb|EDL78429.1| melatonin... receptor 1B [Rattus norvegicus] dbj|BAH03530.1| melatonin receptor 1b [Rattus norvegicus] NP_001094111.1 1e-149 74% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-1365 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PCAP-01-1365 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-144 75% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-0764 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PCAP-01-0764 ref|NP_001094111.1| melatonin receptor 1B [Rattus norvegicus] gb|EDL78429.1| melatonin... receptor 1B [Rattus norvegicus] dbj|BAH03530.1| melatonin receptor 1b [Rattus norvegicus] NP_001094111.1 1e-128 68% ...
NCBI nr-aa BLAST: CBRC-PVAM-01-1069 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PVAM-01-1069 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-177 86% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-0810 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PHAM-01-0810 ref|NP_001094111.1| melatonin receptor 1B [Rattus norvegicus] gb|EDL78429.1| melatonin... receptor 1B [Rattus norvegicus] dbj|BAH03530.1| melatonin receptor 1b [Rattus norvegicus] NP_001094111.1 1e-160 80% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-0280 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PHAM-01-0280 ref|NP_446128.1| melatonin receptor 1A [Rattus norvegicus] gb|EDL78848.1| melatonin... receptor 1A [Rattus norvegicus] dbj|BAH03529.1| melatonin receptor 1a [Rattus norvegicus] NP_446128.1 1e-176 84% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-1001 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGOR-01-1001 ref|NP_001094111.1| melatonin receptor 1B [Rattus norvegicus] gb|EDL78429.1| melatonin... receptor 1B [Rattus norvegicus] dbj|BAH03530.1| melatonin receptor 1b [Rattus norvegicus] NP_001094111.1 1e-129 80% ...
Directory of Open Access Journals (Sweden)
MARCÍLIO HUBNER DE MIRANDA NETO
1999-06-01
Full Text Available We studied the effects of maternal proteic desnutrition on the neurons of the myenteric plexus of the jejunum of rats from Rattus norvegicus species. It was used litters of female rats which received diet with normal proteic level during gestation and lactation (group NN, normal diet during gestation and hypoproteic diet during lactation (group ND; hypoproteic diet during gestation and normal diet during lactation (group DN; hypoproteic diet during both gestation and lactation (group DD. After weaning all the animals received diet of normal proteic level until the 60th day of age, when they were killed. The jejunum of the animals was subjected to whole-mount preparations stained by the method of Giemsa and used for the morphologic and quantitative analyses of the neurons of the myenteric plexus. We verified that maternal proteic malnutrition does not cause decrease on the number of myenteric neurons per unit area of jejunum in rats, but elicits mechanisms which assure that, when the animal again receives normal proteic level diet (22% there occurs storage of proteic material on the cytoplasm of the neurons, thus rendering them larger and strongly basophylic.Estudamos os efeitos da desnutrição protéica materna sobre os neurônios do plexo mientérico do jejuno de ratos da espécie norvegicus. Utilizamos filhotes de ratas que receberam dieta com teor protéico normal durante a gestação e a lactação (grupo NN, dieta normoprotéica durante a gestação e hipoprotéica durante a lactação (grupo ND; dieta hipoprotéica durante a gestação e normoprotéica durante a lactação (grupo DN; dieta hipoprotéica durante a gestação e lactação (grupo DD. Após o desmame todos os animais receberam dieta com teor protéico normal até os 60 dias de vida ocasião em que foram sacrificados. Preparados de membrana do jejuno foram corados pelo método de Giemsa e foram utilizados para análises morfológicas e quantitativas dos neurônios do plexo
Gardner-Santana, L C; Norris, D E; Fornadel, C M; Hinson, E R; Klein, S L; Glass, G E
2009-07-01
Movement of individuals promotes colonization of new areas, gene flow among local populations, and has implications for the spread of infectious agents and the control of pest species. Wild Norway rats (Rattus norvegicus) are common in highly urbanized areas but surprisingly little is known of their population structure. We sampled individuals from 11 locations within Baltimore, Maryland, to characterize the genetic structure and extent of gene flow between areas within the city. Clustering methods and a neighbour-joining tree based on pairwise genetic distances supported an east-west division in the inner city, and a third cluster comprised of historically more recent sites. Most individuals (approximately 95%) were assigned to their area of capture, indicating strong site fidelity. Moreover, the axial dispersal distance of rats (62 m) fell within typical alley length. Several rats were assigned to areas 2-11.5 km away, indicating some, albeit infrequent, long-distance movement within the city. Although individual movement appears to be limited (30-150 m), locations up to 1.7 km are comprised of relatives. Moderate F(ST), differentiation between identified clusters, and high allelic diversity indicate that regular gene flow, either via recruitment or migration, has prevented isolation. Therefore, ecology of commensal rodents in urban areas and life-history characteristics of Norway rats likely counteract many expected effects of isolation or founder events. An understanding of levels of connectivity of rat populations inhabiting urban areas provides information about the spatial scale at which populations of rats may spread disease, invade new areas, or be eradicated from an existing area without reinvasion.
NCBI nr-aa BLAST: CBRC-OLAT-26-0164 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OLAT-26-0164 ref|NP_062037.1| chondroadherin [Rattus norvegicus] sp|O70210|CHAD_RAT Chondroad...herin precursor (Cartilage leucine-rich protein) gb|AAC40060.1| chondroadherin [Rattus norveg...icus] gb|EDM05713.1| chondroadherin [Rattus norvegicus] NP_062037.1 9e-85 57% ...
Helminths of the brown rat (Rattus norvegicus) (Berkenhout, 1769) in the city of Palermo, Italy
Czech Academy of Sciences Publication Activity Database
Milazzo, C.; Ribas, Alexis; Casanova, J. C.; Cagnin, M.; Geraci, F.; Di Bella, C.
2010-01-01
Roč. 47, č. 4 (2010), s. 238-240 ISSN 0440-6605 Institutional research plan: CEZ:AV0Z60930519 Keywords : wild brown rats * helminths * Sicily * Italy Subject RIV: EG - Zoology Impact factor: 0.847, year: 2010
NCBI nr-aa BLAST: CBRC-MDOM-02-0334 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-02-0334 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 94% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-1297 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGOR-01-1297 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-1594 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PHAM-01-1594 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-0982 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-0982 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-1494 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUR-01-1494 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-1316 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-1316 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 81% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-1939 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MEUG-01-1939 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 94% ...
NCBI nr-aa BLAST: CBRC-STRI-01-2565 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-STRI-01-2565 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 2e-82 91% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1554 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-VPAC-01-1554 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 94% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-1368 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PCAP-01-1368 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor emb|CAA39332.1| CB1 cannabinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cann...abinoid receptor [Rattus norvegicus] gb|EDL98589.1| cannabinoid receptor 1 (bra...in) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
Bone morphology of the hind limbs in two caviomorph rodents.
de Araújo, F A P; Sesoko, N F; Rahal, S C; Teixeira, C R; Müller, T R; Machado, M R F
2013-04-01
In order to evaluate the hind limbs of caviomorph rodents a descriptive analysis of the Cuniculus paca (Linnaeus, 1766) and Hydrochoerus hydrochaeris (Linnaeus, 1766) was performed using anatomical specimens, radiography, computed tomography (CT) and full-coloured prototype models to generate bone anatomy data. The appendicular skeleton of the two largest rodents of Neotropical America was compared with the previously reported anatomical features of Rattus norvegicus (Berkenhout, 1769) and domestic Cavia porcellus (Linnaeus, 1758). The structures were analyzed macroscopically and particular findings of each species reported. Features including the presence of articular fibular projection and lunulae were observed in the stifle joint of all rodents. Imaging aided in anatomical description and, specifically in the identification of bone structures in Cuniculus paca and Hydrochoerus hydrochaeris. The imaging findings were correlated with the anatomical structures observed. The data may be used in future studies comparing these animals to other rodents and mammalian species. © 2012 Blackwell Verlag GmbH.
Directory of Open Access Journals (Sweden)
Michael T Bowen
Full Text Available Aggregation is a defensive strategy employed by many prey species in response to predatory threat. Our group has characterized defensive aggregation (huddling in Rattus norvegicus in response to a ball of cat fur. In this situation some rats huddle less, and approach the threatening cue more than others (active vs. passive responders. The present study explored whether active responding is a stable phenotype associated with behaviors outside direct predatory encounters. The neural substrates of active and passive responding under predatory threat were explored using c-Fos immunohistochemistry. Finally, we examined whether the presence of conspecifics during predatory threat biases behavior towards active responding. Active and passive responding styles were found to be stable in individual rats across consecutive group exposures to cat fur, and were predicted by anxiety-like behavior in an open-field emergence test. Active responders displayed less conditioned fear in an environment associated with predatory threat, and had higher post-exposure intake of a weak sucrose solution (a test of "anhedonia". Active responding was associated with: greater cat fur-induced activation of the accessory olfactory bulb, reflecting greater olfactory stimulation in rats actively approaching the fur; lowered activation of somatosensory cortex, reflecting reduced huddling with conspecifics; and reduced activation in the lateral septum. Social exposure to cat fur promoted active responding relative to individual exposure, and lowered c-Fos expression in the dorsomedial periaqueductal grey, medial caudate putamen and lateral habenula. We conclude that individual differences in anti-predator behavior appear stable traits with active responders having a more resilient phenotype. Social exposure to predatory threat has an acute buffering effect, subtly changing the neural and behavioral response towards threat and encouraging active responding. An association between
Bowen, Michael T.; Kevin, Richard C.; May, Matthew; Staples, Lauren G.; Hunt, Glenn E.; McGregor, Iain S.
2013-01-01
Aggregation is a defensive strategy employed by many prey species in response to predatory threat. Our group has characterized defensive aggregation (huddling) in Rattus norvegicus in response to a ball of cat fur. In this situation some rats huddle less, and approach the threatening cue more than others (active vs. passive responders). The present study explored whether active responding is a stable phenotype associated with behaviors outside direct predatory encounters. The neural substrates of active and passive responding under predatory threat were explored using c-Fos immunohistochemistry. Finally, we examined whether the presence of conspecifics during predatory threat biases behavior towards active responding. Active and passive responding styles were found to be stable in individual rats across consecutive group exposures to cat fur, and were predicted by anxiety-like behavior in an open-field emergence test. Active responders displayed less conditioned fear in an environment associated with predatory threat, and had higher post-exposure intake of a weak sucrose solution (a test of “anhedonia”). Active responding was associated with: greater cat fur-induced activation of the accessory olfactory bulb, reflecting greater olfactory stimulation in rats actively approaching the fur; lowered activation of somatosensory cortex, reflecting reduced huddling with conspecifics; and reduced activation in the lateral septum. Social exposure to cat fur promoted active responding relative to individual exposure, and lowered c-Fos expression in the dorsomedial periaqueductal grey, medial caudate putamen and lateral habenula. We conclude that individual differences in anti-predator behavior appear stable traits with active responders having a more resilient phenotype. Social exposure to predatory threat has an acute buffering effect, subtly changing the neural and behavioral response towards threat and encouraging active responding. An association between active
Bowen, Michael T; Kevin, Richard C; May, Matthew; Staples, Lauren G; Hunt, Glenn E; McGregor, Iain S
2013-01-01
Aggregation is a defensive strategy employed by many prey species in response to predatory threat. Our group has characterized defensive aggregation (huddling) in Rattus norvegicus in response to a ball of cat fur. In this situation some rats huddle less, and approach the threatening cue more than others (active vs. passive responders). The present study explored whether active responding is a stable phenotype associated with behaviors outside direct predatory encounters. The neural substrates of active and passive responding under predatory threat were explored using c-Fos immunohistochemistry. Finally, we examined whether the presence of conspecifics during predatory threat biases behavior towards active responding. Active and passive responding styles were found to be stable in individual rats across consecutive group exposures to cat fur, and were predicted by anxiety-like behavior in an open-field emergence test. Active responders displayed less conditioned fear in an environment associated with predatory threat, and had higher post-exposure intake of a weak sucrose solution (a test of "anhedonia"). Active responding was associated with: greater cat fur-induced activation of the accessory olfactory bulb, reflecting greater olfactory stimulation in rats actively approaching the fur; lowered activation of somatosensory cortex, reflecting reduced huddling with conspecifics; and reduced activation in the lateral septum. Social exposure to cat fur promoted active responding relative to individual exposure, and lowered c-Fos expression in the dorsomedial periaqueductal grey, medial caudate putamen and lateral habenula. We conclude that individual differences in anti-predator behavior appear stable traits with active responders having a more resilient phenotype. Social exposure to predatory threat has an acute buffering effect, subtly changing the neural and behavioral response towards threat and encouraging active responding. An association between active responding
Directory of Open Access Journals (Sweden)
Didit Aspriyanto
2017-09-01
Full Text Available Background: Traditional wound treatment using herbal medicine is thought to maintain the health of families and society in general economically, effectively, and efficiently without inducing side effects. One genus of plant that can be used as a traditional medicine is the Mauli banana, indigenous to South Borneo. Mauli banana stem contains bioactive compounds, most of which are tannins along with ascorbic acid, saponin, β-carotene, flavonoids, lycopene, alkaloids, and flavonoids. Tanin has antibacterial and antioxidant effects at low concentrations, as wells as antifungal ones at high concentrations. Purpose: This study aimed to analyze the effects of Mauli banana stem extract at concentrations of 25%, 37.5%, and 50% on the quality of incised wound healing in male Rattus norvegicus rats by assessing FGF-2 expression and fibroblast concentration on days 3 and 7. Methods: This research represented an experimental laboratory-based investigation involving 32 rats of the Rattus norvegicus strain aged 2-2.5 months old. Sampling was performed using a simple random sampling technique since the research population was considered homogeneous and divided into 8 treatment groups (C3, M3-25, M3-37.5, M3-50, C7, M7-25, M7-37.5, M7-50. The rats in each group were anesthetized before their back was incised with length and width of 15x15mm with a depth of 2mm. Gel hydroxy propyl cellulose medium (HPMC was applied to the incised wound of each rat in the control group, while stem Mauli banana extract was applied to that of each rat in the treatment groups three times a day at an interval of 6-8 hours. On day 3, four rats from each group were sacrificed, while, in the remaining groups, the same procedure was performed until day 7, at which point they (8 groups were sacrificed for HE examination in order to assess the amount of fibroblast and for IHC examination to examine FGF-2 expression. Data regarding FGF-2 expression and the amount of fibroblast were analysed
NCBI nr-aa BLAST: CBRC-PCAP-01-0533 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PCAP-01-0533 ref|NP_570096.2| protein kinase C and casein kinase substrate in neurons...ein kinase C and casein kinase substrate in neurons 2 [Rattus norvegicus] gb|EDM15628.1| protein kinase C an...d casein kinase substrate in neurons 2, isoform CRA_a [Rattus norvegicus] gb|EDM1...5629.1| protein kinase C and casein kinase substrate in neurons 2, isoform CRA_a [Rattus norvegicus] gb|EDM1...5631.1| protein kinase C and casein kinase substrate in neurons 2, isoform CRA_a [Rattus norvegicus] NP_570096.2 1e-176 87% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-0237 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUR-01-0237 ref|NP_570096.2| protein kinase C and casein kinase substrate in neurons...ein kinase C and casein kinase substrate in neurons 2 [Rattus norvegicus] gb|EDM15628.1| protein kinase C an...d casein kinase substrate in neurons 2, isoform CRA_a [Rattus norvegicus] gb|EDM1...5629.1| protein kinase C and casein kinase substrate in neurons 2, isoform CRA_a [Rattus norvegicus] gb|EDM1...5631.1| protein kinase C and casein kinase substrate in neurons 2, isoform CRA_a [Rattus norvegicus] NP_570096.2 0.0 85% ...
NCBI nr-aa BLAST: CBRC-EEUR-01-0952 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-EEUR-01-0952 ref|NP_446083.1| barrier to autointegration factor 1 [Rattus norv...egicus] sp|Q9R1T1|BAF_RAT Barrier-to-autointegration factor (LAP2-binding protein 1) dbj|BAA83101.1| L2BP1 [...Rattus norvegicus] gb|AAH84726.1| Barrier to autointegration factor 1 [Rattus norvegicus] NP_446083.1 4e-06 47% ...
Directory of Open Access Journals (Sweden)
Julio Campos Florián
2013-01-01
Full Text Available La presente investigación tuvo como objetivo demostrar la actividad hipolipidémica del extracto acuoso de las hojas del árbol del pan, Artocarpus altilis, en un modelo de hiperlipidemia aguda inducida con tritón X-305, utilizando como especímenes Rattus norvegicus machos, peso promedio 204,5 g, a los que se les administró por vía oral 0,05 g/100 g y 0,2 g/100 g del extracto acuoso de A. altilis; se incluyó un grupo control negativo que recibió solución salina fisiológica y un grupo control positivo hiperlipidémico. Luego de 24 horas de administrar los tratamientos, se realizaron las mediciones en suero de las concentraciones de colesterol y triglicéridos. Encontramos reducciones significativas (p < 0,01 tanto de las cifras de colesterol, como de triglicéridos en relación a las concentraciones obtenidas en el grupo control positivo. También encontramos diferencia significativa (p < 0,01 entre las concentraciones de triglicéridos de los animales tratados con las dos dosis del extracto acuoso de A. altilis. Concluimos que el extracto acuoso de las hojas de A. altilis presenta efecto hipolipidémico a las dosis ensayadas para el modelo de hiperlipidemia inducida con tritón X-305.
NCBI nr-aa BLAST: CBRC-TNIG-14-0023 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-14-0023 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 74% ...
NCBI nr-aa BLAST: CBRC-OANA-01-2200 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OANA-01-2200 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 93% ...
NCBI nr-aa BLAST: CBRC-RNOR-05-0081 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-05-0081 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 100% ...
NCBI nr-aa BLAST: CBRC-TGUT-05-0032 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TGUT-05-0032 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 92% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-3023 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-3023 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-HSAP-06-0074 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-06-0074 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-CFAM-12-0016 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CFAM-12-0016 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 98% ...
NCBI nr-aa BLAST: CBRC-TBEL-01-1883 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TBEL-01-1883 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 98% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0845 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 86% ...
NCBI nr-aa BLAST: CBRC-GGAL-03-0034 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-03-0034 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 93% ...
NCBI nr-aa BLAST: CBRC-RMAC-04-0050 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RMAC-04-0050 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-1332 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1332 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-EEUR-01-1648 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-EEUR-01-1648 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-ETEL-01-1516 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-1516 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-MMUS-04-0013 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-04-0013 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 99% ...
NCBI nr-aa BLAST: CBRC-PTRO-07-0067 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PTRO-07-0067 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-PABE-07-0058 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PABE-07-0058 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
NCBI nr-aa BLAST: CBRC-FCAT-01-1020 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FCAT-01-1020 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 98% ...
NCBI nr-aa BLAST: CBRC-LAFR-01-1734 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-LAFR-01-1734 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 91% ...
NCBI nr-aa BLAST: CBRC-FRUB-02-0074 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0074 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 1e-159 61% ...
NCBI nr-aa BLAST: CBRC-OCUN-01-1522 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OCUN-01-1522 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 1e-28 94% ...
Gene : CBRC-RNOR-04-0153 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0153 4 A Pheromone receptors V1A16_RAT 1e-51 40% ref|NP_001009531.1| vomeronasa...l V1r-type receptor V1rc40 [Rattus norvegicus] gb|AAR87997.1| vomeronasal V1r-type receptor V1rc40 ...[Rattus norvegicus] 1e-169 100% gnl|UG|Rn#S22668978 Rattus norvegicus vomeronasal V1r-type receptor V1rc40 m...LSVFQAITISPSTSLMARFKHKLKRYVINALFYIWVFNLSASSDAILSVGGFTNVSEIKQVKITKTCSLFPMNYIIRGLTFILSSSRDVFFVGVMLNASAYMVIILHR
Directory of Open Access Journals (Sweden)
Marcílio Hubner de Miranda Neto
2004-04-01
Full Text Available O objetivo do trabalho foi comparar o perfil dos corpos celulares dos neurônios mioentéricos NADH-diaforase positivos do estômago de ratos. Utilizou-se 10 animais (Rattus norvegicus, provenientes dos grupos: a controle (n=5, que durante 210 dias receberam, ad libitum, dieta com teor protéico normal (22% e água; e b experimental (n = 5, que durante 210 dias receberam, ad libitum, ração com teor protéico normal (22% e aguardente-de-cana diluída a 30 Gay Lussac (30º v/v. Os estômagos coletados foram submetidos à técnica de evidenciação neuronal. A mensuração do perfil dos corpos celulares dos neurônios (n = 1.000 foi através de um Sistema Computadorizado de Análise de Imagem. O perfil dos corpos celulares dos neurônios do grupo controle ficou entre 60,16 a 638,64 µm2. No grupo experimental variou de 40,84 a 599,15 µm2. Constatamos redução significante no tamanho do corpo celular, aumento de neurônios pequenos e diminuição de neurônios grandesThe purpose of this work was to compare the profile of the cell body of the NADH-diaphorase positive myenteric neurons from the stomach of rats. It was used 10 animals (Rattus norvegicus, from groups a control (n = 5, that during 210 days had ad libitum supply of chow with normal protein level (22% and water; and b experimental (n = 5, that during 210 days had ad libitum supply of chow with normal protein level (22% and sugar cane brandy diluted to 30 Gay Lussac (30o v/v. The stomachs collected and subjected to the technique for neuronal staining. The cell body of the neurons (n = 1.000 was measured through a computerized system of image analysis. The profile of the neurons from the control rats ranged from 60.16 and 638.64 µm2. In the experimental group the values ranged from 40.84 to 599.15 µm2. We observed a significant decrease on the cell body size, increase of the small neurons and decrease of the large neurons
PENGARUH PEMBERIAN MONOSODIUM GLUTAMAT (MSG PADA TIKUS JANTAN (Rattus Norvegicus TERHADAP FSH DAN LH
Directory of Open Access Journals (Sweden)
Zulkarnain Edward
2010-09-01
Full Text Available AbstrakKemajuan teknologi informasi membawa dampak terhadap perubahan gaya hidup masyarakat, termasuk perubahan pola konsumsi makanan yang lebih banyak mengkonsumsi jenis makanan cepat saji, makanan kemasan dan makanan awetan yang belakangan ini semakin banyak dijual dipasar tradisional dan swalayan. Penggunaan bahan tambahan makanan sering dijumpai, salah satunya adalah bahan penyedap yang banyak sekali digunakan seperti senyawa L-asam glutamat yang digunakan dalam bentuk garam yaitu monosodium glutamat (MSG. Berbagai merk dagang MSG telah dikenal dimasyarakat secara luas seperti ajinomoto, vetsin, micin, sasa, miwon dan sebagainya.MSG adalah garam monosodium dengan asam glutamat yang sering digunakan sebagai bahan penyedap masakan untuk merangsang selera makan. Pemberian MSG mengakibatkan gangguan hormonal pada hewan coba, ion glutamat dalam sirkulasi portal akan mempengaruhi hipotalamus dalam memproduksi GnRH yang selanjutnya akan mengganggu hipofise anterior dalam memproduksi FSH dan LH. Fungsi FSH adalah untuk bekerja pada tubulus seminiferus terutama pada sel sertoli untuk meningkatkan spermatogenesis, sedangkan LH berfungsi pada sel Leydig untuk mengatur sekresi testosteron.Penelitian ini bersifat eksperimen dengan rancangan post only group design. Penelitian dilakukan di laboratorium Biologi dan laboratorium Biokimia Fakultas Kedokteran Unand Padang dari tanggal 20 Desember 2009 sampai 30 Februari 2010. Populasi adalah tikus putih jantan strain Jepang (Rattus norvegicus yang berasal dari laboratorium Fakultas Matematika dan Ilmu Pengetahuan Alam Unand. Sampel berjumlah 20 ekor dibagi atas 4 kelompok dengan satu kelompok kontrol dan tiga kelompok perlakuan. Dosis MSG yang digunakan yaitu P1= 4800 mg/kgbb/hari, P2=7200 mg/kgbb/hari dan P3= 9600 mg/kgbb/hari diberikan peroral sebanyak dua siklus epitel seminiferus. Analisa dengan uji Anova dengan derajat kepercayaan 95% dan jika bermakna dilanjutkan dengan uji Multiple Comparissons jenis
NCBI nr-aa BLAST: CBRC-CINT-01-0214 [SEVENS
Lifescience Database Archive (English)
Full Text Available monocarboxylic acid transporters), member 12 [Rattus norvegicus] ref|XP_001079987.1| PREDICTED: similar to s...olute carrier family 16 (monocarboxylic acid transporters), member 12 [Rattus norvegicus] XP_220057.4 3e-18 28% ...
Directory of Open Access Journals (Sweden)
El-Aoufi S
2012-09-01
Full Text Available Salima El-Aoufi,1 Mohamed-Amine Lazourgui,1 Lakhdar Griene,2 Boubekeur Maouche31Laboratoire de Biologie et de Physiologie des Organismes/MMDED, Faculté des Sciences Biologiques, USTHB, El-Alia, Dar El Beida, Algeria; 2Laboratoire d'Hormonologie, Centre Pierre et Marie Curie, C.H.U Mustapha, Algeria; 3Laboratoire de Physicochimie Théorique et Chimie Informatique, Faculté de Chimie, USTHB, El-Alia, Dar El Beida, AlgeriaAbstract: Cardiovascular disease, including atherosclerosis, is the leading cause of death in patients with diabetes worldwide; thus, it is a major medical concern. The endothelium contributes to the control of many vascular functions, and clinical observations show that it is a primary target for diabetic syndrome. To get better insight into the mechanisms underlying atherosclerosis, we studied the interspecific differences in the arterial metabolisms of two, Psammomys obesus and Gerbillus gerbillus, as well as Rattus norvegicus (Wistar rat, well known for its atheroresistance. Twenty-two enzymatic activities and six macromolecular substances were histochemically compared in the two desert species and in Wistar aortas (abdominal and thoracic and arteries (femoral and caudal embedded in a common block. In the healthy adult rodents, enzyme activities were very intense. They demonstrated that aortic myocytes are capable of various synthesis and catabolism processes. However, considering the frequency of atherosclerosis and its phenotypes, significant differences appeared between the species studied. Our comparative study shows that aortic atherosensitive animals have several common metabolic characteristics, which are found in Psammomys rich in metachromatic glycosaminoglycans (involved in the inhibition of lipolysis and in calcification of the organic matrix, reduced activity in enzymes related to the Krebs cycle (weakening energetic power, and low lipolytic enzyme, adenosine triphosphatase, and adenosine diphosphatase activities
NCBI nr-aa BLAST: CBRC-AGAM-02-0156 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-AGAM-02-0156 ref|XP_234385.3| PREDICTED: similar to pecanex homolog [Rattus no...rvegicus] ref|XP_001055794.1| PREDICTED: similar to pecanex homolog [Rattus norvegicus] XP_234385.3 1e-94 39% ...
NCBI nr-aa BLAST: CBRC-RNOR-05-0235 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-05-0235 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 0.0 99% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-0894 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PCAP-01-0894 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-163 81% ...
NCBI nr-aa BLAST: CBRC-STRI-01-2314 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-STRI-01-2314 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-158 87% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...
NCBI nr-aa BLAST: CBRC-ETEL-01-0499 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-0499 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-162 80% ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1379 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-1379 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-168 83% ...
NCBI nr-aa BLAST: CBRC-MEUG-01-1506 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MEUG-01-1506 ref|XP_236329.4| PREDICTED: similar to Ladybird homeobox corepres...sor 1 [Rattus norvegicus] ref|XP_001075793.1| PREDICTED: similar to Ladybird homeobox corepressor 1 [Rattus norvegicus] XP_236329.4 1e-123 66% ...
NCBI nr-aa BLAST: CBRC-TGUT-03-0000 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TGUT-03-0000 ref|NP_446167.2| solute carrier family 5 (inositol transporters),... member 3 [Rattus norvegicus] gb|EDM10751.1| solute carrier family 5 (inositol transporters), member 3 [Rattus norvegicus] NP_446167.2 0.0 81% ...
NCBI nr-aa BLAST: CBRC-MDOM-09-0050 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-09-0050 ref|NP_001017377.1| progestin and adipoQ receptor family member I...V [Rattus norvegicus] gb|AAH92635.1| Progestin and adipoQ receptor family member IV [Rattus norvegicus] gb|EDM03772.1| progesti
NCBI nr-aa BLAST: CBRC-DSIM-01-0068 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-01-0068 ref|NP_001017377.1| progestin and adipoQ receptor family member I...V [Rattus norvegicus] gb|AAH92635.1| Progestin and adipoQ receptor family member IV [Rattus norvegicus] gb|EDM03772.1| progesti
Directory of Open Access Journals (Sweden)
Leila SMAIL
2017-07-01
Full Text Available Introduction. L’insulino‐résistance, marquée par une réaction inflammatoire via la production de TNF‐α et par l’hyperinsulinémie compensatoire, conduit à long terme à l’installation d’une glucolipotoxicité et du diabète de type 2. Objectif. Dans cette étude, les effets d’un extrait aqueux de Globularia alypum (Ga a été analysé in vitro, suite à un stress induit sur le cardiomyocyte de Rattus norvegicus. Matériel et Méthodes. Le stress a été induit par addition d’une dose élevée d’insuline (10 UI/ mL. Les taux de prolifération ont été déterminés par comptage et les contenus cellulaires en monoxyde d’azote (NO, en malondialdéhyde (MDA et en catalase ont été évalués. Résultats. En présence de la dose élevée d’insuline, les cardiomyocytes ont montré une diminution de la survie cellulaire, un déséquilibre du statut redox en faveur d’une augmentation de NO et de MDA et d’une diminution d’une enzyme du système antioxydant, la catalase. Suite à l’action de l’extrait de Ga, il a été noté une amélioration du taux de prolifération cellulaire, une diminution du taux de No et de MDA ainsi qu’une augmentation de l’activité de la catalase. Conclusion. L’état de stress induit sur le cardiomyocyte par l’insulino‐résistance, mimé par la dose élevée d’insuline, entraîne des altérations physiologiques et biochimiques. Ces dernières, précurseurs de mort cellulaire par apoptose sont atténuées après addition d’un extrait de Globularia alypum, lequel pourrait constituer une cible thérapeutique en aval de l’installation du DT2.
Directory of Open Access Journals (Sweden)
A. RAFIQUE, S. A. RANA, H. A. KHAN AND A. SOHAIL1
2009-07-01
Full Text Available The aim of the present study was to investigate prevalence of zoonotic helminths from human, Rattus rattus (R. rattus, Rattus norvegicus (R. norvegicus and Mus musculus of eight different structures, namely grain shops in grain market, departmental stores, railway godowns, food processing plants (bakeries, poultry farms, houses in kachi-abadies, houses in departmental colonies and posh residences and banglows in Faisalabad city. All the structures were sampled for 2 months each and completed in 16 months. Highest prevalence (70% of Vsmpirolepis spp. was observed in R. rattus sampled from poultry farms, which was significantly higher (P<0.05 than the prevalence of all the helminths recovered from other structures. Hymenolepis nana (H. nana was observed in 60% of the sampled Mus musculus collected from kachi-abadies, which was significantly higher (P<0.05 than all other structures studies for H. nana, except R. rattus from kachi-abadies (55% and R. norvegicus from grain shops in grain market (55%. The rodent’s endo-parasites viz., Hymenolepis nana, Teania taenaeformis, Entrobius spps and Trichuiris spps observed in R. rattus, R. norvegicus and M. musculus at different percentages were also recorded in human stool samples with an incidence of 48, 21, 76 and 10%, respectively.
Rat-bites of an epidemic proportion in Peshawar vale; a GIS based approach in risk assessment.
Fatima, Syeda Hira; Zaidi, Farrah; Adnan, Muhammad; Ali, Asad; Jamal, Qaiser; Khisroon, Muhammad
2018-03-19
Contemporary studies demonstrate that rodent bites do not occur frequently. However, a huge number of cases were reported from Peshawar vale, Pakistan during 2016. Two species, the local black rat Rattus rattus (Linnaeus, 1758) and the invasive brown rat Rattus norvegicus (Berkenhout, 1769) might be the suspected cause. Several studies indicated the invasion of brown rats into Pakistan presumably via port city of Karachi. In this study, we modeled geospatial distribution of rodent bites for risk assessment in the region. Bite cases reported to tertiary care lady reading hospital were monitored from January 1 to August 31, 2016. Among 1747 cases, statistically informative data (n = 1295) was used for analyses. MaxEnt algorithm was employed for geospatial modeling, taking into account various environmental variables (temperature, precipitation, humidity, and elevation) and anthropogenic factors (human population density, distance from roads, distance from water channels, and land use/land cover). MaxEnt results revealed that urban slums (84.5%) are at highest risk followed by croplands (10.9%) and shrublands (2.7%). Anthropogenic factors affecting incidence of rodent bites included host density (contribution: 34.7), distance from water channels (3.2), land use/land cover (2.8), and distance from roads (2). Most of the cases occurred within a radius of 0.3 km from roads and 5 km from water channels. Rodent bite incidence is currently at its peak in Peshawar vale. Factors significantly affecting rodents' bite activity and their distribution and dispersal include urbanization, distance from roads, and water channels. Further studies are needed to determine the impact of invasion by brown rat on bite incidence.
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...
Isolation and characterization of microsatellites in Rattus rattus
Czech Academy of Sciences Publication Activity Database
Loiseau, A.; Rahelinirina, S.; Rahalison, L.; Konečný, Adam; Duplantier, J.-M.; Brouat, C.
2008-01-01
Roč. 8, č. 4 (2008), s. 916-918 ISSN 1755-098X R&D Projects: GA AV ČR IAA6093404 Institutional research plan: CEZ:AV0Z60930519 Keywords : genetic diversity * microsatellite * Rattus rattus * Rodentia Subject RIV: EB - Genetics ; Molecular Biology
Toxicity of selected organic chemicals to the earthworm Eisenia fetida
Energy Technology Data Exchange (ETDEWEB)
Neuhauser, E.F.; Loehr, R.C.; Malecki, M.R.; Milligan, D.L.; Durkin, P.R.
A number of methods recently have been developed to biologically evaluate the impact of man's activities on soil ecosystems. Two test methods, the 2-d contact test and the 14-d artificial soil test, were used to evaluate the impact of six major classes of organic chemicals on the earthworm Eisenia fetida (Savigny). Of the organic chemicals tested, phenols and amines were the most toxic to the worms, followed in descending order of toxicity by the substituted aromatics, halogenated aliphatics, polycyclic aromatic hydrocarbons, and phthalates. No relationship was found between earthworm toxicity as determined by the contact test and rat, Rattus norvegicus Berkenhout and mouse, Mus musculus L. LD/sub 50/ values. The physicochemical parameters of water solubility, vapor pressure, and octanol/water partition coefficient for the chemicals tested in the contact test did not show a significant relationship to the E. fetida LC/sub 50/ values. These studies indicate that: (i) earthworms can be a suitable biomonitoring tool to assist in measuring the impact of organic chemicals in wastes added to soils and (ii) contact and artificial soil tests can be useful in measuring biological impacts.
Directory of Open Access Journals (Sweden)
Ersamukti Rahmatullah Achmad
2015-10-01
Full Text Available Marsh fleabane roots (Pluchea indica L. and guava leaves (Psidium guajava L. are traditionally used as an anti-inflammatory. The research has been conducted with the aim of knowing the anti-inflammatory effect of the combination of decoction of Marsh fleabane roots (Pluchea indica L. and infusion of guava leaves (Psidium guajava L., and also determining the effective concentration of such combination. The research used artificial edema method in white rat's leg ( Rattus norvegicus with the observation for 6 hours on the change of leg volume in white rat. The measurement of white rat's leg volume used a pletismometer. The type of treatment was devided into 5 groups: negative control (Aquadest, positive control (Na Diclofenac, combination 1 (MFR 10% : IGL 8%, combination 2 (MFR 5% : IGL 5%, and combination 3 (MFR 8% : IGL 10%. The data obtained were processed using One-Way ANOVA method with the result seen on the percent inhibition of inflammation resulting concentration of MFR 5%: IGL 5% amounting to 23.47%, and subsequently combined with a concentration of MFR 10% : IGL 8% and concentrations MFR 8% : IGL 10% respectively by the percent inhibition of inflammation by 20.70% and 13.75%. The data obtained show the combination with a concentration of 5% : 5% have anti- inflammatory effect are better than the other combinations as well as comparable to the positive control
lestari purba, Sri; Rini Saraswati, Tyas; Isdadiyanto, Sri
2018-05-01
Background: Quail eggs contain a considerable amount of complete nutritional sources such as carbohydrates, proteins, fats, and micronutrients. However, they also have a high cholesterol level, which can potentially cause atherosclerosis and chronic heart diseases. The response of the body to foods containing is influenced by factors such as ethnicity, genetics, and hormonal and nutrient status of the consumer. The cholesterol level of quail eggs can be reduced by manipulating the feed using supplemental organic feed. Organic quail eggs have been believed to correct the lipid profile of white mice during the lactation phase. Purpose: The aim of this study was to analyze the effect of feed containing organic quail eggs on the blood lipid profile of white mice (Rattus norvegicus L.) during the lactation phase. Materials and Methods: This experimental study was conducted using a completely randomized design with four experiments and five repetitions. Experimental mice: T0 mice were used as control; T1 mice were supplemented with quail eggs produced by quails that were fed with standard feed; T2 mice were supplemented with eggs produced by quails fed with standard organic feed; and T3 mice were supplemented with eggs produced by quails fed with organic feed with the addition of cassava leaf flour, mackerel flour, and turmeric powder. Quail egg supplementation was administered to the mice from the early pregnancy period till the end of the lactation phase. The acquired data were analyzed using ANOVA. SPSS version 16.0 software for Windows was used for data analyses. Results and summary: Feeding the white mice with different compositions of organic quail egg supplements had no effect on the consumption of feed and water, body weight, and lipid profile (including total cholesterol, LDL, HDL, and triglyceride) during the lactation phase (P > 0.05).
African Journals Online (AJOL)
2015-02-18
Feb 18, 2015 ... ... use in sickle cell disease management regimen can cause hepatocellular damage in wistar rats. ... synergistic clinical benefit in sickle cell disease. (SCD) than ... was made to expose the thoraco-abdominal region. Part of ...
Guenther, Sebastian; Bethe, Astrid; Fruth, Angelika; Semmler, Torsten; Ulrich, Rainer G; Wieler, Lothar H; Ewers, Christa
2012-01-01
Urban rats present a global public health concern as they are considered a reservoir and vector of zoonotic pathogens, including Escherichia coli. In view of the increasing emergence of antimicrobial resistant E. coli strains and the on-going discussion about environmental reservoirs, we intended to analyse whether urban rats might be a potential source of putatively zoonotic E. coli combining resistance and virulence. For that, we took fecal samples from 87 brown rats (Rattus norvegicus) and tested at least three E. coli colonies from each animal. Thirty two of these E. coli strains were pre-selected from a total of 211 non-duplicate isolates based on their phenotypic resistance to at least three antimicrobial classes, thus fulfilling the definition of multiresistance. As determined by multilocus sequence typing (MLST), these 32 strains belonged to 24 different sequence types (STs), indicating a high phylogenetic diversity. We identified STs, which frequently occur among extraintestinal pathogenic E. coli (ExPEC), such as STs 95, 131, 70, 428, and 127. Also, the detection of a number of typical virulence genes confirmed that the rats tested carried ExPEC-like strains. In particular, the finding of an Extended-spectrum beta-lactamase (ESBL)-producing strain which belongs to a highly virulent, so far mainly human- and avian-restricted ExPEC lineage (ST95), which expresses a serogroup linked with invasive strains (O18:NM:K1), and finally, which produces an ESBL-type frequently identified among human strains (CTX-M-9), pointed towards the important role, urban rats might play in the transmission of multiresistant and virulent E. coli strains. Indeed, using a chicken infection model, this strain showed a high in vivo pathogenicity. Imagining the high numbers of urban rats living worldwide, the way to the transmission of putatively zoonotic, multiresistant, and virulent strains might not be far ahead. The unforeseeable consequences of such an emerging public health
Directory of Open Access Journals (Sweden)
Sebastian Guenther
Full Text Available Urban rats present a global public health concern as they are considered a reservoir and vector of zoonotic pathogens, including Escherichia coli. In view of the increasing emergence of antimicrobial resistant E. coli strains and the on-going discussion about environmental reservoirs, we intended to analyse whether urban rats might be a potential source of putatively zoonotic E. coli combining resistance and virulence. For that, we took fecal samples from 87 brown rats (Rattus norvegicus and tested at least three E. coli colonies from each animal. Thirty two of these E. coli strains were pre-selected from a total of 211 non-duplicate isolates based on their phenotypic resistance to at least three antimicrobial classes, thus fulfilling the definition of multiresistance. As determined by multilocus sequence typing (MLST, these 32 strains belonged to 24 different sequence types (STs, indicating a high phylogenetic diversity. We identified STs, which frequently occur among extraintestinal pathogenic E. coli (ExPEC, such as STs 95, 131, 70, 428, and 127. Also, the detection of a number of typical virulence genes confirmed that the rats tested carried ExPEC-like strains. In particular, the finding of an Extended-spectrum beta-lactamase (ESBL-producing strain which belongs to a highly virulent, so far mainly human- and avian-restricted ExPEC lineage (ST95, which expresses a serogroup linked with invasive strains (O18:NM:K1, and finally, which produces an ESBL-type frequently identified among human strains (CTX-M-9, pointed towards the important role, urban rats might play in the transmission of multiresistant and virulent E. coli strains. Indeed, using a chicken infection model, this strain showed a high in vivo pathogenicity. Imagining the high numbers of urban rats living worldwide, the way to the transmission of putatively zoonotic, multiresistant, and virulent strains might not be far ahead. The unforeseeable consequences of such an emerging public
Directory of Open Access Journals (Sweden)
I Made Sumarya
2016-06-01
Full Text Available Background: Betel leaf extracts (Piper betle L. antioxidant activity and enzyme inhibitors of XO. Hyperuricemia cause oxidative stress by increasing the formation of reactive oxygen species (ROS cause lipid peroxidation and oxygenation of low-density lipoprotein cholesterol (LDLc. Objective: The aim of this research was to determine the betel leaf extract as an anti hyperuricemia that can lower the blood uric acid levels and oxidative stress by lowering the levels of MDA and increase the SOD of hyperuricemia of the rat’s blood. Method: Experimental research was conducted with the design of The Randomized Post Test Only Control Group Design, on normal Wistar rats (Rattus norvegicus, administered with oxonic potassium (hyperuricemia and the hyperuricemia rats either given betel leaf extract and allopurinol. After the experiment of uric acid levels, MDA and SOD in rat blood determined. Results: The results showed that the betel leaf extract significantly (p <0.05 lower uric acid levels, MDA and increase levels of SOD in rat blood. There is a positive correlation between the levels of uric acid with MDA levels and a negative correlation, although not significantly with SOD (p >0.05. Conclusion: It can be concluded that the betel leaf extract as an anti-hyperuricemia can lower the uric acid levels and decreases oxidative stress by lowering the levels of MDA and increasing the SOD.
Trezza, Alfonso; Cicaloni, Vittoria; Porciatti, Piera; Langella, Andrea; Fusi, Fabio; Saponara, Simona; Spiga, Ottavia
2018-01-01
ATP-sensitive inward rectifier potassium channels (Kir), are a potassium channel family involved in many physiological processes. K ATP dysfunctions are observed in several diseases such as hypoglycaemia, hyperinsulinemia, Prinzmetal angina-like symptoms, cardiovascular diseases. A broader view of the K ATP mechanism is needed in order to operate on their regulation, and in this work we clarify the structure of the Rattus norvegicus ATP-sensitive inward rectifier potassium channel 8 (Kir6.1), which has been obtained through a homology modelling procedure. Due to the medical use of flavonoids, a considerable increase in studies on their influence on human health has recently been observed, therefore our aim is to study, through computational methods, the three-dimensional (3D) conformation together with mechanism of action of Kir6.1 with three flavonoids. Computational analysis by performing molecular dynamics (MD) and docking simulation on rat 3D modelled structure have been completed, in its closed and open conformation state and in complex with Quercetin, 5-Hydroxyflavone and Rutin flavonoids. Our study showed that only Quercetin and 5-Hydroxyflavone were responsible for a significant down-regulation of the Kir6.1 activity, stabilising it in a closed conformation. This hypothesis was supported by in vitro experiments demonstrating that Quercetin and 5-Hydroxyflavone were capable to inhibit K ATP currents of rat tail main artery myocytes recorded by the patch-clamp technique. Combined methodological approaches, such as molecular modelling, docking and MD simulations of Kir6.1 channel, used to elucidate flavonoids intrinsic mechanism of action, are introduced, revealing a new potential druggable protein site.
Reproductive Toxicity of Triptolide in Male House Rat, Rattus rattus
Directory of Open Access Journals (Sweden)
Neena Singla
2014-01-01
Full Text Available The aim of study was to investigate the toxic effect of triptolide fed in bait on reproduction of male house rat, Rattus rattus. Feeding of cereal based bait containing 0.2% triptolide to male R. rattus for 5 days in no-choice feeding test, leading to mean daily ingestion of 20.45 mg/kg bw of triptolide, was found effective in significantly (P≤0.05 reducing sperm motility and viability in cauda epididymal fluid by 80.65 and 75.14%, respectively, from that of untreated rats. Pregnancy rates were decreased by 100% in untreated cyclic female rats paired with male rats treated with 0.2% triptolide. Present studies suggest the potential of 0.2% triptolide bait in regulating reproductive output of R. rattus.
NCBI nr-aa BLAST: CBRC-STRI-01-2632 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-STRI-01-2632 ref|NP_001100988.1| non imprinted in Prader-Willi/Angelman syndro...me 2 homolog [Rattus norvegicus] gb|EDL86457.1| non imprinted in Prader-Willi/Angelman syndrome 2 homolog (h...uman) (predicted), isoform CRA_a [Rattus norvegicus] gb|EDL86458.1| non imprinted in Prader-Willi/Angelman s
Rika, Margareth; Fatchiyah
2017-11-01
Type-2 diabetes mellitus (T2DM) is a degenerative disease that causes an imbalance in the metabolism. The aim of this research is to determine the influences of CSN1S2 on the structure of microglial cells in T2DM. Rats (Rattus norvegicus) were divided into eight groups of treatment with looping three times each between treatment groups (CM) Control. The control is given a milk treatment with doses of 375 mg/kg (CM375), 750 mg/kg (CM750), and 1500 mg/kg (CM1500), T2DM (DMK), and T2DM with CSN1S2 375 mg/kg dose (DM375), 750mg/kg (DM750), and 1500 mg/kg (DM1500). The animal model T2DM was induced by a high-fat diet in the form of feed followed by injection of STZ (dose of 25 mg/kg of animal treatment) and treatment of CSN1S2 for 28 days. Brain organs were taken and analysed in histopathology stained by Hematoxylin-eosin (HE) and observed using Olympus BX53. Based on the results, it was concluded that CSN1S2 protein is influential for induction of microglial cell proliferation in animal models of T2DM, as immunity responds to the inflammatory condition in T2DM.
NCBI nr-aa BLAST: CBRC-TNIG-01-0000 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-01-0000 ref|NP_036871.2| adrenergic receptor, alpha 2a [Rattus norvegicus...] sp|P22909|ADA2A_RAT Alpha-2A adrenergic receptor (Alpha-2A adrenoceptor) (Alpha-2A adrenoreceptor) (Alpha-...2AAR) (CA2-47) (Alpha-2D adrenergic receptor) gb|AAC24959.1| alpha2D adrenergic receptor [Rattus norvegicus] NP_036871.2 4e-41 37% ...
NCBI nr-aa BLAST: CBRC-MMUS-19-0098 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-19-0098 ref|NP_036871.2| adrenergic receptor, alpha 2a [Rattus norvegicus...] sp|P22909|ADA2A_RAT Alpha-2A adrenergic receptor (Alpha-2A adrenoceptor) (Alpha-2A adrenoreceptor) (Alpha-...2AAR) (CA2-47) (Alpha-2D adrenergic receptor) gb|AAC24959.1| alpha2D adrenergic receptor [Rattus norvegicus] NP_036871.2 0.0 97% ...
Directory of Open Access Journals (Sweden)
Tony Hartono
2008-09-01
Full Text Available ABSTRACT The background of this study is to visualize histopathological changes on aorta of cirrhosis rats (Rattus norvegicus induced by endotoxin E. coli O55 : B5 This study was a laboratory experimental using complete randomized design with five treatments and five repetitions. Twenty five male Wistar rats were used as experimental model of cirrhosis by bile duct ligation (BDL technique. Three weeks after BDL, all cirrhosis experimental models were induced with a single intra venous injection of Eschericia coli endotoxin (3mg/kg b.b in 1 ml sterile saline, except those of five control rats that induced with sterile saline at the same volume only. Aortas of control rats group were excised at 6 hours after induction with sterile saline, whereas the other four groups were done at 6, 12, 18 and 24 hours after induction with endotoxin. The quantity of endothelial cell, discontinuity increment and the thickness of internal elastic lamina layer were observed to know histopathological changes on aorta. Histopathological changes were observed using a light mycroscope, dyscontinuity and thickness of internal elastic lamina were measured by reticular micrometer. The quantity of endothelial cell on control and observation interval of 6 and 12 hours as significant difference (P<0.05, which are bigger than that of 18 and 24 hours. Rats in the control group have the biggest quantity comparing to the other treatments. Discontinuity and thickness of internal elastic lamina layer had significant difference (P<0.05 on control, observation on 6 and 12 hours compared to observation on 18 and 24 hours after being induced with endotoxine. The highest discontinuity and the thinnest elastic lamina internal were obtained within observation on 24 hours. VCAM-1 expression on control group differ from observation on 6 and 12hours but all of them have significant difference to observation on 18 and 24 hours (P<0,05. The decrease of endothelial cell number is caused by
NCBI nr-aa BLAST: CBRC-RNOR-04-0246 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0246 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-125 75% ...
NCBI nr-aa BLAST: CBRC-CPOR-01-1266 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CPOR-01-1266 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 6e-64 44% ...
NCBI nr-aa BLAST: CBRC-RNOR-04-0249 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0249 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-134 76% ...
NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0238 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-133 80% ...
NCBI nr-aa BLAST: CBRC-RNOR-04-0255 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0255 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-120 74% ...
NCBI nr-aa BLAST: CBRC-RNOR-04-0243 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0243 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-132 76% ...
NCBI nr-aa BLAST: CBRC-RNOR-04-0244 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0244 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-175 100% ...
NCBI nr-aa BLAST: CBRC-OCUN-01-0923 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OCUN-01-0923 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 8e-74 48% ...
NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0259 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-126 74% ...
NCBI nr-aa BLAST: CBRC-RNOR-04-0240 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-04-0240 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-132 76% ...
Karyotype evolution and species differentiation in the genus Rattus ...
African Journals Online (AJOL)
Rattus is the most studied genus all over the world but species of the genus are not thoroughly reported from Manipur. The present paper deals with the morphometric, cytotaxonomic and phylogenetic studies of Manipur, India. The different species of Rattus namely Rattus rattus, Rattus brunneusculus, Rattus tanezumi and ...
Directory of Open Access Journals (Sweden)
Nurihardiyanti Nurihardiyanti
2015-10-01
Full Text Available Research on diuretic activity of seed extract combination of papaya (Carica papaya L and snake fruit (Salacca zalacca (Gaert. Voss to male wistar strain rats (Rattus norvegicus L. has been conducted. This study aimed to determine the diuretic effect of the seed extract combination and its effective dose combination as diuretics. The extract was prepared by maceration method using ethanol 96%. Diuretic activity test was divided into 5 treatment groups. Each group consisted of 5 rats. Group 1 (negative control was given suspension of Na-CMC 0.5%; Group 2 (positive control was given furosemide 3.6 mg/kgBW; Group 3, 4, and 5 were given dose combination of snake fruit seed extract and papaya seed extract successively at “37.5 mg/kgBW + 7.5 mg/kgBW”; “70 mg/kgBW + 15mg/kgBW”; and “140 mg/kgBW + 30 mg/kgBW”. Each rat was then orally given warm distilled water (70°C 10ml/100gBW as loading dose. The excreted urine volume was measured and recorded every 30 minutes for 6 hours which was continued to cumulative urine volume calculation. Furthermore, sample was taken from the cumulative urine to measure levels of sodium (Na, potassium (K, and the pH of the urine. Data were statistically analyzed using ANOVA (Analysis of Variance. The results showed that the effective extract dose combination was found in Group 5’s dose (140 mg/kgBW of snake fruit seed extract and 30 mg/kgBW papaya seed extract with diuretic activity index of 1.48; urine pH of 7.52; sodium saluretic index of 1.62; and potassium saluretik index of 1.56
Herlina Pratiwi; Djoko Winarso; Nunung Handoyo
2017-01-01
This study was conducted to determine levels of LDL and liver damage in rats (Rattus norvegicus) models of type 1 diabetes mellitus inducted by streptozotocin (STZ) with etanol extract of turmeric (Curcuma Longa L) therapy. Animals used rat (Rattus norvegicus) 3-month-old males who were divided into 5 groups, each group consisting of four mice. The group was divided according to treatment: negative control (not induced by STZ), the positive control group (STZ induced), groups of rats DM 1 wit...
Gene Therapy for Fracture Repair
2007-05-01
modulator-1; c-myc binding protein [ Homo sapiens ]. regulation of transcription, DNA dependent NM_012488 1.55 2.53 Rattus norvegicus α-2-macroglobulin...myc binding protein [ Homo sapiens ] Regulation of transcription, DNA dependent NM_012488 1.55 2.53 Rattus norvegicus α-2-macroglobulin (A2m) Protease...1-HIV LTR-MLV Promoter EG FP -C el l N um be r (M ea n) 10 ul Vector 50 ul Vector 7 Periosteal/Endosteal Cell Transduction 0 200 400 600 800
Over Rattus rattus roquei Sody met beschrijving van een nieuw ras van Rattus rattus van Soemba
Sody, H.J.V.
1930-01-01
Geen der op Java voorkomende soorten heeft wellicht den werkers in Javaansche ratten zooveel determinatie-zorgen gekost als de voor kort door mij 1) met roquei benoemde Javaansche „boomrat" 2). Door enkele auteurs 3) werd de vorm oorspronkelijk slechts aangeduid als Mus sp. of Rattus sp., ter
Potential of Eucalyptus Oil as Repellent against House Rat, Rattus rattus
Thind, Ramandeep Kaur; Mahal, Amrit Kaur
2014-01-01
Rodent repellents are chemicals which by taste or odour or possibly by both will prevent animal from feeding or gnawing. Such substances may be used in protecting an area from rodent infestation or in protecting packaged food, packing materials, electric cables, and other important vulnerable materials. Mature and healthy house rat, Rattus rattus of both sexes, was exposed to 5, 10, and 20% eucalyptus oil applied as spray in laboratory pens in bichoice tests. Each concentration was applied through three different modes of application, that is, daily, once, and alternatively in a week. Repellent effect of the oil was assessed based on food consumption from treated and untreated sides for four days. In overall, food consumption was significantly (P eucalyptus oil. Present studies reveal the potential of eucalyptus oil in repelling away R. rattus; however, further studies may be conducted to enhance the persistence of repellent effect for longer period of time. PMID:24523633
International Nuclear Information System (INIS)
Jamali, M.; Sahabi, Z.
1993-01-01
The area under study is Ramsar known as one of the high level natural radioactive areas in the world with radiation levels ranging from 0.8 to 5.5 mR.h -1 . The radioactivity of the area is due to 226 Ra and its daughters which have been brought up to the earth surface by the water of the warm springs. It is necessary to say that the radioactive area of Ramsar is divided into three parts: with high, medium and low radiation areas. The control area is Babol with a radius of 10 kilometers. The area has natural background radiation. In the control area thirty Rattus-rattus and in the area of study sixty Rattus-rattus were trapped. It was tried that the Rattuses chosen be from a distance of maximum 500 meters, and from the three different parts of the radioactive areas. Then all the ninety Rattuses were transported to Tehran for experiment. An average of 10-30 Rattuses were trapped for one week, and the maximum time between the trapping and the dissection was one month. The chromosomal study was followed by the Ford technique. The staining was routine and G. banding. No chromosomal disorders and morphological anomalies were considered. (author). 5 refs, 1 fig
Directory of Open Access Journals (Sweden)
sariano ferni
2017-07-01
Full Text Available Background: Background: Intraoral radiography use some lower LET (Linear Energy Transfer and could penetrate submandibular salivary gland. Radiography have negative impact which is decrease catalase enzyme of human body. Brown algae (Sargassum sp. has a flavonoid antioxidant, polysaccharides as Fucoidan and alginat (Na-alginat can be used for immunomodulator, antioxidative and activation modulation of immune. Purpose: To knowing effectiveness of brown algae (Sargassum sp. on activity catalase enzyme submandibular salivary gland Rattus Novergicus strain Wistar with irradiation low LET. Material and Methods: 28 samples of Rattus Novergicus strain Wistar, weight 200gr, age 2-3months, gender male, sample divide into 4 groups, K1 (control with brown algae dosage 0,018mg/kgbw K2 (use brown algae and irradiation 4 times, K3 (use brown algae and irradiation 8 times, K4 (use brown algae and irradiation 14 times. Brown algae been given 7days before apply irradiotion on day 8, then did euthanasia and took submandibular salivary gland. After that did measurement activity of catalase enzyme and counted by spectrophotometer with 240 λ. Result: Data were analyze by Shapiro-wilk, One Way ANOVA and Bonferroni. The activity of catalase enzyme have increased; 0,2586 ± 0,1050 (K1, 0,2595 ± 0,0630 (K2, 0,3252 ± 0,1663 (K3, 0,3668 ± 0,0852 (K4 but theres no significant differences activity of catalase enzyme between one group to other group. Conclusion: Brown algae dosage 0,018mg/kgbw can’t increase activity of catalase enzyme on Rattus Novergicus strain Wistar.
LASERTERAPIA NA INFLAMAÇÃO PULMONAR EXPERIMENTAL EM RATTUS NORVEGICUS OCASIONADO PELA PAPAÍNA
Directory of Open Access Journals (Sweden)
Diego Rodrigues Pessoa
2017-01-01
Full Text Available Resumo: A Doença Pulmonar Obstrutiva Crônica (DPOC é caracterizada pela limitação do fluxo aéreo decorrente da dilatação dos espaços aéreos distais aos bronquíolos terminais. Analisar os efeitos da laserterapia quanto ao processo cicatricial na lesão pulmonar experimental em Rattus Novergicus. Utilizaram-se trinta animais agrupados em três grupos de dez animais: grupo controle (GC (não recebeu nada, grupo DPOC (GD (foi pulverizado 3 doses de papaína 3mg/kg e grupo DPOC + Laser (GDL (após 7 dias da indução da lesão com papaína foi tratado com laser de 660 nm durante 15 dias.Para analise dos resultados foi realizado o lavado broncoalveolar. Quanto ao Lavado: GC (número de células normais, GD (aumento de células inflamatórias e GDL (diminuição de células inflamatórias. A laserterapia diminui o numero de células inflamatórias, entretanto, não possui efeito reconstrutor do parênquima pulmonar apenas estabiliza a lesão comprovando sua ação anti-inflamatória.
Castillo Minaya, Karen Yanet; Castillo Minaya, Estalin Humberto; Huamán Saavedra, Juan Jorge
2013-01-01
Introducción: Las dislipidemias representan un factor de riesgo primario para la cardiopatía coronaria. Objetivo: Comparar el efecto sobre el perfil lipídico entre Averrhoa carambola L. o "carambola" vs el Gemfibrozilo en Rattus rattus var albinus. Material y Métodos: Se realizó un estudio aleatorizado. Se trabajó con 39 Rattus rattus var albinus machos; divididos al azar en 2 grupos experimentales (GE) y un grupo control (GC). Sometidos a 2 semanas de acondicionamiento, 2 semanas de alimenta...
Rhipicephalus sanguineus sensu lato(Ixodidae in synantropic rodents in Rio Grande do Sul, Brazil
Directory of Open Access Journals (Sweden)
Kathleen Tavares Winkel
Full Text Available Rhipicephalus sanguineus, the brown dog tick, is responsible for maintaining and transmitting various pathogens, both in animals and human beings, and it is of great sanitary importance. This communication reports the first occurrence of Rhipicephalus sanguineus sensu lato parasitizing Rattus norvegicus in the state of Rio Grande do Sul, Brazil, and it is also the first record of this tick species parasitizing Rattus rattus in Brazil. The rodents were captured from the port area, located in the city of Pelotas, Rio Grande do Sul, Brazil. We collected 6 larvae of this tick species from 2 male R. rattus individuals, and 3 larvae from 2 female R. norvegicus individuals; parasitized specimens of both rodent species were captured from different sites within the experimental area. This record broadens the number of Rhipicephalus sanguineus sensu lato hosts in urban areas, indicating the need for continued monitoring on population density for both R. sanguineus and synanthropic rodents.
Gene : CBRC-MLUC-01-0981 [SEVENS
Lifescience Database Archive (English)
Full Text Available CTED: similar to Salivary gland secretion 1 CG3047-PA [Rattus norvegicus] 7e-34 41% MPQATMPIDHDAHRPRCPQVYDAHSPDAHRSRCSQATMP...TGHDAHRPRCSQAPMPTGHDARRPRCSQARCPTGHDAHRPRCPQATMFTGHDAHRPRCSQATMPTGHDAHRPRCPQATMPTGHDAHRPRCSQAMMPTGHDVHRPRCLQATMPTGHDVHRPRCLQATMPTGHDARRPRCSQAMMPAGHDAHRP ...
Directory of Open Access Journals (Sweden)
Zakia Umami
2015-05-01
Full Text Available ABSTRACTThe purpose of this study was to determine the cow’s milk powder to increased serum levels of High Density Lipoprotein (HDL of white male rat model with diabetes mellitus type 2. The design of this study was a post-test control group study conducted in 30 male rats which randomly divided into five groups. Negative control group was the group of rats which fed normally, the positive control group was induced by streptozotocin (STZ without given cow’s milk, group P1, P2, P3 were given a normal diet and cow’s milk 0.9; 1.8, and 2.7 g orally every day. The results of this study were the levels of HDL in K(-=44.22 mg/dl, K(+=47.45 mg/dl, P1=56.56 mg/dl, P2=51.82 mg/dl, and P3=59.45 mg/dl. The conclusion was the milk powder was not significantly increase levels of HDL (p>0.05. More longer intervention was suggested for further research to get more significant of HDL level on type 2 diabetes mellitus.Keywords: HDL serum level, high fat diet, milk powder, streptozotocinABSTRAKTujuan penelitian ini adalah menganalisis pengaruh pemberian susu sapi bubuk terhadap peningkatan kadar serum High Density Lipoprotein (HDL tikus putih (Rattus norvegicus berjenis kelamin jantan model diabetes melitus (DM tipe 2. Penelitian ini menggunakan desain penelitian post test control group dengan 30 ekor tikus dibagi secara acak menjadi lima kelompok. Kelompok K(- adalah tikus yang diberi pakan normal, kelompok K(+ diinduksi dengan streptozotocin (STZ tanpa diberi susu, kelompok P1 sampai P3 diberi diet normal dan susu 0,9; 1,8, dan 2,7 g secara oral setiap hari. Hasil penelitian menunjukkan kadar HDL pada K(-=44,22 mg/dl, K(+=47,45 mg/dl, P1=56,56 mg/dl, P2=51,82 mg/dl, dan P3=59,45 mg/dl. Susu sapi bubuk mampu meningkatkan kadar HDL tikus model DM tipe 2 akan tetapi tidak signifikan (p>0,05. Perlu dilakukan penelitian lebih lanjut dengan waktu lama penelitian yang berbeda sehingga bisa berdampak yang lebih signifikan untuk kadar HDL pada DM tipe 2.Kata kunci
Dicty_cDB: Contig-U06984-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available tigen NY-CO-7 (NY-C... 36 0.56 AF129085_1( AF129085 |pid:none) Homo sapiens carboxy terminus of H... 36 0.56... DNA Entam... 44 5.1 1 ( EK423693 ) 1095515647805 Global-Ocean-Sampling_GS-31-01-...2962047198 Global-Ocean-Sampling_GS-31-01-01-1... 34 8.3 2 ( AC117108 ) Rattus norvegicus clone CH230-240I5,...SEQUENC... 30 8.6 2 ( EK533234 ) 1095516016996 Global-Ocean-Sampling_GS-32-01-01-1... 40 8.9 2 ( AC106212 ) ...Rattus norvegicus clone CH230-42I19, *** SEQUENCI... 30 9.0 2 ( ER390099 ) 1094428835918 Global-Ocean-Sampli
Hernández-Brito, Dailos; Luna, Amparo; Carrete, Martina; Tella, José Luis
2014-01-01
The rose-ring parakeet (Psittacula krameri) is one of the most successful invasive birds in its establishment worldwide. Studies addressing its potential impact on native biota mostly focus on birds and little is known about how these and other parakeet species interact with native mammals. Here, we report 21 aggressions of rose-ringed parakeets towards black rats (Rattus rattus) in urban parks in Seville (Southern Spain) and Tenerife (Canary Islands). Either solitary parakeets or, more often...
Directory of Open Access Journals (Sweden)
Chelsea G Himsworth
Full Text Available Methicillin-resistant Staphylococcus aureus (MRSA is an important cause of multi-drug-resistant infections in people, particularly indigent populations. MRSA can be transmitted between people and domestic animals, but the potential for transmission between people and commensal pests, particularly rodents, had not been investigated. The objective of this study was to identify the presence and characterize the ecology of MRSA in rats (Rattus spp. from in an impoverished, inner-city neighborhood. Oropharyngeal swabs were collected from rats trapped in 33 city blocks and one location within the adjacent port. Bacterial culture was performed and MRSA isolates were characterized using a variety of methods, including whole-genome sequencing (WGS. The ecology of MRSA in rats was described using phylogenetic analysis, geospatial analysis, and generalized linear mixed models. MRSA was identified 22 of 637 (3.5% rats tested, although prevalence varied from 0 - 50% among blocks. Isolates belonged to 4 clusters according to WGS, with the largest cluster (n = 10 containing isolates that were genetically indistinguishable from community-acquired USA300 MRSA strains isolated from people within the study area. MRSA strains demonstrated both geographic clustering and dispersion. The odds of an individual rat carrying MRSA increased with increased body fat (OR = 2.53, 95% CI = 1.33-4.82, and in the winter (OR = 5.29, 95% CI = 1.04-26.85 and spring (OR = 5.50, 95% CI = 1.10-27.58 compared to the fall. The results show that urban rats carried the same MRSA lineages occurring in local human and/or animal populations, supporting recent transmission from external sources. MRSA carriage was influenced by season, most likely as a result of temporal variation in rat behavior and rat-human interactions.
Levantamento da fauna de Coleoptera (Insecta associada à carcaça de roedores na região Sul do Brasil
Directory of Open Access Journals (Sweden)
Vinícius Costa-Silva
2017-12-01
Abstract. Coleoptera (Arthropoda, Insecta is considered one of the most important organism groups associated with organic matter decomposition and therefore may be useful to elucidate issues in the criminal context. The richness and abundance of beetles, including the necrophagous species, may vary according to climatic and physiogeographic conditions in different regions, thus the knowledge of the local entomofauna becomes relevant. Thereby, this study aimed to survey the local fauna and register the seasonal behavior of Coleoptera species associated with rodent carcasses exposed in a rural environment at Santa Maria, Rio Grande do Sul, Brazil (29°43'02.88"S 53°43'52.24"W. The collections were carried out quarterly throughout 12 months. Four Rattus norvegicus (Berkenhout carcasses weighing approximately 400 g were exposed, simultaneously, in each season, protected by a steel cage. Four pitfall traps were arranged around each carcass. A total of 1,856 specimens belonging to 14 families of Coleoptera were collected. The greatest abundance was observed during spring (N= 1,006, followed by summer (N= 518, winter (N= 319 and fall (N= 26. Records of the necrophagous entomofauna of Rio Grande do Sul are still scarce. Beyond contributing to the database promotion of the necrophagous species of beetle as a forensic purpose, it is expected that this paper may instigate the achievement of more faunistic surveys, regarding the biodiversity matter of two singular biomes present in the South region, Pampa and Atlantic Forest.Â
Research Note. Occurrence of gastrointestinal helminths in commensal rodents from Tabasco, Mexico
Cigarroa-Toledo N.; Santos-Martinez Y. De Los; Zaragoza-Vera C. V.; Garcia-Rodriguez M. M.; Baak-Baak C. M.; Machain-Williams C.; Garcia-Rejon J. E.; Panti-May J. A.; Torres-Chable O. M.
2017-01-01
The aim of this study was to determine the prevalence and species composition of helminths in commensal rodents captured inside private residences in the city of Villahermosa in Tabasco, Mexico. Trapping was performed at each house for three consecutive nights from October to December 2015. Fifty commensal rodents were captured: 23 Rattus norvegicus, 16 Mus musculus and 11 Rattus rattus. Rodents were transported alive to the laboratory and held in cages until they defecated. Feces were analyz...
Directory of Open Access Journals (Sweden)
Solikhin dan Purnomo .
2011-11-01
Full Text Available Paddyfield Rat (Rattus-rattus argentiventer Preference and Its Impact on The Damage Pattern of Dodokan and Cianjur Rice Cultivar. A field experiment was conducted during the dry season of 2006 in Central Lampung to evaluate the preference of paddyfield rat (Rattus-rattus argentiventer to Dodokan and Cianjur rice cultivars in the rice field and its impact on the damage pattern caused by the rat’s attack. The experiment of six treatments and 3 replications were arranged in a randomized completely block design. Each treatment consisted of two rice cultivars i.e. Cisadane and Dodokan. Dodokan cultivar was planted in centre of each experimental unit, surrounded by Cianjur, forming six different patterns (formations as treatment. All experimental units then were exposed to natural paddyfield rat population. Weekly observations on both cultivars were made to record the damage caused by the rat from 30 to 84 day after transplanting. Aerial view of all treatments were also taken at 84 days after transplanting (a week prior to harvest. The result showed that the paddyfield rat significantly prefered Dodokan rice cultivar to Cianjur. Eventually, the preference of the rat influenced the damage pattern of Dodokan rice cultivar, showed by some unique aerial views of the plot.
A comparative assessment of efficacy of three anticoagulant rodenticides.
Renapurkar, D M
1982-01-01
Results are presented of feeding tests carried out with three common anticoagulant rodenticides viz., coumatetralyl, fumarin and warfarin on three common species of commensal rodents i.e., Rattus rattus, Rattus norvegicus and Bandicota bengalensis. All three species of rodents were susceptible to anticoagulant rodenticides. However, the action of these compounds in B. bengalensis was comparatively slow. Coumatetralyl was found to be the most effective rodenticide followed by fumarin and warfarin. Liquid baits of these compounds are more effective in comparison to food baits.
UniProt search blastx result: AK287898 [KOME
Lifescience Database Archive (English)
Full Text Available oxidil sulfotransferase) (Mx-ST) - Rattus norvegicus (Rat) 4.00E-21 ... ...ransferase) (Phenol sulfotransferase) (PST-1) (Sulfokinase) (Aryl sulfotransferase IV) (ASTIV) (Tyrosine-ester sulfotransferase) (Min
UniProt search blastx result: AK287865 [KOME
Lifescience Database Archive (English)
Full Text Available oxidil sulfotransferase) (Mx-ST) - Rattus norvegicus (Rat) 4.00E-23 ... ...ransferase) (Phenol sulfotransferase) (PST-1) (Sulfokinase) (Aryl sulfotransferase IV) (ASTIV) (Tyrosine-ester sulfotransferase) (Min
Sciberras, Arnold; Lalov, Sdravko Vesselinov
2007-01-01
Recently the presence of the black rat Rattus rattus was reported from the island of Fungus Rock which houses a remarkable flora and fauna and has been a protected site for over 250 years. A preliminary account of the rat's impact on some Fungus Rock species is given and threats to the island's ecosystem are discussed.
Arabidopsis CDS blastp result: AK105135 [KOME
Lifescience Database Archive (English)
Full Text Available AK105135 001-102-A05 At2g27170.1 structural maintenance of chromosomes (SMC) family protein similar to basem...ent membrane-associated chondroitin proteoglycan Bamacan [Rattus norvegicus] GI:178
Research Note. Occurrence of gastrointestinal helminths in commensal rodents from Tabasco, Mexico
Directory of Open Access Journals (Sweden)
Cigarroa-Toledo N.
2017-06-01
Full Text Available The aim of this study was to determine the prevalence and species composition of helminths in commensal rodents captured inside private residences in the city of Villahermosa in Tabasco, Mexico. Trapping was performed at each house for three consecutive nights from October to December 2015. Fifty commensal rodents were captured: 23 Rattus norvegicus, 16 Mus musculus and 11 Rattus rattus. Rodents were transported alive to the laboratory and held in cages until they defecated. Feces were analyzed for helminth eggs using the Sheather’s flotation technique. The overall prevalence of helminths in rodents was 60 %: R. norvegicus was more likely to be parasitized (87.0 % than R. rattus (63.6 % and M. musculus (18.8 %. Eggs from at least 13 species of helminths were identified: Hymenolepis diminuta, Rodentolepis nana, Moniliformis moniliformis, Heligmosomoides polygyrus, Heterakis spumosa, Mastophorus muris, Nippostrongylus brasiliensis, Strongyloides ratti, Syphacia obvelata, Syphacia muris, Toxocara sp., Trichosomoides crassicauda, and Trichuris muris. This is the first study to report the presence of H. polygyrus, S. ratti and T. crassicauda in commensal rodents in Mexico. In conclusion, our results suggest that helminths commonly infect commensal rodents in Villahermosa and therefore rodents present a health risk to inhabitants in this region.
Detection of a Yersinia pestis gene homologue in rodent samples
Directory of Open Access Journals (Sweden)
Timothy A. Giles
2016-08-01
Full Text Available A homologue to a widely used genetic marker, pla, for Yersinia pestis has been identified in tissue samples of two species of rat (Rattus rattus and Rattus norvegicus and of mice (Mus musculus and Apodemus sylvaticus using a microarray based platform to screen for zoonotic pathogens of interest. Samples were from urban locations in the UK (Liverpool and Canada (Vancouver. The results indicate the presence of an unknown bacterium that shares a homologue for the pla gene of Yersinia pestis, so caution should be taken when using this gene as a diagnostic marker.
Batth, B K; Parshad, R K
2000-02-01
The distribution of mast cells in various ovarian compartments was studied during different stages of the reproductive cycles in Rattus rattus. Two types of mast cell populations were recognized with light microscopy i.e., light purple and deep purple, the latter also includes deeply stained cells with extruded granules. Mast cells identified by electron microscopy showed the ultrastructural features during granule formation and release of their content. Significantly higher numbers of mast cells per unit area of ovary were seen at estrus and diestrus. Numbers of mast cells also remained high during pregnancy with possible involvement of mast cell products in vascularization of corpora lutea. A positive correlation existed between mast cell counts and embryo number during pregnancy. However, numbers of mast cells declined significantly after parturition.
GenBank blastx search result: AK058591 [KOME
Lifescience Database Archive (English)
Full Text Available AK058591 001-017-G08 AY953023.1 Rattus norvegicus smooth muscle myosin heavy chain, alternative... isoform B, S1 region mRNA, partial cds, alternatively spliced.|ROD ROD 4e-66 +2 ...
Directory of Open Access Journals (Sweden)
Nevy Triditha Putri
2016-12-01
Full Text Available Intraoral periapical radiograph examination is the additional examination which is the most widely used in Dentistry. This radiograph examination using an x-ray ionizing radiation with low LET (Linear Energy Transfer, and may affect submandibular salivary gland. Ionizing radiation exposure can cause damage by inducing a series of changes at the molecular and cellular level. This study aimed to prove the effects of x-ray ionizing radiation with low LET towards the catalase activity of Rattus norvegicus strain Wistar’s submandibular gland. The subjects were 28 male Wistar rats and divided into 4 groups (n=7. Three groups were exposed 4, 8 and 14 times to radiation with 0.002 µSv for each exposure. The catalase activity of each rat was examined by a spectrophotometer. Data were analyzed using one-way ANOVA followed by Bonferroni test. The results showed the average of catalase activity on Wistar rat’s submandibular gland, respectively for: 0.150±0.0895 (KK, 0.1405±0.0607 (K1, 0.1228±0.0290 (K2, 0.1227±0.0556 (K3. Data showed significant differences of catalase activity between test groups, but showed not significant differences of catalase activity between each groups of Rattus norvegicus strain Wistar’s submandibular gland. In this study concluded decreased catalase activity of Rattus norvegicus strain Wistar’s submandibular gland resulting from x-rays ionizing radiation by 4 times, 8 times and 14 times exposures.
Comparative Studies on the Cardiovascular System in the Wistar ...
African Journals Online (AJOL)
PROF HORSFALL
http://ww.bioline.org.br/ja. Comparative Studies on the Cardiovascular System in the Wistar Rat (Rattus .... norvegicus) were gotten from the animal house of the. Department of Anatomy .... Locomotion and Respiration in. Marine Air – Breathing ...
Invasive rats on tropical islands: Their population biology and impacts on native species
Harper, Grant A.; Bunbury, Nancy
2015-01-01
The three most invasive rat species, black or ship rat Rattus rattus, brown or Norway rats, R. norvegicus and Pacific rat, R. exulans have been incrementally introduced to islands as humans have explored the world’s oceans. They have caused serious deleterious effects through predation and competition, and extinction of many species on tropical islands, many of which are biodiversity hotspots. All three rat species are found in virtually all habitat types, including mangrove and arid shrub la...
UniProt search blastx result: AK287865 [KOME
Lifescience Database Archive (English)
Full Text Available AK287865 J065201C22 P49889|ST1E3_RAT Estrogen sulfotransferase, isoform 3 (EC 2.8.2....4) (EST-3) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 2.00E-28 ...
UniProt search blastx result: AK287865 [KOME
Lifescience Database Archive (English)
Full Text Available AK287865 J065201C22 P52844|ST1E1_RAT Estrogen sulfotransferase, isoform 1 (EC 2.8.2....4) (EST-1) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 3.00E-28 ...
UniProt search blastx result: AK287865 [KOME
Lifescience Database Archive (English)
Full Text Available AK287865 J065201C22 P49890|ST1E6_RAT Estrogen sulfotransferase, isoform 6 (EC 2.8.2....4) (EST-6) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 1.00E-27 ...
UniProt search blastx result: AK287898 [KOME
Lifescience Database Archive (English)
Full Text Available AK287898 J065210I16 P52845|ST1E2_RAT Estrogen sulfotransferase, isoform 2 (EC 2.8.2....4) (EST-2) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 2.00E-18 ...
UniProt search blastx result: AK287898 [KOME
Lifescience Database Archive (English)
Full Text Available AK287898 J065210I16 P49890|ST1E6_RAT Estrogen sulfotransferase, isoform 6 (EC 2.8.2....4) (EST-6) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 2.00E-18 ...
UniProt search blastx result: AK287898 [KOME
Lifescience Database Archive (English)
Full Text Available AK287898 J065210I16 P49889|ST1E3_RAT Estrogen sulfotransferase, isoform 3 (EC 2.8.2....4) (EST-3) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 1.00E-18 ...
UniProt search blastx result: AK287898 [KOME
Lifescience Database Archive (English)
Full Text Available AK287898 J065210I16 P52844|ST1E1_RAT Estrogen sulfotransferase, isoform 1 (EC 2.8.2....4) (EST-1) (Sulfotransferase, estrogen-preferring) (Estrone sulfotransferase) - Rattus norvegicus (Rat) 6.00E-19 ...
UniProt search blastx result: AK289207 [KOME
Lifescience Database Archive (English)
Full Text Available sor (EC 1.4.1.3) (GDH) (Memory-related protein 2) (MRG-2) - Rattus norvegicus (Rat) 1.00E-64 ... ...AK289207 J100056H18 P10860|DHE3_RAT Glutamate dehydrogenase 1, mitochondrial precur
Indian Academy of Sciences (India)
rats and mice have, as commensals of man or by natural means, invaded every continent ... Split open the kegs of salted sprats. Made nests inside the ... The brown rat, Rattus norvegicus, also called the field or sewer. Rodents encompass a ...
Lung and hearth nematodes in some Spanish mammals.
Alvarez, F; Iglesias, R; Bos, J; Rey, J; Sanmartin Durán, M L
1991-01-01
Thirteen host species belonging to the orders Rodentia, Insectivora and Carnivora from various localities in Galicia (NW Spain) were examined for heart and lung parasites. The following species were found: Parastrongylus dujardini (5.5%) in Apodemus sylvaticus, Crenosoma striatum in Erinaceus europaeus (83%), Angiostrongylus vasorum, Crenosoma vulpis and Eucoleus aerophilus in Vulpes vulpes (3, 3.46 and 0.50%, respectively), Crenosoma taiga in Putorius putorius (100%) and Crenosoma sp. in Meles meles (25%). In Crocidura russula nematode larvae were found (3.3%). Mus musculus, Rattus norvegicus, Rattus rattus, Talpa caeca, Sorex araneus, Genetta genetta and Canis lupus were not parasitized by lung or heart parasites.
NCBI nr-aa BLAST: CBRC-MDOM-01-0241 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-01-0241 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 2e-54 67% ...
NCBI nr-aa BLAST: CBRC-MDOM-11-0078 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-11-0078 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 1e-50 61% ...
NCBI nr-aa BLAST: CBRC-MDOM-04-0193 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-04-0193 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 3e-51 66% ...
NCBI nr-aa BLAST: CBRC-MDOM-02-0479 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-02-0479 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 4e-65 94% ...
NCBI nr-aa BLAST: CBRC-MDOM-01-0082 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-01-0082 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 2e-55 68% ...
NCBI nr-aa BLAST: CBRC-MDOM-01-0046 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-01-0046 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 5e-69 84% ...
NCBI nr-aa BLAST: CBRC-MDOM-05-0033 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-05-0033 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 2e-68 85% ...
NCBI nr-aa BLAST: CBRC-MDOM-02-0442 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-02-0442 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 9e-61 64% ...
NCBI nr-aa BLAST: CBRC-MDOM-01-0547 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-01-0547 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 3e-61 82% ...
NCBI nr-aa BLAST: CBRC-MDOM-04-0085 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-04-0085 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 3e-66 86% ...
NCBI nr-aa BLAST: CBRC-FRUB-02-0728 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0728 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 3e-26 73% ...
NCBI nr-aa BLAST: CBRC-MDOM-06-0136 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-06-0136 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 8e-54 74% ...
NCBI nr-aa BLAST: CBRC-MDOM-07-0064 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-07-0064 ref|XP_001077205.1| PREDICTED: similar to High mobility group protein 1 (HMG-1) (High mobi...lity group protein B1) (Amphoterin) (Heparin-binding protein p30) [Rattus norvegicus] XP_001077205.1 1e-60 64% ...
UniProt search blastx result: AK287474 [KOME
Lifescience Database Archive (English)
Full Text Available AK287474 J043022N04 P04917|PGSG_RAT Secretory granule proteoglycan core protein pre...cursor (Chondroitin sulfate proteoglycan core protein) (Proteoglycan 10K core protein) (PG19 core protein) (Cytolytic granule proteoglycan core protein) - Rattus norvegicus (Rat) 0 ...
NCBI nr-aa BLAST: CBRC-OPRI-01-1187 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-1187 ref|XP_344240.3| PREDICTED: similar to Paired mesoderm homeobox p...rotein 2B (Paired-like homeobox 2B) (PHOX2B homeodomain protein) (Neuroblastoma Phox) (NBPhox) [Rattus norvegicus] XP_344240.3 8.8 38% ...
GenBank blastn search result: AK288534 [KOME
Lifescience Database Archive (English)
Full Text Available AK288534 J090045E15 AC095876.6 AC095876 Rattus norvegicus BAC CH230-10G12 (Children's Hospital Oakland Resea...rch Institute Rat (BN/SsNHsd/MCW) BAC library) complete sequence. ROD 3e-81 1 -1 ...
Dicty_cDB: Contig-U15301-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 6 |pid:none) Amphimedon queenslandica hedgling ... 35 2.9 AP005643_12( AP005643 |...l... 35 2.9 AB003753_1( AB003753 |pid:none) Rattus norvegicus genes for high s... 35 2.9 EU285556_1( EU28555
de Faria, Marcos Tucunduva; Calderwood, Michael S.; Athanazio, Daniel A.; McBride, Alan J. A.; Hartskeerl, Rudy A.; Pereira, Martha Maria; Ko, Albert I.; Reis, Mitermayer G.
2008-01-01
A survey was conducted to identify reservoirs for urban leptospirosis in the city of Salvador, Brazil. Sampling protocols were performed in the vicinity of households of severe leptospirosis cases identified during active hospital-based surveillance. Among a total of 142 captured Rattus norvegicus
Directory of Open Access Journals (Sweden)
Lim Boo Liat
2012-09-01
Full Text Available Sebuah percobaan penanggulangan pinjal Xenopsyll cheopis dari tikus Rattus rattus diardii dilakukan di Ciloto dari bulan Februari sampai Nopember 1978. Racun serangga yang digunakan 50 % mala-thion wdp, 40 % fenitrothion wdp dan 75 % DDT wdp. dicampur dengan serbuk bedak sehingga terdapat 5 % zat racun aktif (active ingredient. Percobaan dilakukan pada 3 dusun. Pengamatan dilakukan dari bulan Februari sampai Nopember 1978 di daerah percobaan dan daerah kontrol DDT 5 % tidak effektif untuk pemberantasan pinjal, malathion 5 % effektif sampai 15 minggu dan Fenitrothion 5 % sampai 19 minggu sesudah perlakuan pertama. Ketiga racun serangga juga effektif untuk tungau dan kutu, tapi tidak demikian untuk tungau dewasa mesostigmatik (mesostigmatic mites.
Directory of Open Access Journals (Sweden)
Agnes Antônia Sampaio Pereira
Full Text Available Knowledge of potential reservoirs of Leishmania spp. in an anthropic environment is important so that surveillance and control measures can be implemented. The aim of this study was to investigate the infection by Leishmania in small mammals in an area located in Minas Gerais, Brazil, that undergoes changes in its natural environment and presents autochthonous human cases of cutaneous leishmaniasis (CL and visceral leishmaniasis (VL. For the capture of the animals, Sherman and Tomahawk traps were used and distributed in the peridomicile of houses with reports of autochthonous cases of CL or VL. Six catches were carried out on two consecutive nights with intervals of two months during one year and samples of spleen, liver, tail skin, ear skin and bone marrow of the animals were obtained. Parasitological and molecular methods were used to detect the infection. Identification of the Leishmania species was performed by PCR RFLPhsp70. Twenty five animals of four species were captured: ten Rattus rattus, nine Didelphis albiventris, five Cerradomys subflavus and one Marmosops incanus. In the PCR-hsp70, five animals were positive (20%. The Leishmania species identified in PCR-RFLPhsp70 were: Leishmania braziliensis in D. albiventris (2, C. subflavus (1 and R. rattus (1 and Leishmania infantum in R. rattus (1. The highest positivity rate for L. braziliensis was obtained in the liver samples. The spleen was the only tissue positive for L. infantum. It was isolated in culture medium L. braziliensis from two samples (liver and spleen of R. rattus. This is the first record of isolation of L. braziliensis from R. rattus in the southeastern region of Brazil. These results are relevant to the knowledge of the epidemiology of leishmaniasis in the region, mainly in the investigation of the presence of hosts and possible reservoirs of the parasite.
Immuno-modulatory properties of prebiotics extracted from Vernonia ...
African Journals Online (AJOL)
Methods: The immuno-modulatory potential was evaluated by monitoring the effects of oral administration of the extract on immunological, haematological and lipid profiles of Rattus norvegicus, while the prebiotic components were identified by thin layer chromatography (TLC), following liquid-liquid fractionation of the ...
Performance of rats orogastrically dosed with faecal strains of ...
African Journals Online (AJOL)
Administrator
strains of Lactobacillus acidophilus and challenged ... Albino rats (Rattus norvegicus) were orogastrically dosed with faecal strains of Lactobacillus .... Chang et al. (2001) reported a similar observation in piglets fed probiotic strain, Lactobacillus reuteri BSA 131. Francisco et al. (1995) had earlier reported that selected ...
Access to enriched housing is rewarding to rats as reflected by their anticipatory behaviour
Harst, van der J.E.; Fermont, P.C.J.; Bilstra, A.; Spruijt, B.M.
2003-01-01
We tested the general assumption that enrichment of the housing environment is rewarding to laboratory rats, Rattus norvegicus. We used the behavioural response in anticipation of a forthcoming reward as a measure of the rewarding property of a simple enriched cage. For this, a Pavlovian
Lifescience Database Archive (English)
Full Text Available 15 |pid:none) Rhodococcus opacus B4 DNA, comp... 88 4e-16 BC088249_1( BC088249 |pid:none) Rattus norvegicus pipecoli... BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 87 1e-15 BC116493_1( B
Arabidopsis CDS blastp result: AK061637 [KOME
Lifescience Database Archive (English)
Full Text Available AK061637 001-036-A11 At1g77130.1 glycogenin glucosyltransferase (glycogenin)-relate...d contains similarity to glycogenin-1 from Mus musculus [SP|Q9R062], Rattus norvegicus [SP|O08730], Homo sapiens [SP|P46976] 4e-84 ...
Effect of electrolyzed reduced water on malondialdehyde levels and ...
African Journals Online (AJOL)
Purpose: To evaluate the effects of electrolyzed reduced water (ERW) on malondialdehyde (MDA) levels and neutrophil cells in Wistar rats suffering from aggressive periodontitis. Methods: Wistar rats (Rattus norvegicus) were infected with A. actinomycetemcomitans before being divided into a control group and a treatment ...
Genome sequence of the Brown Norway rat yields insights into mammalian evolution
DEFF Research Database (Denmark)
Gibbs, Richard A; Weinstock, George M; Metzker, Michael L
2004-01-01
The laboratory rat (Rattus norvegicus) is an indispensable tool in experimental medicine and drug development, having made inestimable contributions to human health. We report here the genome sequence of the Brown Norway (BN) rat strain. The sequence represents a high-quality 'draft' covering ove...
Desvars-Larrive, Amélie; Pascal, Michel; Gasqui, Patrick; Cosson, Jean-François; Benoît, Etienne; Lattard, Virginie; Crespin, Laurent; Lorvelec, Olivier; Pisanu, Benoît; Teynié, Alexandre; Vayssier-Taussat, Muriel; Bonnet, Sarah; Marianneau, Philippe; Lacôte, Sandra; Bourhy, Pascale; Berny, Philippe; Pavio, Nicole; Le Poder, Sophie; Gilot-Fromont, Emmanuelle; Jourdain, Elsa; Hammed, Abdessalem; Fourel, Isabelle; Chikh, Farid; Vourc'h, Gwenaël
2017-01-01
Brown rats are one of the most widespread urban species worldwide. Despite the nuisances they induce and their potential role as a zoonotic reservoir, knowledge on urban rat populations remains scarce. The main purpose of this study was to characterize an urban brown rat population from Chanteraines park (Hauts-de-Seine, France), with regards to haematology, population genetics, immunogenic diversity, resistance to anticoagulant rodenticides, and community of parasites. Haematological parameters were measured. Population genetics was investigated using 13 unlinked microsatellite loci. Immunogenic diversity was assessed for Mhc-Drb. Frequency of the Y139F mutation (conferring resistance to rodenticides) and two linked microsatellites were studied, concurrently with the presence of anticoagulant residues in the liver. Combination of microscopy and molecular methods were used to investigate the occurrence of 25 parasites. Statistical approaches were used to explore multiple parasite relationships and model parasite occurrence. Eighty-six rats were caught. The first haematological data for a wild urban R. norvegicus population was reported. Genetic results suggested high genetic diversity and connectivity between Chanteraines rats and surrounding population(s). We found a high prevalence (55.8%) of the mutation Y139F and presence of rodenticide residues in 47.7% of the sampled individuals. The parasite species richness was high (16). Seven potential zoonotic pathogens were identified, together with a surprisingly high diversity of Leptospira species (4). Chanteraines rat population is not closed, allowing gene flow and making eradication programs challenging, particularly because rodenticide resistance is highly prevalent. Parasitological results showed that co-infection is more a rule than an exception. Furthermore, the presence of several potential zoonotic pathogens, of which four Leptospira species, in this urban rat population raised its role in the maintenance
Lafferty, Kevin D; Hathaway, Stacie A; Wegmann, Alex S; Shipley, Frank S; Backlin, Adam R; Helm, Joel; Fisher, Robert N
2010-02-01
Black rats ( Rattus rattus ) and their stomach nematodes (Mastophorus muris) were historically introduced to islets at Palmyra Atoll in the central Pacific Line Islands. To investigate patterns of parasitism, we trapped rats and quantified nematodes on 13 islets of various sizes and habitat types. Most rats were parasitized (59%) with an average of 12 worms per infected rat. Islet size did not greatly influence parasite population biology. Nematodes also did not appear to affect rat condition (weight to skull length). The only strong and consistent factor associated with the mean abundance of nematodes in rats was habitat (dominant cover and locally dominant plant species). Thus, nematodes were much more abundant in rats from sites dominated by coconut trees (Cocos nucifera). Coconut trees may also be an introduced species at Palmyra Atoll.
Czech Academy of Sciences Publication Activity Database
Vlčková, V.; Malinová, M.; Koubková, B.; Szaková, J.; Zídek, Václav; Fučíková, A.; Zídková, J.; Kolihová, D.; Tlustoš, P.
2014-01-01
Roč. 59, č. 9 (2014), s. 416-427 ISSN 1212-1819 R&D Projects: GA ČR GA13-04580S Institutional support: RVO:67985823 Keywords : risk elements * soil * soil ingestion * liver * kidney * blood * Rattus norvegicus Subject RIV: ED - Physiology Impact factor: 1.183, year: 2014
Lafferty, K.D.; Hathaway, S.A.; Wegmann, A.S.; Shipley, F.S.; Backlin, A.R.; Helm, J.; Fisher, R.N.
2010-01-01
Black rats (Rattus rattus) and their stomach nematodes (Mastophorus muris) were historically introduced to islets at Palmyra Atoll in the central Pacific Line Islands. To investigate patterns of parasitism, we trapped rats and quantified nematodes on 13 islets of various sizes and habitat types. Most rats were parasitized (59) with an average of 12 worms per infected rat. Islet size did not greatly influence parasite population biology. Nematodes also did not appear to affect rat condition (weight to skull length). The only strong and consistent factor associated with the mean abundance of nematodes in rats was habitat (dominant cover and locally dominant plant species). Thus, nematodes were much more abundant in rats from sites dominated by coconut trees (Cocos nucifera). Coconut trees may also be an introduced species at Palmyra Atoll. ?? American Society of Parasitologists 2010.
Performance of rats orogastrically dosed with faecal strains of ...
African Journals Online (AJOL)
Albino rats (Rattus norvegicus) were orogastrically dosed with faecal strains of Lactobacillus acidophilus and simultaneously infected with Escherichia coli, while the control was challenged with E. coli alone. The treatment was repeated the second day and post ingestion period of 18 days follow. It was observed that rats ...
Lifescience Database Archive (English)
Full Text Available _MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 Length = 993 Score = 42.4 bits (98),...THGEYTSAAE 635 >tr|Q9EQN5|Q9EQN5_RAT Antifreeze-enhancer binding protein AEP OS=Rattus norvegicus GN=Ighmbp2
Czech Academy of Sciences Publication Activity Database
Száková, J.; Novosadová, Z.; Zídek, Václav; Fučíková, A.; Zídková, J.; Miholová, D.; Tlustoš, P.
2012-01-01
Roč. 57, č. 9 (2012), s. 430-441 ISSN 1212-1819 Grant - others:GA AV ČR(CZ) IAA400400806 Program:IA Institutional support: RVO:67985823 Keywords : risk elements * soil ingestion * liver * kidney * bones * Rattus norvegicus Subject RIV: GG - Livestock Rearing Impact factor: 0.922, year: 2012
Sayapina I. Y.; Ogorodnikova T. L.
2013-01-01
The article presents the results of the research of the generative function of the testis of the Rattus norvegicus Albinus after seven-day adaptation to low temperatures. We revealed the adaptation induced spermatogenesis disorders in the rat testis. The observed changes may be induced by the general adaptation syndrome
Vicuña Ríos, Augusto; Izquierdo Henríquez, Elva Julieta; Huamán Saavedra, Juan Jorge
2012-01-01
Objetivo: Comparar efectos hipotrigliceridemiantes entre gemfibrozilo y aceite de Sacha Inchi en Rattus rattus var albinus. Materiales y Método: Se utilizaron 36 especímenes, los cuales fueron divididos al azar en 2 grupos experimentales (GE1 y GE2) y un grupo control (GC). Fueron sometidos a etapa de acondicionamiento por 2 semanas, luego alimentación rica en grasa por 2 semanas; posteriormente se administró aceite de Sacha Inchi y gemfibrozilo a GE1 y GE2, respectivamente. Se midieron los n...
Ali, Asad; Zaidi, Farrah; Fatima, Syeda Hira; Adnan, Muhammad; Ullah, Saleem
2018-03-24
In this study, we propose to develop a geostatistical computational framework to model the distribution of rat bite infestation of epidemic proportion in Peshawar valley, Pakistan. Two species Rattus norvegicus and Rattus rattus are suspected to spread the infestation. The framework combines strengths of maximum entropy algorithm and binomial kriging with logistic regression to spatially model the distribution of infestation and to determine the individual role of environmental predictors in modeling the distribution trends. Our results demonstrate the significance of a number of social and environmental factors in rat infestations such as (I) high human population density; (II) greater dispersal ability of rodents due to the availability of better connectivity routes such as roads, and (III) temperature and precipitation influencing rodent fecundity and life cycle.
Czech Academy of Sciences Publication Activity Database
Myška, A.; Száková, J.; Fučíková, A.; Mlejnek, Petr; Zídek, Václav; Tremlová, J.; Mestek, O.; Koplík, R.; Zídková, J.; Melčová, M.; Tlustoš, P.
2016-01-01
Roč. 61, č. 11 (2016), s. 496-505 ISSN 1212-1819 R&D Projects: GA ČR(CZ) GA13-04580S Institutional support: RVO:67985823 Keywords : Se * Brassica napus * fortification * Rattus norvegicus * trace and major minerals Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.741, year: 2016
Lifescience Database Archive (English)
Full Text Available fadin OS=Rattus norvegicus GN=Mllt4 PE=1 SV=1 33 0.57 sp|Q80ZC9|PS1C2_MOUSE Psoriasis susceptibility 1 candi...APPPPPQRNASYLKTQVLSPDSLF 1731 >sp|Q80ZC9|PS1C2_MOUSE Psoriasis susceptibility 1 candidate gene 2 protein hom
2014-06-01
level of activity, gait and posture, reactivity to handling or sensory stimuli, altered strength, and stereotypes or bizarre behavior (e.g., self...historical database. V.3.3. Laboratory Animals V.3.3.1. Genus and Species: Rattus norvegicus V.3.3.2. Strain/Stock: Sprague-Dawley V.3.3.3
Gornik, Sebastian G; Albalat, Amaya; Theethakaew, Chonchanok; Neil, Douglas M
2013-11-01
Once a nuisance by-catch, today the Norway lobster (Nephrops norvegicus) is a valuable UK fisheries commodity. Unfortunately, the species is very susceptible to quality deterioration post harvest as it quickly develops black spots and also spoils rapidly due to bacterial growth. Treatment with chemicals can stop the blackening and carefully monitored cold storage can result in a sensory shelf life of up to 6.5 days. The high susceptibility to spoilage greatly restricts the extent to which N. norvegicus can be distributed to retailers and displayed for sale. The application of modified atmosphere (MA) could be extremely beneficial, allowing the chilled product to stay fresh for a long period of time, thus ensuring higher sales. In the present study, we identified a gas mix for the MA packaging (MAP) of whole N. norvegicus lobster into 200 g retail packs. Our results show that a shelf life extension to 13 days can be achieved when retail packs are stored in MAP at 1 °C. Effectiveness of the MAP was evaluated by using a newly developed QIM for MA-packaged whole N. norvegicus and also by analyzing bacterial plate counts. Changes in the microflora and effects of different storage temperatures on the quality of the MA packs are also presented. The main specific spoilage organism (SSO) of modified atmosphere packaged Norway lobster is Photobacterium phosphoreum. © 2013.
Directory of Open Access Journals (Sweden)
Sukmawati Sukmawati
2015-10-01
Full Text Available Anti-inflammatory activity test of ethanolic extract of banana leaf (Musa Paradisiaca L. on carrageenan-induced paw edema in white male rats (Rattus novergicus L. has been conducted. It was aimed to investigate and to determine the anti-inflammatory activity and its effective dose. The extract was prepared by maceration method using ethanol 96%. Anti-inflammatory activity test was performed in five different groups. Each group consisted of 5 rats. The 1st group (negative control was given 0.5% CMC-Na suspension; the 2nd group (positive control was given diclofenac sodium 9 mg/KgBW; the 3rd, 4th, and 5th groups were successively given the banana leaf extract as much as 500, 750 and 1000 mg/KgBW. Each rat was then induced by 1% carrageenan and tested using subplantar method. The inflamed paw diameter was measured using a calliper while the inflamed paw volume using pletysmometer. The measurements were done for 6 hours long with intervals of 60 minutes. The data was statistically analyzed using ANOVA (analysis of variance. The results showed that the negative control had a significant difference with the other treatment groups which did not show any anti-inflammatory effect. In conclusion, ethanolic extract of banana leaf has effective anti-inflammatory activity at a dose of 750 mg/KgBW
Comparative nutritional evaluation of fungus and alkali treated rice ...
African Journals Online (AJOL)
Feeding trial was conducted with growing white albino rats (Rattus norvegicus) for 56 days to determine whether alkali (NaOH) or fungus (Mushroom) treatment of rice husk would affect rat's performance. The treated rice husk comprised 10% of the rat's diets, the rests of which were 50% maize, 20% soybeans, 19% ...
Directory of Open Access Journals (Sweden)
K. C. Megawe
2012-09-01
Full Text Available Survai rodent dan pinjal dilakukan di pelabuhan Semarang dan Ujung Pandang pada bulan Desember 1984 — Mei 1985. Pada survai tersebut ditemukan 3 jenis tikus yaitu Rattus norvegicus, R. r. diardii dan R. exulans dan satu jenis cecurut Suncus murinus. Jenis tikus yang banyak ditemukan di pelabuhan Semarang adalah R. r. diardii sedang di pelabuhan Ujung Pandang adalah R. norvegicus. Pinjal Xenopsylla cheopis ditemukan di kedua daerah yang disurvai, infestasi lebih tinggi pada R. norvegicus dan R. r. diardii daripada R. exulans dan S. murinus. Indeks pinjal di pelabuhan Ujung Pandang dan sekitarnya 4 kali lebih besar daripada di Semarang. Hasil uji kerentanan pinjal menunjukkan bahwa pinjal di kedua daerah pelabuhan tersebut masih peka terhadap DDT 4%, malathion 0,5% dan fenitrothion 1%.
African Journals Online (AJOL)
Items 51 - 100 of 437 ... Vol 13, No 1 (2016), Bird species of Mouau with special emphasis on foraging behavior of the northern ... Vol 11, No 2 (2014), Challenges of E-Waste pollution to soil ... Vol 12, No 3 (2015), Consumer preference for swine offals and its ... ethanolic leaf extracts on packed cell volume of Rattus norvegicus ...
Improved ovulation rate and implantation in rats treated with royal jelly
African Journals Online (AJOL)
The ovaries and uteris of 12 mature female rats (Rattus norvegicus) were examined to determine the effect of commercial royal jelly on ovulation, ovarian weight and implantation rates. Rats were split in two groups of 6 each. Group one served as the treatment and group two the control. A daily dose of 25mg of royal jelly ...
Echchakery, Mohamed; Chicharro, Carmen; Boussaa, Samia; Nieto, Javier; Carrillo, Eugenia; Sheila, Ortega; Moreno, Javier; Boumezzough, Ali
2017-10-02
Leishmaniasis remains a major public health problem in African nations, including Morocco, where little is known about the vertebrate reservoirs involved in the causal parasites' transmission cycles. The present study investigates the role of rodent species as potential reservoirs of Leishmania spp. in central Morocco, where both L. tropica and L. infantum have been reported. Rodents were caught from 22 sites in central Morocco, by using Sherman metal traps, and identified morphologically. For each specimen, genomic DNA was extracted from different tissues using the Speed Tools DNA extraction Kit. Then, samples were PCR-analyzed, targeting the SSU rRNA gene to detect Leishmania spp. DNA, followed by amplification of the internal transcribed spacer 1 (ITS1) and its sequencing to identify the species. A total of 197 rodents belonging to ten species were captured and identified: Rattus rattus (40.61%), Mus musculus (25.38%), Apodemus sylvaticus (8.63%), Mus spretus (7.11%), Meriones shawi (5.58%), Rattus norvegicus (4.57%), Meriones libycus (3.05%), Mastomys erythroleucus (2.03%), Gerbillus campestris (2.03%) and Lemniscomys barbarus (1.01%). Molecular analysis revealed the presence of Leishmania species in 18 specimens: six R. rattus (out of 80 captured; 7.5%), 11 M. musculus (out of 50 captured; 22%), and one R. norvegicus (out of 9 captured; 11.11%). To the best of our knowledge, L. infantum and L. tropica were identified in rodent species for the first time in Morocco. These findings suggest that rodent species may be involved in L. infantum and L. tropica transmission cycles in this country but that further studies are needed to confirm their role as reservoirs of Leishmania species in Morocco.
Šnábel, Viliam; Utsuki, Daisuke; Kato, Takehiro; Sunaga, Fujiko; Ooi, Hong-Kean; Gambetta, Barbara; Taira, Kensuke
2014-09-01
Heterakis spumosa is a nematode of invasive rodents, mainly affiliated with Rattus spp. of Asian origin. Despite the ecological importance and cosmopolitan distribution, little information is available on the genetic characteristics and infectivity to experimental animals of this roundworm. Heterakis isolates obtained from naturally infected brown rats caught in 2007 in the city of Sagamihara, east central Honshu, Japan, and maintained by laboratory passages were subjected to mitochondrial sequence analysis and experimental infection in mice. Sequencing of the cox1 gene revealed that nucleotides of H. spumosa and previously examined Heterakis isolonche isolates from gallinaceous birds in Japan differed by 11.2-12.2% that conforms to the range expected for interspecific differences. The two H. spumosa isolates differed by a single 138T/C non-synonymous substitution in the 393-bp mt sequence. In a dendrogram, the H. spumosa samples formed a subcluster with members of the nematode superfamily Heterakoidea, H. isolonche and Ascaridia galli. In an experimental infection study, ICR, AKR, B10.BR and C57BL/6 mice strains were inoculated with 200 H. spumosa eggs/head and necropsied at 14 and 90 days post-inoculation (DPI) when the number of worms was recorded. Eggs were initially detected in faeces from 32-35 DPI in ICR, AKR and B10.BR mice and the highest mean number of eggs per gram of faeces (EPG) was 4,800 at 38 DPI, 2,200 at 58 DPI and 800 at 44 and 72 DPI in ICR, AKR and B10.BR mice, respectively. No eggs were observed in faeces of the C57BL/6 mouse strain during the experiment. A similar number of juvenile worms were isolated from all mouse strains at 14 DPI, whereas no adult worms were detected in C57BL/6 mice at 90 DPI.
Directory of Open Access Journals (Sweden)
Neena Singla
2014-05-01
Conclusions: Present data support the use of 2% egg albumin and egg shell powder in cereal bait to enhance acceptance and efficacy of 2% zinc phosphide bait against R. rattus. This may further help in checking the spread of rodent borne diseases to animals and humans.
Castillo Saavedra, Ericson Félix
2010-01-01
The peptic ulcer is a lesion that affects an area of the gastrointestinal mucose usually in the stomach or duodenum produced by a disbalance between defensives and protects factors. This report was oriented on determinating phytochemistry of Minthostachys mollis (Kunth) Griseb, Malva sylvestris L., and analyze if these plants in study had synergistic protect effect in the acute injure of gastric mucose induced by ethanol in Rattus rattus var. albinus. Phytochemical screening was realized usin...
Czech Academy of Sciences Publication Activity Database
Drewes, S.; Straková, Petra; Drexler, J. F.; Jacob, J.; Ulrich, R. G.
2017-01-01
Roč. 99, č. 4 (2017), s. 61-108 ISSN 0065-3527 Institutional support: RVO:68081766 Keywords : hepatitis-e virus * squirrels Sciurus-vulgaris * dependent DNA-polymerase * korean hemorrhagic-fever * beaver Castor-canadensis * mouse Micromys-minutus * rats Rattus-norvegicus * rous-sarcoma-virus * West-Nile-virus * population-cycles Subject RIV: EE - Microbiology, Virology OBOR OECD: Virology Impact factor: 4.243, year: 2016
NCBI nr-aa BLAST: CBRC-RNOR-03-0467 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-03-0467 ref|NP_077809.1| adrenergic receptor, alpha 1d [Rattus norvegicus...] sp|P23944|ADA1D_RAT Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (RA42) gb|AAB59704.1| alpha 1a/d adrenergic receptor NP_077809.1 0.0 99% ...
NCBI nr-aa BLAST: CBRC-GGAL-04-0044 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-04-0044 ref|NP_077809.1| adrenergic receptor, alpha 1d [Rattus norvegicus...] sp|P23944|ADA1D_RAT Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (RA42) gb|AAB59704.1| alpha 1a/d adrenergic receptor NP_077809.1 1e-171 59% ...
Directory of Open Access Journals (Sweden)
G.S. Gazeta
2004-12-01
Full Text Available Foi analisada a ocorrência de babesiose em pequenos roedores nos municípios de Silva Jardim e Nova lguaçu, Estado do Rio de Janeiro. Foram capturados 44 roedores de seis espécies diferentes e entre eles a prevalência da infecção foi de 27,3%. Rattus norvegicus foi considerado o principal reservatório (50,0% e Oligoryzomys nigripes como novo hospedeiro para Babesia sp. Este foi o primeiro relato de Babesia sp. em roedores no Brasil. A freqüência de roedores positivos e o risco de infecção dos roedores não diferiram entre as áreas estudadas.The occurrence of babesiosis was studied in 44 small rodents of six species captured in Silva Jardim and Nova lguaçu counties, State of Rio de Janeiro, Brazil. The prevalence of injection was 27.3%. Rattus norvegicus was considered as the main reservoir and Oligoryzomys nigripes as a new host to Babesia sp. The frequency and the risk of rodent infection were considered equal among the studied areas. This is the first report of Babesia sp in small rodents in Brazil.
Directory of Open Access Journals (Sweden)
Ervi Husni
2016-11-01
Full Text Available Pendahuluan: Jumlah penduduk Indonesia sensus tahun 2010 sebanyak 237,6 juta jiwa dengan laju pertumbuhan penduduk 1,49 % per tahun. Target RPJPMN 2010-2014 sebesar1,14 %, laju pertumbuhan penduduk saat ini 0,53 % masih lebih tinggi. Pengendalian penduduk diperlukan antara lain dengan pemakaian kontrasepsi pada wanita maupun pria. Keterlibatan pria dalam KB masih rendah hanya 6,26 %. Tujuan penelitian untuk membuktikan zat aktif daun jambu biji merah dapat menurunkan kadar FSH dan spermatogenesis pada tikus putih jantan (Rattus norvegikus. Metode: Penelitian ini merupakan penelitian eksperimen dengan rancangan Post test only control group design. Besar sampel menggunakan rumus Federer dengan jumlah sampel 30 ekor tikus putih, terbagi tiga kelompok yaitu Kelompok 1 (K1 kelompok kontrol diberikan larutan CMC 0,5 % 1 ml/ hari, Kelompok Perlakuan 1 (P1 diberikan ekstrak daun jambu biji merah dosis 40 mg/ml/hari dan kelompok Perlakuan 2 (P2 diberikan ekstrak daun jambu biji merah dosis 80 mg/ml/hari dan diberikan selama 30 hari. Variabel penelitian jumlah sel spermatogenik ( Spermatogonium, Spermatosit primer dan Spermatid. Data dianalisis menggunakan uji ANOVA. Hasil: Hasil analisis data dengan uji ANOVA jumlah sel spermatogonium nilai p 0,801 (p < 0,05: tidak ada perbedaan signifikan diantara ketiga kelompok, uji LSD tidak dilakukan. Hasil uji ANOVA untuk jumlah sel spermatosit primer didapatkan nilai p 0,102 ( p < 0,05 , berarti tidak ada perbedaan signifikan diantara ketiga kelompok, uji LSD tidak dilakukan. Hasil uji ANOVA untuk jumlah sel spermatid nilai p 0,001 (p < 0,05 berarti terdapat perbedaan signifikan diantara ketiga kelompok. Hasil uji LSD kontrol dengan P1 (p 0,036 : berbeda, Kontrol dengan P2 (p <0,000: berbeda, P1 dengan P2 (p <0,033 : berbeda. Diskusi: Kesimpulan penelitian ini adalah pemberian ekstrak daun jambu biji merah tidak menurunkan jumlah sel spermatogonium dan sel spermatosit primer tetapi menurunkan jumlah
[Cockroaches and co. The role of health pests as allergen source].
Raulf, M; Sander, I; Gonnissen, D; Zahradnik, E; Brüning, T
2014-05-01
In most of the cases health pests are carriers of pathogens or parasites which have a negative impact on human health or affect the health of other mammals. What is lesser known is that they can also act as allergens. Most of the health pests in this sense belong to the arthropods, such as cockroaches (Blattaria), mosquitos (Culiciformia), lice (Pediculus humanus corporis), fleas (Siphonaptera) and ticks (Argasidae). In the group of vertebrates rats (Rattus norvegicus and Rattus rattus), house mice (Mus musculus) and pigeons (Columba livia domestica) are also classified as health pests. Also storage pests which are not carriers of pathogens can induce secondary infestation with hygiene pests or molds and have an underestimated impact on human health. In this article selected examples of health pests and also storage pests as an allergen source are described, taking into account the sensitization prevalence and identified single allergens.
Himsworth, Chelsea G; Parsons, Kirbee L; Jardine, Claire; Patrick, David M
2013-06-01
Urban Norway and black rats (Rattus norvegicus and Rattus rattus) are the source of a number of pathogens responsible for significant human morbidity and mortality in cities around the world. These pathogens include zoonotic bacteria (Leptospira interrogans, Yersina pestis, Rickettsia typhi, Bartonella spp., Streptobacillus moniliformis), viruses (Seoul hantavirus), and parasites (Angiostrongylus cantonensis). A more complete understanding of the ecology of these pathogens in people and rats is critical for determining the public health risks associated with urban rats and for developing strategies to monitor and mitigate those risks. Although the ecology of rat-associated zoonoses is complex, due to the multiple ways in which rats, people, pathogens, vectors, and the environment may interact, common determinants of human disease can still be identified. This review summarizes the ecology of zoonoses associated with urban rats with a view to identifying similarities, critical differences, and avenues for further study.
First Isolates of Leptospira spp., from Rodents Captured in Angola
Fortes-Gabriel, Elsa; Carreira, Teresa; Vieira, Maria Luísa
2016-01-01
Rodents play an important role in the transmission of pathogenic Leptospira spp. However, in Angola, neither the natural reservoirs of these spirochetes nor leptospirosis diagnosis has been considered. Regarding this gap, we captured rodents in Luanda and Huambo provinces to identify circulating Leptospira spp. Rodent kidney tissue was cultured and DNA amplified and sequenced. Culture isolates were evaluated for pathogenic status and typing with rabbit antisera; polymerase chain reaction (PCR) and sequencing were also performed. A total of 37 rodents were captured: Rattus rattus (15, 40.5%), Rattus norvegicus (9, 24.3%), and Mus musculus (13, 35.2%). Leptospiral DNA was amplified in eight (21.6%) kidney samples. From the cultures, we obtained four (10.8%) Leptospira isolates belonging to the Icterohaemorrhagiae and Ballum serogroups of Leptospira interrogans and Leptospira borgpetersenii genospecies, respectively. This study provides information about circulating leptospires spread by rats and mice in Angola. PMID:26928840
Lifescience Database Archive (English)
Full Text Available C and casein kinase substrate in neurons protein 1 OS=Mus musculus GN=Pacsin1 PE...se substrate in neurons protein 1 OS=Rattus norvegicus GN=Pacsin1 PE=1 SV=1 Length = 441 Score = 32.3 bits (...e in neurons protein 1 OS=Pongo abelii GN=Pacsin1 PE=2 SV=1 Length = 444 Score = 32.0 bits (71), Expect = 2.
High diversity of picornaviruses in rats from different continents revealed by deep sequencing.
Hansen, Thomas Arn; Mollerup, Sarah; Nguyen, Nam-Phuong; White, Nicole E; Coghlan, Megan; Alquezar-Planas, David E; Joshi, Tejal; Jensen, Randi Holm; Fridholm, Helena; Kjartansdóttir, Kristín Rós; Mourier, Tobias; Warnow, Tandy; Belsham, Graham J; Bunce, Michael; Willerslev, Eske; Nielsen, Lars Peter; Vinner, Lasse; Hansen, Anders Johannes
2016-08-17
Outbreaks of zoonotic diseases in humans and livestock are not uncommon, and an important component in containment of such emerging viral diseases is rapid and reliable diagnostics. Such methods are often PCR-based and hence require the availability of sequence data from the pathogen. Rattus norvegicus (R. norvegicus) is a known reservoir for important zoonotic pathogens. Transmission may be direct via contact with the animal, for example, through exposure to its faecal matter, or indirectly mediated by arthropod vectors. Here we investigated the viral content in rat faecal matter (n=29) collected from two continents by analyzing 2.2 billion next-generation sequencing reads derived from both DNA and RNA. Among other virus families, we found sequences from members of the Picornaviridae to be abundant in the microbiome of all the samples. Here we describe the diversity of the picornavirus-like contigs including near-full-length genomes closely related to the Boone cardiovirus and Theiler's encephalomyelitis virus. From this study, we conclude that picornaviruses within R. norvegicus are more diverse than previously recognized. The virome of R. norvegicus should be investigated further to assess the full potential for zoonotic virus transmission.
2014-03-21
strength, and stereotypes or changes in behavior (e.g., self- mutilation). Pregnant females approaching gestation day 21 were observed more frequently...and stereotypes or abnormal behavior (e.g., self mutilation , walking backwards). All data related to the observation of rats will be detailed and...are the recommended species due to an historical and extensive database. V.3.3. Laboratory animals V.3.3.1. Genus and Species: Rattus norvegicus V
Pengaruh Waktu Fermentasi Teh Kombucha Kadar 50% terhadap Glukosa Darah Tikus Putih
TANA, SILVANA; ISDADIYANTO, SRI
2016-01-01
Penelitian ini bertujuan untuk mengetahui pengaruh pemberian teh kombucha kadar 50% terhadap kondisi glukosa darah dengan variasi waktu fermentasi. Teh kombucha termasuk pangan fungsional karena memiliki karakteristik sensori seperti penampakan, warna, tekstur, atau konsistensi dan citarasa yang dapat diterima oleh konsumen. Hewan uji yang dipakai adalah tikus putih (Rattus norvegicus)jantan sebanyak 16 ekor umur 2 bulan, dengan perlakuan teh kombucha yang difermentasi selama 6, 9 dan 12 ha...
First Isolates of Leptospira spp., from Rodents Captured in Angola.
Fortes-Gabriel, Elsa; Carreira, Teresa; Vieira, Maria Luísa
2016-05-04
Rodents play an important role in the transmission of pathogenic Leptospira spp. However, in Angola, neither the natural reservoirs of these spirochetes nor leptospirosis diagnosis has been considered. Regarding this gap, we captured rodents in Luanda and Huambo provinces to identify circulating Leptospira spp. Rodent kidney tissue was cultured and DNA amplified and sequenced. Culture isolates were evaluated for pathogenic status and typing with rabbit antisera; polymerase chain reaction (PCR) and sequencing were also performed. A total of 37 rodents were captured: Rattus rattus (15, 40.5%), Rattus norvegicus (9, 24.3%), and Mus musculus (13, 35.2%). Leptospiral DNA was amplified in eight (21.6%) kidney samples. From the cultures, we obtained four (10.8%) Leptospira isolates belonging to the Icterohaemorrhagiae and Ballum serogroups of Leptospira interrogans and Leptospira borgpetersenii genospecies, respectively. This study provides information about circulating leptospires spread by rats and mice in Angola. © The American Society of Tropical Medicine and Hygiene.
Directory of Open Access Journals (Sweden)
Dian Perwitasari
2014-08-01
Full Text Available AbstrakLatar belakang: Hantavirus hidup dan berkembang biak di tubuh hewan pengerat, salah satunya Rattus norvegicus yang banyak ditemukan di daerah kepulauan di Indonesia. Hantavirus spesies Seoul virus (SEOV adalah virus RNA negatif rantai tunggal yang termasuk dalam keluarga Bunyaviridae, mempunyai beberapa gen spesifik terutama gen S yang dapat dikembangkan untuk uji diagnostik. Tujuan penelitian ini ialah untuk mengetahui karakter dari gen S dari Hantavirus spesies Seoulvirus.Metode:Pada penelitian ini dilakukan sekuensing gen S yang berasal dari jaringan paru-paru rodensia. Fragmen DNA yang disekuensing menggunakan primer DNA SEOS-28F danSEOS -360R,VNS-1501F dan VNS-CSR. Hasil sekuensing dianalisis menggunakan program seqscapedan dianalisis menggunakan program Bioedit dan Mega5. Analisis filogenetik untuk homologi nukleotida dan asam amino dari ketiga strain Kepulauan Seribu tersebut dibandingkan dengan spesies hantavirus lainnya yang diambil dari genebank. Hasil:Analisis Homologi nukleotida dan asam amino antara strain Kepulauan Seribu dengan SEOV menunjukkan homologi nukleotida tertinggi pada strain KS74 (88,4% dan terendah pada KS90 (87,2%, sedangkan homologi asam amino tertinggi adalah strain KS74 (91.3% dan terendah pada strain KS90 (89,5%. Kesimpulan:Karakter gen S virus yang ditemukan di Kepulauan Seribu sebanding dengan virus SEOV yang ditemukan di Singapura dan Korea. (Health Science Indones 2014;1:1-6Kata kunci:Seoul virus, gen S, Kepulauan Seribu, IndonesiaAbstractBackground: Hantavirus lives and reproduces in the body of rodents. Rattus norvegicuswas one found in the Kepulauan Seribu islands of Indonesia. Hantavirus species Seoul virus (SEOV is a negative single chain RNA viruses included in the family Bunyaviridae. It has a few specific genes, especially genes S that can be developed for a diagnostic test. The aim of this study was to ascertain the character of gene S of hantavirus species Seoul virus. Methods: Gene
Adhesion of streptococcus rattus and streptococcus mutans to metal surfaces
International Nuclear Information System (INIS)
Branting, C.; Linder, L.E.; Sund, M.-L.; Oden, A.; Wiatr-Adamczak, E.
1988-01-01
The adhesion of Streptococcus rattus BHT and Streptococcus mutans IB to metal specimens of amalgam, silver, tin and copper was studied using (6- 3 H) thymidine labeled cells. In the standard assay the metal specimens were suspended by a nylon thread in an adhesion solution containing a chemically defined bacterial growth medium (FMC), sucrose, and radiolabeled bacteria. Maximum amounts of adhering bacteria were obtained after about 100 min of incubation. Saturation of the metal specimens with bacteria was not observed. Both strains also adhered in the absence of sucrose, indicating that glucan formation was not necessary for adhesion. However, in the presence of glucose, adhesion was only 26-45% of that observed in the presence of equimolar sucrose. Sucrose-dependent stimulation of adhesion seemed to be due to increased cell-to-cell adhesion capacity. Isolated radiolabeled water-insoluble and water-soluble polysaccharides produced from sucrose by S. rattus BHT were not adsorbed to the metal surfaces. (author)
Adhesion of streptococcus rattus and streptococcus mutans to metal surfaces
Energy Technology Data Exchange (ETDEWEB)
Branting, C.; Linder, L.E.; Sund, M.-L.; Oden, A.; Wiatr-Adamczak, E.
1988-01-01
The adhesion of Streptococcus rattus BHT and Streptococcus mutans IB to metal specimens of amalgam, silver, tin and copper was studied using (6-/sup 3/H) thymidine labeled cells. In the standard assay the metal specimens were suspended by a nylon thread in an adhesion solution containing a chemically defined bacterial growth medium (FMC), sucrose, and radiolabeled bacteria. Maximum amounts of adhering bacteria were obtained after about 100 min of incubation. Saturation of the metal specimens with bacteria was not observed. Both strains also adhered in the absence of sucrose, indicating that glucan formation was not necessary for adhesion. However, in the presence of glucose, adhesion was only 26-45% of that observed in the presence of equimolar sucrose. Sucrose-dependent stimulation of adhesion seemed to be due to increased cell-to-cell adhesion capacity. Isolated radiolabeled water-insoluble and water-soluble polysaccharides produced from sucrose by S. rattus BHT were not adsorbed to the metal surfaces.
Genotoxic effects in wild rodents (Rattus rattus and Mus musculus) in an open coal mining area.
León, Grethel; Pérez, Lyda Espitia; Linares, Juan Carlos; Hartmann, Andreas; Quintana, Milton
2007-06-15
Coal is a mixture of a variety of compounds containing mutagenic and carcinogenic polycyclic aromatic hydrocarbons. Exposure to coal is considered as an important non-cellular and cellular source of reactive oxygen species that can induce DNA damage. In addition, spontaneous combustion can occur in coal mining areas, further releasing compounds with detrimental effects on the environment. In this study the comet assay was used to investigate potential genotoxic effects of coal mining activities in peripheral blood cells of the wild rodents Rattus rattus and Mus musculus. The study was conducted in a coal mining area of the Municipio de Puerto Libertador, South West of the Departamento de Cordoba, Colombia. Animals from two areas in the coal mining zone and a control area located in the Municipio de Lorica were investigated. The results showed evidence that exposure to coal results in elevated primary DNA lesions in blood cells of rodents. Three different parameters for DNA damage were assessed, namely, DNA damage index, migration length and percentage damaged cells. All parameters showed statistically significantly higher values in mice and rats from the coal mining area in comparison to the animals from the control area. The parameter "DNA Damage Index" was found to be most sensitive and to best indicate a genotoxic hazard. Both species investigated were shown to be sensitive indicators of environmental genotoxicity caused by coal mining activities. In summary, our study constitutes the first investigation of potential genotoxic effects of open coal mining carried out in Puerto Libertador. The investigations provide a guide for measures to evaluate genotoxic hazards, thereby contributing to the development of appropriate measures and regulations for more careful operations during coal mining.
Manganese induced immune suppression of the lobster, Nephrops norvegicus
International Nuclear Information System (INIS)
Hernroth, Bodil; Baden, Susanne P.; Holm, Kristina; Andre, Tove; Soederhaell, Irene
2004-01-01
Manganese (Mn) is one of the most abundant elements on earth, particularly in the soft bottom sediments of the oceans. As a micronutrient Mn is essential in the metabolic processes of organisms. However, at high concentrations the metal becomes a neurotoxin with well-documented effects. As a consequence of euthrophication, manganese is released from bottom sediments of coastal areas and the Norway lobsters, Nephrops norvegicus, can experience high levels of bioavailable Mn 2+ . Here, we present the first report showing that Mn also affects several fundamental processes in the mobilisation and activation of immunoactive haemocytes. When N. norvegicus was exposed to a realistic [Mn 2+ ] of 20 mg l -1 for 10 days 24.1 μg ml -1 was recorded in the haemolymph. At this concentration the total haemocyte count was reduced by ca. 60%. By using BrdU as a tracer for cell division, it was shown that the proliferation rate in the haematopoietic tissue did not increase, despite the haemocytepenia. A gene coding for a Runt-domain protein, known to be involved in maturation of immune active haemocytes in a variety of organisms, was identified also in haemocytes of N. norvegicus. The expression of this gene was >40% lower in the Mn-exposed lobsters as judged by using a cDNA probe and the in situ hybridisation technique. In response to non-self molecules, like lipopolysaccharide (LPS), the granular haemocytes of arthropods are known to degranulate and thereby release and activate the prophenoloxidase system, necessary for their immune defence. A degranulation assay, tested on isolated granular haemocytes, showed about 75% lower activity in the Mn-exposed lobsters than that for the unexposed. Furthermore, using an enzymatic assay, the activation per se of prophenoloxidase by LPS was found blocked in the Mn-exposed lobsters. Taken together, these results show that Mn exposure suppressed fundamental immune mechanisms of Norway lobsters. This identifies a potential harm that also
Manganese induced immune suppression of the lobster, Nephrops norvegicus
Energy Technology Data Exchange (ETDEWEB)
Hernroth, Bodil [Department of Marine Ecology, Goeteborg University, Kristineberg Marine Research Station, SE-450 34 Fiskebaeckskil (Sweden)]. E-mail: bodil.hernroth@kmf.gu.se; Baden, Susanne P. [Department of Marine Ecology, Goeteborg University, Kristineberg Marine Research Station, SE-450 34 Fiskebaeckskil (Sweden); Holm, Kristina [Department of Marine Ecology, Goeteborg University, Kristineberg Marine Research Station, SE-450 34 Fiskebaeckskil (Sweden); Andre, Tove [Department of Comparative Physiology, Evolutionary Biology Centre, Uppsala University, Norbyvaegen 18A, SE-752 36 Uppsala (Sweden); Soederhaell, Irene [Department of Comparative Physiology, Evolutionary Biology Centre, Uppsala University, Norbyvaegen 18A, SE-752 36 Uppsala (Sweden)
2004-12-10
Manganese (Mn) is one of the most abundant elements on earth, particularly in the soft bottom sediments of the oceans. As a micronutrient Mn is essential in the metabolic processes of organisms. However, at high concentrations the metal becomes a neurotoxin with well-documented effects. As a consequence of euthrophication, manganese is released from bottom sediments of coastal areas and the Norway lobsters, Nephrops norvegicus, can experience high levels of bioavailable Mn{sup 2+}. Here, we present the first report showing that Mn also affects several fundamental processes in the mobilisation and activation of immunoactive haemocytes. When N. norvegicus was exposed to a realistic [Mn{sup 2+}] of 20 mg l{sup -1} for 10 days 24.1 {mu}g ml{sup -1} was recorded in the haemolymph. At this concentration the total haemocyte count was reduced by ca. 60%. By using BrdU as a tracer for cell division, it was shown that the proliferation rate in the haematopoietic tissue did not increase, despite the haemocytepenia. A gene coding for a Runt-domain protein, known to be involved in maturation of immune active haemocytes in a variety of organisms, was identified also in haemocytes of N. norvegicus. The expression of this gene was >40% lower in the Mn-exposed lobsters as judged by using a cDNA probe and the in situ hybridisation technique. In response to non-self molecules, like lipopolysaccharide (LPS), the granular haemocytes of arthropods are known to degranulate and thereby release and activate the prophenoloxidase system, necessary for their immune defence. A degranulation assay, tested on isolated granular haemocytes, showed about 75% lower activity in the Mn-exposed lobsters than that for the unexposed. Furthermore, using an enzymatic assay, the activation per se of prophenoloxidase by LPS was found blocked in the Mn-exposed lobsters. Taken together, these results show that Mn exposure suppressed fundamental immune mechanisms of Norway lobsters. This identifies a potential
International Nuclear Information System (INIS)
Holdaway, R.N.; Anderson, A.J.
1998-01-01
The Pacific rat (Rattus exulans) was transported throughout the western Pacific by migrant peoples in prehistory. Meredith et al (1985) reported a minimum date for the presence of Rattus exulans on Norfolk Island using dates on charcoal from an apparently enclosing layer (the upper part of their Unit C4) in Cemetery Bay. 8 refs., 3 tabs
Changes in weight and body fat after use of tetracycline and Lactobacillus gasseri in rats
Jorge José Marciano; Fernando de Sá Del Fiol; Alessandra Cristina Marciano Tardelli Ferreira; Maria Cláudia Marques; Luciane Lopes Santana
2017-01-01
ABSTRACT Recent studies have shown a role of intestinal microbiota in obesity. The consumption of antibiotics in the last 70 years has led to changes in intestinal microbiota, which has led to weight gain and body fat accumulation. To evaluate the possibility of weight gain induced by antibiotics and the possible protective effect of probiotics, we divided 45 animals (Rattus norvegicus) into groups and administered the following treatments over two weeks: tetracycline, tetracycline + Lactobac...
Unigene BLAST: CBRC-RNOR-20-0133 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-20-0133 gnl|UG|Rn#S14181288 UI-R-DO1-cms-c-10-0-UI.s1 UI-R-DO1 Rattus nor...vegicus cDNA clone UI-R-DO1-cms-c-10-0-UI 3', mRNA sequence /clone=UI-R-DO1-cms-c-10-0-UI /clone_end=3' /gb=BQ202827 /gi=20419292 /ti=154455115 /ug=Rn.83937 /len=645 0.001 44% ...
Proteomic Analysis of Leptospira interrogans Shed in Urine of Chronically Infected Hosts▿
Monahan, Avril M.; Callanan, John J.; Nally, Jarlath E.
2008-01-01
Leptospirosis is a global zoonotic disease. The causative agent, pathogenic Leptospira species, survives in the renal tubules of chronically infected hosts, from where leptospires are shed via urine into the environment. Infection of new hosts can present as an array of acute and chronic disease processes reflecting variations in host-pathogen interactions. The present study was designed to reproduce the carrier phase of infection in Rattus norvegicus, thus facilitating shedding of leptospire...
Dicty_cDB: Contig-U05551-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 15167 ) Rattus norvegicus clone CH230-160B10, *** SEQUENC... 38 0.19 2 ( CX072891 ) UCRCS08_2G12_b Parent...63 ) UCRCS08_0004A10_f Parent Washington Navel Orange ... 34 3.5 2 ( EY735173 ) CS00-C3-704-102-D02-CT.F Swe...CX672846 ) UCRCS10_19F11_b Madame Vinous Sweet Orange Multip... 34 3.4 2 ( CV7142
Al Ayoubi, Alfian Salahudin; Dhanardhono, Tuntas; Bhima, Sigit Kirana Lintang
2016-01-01
Background : Brodifacoum is an anticoagulant substance which usually used as pest control, but this substance has a poisoning effect the body. Brodifacoum is absorbed through gastrointestinal tract which can cause the disorder of blod clotting by slowing down the process of epoxide reductase of vitamin-K.Aim : To know the comparison of Histopathology Rattus norvegicus Intestine against brodifacoum administration LD50 and LD100.Methods :This study was an experimental study with post test only ...
Basic Microsurgery Training Using the Laboratory Rat (Rattus norvegicus)
2018-03-01
there been any personnel/staffing changes (PI/CI/ AI /TC/Instructor) since the last IACUC approval of protocol, or annual review? ___ Yes _X_ No If yes...Include Name, Protocol function - PI/CI/ AI /TC/Instructor, IACUC approval - Yes/No) DELETIONS: (Include Name, Protocol function - PI/CI/ AI /TC
Phylogeography of Rattus norvegicus in the South Atlantic Ocean
Directory of Open Access Journals (Sweden)
Melanie Hingston
2016-12-01
Full Text Available Norway rats are a globally distributed invasive species, which have colonized many islands around the world, including in the South Atlantic Ocean. We investigated the phylogeography of Norway rats across the South Atlantic Ocean and bordering continental countries. We identified haplotypes from 517 bp of the hypervariable region I of the mitochondrial D-loop and constructed a Bayesian consensus tree and median-joining network incorporating all other publicly available haplotypes via an alignment of 364 bp. Three Norway rat haplotypes are present across the islands of the South Atlantic Ocean, including multiple haplotypes separated by geographic barriers within island groups. All three haplotypes have been previously recorded from European countries. Our results support the hypothesis of rapid Norway rat colonization of South Atlantic Ocean islands by sea-faring European nations from multiple European ports of origin. This seems to have been the predominant pathway for repeated Norway rat invasions of islands, even within the same archipelago, rather than within-island dispersal across geographic barriers.
Characterizing a Rat Brca2 Knockout Model
2007-05-01
Brca2 was tested in various tumor inducing experimental settings [49,52] * activated form Hs = Homo sapiens ; Rn = Rattus norvegicus; MMTV...sequencing gDNA from a wild-type 2 SD rat over a region of intron 21 that contains the splicing branch site 2 (underlined). ( el The same sequence from the...from the El pups at 1 week of age for macromolecule isolation. We also visually checked all Fk pups for gross abnormalities in physi- cal
Identification of Potential Therapeutic Mechanisms for HIP1 Inhibition in Breast Cancer
2007-05-01
HIP1 siRNA. The data represent experimental triplicates normalized to actin lev- els from cells treated with a scrambled control siRNA and the error...NP_003950), Sp putative clathrin coat assembly protein (NP_596345), ScSla2p (NP_014156), Xl Hip1-prov protein (AAH77182), and RnAP180 (CAA48748). Hs, Homo ... sapiens ; Sc, Saccharomyces cerevisiae; Sp, Schizosaccharomyces pombe; Xl, Xenopus laevis; Rn, Rattus norvegicus. An I/LWEQ module sequence alignment
Dicty_cDB: Contig-U12422-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 3 ( EL513628 ) CHUY396.b1_G03.ab1 CHU(XYZ) puzzle sunflower Heli... 42 1e-06 4 (... EL513966 ) CHUY737.b1_B18.ab1 CHU(XYZ) puzzle sunflower Heli... 42 1e-06 4 ( DH772441 ) Rattus norvegicus D...03, 5' ... 48 1e-05 3 ( EL513533 ) CHUX637.b1_I16.ab1 CHU(XYZ) puzzle sunflower Heli... 42 1e-05 3 ( AC10558
Lifescience Database Archive (English)
Full Text Available mal sarcosine oxidase; S... 48 1e-04 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 4...8 1e-04 BC088249_1( BC088249 |pid:none) Rattus norvegicus pipecolic acid o... 48 2e-04 AY892312_1( AY892312 ...id:none) Pongo abelii mRNA; cDNA DKFZp469L1... 48 2e-04 BC027622_1( BC027622 |pid:none) Homo sapiens pipecoli
Kataranovski, M; Mirkov, I; Belij, S; Popov, A; Petrovic, Z; Gaci, Z; Kataranovski, D
2011-05-01
Gastrointestinal helminths of Norway rat (Rattus norvegicus) from the Belgrade area were studied as a part of a wider ecological research of rats in Serbia (data on the distribution, population ecology, economic and epizoothiological-epidemiological importance, and density control). Rats were captured from May 2005 to July 2009 at both urban and suburban-rural sites. Of a total of 302 trapped rats 48% were males and 52% females, with 36.5% and 38.8% of juvenile-subadult individuals, per sex respectively. Intestinal helminth infection was noted in 68.5% of rats, with a higher prevalence in male hosts and in adult individuals. Higher numbers of infected juveniles-subadults were noted in suburban-rural habitats, while an opposite tendency was noted in adult rats. Seven helminth species were recovered, of which five were nematode (Heterakis spumosa, Nippostrongylus brasiliensis, Capillaria sp., Trichuris muns and Syphacia muris) and two cestode species (Hymenolepis diminuta and Rodentolepis fraterna). The most prevalent parasites were Heterakis spumosa (36.7%) and Hymenolepis diminuta (30.5 %). Sex and habitat-related differences were noted in the prevalence of infection with Capillaria sp. and Trichuris muris, while there were no age-related differences in the prevalence of infection with any individual helminth species. Significantly higher prevalence of infection was noted in summer as compared to spring or winter, with a tendency to be higher in autumn as compared to spring. The only significant difference in the prevalence of infection between habitat-related was noted during spring. H. spumosa was most prevalent in summer, while H. diminuta and N. brasiliensis in autumn. The mean intensity of infection with H. spumosa, R. fraterna, S. muris and T muris was higher in autumn than in the other seasons, while N. brasiliensis and Capillaria sp. occured in winter. No more than four helminth species were found in one host.
Mente, Elena
2010-09-01
Successful commercial aquaculture of crustacean species is dependent on satisfying their nutritional requirements and on producing rapidly growing and healthy animals. The results of the present study provide valuable information for feeding habits and growth of Nephrops norvegicus L., 1758) under laboratory conditions. The aim of the present study was to examine food consumption, growth and physiology of the Norway lobster N. norvegicus under laboratory conditions. N. norvegicus (15 g wet weight) were distributed into 1001 tanks consisting of five numbered compartments each. They were fed the experimental diets (frozen mussels and pellets) for a period of 6 months. A group of starved Nephrops was stocked and fasted for 8 months. Although Nephrops grew well when fed the frozen mussels diet, feeding on a dry pellet feed was unsatisfactory. The starvation group, despite the fact that showed the highest mortality (50%), exhibited a remarkable tolerance to the lack of food supply. The study offers further insight by correlating the amino acid profiles of Nephrops tail muscle with the two diets. The deviations from the mussel's diet for asparagine, alanine and glutamic acid suggest a deficiency of these amino acids in this diet. The results of the present study showed that the concentrations of free amino acids are lower in relative amount than those of protein-bound amino acids, except for arginine, proline and glycine. The present study contributes to the improvement of our knowledge on nutritional requirements of the above species. © 2010 ISZS, Blackwell Publishing and IOZ/CAS.
DEFF Research Database (Denmark)
Feekings, Jordan P.; Christensen, Asbjørn; Jonsson, Patrik
2015-01-01
Research into the influence of environmental variables on the behaviour of Norway lobster (Nephrops norvegicus), and hence catch rates, dates back to the 1960s (e.g., Höglund and Dybern, Diurnal and seasonal variations in the catch‐composition of Nephrops norvegicus (L.) at the Swedish west coast...... on commercial trawl catches of Nephrops norvegicus (L.). ICES J. Mar. Sci. 58:1318). Here, we aimed to dissociate environmental variability in Norway lobster catches to improve resource exploitation efficiency within the Skagerrak and Kattegat trawl fisheries by utilising data collected as part of an extensive...
Directory of Open Access Journals (Sweden)
Herlina Pratiwi
2017-02-01
Full Text Available This study was conducted to determine levels of LDL and liver damage in rats (Rattus norvegicus models of type 1 diabetes mellitus inducted by streptozotocin (STZ with etanol extract of turmeric (Curcuma Longa L therapy. Animals used rat (Rattus norvegicus 3-month-old males who were divided into 5 groups, each group consisting of four mice. The group was divided according to treatment: negative control (not induced by STZ, the positive control group (STZ induced, groups of rats DM 1 with etanol turmeric extract therapy a dose of 1.2 g / kg, groups of rats DM 1 with etanol turmeric extract therapy a dose of 1.8 g / kg, and groups of rats DM 1 with etanol turmeric extract therapy a dose of 2.7 g / kg. LDL levels measured by direct method and the severity of liver damage was observed through histopatology picture. The results showed that the etanol extract of turmeric dose of 2.7 g / kg in a rats model of type 1 diabetes mellitus can lower LDL levels up to 59.55%, and reduced the severity of fatty liver with reduced fat vacuoles. The conclusion from this study that the etanol extract of turmeric contains antioxidants that can lower LDL levels and reduced the severity of fatty liver in type 1 diabetes mellitus.
Suspension feeding in adult Nephrops norvegicus (L.) and Homarus gammarus (L.) (decapoda)
Loo, Lars-Ove; Pihl Baden, Susanne; Ulmestrand, Mats
Suspension feeding in adults of the Norway lobster Nephrops norvegicus (40-74 g) and the European lobster Homarus gammarus (280-350 g) was tested in experiments offering planktonic food items of different sizes from 200 to 600 μm and measuring the clearing capacity. Both lobster species were found to effectively clear water of food particles comprising nauplii of the brine shrimp Artemia salina of about 600 μm in size. These were reduced to 50% of the initial concentration within 5 h and to 90% within 12 h. When N. norvegicus was offered food particles averaging 200 μm, a significant reduction in average size occurred, indicating that the minimum retention size is around 200 μm. Fluorescently dyed Artemia salina were recovered in the stomach and intestine of lobsters proving that the filtered particles are passed to the digestive tract. Results from other experiments, using the blood pigment (haemocyanin) concentration as an index of nutritional state, indicated that the lobsters can get some nutritional advantage from suspension feeding. Suspension feeding in larger decapods has not been described previously, so the significance of this finding is discussed with respect to changes in behavioural and ecological role.
Renardi P., Ricky; Dhanardhono, Tuntas; Bhima, Sigit Kirana Lintang
2015-01-01
Background : Brodifakum is a substance that often used as rat poison and disrupt the process of blood coagulation.As a result of this disorder can cause bleeding in vital organs of rat. This study was conducted to assess the gastric anatomic pathology due to Brodifakum. Aim : To know the comparison of Anatomical Pathology Rattus norvegicus Gastric againstbrodifacoum administration LD50 and LD100.Methods :This study was an experimental study with post test only group design. The sample of this...
Directory of Open Access Journals (Sweden)
Prem Nidhi Sharma
2015-12-01
Full Text Available Three different plant products diets – i neem (Azadirachta indic A. Juss oil mixed diet (neem oil mixed @ 80 ml/kg of normal diet, ii neem seed powder mixed diet (neem seed powder mixed @ 80 g/kg of normal diet and iii custard apple (Annona reticulata L. seed powder mixed diet (custard apple seed powder mixed @ 80 g/kg of normal diet were separately fed to mature rats (Rattus rattus with single dose feeding of 80 g per pair in a day on 13th week-age during the experimenting years, 2012/013 and 2013/014. In control group only normal diet without neem and custard apple constituents were fed. Sterility test of rat was conducted up to 38 and 28 weeks-age in first and second year, respectively. The test rats were fed normal diet during whole experimenting periods except the one day when they were fed only the neem or custard apple mixed diet on the age of 13th week. Efficacy of the mixed diets on rat-sterility was determined based on pregnancy and parturition by the rats. The two years' results confirmed that all the tested three mixed diets – neem oil mixed diet, neem seed powder mixed diet, and custard apple seed powder mixed diet were effective to stop pregnancy and parturition in rats during whole experimenting periods up to 38 and 28 weeks-age with single dose feeding of 80 g per pair (40 gm/rat in a day on 13th week-age of the rats; whereas the pregnancy and parturition were observed in the rats that were fed only the normal diet. It is expected, neem and custard apple mixed diets can be utilized in reducing the economically important rodent populations in rice-wheat cropping system in future.
Directory of Open Access Journals (Sweden)
Toril Loennechen Moen
2006-12-01
Full Text Available In 1768 J.E. Gunnerus first described the species Hydroides norvegicus (Polychaeta, Serpulidae, the type of the genus Hydroides which today includes close to 90 species worldwide and is the largest serpulid genus. This description has therefore great value as a type description, but as it is written in an old-fashioned Danish/Norwegian language with a font which is hard to interpret, the description is rather inaccessible to most polychaetologists. This paper presents a translation of Gunnerus’ description of H. norvegicus and a brief review of the present day status of the species. Comments on Gunnerus’ description of Serpula triqvetra are also included, as well as references to his correspondence with Swedish naturalist Carolus Linnæus regarding the species in question.
Tatard, C; Garba, M; Gauthier, P; Hima, K; Artige, E; Dossou, D K H J; Gagaré, S; Genson, G; Truc, P; Dobigny, G
2017-07-01
Although they are known to sometimes infect humans, atypical trypanosomes are very poorly documented, especially in Africa where one lethal case has yet been described. Here we conducted a survey of rodent-borne Trypanosoma in 19 towns and villages of Niger and Nigeria, with a special emphasis on Niamey, the capital city of Niger. The 1298 rodents that were captured yielded 189 qPCR-positive animals from 14 localities, thus corresponding to a 14.6% overall prevalence. Rats, especially black rats, displayed particularly elevated prevalence (27.4%), with some well sampled sites showing 40-50% and up to 68.8% of Trypanosoma-carrying individuals. Rattus were also characterized by significantly lower Ct values than in the other non-Rattus species. DNA sequences could be obtained for 43 rodent-borne Trypanosoma and corresponded to 41 T. lewisi (all from Rattus) and 2 T. microti (from Cricetomys gambianus). These results, together with data compiled from the available literature, suggest that Rattus may play a particular role for the maintaining and circulation of Trypanosoma, especially T. lewisi, in Africa. Taken into account its strong abilities to invade coastal and inland regions of the continent, we believe that this genus deserves a particular attention in regards to potentially under-looked but emerging atypical trypanosome-related diseases. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Pranab Jyoti-Bhuyan
2015-10-01
Full Text Available Background: Tropical rat mite (Ornithonyssus bacoti is reported from many parts of the world and is considered important in transmitting rickettsial pathogens. There have been scanty reports on prevalence of this parasite from India. Following a recent report of O. bacoti infestation in a laboratory mice colony from Nilgiris, Tamil Nadu, India, attempts were made to detect the parasite in its natural reservoir, ie the domestic and peridomestic rats (Rattus rattus.Methods: The National Centre for Disease Control, Coonoor is involved in screening plague in domestic and peridomestic rats in Nilgiris and erstwhile plague endemic areas of Southern India. The parasite samples were identified based on the morphological characteristics attributable to O. bacoti and as per description of published literature.Results: Seven mite samples identified as O. bacoti based on morphological characteristics were isolated incidentally from domestic and peridomestic rodents in and around the hilly districts of Nilgiris, Southern India, during the routine plague surveillance programme. The identification was based on the morphological characteristics attributable to O. bacoti observed under a low power microscope.Conclusion: In India, this is probably the first record of isolation of O. bacoti from domestic and peridomestic rodents. Prevalence of such parasite in domestic and peridomestic rats necessitates further investigation on monitoring and surveillance of rickettsial diseases in the locality, as these parasites are considered to be potential vector of transmitting rickettsial pathogens
Database Description - FANTOM5 | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available List Contact us FANTOM5 Database Description General information of database Database name FANTOM5 Alternati...me: Rattus norvegicus Taxonomy ID: 10116 Taxonomy Name: Macaca mulatta Taxonomy ID: 9544 Database descriptio...l Links: Original website information Database maintenance site RIKEN Center for Life Science Technologies, ...ilable Web services Not available URL of Web services - Need for user registration Not available About This Database Database... Description Download License Update History of This Database Site Policy | Contact Us Database Description - FANTOM5 | LSDB Archive ...
Hassina Khaldoun Oularbi
2014-01-01
Lambda-cyhalothrin (LCT) is a type II pyrethroid insecticide widely used in pest management. This study was undertaken to evaluate the toxic effects of LCT on the kidneys and adrenal glands of rats after subacute exposure. Twenty-eight 6-week-old male albino Rattus norvegicus rats were randomly assigned to four groups. Group 1 was the control group, which received distilled water. The experimental groups 2, 3 and 4 received 20.4, 30.6 and 61.2 mg/kg body weight, respectively, of LCT, administ...
Enzyme markers in inbred rat strains: genetics of new markers and strain profiles.
Adams, M; Baverstock, P R; Watts, C H; Gutman, G A
1984-08-01
Twenty-six inbred strains of the laboratory rat (Rattus norvegicus) were examined for electrophoretic variation at an estimated 97 genetic loci. In addition to previously documented markers, variation was observed for the enzymes aconitase, aldehyde dehydrogenase, and alkaline phosphatase. The genetic basis of these markers (Acon-1, Ahd-2, and Akp-1) was confirmed. Linkage analysis between 35 pairwise comparisons revealed that the markers Fh-1 and Pep-3 are linked. The strain profiles of the 25 inbred strains at 11 electrophoretic markers are given.
STUDIES ON INDUCED HEPATOTOXICITY IN MALE ALBINO RATS (RATTUS NORVEGICUS)
International Nuclear Information System (INIS)
ABULYAZID, I.; ABBAS, O.A.; FAYEZ, V.
2008-01-01
Levanox, a hepato protective drug, and garlic powder have been considered as safe anti-oxidant agents. The present investigation refers to biochemical and molecular studies to evaluate the protective role of levanox and/or garlic powder toward CCl4-induced toxicity in adult male albino rats. CCl4 intoxication was attempted using a dose of 0.03 ml/kg of rat body weight.Pre-treatment with levanox (one capsule/ kg of rat body weight, each capsule contains 100 mg catechu, 7.5 mg dandelion, 75 mg termiric 2 % curcumin , 17.5 mg silymarin, 100 mg lecithin) was more effective than garlic powder (100mg/kg of rat body weight) in reducing CCl4-induced hepatotoxicity as revealed by its higher potency in reducing elevation of aspartate (AST) and alanine (ALT) aminotransferases in serum. Serum of control rats and those treated with levanox or garlic or CCl4 produced 13 types of proteins, differing in the molecular weight (MW) and densities, while those of levanox + garlic or garlic +CCl4 produced 14 bands differing in the MW and densities. The similarity index at the epigenetic level was also studied using the primers under study. The control sample produced one amplified DNA fragment with Rf of 0.73 and a molecular size (MS) of 67 base pair (bp) . Using the same primers, no amplified DNA fragment with the same MS was produced in the sample taken from levanox + garlic treated group.OPA-2 primer of sequence 5?- AGA TGC AGC C-3? produced one amplified DNA band with MS of 292 bp and Rf of 0.46 . However, the same primer produced one amplified DNA characteristic band with a molecular size of 363 bp and Rf of 0.43 in the sample of levanox + garlic group.In the control sample, OPA-4 primer of sequence 5? - ACG CAC AAC C-3? produced one amplified DNA band of MS of 299 bp and Rf of 0.43. The same primer produced one amplified characteristic DNA band with MS of 363 bp and Rf of 0.43 in the sample of levanox + garlic group.Dual treatment with levanox and garlic powder resulted in a characteristic protein differing from that of control as revealed through SDS-PAGE and confirmed by RAPD-PCR
Food Color Induced Hepatotoxicity in Swiss Albino Rats, Rattus norvegicus.
Saxena, Beenam; Sharma, Shiv
2015-01-01
Certain dietary constituents can induce toxicity and play a critical role in the development of several hepatic disorders. Tartrazine, metanil yellow and sunset yellow are widely used azo dyes in food products, so the present study is aimed to investigate the food color induced hepatotoxicity in Swiss albino rats. Swiss albino rats were divided into four groups, each group having six animals. Group I served as control, Group II, Group III and Group IV were administered with 25, 50 and 75 mg/kg body weight blend of sunset yellow, metanil yellow and tartrazine for 30 days. Hepatotoxicity in rats treated with a blend of these food colors was studied by assessing parameters such as serum total protein, serum albumin, serum alkaline phosphatase (ALP) as well as hepatic malondialdehyde (MDA). The activity of superoxide dismutase (SOD), reduced glutathione (GSH) and catalase (CAT) were assessed. Significantly increased concentrations of serum total protein, serum albumin, serum ALP and hepatic MDA and significantly lowered levels of SOD, reduced GSH and CAT in the liver tissue of treated animals were observed when compared with control animals. The alteration in the liver includes necrosis of hepatocytes, infiltration and vacuolation. The result indicates that consumption of food color in diet induces liver tissue damage. The used doses of food color were mostly attributable to hepatocellular damage and drastic alteration in antioxidant defense system.
Food Color Induced Hepatotoxicity in Swiss Albino Rats, Rattus norvegicus
Saxena, Beenam; Sharma, Shiv
2015-01-01
Objective: Certain dietary constituents can induce toxicity and play a critical role in the development of several hepatic disorders. Tartrazine, metanil yellow and sunset yellow are widely used azo dyes in food products, so the present study is aimed to investigate the food color induced hepatotoxicity in Swiss albino rats. Materials and Methods: Swiss albino rats were divided into four groups, each group having six animals. Group I served as control, Group II, Group III and Group IV were ad...
Food Color Induced Hepatotoxicity in Swiss Albino Rats, Rattus norvegicus
Saxena, Beenam; Sharma, Shiv
2015-01-01
Objective: Certain dietary constituents can induce toxicity and play a critical role in the development of several hepatic disorders. Tartrazine, metanil yellow and sunset yellow are widely used azo dyes in food products, so the present study is aimed to investigate the food color induced hepatotoxicity in Swiss albino rats. Materials and Methods: Swiss albino rats were divided into four groups, each group having six animals. Group I served as control, Group II, Group III and Group IV were administered with 25, 50 and 75 mg/kg body weight blend of sunset yellow, metanil yellow and tartrazine for 30 days. Hepatotoxicity in rats treated with a blend of these food colors was studied by assessing parameters such as serum total protein, serum albumin, serum alkaline phosphatase (ALP) as well as hepatic malondialdehyde (MDA). The activity of superoxide dismutase (SOD), reduced glutathione (GSH) and catalase (CAT) were assessed. Results: Significantly increased concentrations of serum total protein, serum albumin, serum ALP and hepatic MDA and significantly lowered levels of SOD, reduced GSH and CAT in the liver tissue of treated animals were observed when compared with control animals. The alteration in the liver includes necrosis of hepatocytes, infiltration and vacuolation. Conclusion: The result indicates that consumption of food color in diet induces liver tissue damage. The used doses of food color were mostly attributable to hepatocellular damage and drastic alteration in antioxidant defense system. PMID:26862277
Directory of Open Access Journals (Sweden)
DR. Scheibler
Full Text Available We inventoried terrestrial small mammals in an agricultural area in southern Brazil by using trapping and prey consumed by Barn Owls (Tyto alba and White-tailed Kites (Elanus leucurus. Small mammals were trapped in three habitat types: corn fields, uncultivated fields ("capoeiras", and native forest fragments. A total of 1,975 small mammal specimens were trapped, another 2,062 identified from the diet of Barn Owls, and 2,066 from the diet of White-tailed Kites. Both trapping and prey in the predators' diet yielded 18 small mammal species: three marsupials (Didelphis albiventris, Gracilinanus agilis, and Monodelphis dimidiata and 15 rodents (Akodon paranaensis, Bruceppatersonius iheringi, Calomys sp., Cavia aperea, Euryzygomatomys spinosus, Holochilus brasiliensis, Mus musculus, Necromys lasiurus, Nectomys squamipes, Oligoryzomys nigripes, Oryzomys angouya, Oxymycterus sp.1, Oxymycterus sp.2, Rattus norvegicus, and Rattus rattus (Linnaeus, 1758. The greatest richness was found in the uncultivated habitat. We concluded that the three methods studied for inventorying small mammals (prey in the diet of Barn Owls, White-tailed Kites, and trapping were complementary, since together, rather than separately, they produced a better picture of local richness.
McGregor, Anthony; Jones, Peter M; Good, Mark A; Pearce, John M
2006-07-01
Naive male Hooded Lister rats (Rattus norvegicus) were required to find a submerged platform in a right-angled corner between a long and a short wall of a pool in the shape of an irregular pentagon. Tests in a rectangular pool revealed a preference for the corners that corresponded with the correct corner in the pentagon. These findings indicate that rats identified the correct corner in the pentagon by local cues. They contradict the suggestion that rats navigate by moving in a particular direction relative to the principal axis of the shape of their environment.
DEFF Research Database (Denmark)
Zhang, X.; Yang, J.; Yu, J.
2002-01-01
Nucleoporin 155 (Nup155) is a major component of the nuclear pore complex (NPC) involved in cellular nucleo-cytoplasmic transport. We have acquired the complete sequence and interpreted the genomic organization of the Nup155 orthologos from human (Homo sapiens) and pufferfish (Fugu rubripes), which...... complementary to RNAs of the Nup155 orthologs from Fugu and mouse. Comparative analysis of the Nup155 orthologs in many species, including H. sapiens, Mus musculus, Rattus norvegicus, F. rubripes, Arabidopsis thaliana, Drosophila melanogaster, and Saccharomyces cerevisiae, has revealed two paralogs in S...
Verocytotoxin-producing Escherichia coli in wild birds and rodents in close proximity to farms
DEFF Research Database (Denmark)
Nielsen, Eva Møller; Skov, Marianne; Madsen, Jesper J.
2004-01-01
Wild animals living close to cattle and pig farms (four each) were examined for verocytotoxin-producing Escherichia coli (VTEC; also known as Shiga toxin-producing E. coli). The prevalence of VTEC among the 260 samples from wild animals was generally low. However, VTEC isolates from a starling...... (Sturnus vulgaris) and a Norway rat (Rattus norvegicus) were identical to cattle isolates from the corresponding farms with respect to serotype, virulence profile, and pulsed-field gel electrophoresis type. This study shows that wild birds and rodents may become infected from farm animals or vice versa...
Costa, Thiago Dias; Barros, Romariz da Silva; Galvão, Olavo de Faria; dos Reis, Maria de Jesus Dutra
2012-01-01
Estudos sobre a formação de classes de estímulos usualmente requerem o treino de discriminações de linha de base que incluem múltiplas discriminações simples e/ou condicionais inter-relacionadas. O objetivo do presente estudo foi replicar a fase de aquisição de discriminações de linha de base de um estudo anterior com ratos como sujeitos, com mudanças de procedimento objetivando tornar mais eficiente o treino de linha de base. Seis ratos albinos (Rattus norvegicus) foram submetidos a treino d...
Camila Belmonte Oliveira
2014-01-01
Este estudo teve como objetivo desenvolver e testar lipossomas de aceturato de diminazeno em testes in vitro e in vivo visando o controle de Trypanosoma evansi. O teste in vitro foi realizado em meio de cultura nas concentrações de 0,25, 0,5, 1, 2 e 3 μg/mL de aceturato de diminazeno convencional (C-DMZ) e lipossomal (L-DMZ). Para os testes in vivo foram utilizados 114 ratos (Rattus norvegicus) divididos em seis grupos (A, B, C, D, E e F) em dois experimentos, um para aval...
DEFF Research Database (Denmark)
Markussen, Mette Drude; Heiberg, Ann-Charlotte; Fredholm, Merete
2008-01-01
Anticoagulant resistance in Norway rats (Rattus norvegicus) has been suggested to be due to mutations in the VKORC1 gene, encoding the target protein of anticoagulant rodenticides such as warfarin and bromadiolone. Other factors, e.g. pharmacokinetics, may however also contribute to resistance. We...... that bromadiolone resistance in Norway rats involves enhanced anticoagulant clearance and metabolism catalyzed by specific cytochrome P450 enzymes, such as Cyp2e1, Cyp3a2 and Cyp3a3. This pharmacokinetically based resistance varies to some extend between the genders....
DEFF Research Database (Denmark)
Markussen, Mette Drude Kjær; Heiberg, Ann-Charlotte; Fredholm, Merete
2008-01-01
Background: Anticoagulant resistance in Norway rats, Rattus norvegicus (Berk.), has been suggested to be conferred by mutations in the VKORC1 gene, encoding the target protein of anticoagulant rodenticides. Other factors, e.g. pharmacokinetics, may also contribute to resistance, however. To examine......, Cyp3a2 and Cyp3a3 genes. On exposure to bromadiolone, females had higher Cyp2e1 expression than males, which possibly explains why female rats are generally more tolerant to anticoagulants than male rats. Conclusion: results suggest that bromadiolone resistance in a Danish strain of Norway rats...
Brouat, Carine; Rahelinirina, Soanandrasana; Loiseau, Anne; Rahalison, Lila; Rajerison, Minoariso; Laffly, Dominique; Handschumacher, Pascal; Duplantier, Jean-Marc
2013-01-01
Background Landscape may affect the distribution of infectious diseases by influencing the population density and dispersal of hosts and vectors. Plague (Yersinia pestis infection) is a highly virulent, re-emerging disease, the ecology of which has been scarcely studied in Africa. Human seroprevalence data for the major plague focus of Madagascar suggest that plague spreads heterogeneously across the landscape as a function of the relief. Plague is primarily a disease of rodents. We therefore investigated the relationship between disease distribution and the population genetic structure of the black rat, Rattus rattus, the main reservoir of plague in Madagascar. Methodology/Principal Findings We conducted a comparative study of plague seroprevalence and genetic structure (15 microsatellite markers) in rat populations from four geographic areas differing in topology, each covering about 150–200 km2 within the Madagascan plague focus. The seroprevalence levels in the rat populations mimicked those previously reported for humans. As expected, rat populations clearly displayed a more marked genetic structure with increasing relief. However, the relationship between seroprevalence data and genetic structure differs between areas, suggesting that plague distribution is not related everywhere to the effective dispersal of rats. Conclusions/Significance Genetic diversity estimates suggested that plague epizootics had only a weak impact on rat population sizes. In the highlands of Madagascar, plague dissemination cannot be accounted for solely by the effective dispersal of the reservoir. Human social activities may also be involved in spreading the disease in rat and human populations. PMID:23755317
DEFF Research Database (Denmark)
Feekings, Jordan P.; Berg, Casper Willestofte; Krag, Ludvig Ahm
2016-01-01
analyse catchrates of four target species, Norway lobster (Nephrops norvegicus), cod (Gadus morhua), plaice (Pleuronectesplatessa) and haddock (Melanogrammus aeglefinus), to try and understand how the use of multi-rig trawlshave altered catch rates within the Danish demersal trawl fishery over the last 16...
Directory of Open Access Journals (Sweden)
Yesy Febnica Dewi
2014-02-01
Full Text Available Penelitian ini bertujuan untuk mengetahui pengaruh ekstrak daun sirih merah (Piper crocatum terhadap penurunan kadar glukosa darah tikus putih jantan (Rattus novergicus yang diinduksi aloksan. Penelitian ini menggunakan 20 ekor tikus putih jantan (Rattus novergicus yang diadaptasi selama tiga minggu dan dibagi secara acak menjadi lima kelompok dan masing-masing kelompok berjumlah empat ekor. Rancangan yang digunakan adalah Rancangan Acak Lengkap (RAL. Ada lima perlakuan yang diberikan sebagai berikut: perlakuan I sebagai kontrol diabetes tanpa diberikan perlakuan, perlakuan II sebagai kontrol negatif (aloksan 120 mg/kg bb, perlakuan III aloksan + suspensi ekstrak daun sirih merah 2% (dosis 50 mg/kg bb, perlakuan IV aloksan + suspensi ekstrak daun sirih merah 2% (dosis 100 mg/kg bb, perlakuan V sebagai kontrol positif (Aloksan + Glibenklamid 1 ml/kg bb. Hasil penelitian menunjukkan bahwa ekstrak daun sirih merah (Piper crocatum 2% pada dosis 50 mg/kg bb, maupun dosis 100 mg/kg bb dapat menurunkan kadar glukosa darah tikus putih jantan (Rattus novergicus dan ekstrak daun sirih merah (Piper crocatum 2% memiliki efek yang sebanding dengan glibenklamid sebagai penurun glukosa darah.
Dutto, M; Di Domenico, D; Rubbiani, M
2018-01-01
Rodent control operations represent an important tool for the prevention and management of infestations, in outdoor environments, by synanthropic rodents (Rattus rattus and R. norvegicus), which are a source of economic and environmental damage with significant sanitary implications. Although the use of anticoagulants is safer to humans and pets compared to the use of acute poisoning substances, an intrinsic hazard of the active ingredients exists, i.e. the possible poisoning of non-target organisms (e.g., children, pets and wildlife) following exposure. The risks arising from the use of anticoagulants for rodent control operations in anthropic contexts can therefore only be mitigated by a proper selection of the active ingredient, bait formulation and administration techniques, since an active ingredient with selective action towards non-target species does not currently exist on the market. This document lists practical proposals aimed at reducing the possibility of toxic exposure to anticoagulant rodenticides and mitigate the toxicological risk of human baits and non-target species.
Directory of Open Access Journals (Sweden)
Maryani Cyccu Tobing, Ameilia Zuliyanti Siregar, Lisnawita, dan Meirani.
2011-11-01
Full Text Available The use of protozoan Sarcocystis singaporensis (Apicomplexa: Sarcocystidae for control rice field rat Rattus argentiventer. Rats are still a number-one-pest in field rice of various areas in Indonesia. Biological control using microparasite Sarcocystis singaporensis (Apicomplexa: Sarcocystidae is a highly host-specific protozoan for controlling the rats. The objective of this research was to study the use of protozoa parasite S. singaporensis against rodent pest Rattus argentiventer. The design of experiment was Factorial Randomized Complete Design with ten treatments and four replications. The first factor was sporocyt doses of S. singaporensis (control; 1 x 105; 2 x 105; 3 x 105; 4 x 105, while the second factor was rats sexual category (male and female. The results showed that dose of sporocysts S. singaporensis was significantly different but rats’ sexual category has no effect on the treatments. The highest mortalities was on dose 4 x 105 (100% at 12.08 days, food consumption decreased two to four days before rats died, weight of rats decreased because of the infection of S. singaporensis.
How Important Are Rats As Vectors of Leptospirosis in the Mekong Delta of Vietnam?
Loan, Hoang Kim; Van Cuong, Nguyen; Takhampunya, Ratree; Kiet, Bach Tuan; Campbell, James; Them, Lac Ngoc; Bryant, Juliet E.; Tippayachai, Bousaraporn; Van Hoang, Nguyen; Morand, Serge; Hien, Vo Be
2015-01-01
Abstract Leptospirosis is a zoonosis known to be endemic in the Mekong Delta of Vietnam, even though clinical reports are uncommon. We investigated leptospira infection in rats purchased in food markets during the rainy season (October) (n=150), as well as those trapped during the dry season (February–March) (n=125) in the region using RT-PCR for the lipL32 gene, confirmed by 16S rRNA, as well as by the microscopic agglutination test (MAT). Results were compared with the serovar distribution of human cases referred from Ho Chi Minh City hospitals (2004–2012) confirmed by MAT (n=45). The MAT seroprevalence among rats was 18.3%. The highest MAT seroprevalence corresponded, in decreasing order, to: Rattus norvegicus (33.0%), Bandicota indica (26.5%), Rattus tanezumi (24.6%), Rattus exulans (14.3%), and Rattus argentiventer (7.1%). The most prevalent serovars were, in descending order: Javanica (4.6% rats), Lousiana (4.2%), Copenageni (4.2%), Cynopterie (3.7%), Pomona (2.9%), and Icterohaemorrhagiae (2.5%). A total of 16 rats (5.8%) tested positive by RT-PCR. Overall, larger rats tended to have a higher prevalence of detection. There was considerable agreement between MAT and PCR (kappa=0.28 [0.07–0.49]), although significantly more rats were positive by MAT (McNemar 29.9 (pgeographically linked co-sampling of humans and animals to establish the main sources of leptospirosis in the region. PMID:25629781
Pneumocystis carinii: its incidence in rodents and enhancement of the infection by corticosteroids
Directory of Open Access Journals (Sweden)
Helly A. Lage
1973-01-01
Full Text Available A survey was made on the incidence of Pneumocystis carinii in 361 rodents including sewer rats, albino rats, albino mice, guinea-pigs and rabbits. P. carinii was found in 4 of the 215 Rattus norvegicus examined (1,8%. These results accord with recent observations but disagree with investigations made by the researchers who first studied this parasite in the past when high indexes of infection were found. However, in 20 albino rats treated with corticosteroids (betamethazone we found 8 positive (40% and in 20 albino mice treated by the same way, 9 were positive for P. carinii (45%. These results confirm the opportunistic character of P. carinii in rodents already well demonstrated in man.Foi feita uma investigação sobre a ocorrência de P. carinii em 361 roedores, incluindo ratos de esgoto, ratos albinos, camundongos albinos, cobaios e coelhos. Só foram encontrados positivos 4 Rattus norvegicus em 215 examinados (1.8%. Estes resultados estão de acordo com observações feitas nos últimos anos, os quais constrastam com as verificações feitas nos primeiros anos, os quais contrastam com as verificações feitas nos primeiros anos de estudo do P. carinii, quando foram assinalados altos índices infecciosos. Entretanto, em 20 ratos albinos tratados com corticosteróides (betametasona foram encontrados 8 positivos (40%; e em 20 camundongos albinos, tratados do mesmo modo, foram encontrados 9 positivos (45%. Estes resultados confirmaram o caráter oportunístico do P. carinii no roedores, do mesmo modo como acontece no homem.
Paradoxical sleep deprivation decreases serum testosterone and Leydig cells in male rats
Directory of Open Access Journals (Sweden)
Fitranto Arjadi
2014-04-01
Full Text Available Background Chronic stress increases glucocorticoid levels and accelerates reduction in Leydig cells functions and numbers. Chronic stress models in the working place comprise sleep deprivation, sedentary stress, and physical stress. The aim of this study was to evaluate the effect of various work stress models, such as stress from paradoxical sleep deprivation (PSD, immobilization, and footshock, on serum testosterone levels and number of Leydig cells in male albino rats. Methods This study was of experimental randomized post-test only with control group design using 24 male Wistar albino rats (Rattus norvegicus. The sample was divided into 4 groups: K1 (control, K2 (PSD, K3 (immobilization and K4 (footshock, receiving treatment for 25 days. Measured parameters were serum testosterone level and Leydig cell number. Analysis of variance (ANOVA was used for statistical analysis, followed by post hoc LSD. Results Mean serum testosterone levels (0.07 ± 0.08 ng/mL and Leydig cell numbers (4.22 ± l0.96 were lowest in the PSD stress model. Serum testosterone levels differed significantly between controls and PSD group (p=0.014, while there was a significant difference in numbers of Leydig cells between footshock stress and PSD (p=0.011 and between the three stress groups and controls (p=0.006. Conclusion This study demonstrated that PSD, immobilization and footshock stress significantly decreased serum testosterone levels and number of Leydig cells in male albino rats (Rattus norvegicus. The mechanism by which PSD affects serum testosterone is still unclear.
Angiostrongylus cantonensis and Rat Lungworm Disease in Brazil
de Oliveira Simões, Raquel; Fernandez, Monica Ammon; Júnior, Arnaldo Maldonado
2013-01-01
The metastrongyloid nematode genus Angiostrongylus includes 18 species, two of which are relevant from a medical standpoint, Angiostrongylus costaricensis and Angiostrongylus cantonensis. The first was described from Costa Rica in 1971 and causes abdominal angiostrongyliasis in the Americas, including in Brazil. Angiostrongylus cantonensis, first described in 1935 from Canton, China, is the causative agent of eosinophilic meningitis. The natural definitive hosts are rodents, and molluscs are the intermediate hosts. Paratenic or carrier hosts include crabs, freshwater shrimp, amphibians, flatworms, and fish. Humans become infected accidentally by ingestion of intermediate or paratenic hosts and the parasite does not complete the life cycle as it does in rats. Worms in the brain cause eosinophilic meningitis. This zoonosis, widespread in Southeast Asia and the Pacific islands, has now been reported from other regions. In the Americas there are records from the United States, Cuba, Jamaica, Brazil, Ecuador, and Haiti. In Brazil seven human cases have been reported since 2007 from the southeastern and northeastern regions. Epidemiological studies found infected specimens of Rattus norvegicus and Rattus rattus as well as many species of molluscs, including the giant African land snail, Achatina fulica, from various regions of Brazil. The spread of angiostrongyliasis is currently a matter of concern in Brazil. PMID:23901376
DEFF Research Database (Denmark)
Frandsen, Rikke; Herrmann, Bent; Madsen, Niels
2010-01-01
The selectivity for Nephrops (Nephrops norvegicus) in trawl codends generally is poor and the lack of steepness of the selection curve results in high discard rates and/or loss of legal-sized catch. This poor codend selectivity often is attributed to the irregular shape of Nephrops, which to some...
Pellizzaro, Maysa; Conrado, Francisco de Oliveira; Martins, Camila Marinelli; Joaquim, Sâmea Fernandes; Ferreira, Fernando; Langoni, Helio; Biondo, Alexander Welker
2017-01-01
Norway rats (Rattus norvegicus) are zoonotic reservoirs for Leptospira spp. and Toxoplasma gondii, and influence diseases in urban areas. Free-ranging and laboratory-raised rats from two zoos in southern Brazil were tested for Leptospira spp. and T. gondii using microscopic agglutination and modified agglutination tests, respectively. Overall, 25.6% and 4.6% free-ranging rats tested positive for Leptospira spp. and T. gondii, respectively, with co-seropositivity occurring in two animals. For laboratory-raised rats, 20% tested positive for Leptospira spp. Also, Leptospira biflexa serovar Patoc and Leptospira noguchii serovar Panama were found. Serosurveys can show the environmental prevalence of zoonotic pathogens.
G.S. Gazeta; R.W. Carvalho; R.F. Avelar; M. Amorim; A.E. Aboud-Dutra
2004-01-01
Foi analisada a ocorrência de babesiose em pequenos roedores nos municípios de Silva Jardim e Nova lguaçu, Estado do Rio de Janeiro. Foram capturados 44 roedores de seis espécies diferentes e entre eles a prevalência da infecção foi de 27,3%. Rattus norvegicus foi considerado o principal reservatório (50,0%) e Oligoryzomys nigripes como novo hospedeiro para Babesia sp. Este foi o primeiro relato de Babesia sp. em roedores no Brasil. A freqüência de roedores positivos e o risco de infecção dos...
Presence of Trypanosoma cruzi in tissues of experimentally infected Wistar rats and their fetuses
Alarcón, Maritza; Lugo de Yarbuh, Ana; Moreno, Elio A; Payares, Gilberto; Araujo, Sonia; Colmenares, Melisa
2006-01-01
Este estudio fue realizado con un grupo de ratas juveniles hembras (Rattus norvegicus) cepa Wistar con 20 días de nacidas y 250 grs. de peso. Cada rata fue inoculada inyectándole por vía intraperitoneal 0.1 mL de la suspensión sanguínea con 1x105 tripomastigotes sanguícolas de Trypanosoma cruzi (cepa I/PAS/VE/00/PLANALTO). Los parásitos fueron aislados de Panstrongylus geniculatus, naturalmente infectado y capturado en un área urbana del valle de Caracas, Venezuela y mantenidos en ratones NMR...
Anticoagulant resistance: a relevant issue in sewer rat (Rattus norvegicus) control?
DEFF Research Database (Denmark)
Heiberg, Ann-Charlotte
2009-01-01
the resistant rats, had resistance-related mutations in the VKORC1 gene. CONCLUSION: The results of this study suggest that the genetic background of anticoagulant resistance may have to be redefined in respect of resistance-related changes in the VKORC1 gene. Copyright © 2009 Society of Chemical Industry......BACKGROUND: The majority of rat problems in cities are thought to be related to defective sewers, and the use of anticoagulant rodenticides in such places is often implemented as part of regular urban rodent control. Knowledge pertaining to the resistance status of sewer rat populations is non......-existent, which may be leading to control problems in cities. It has become crucial to provide knowledge on the prevalence of resistance and how different control strategies have affected its prevalence among sewer rat populations. The prevalence of resistance was investigated in six sewer locations in Copenhagen...
Intermittent fasting decreases oxidative stress parameters in Wistar rats (Rattus norvegicus)
Titis Nurmasitoh; Shindy Yudha Utami; Endah Kusumawardani; Abdulhalim Ahmad Najmuddin; Ika Fidianingsih
2018-01-01
Background Chronic and degenerative diseases are closely related to modern lifestyles that tend to be deficient in physical activity but excessive in food intake. One method used to overcome this problem is dietary restriction through intermittent fasting. Intermittent fasting decreases the risk of chronic and degenerative diseases, e.g. by lowering oxidative stress. Oxidative stress can be determined from the malondialdehyde (MDA) levels and lipid profile in the blood. The present study a...
Norway rats (Rattus norvegicus) communicate need, which elicits donation of food.
Schweinfurth, Manon K; Taborsky, Michael
2018-05-01
Reciprocal cooperation has been observed in a wide range of taxa, but the proximate mechanisms underlying the exchange of help are yet unclear. Norway rats reciprocate help received from partners in an iterated Prisoner's Dilemma game. For donors, this involves accepting own costs to the benefit of a partner, without obtaining immediate benefits in return. We studied whether such altruistic acts are conditional on the communication of the recipient's need. Our results show that in a 2-player mutual food-provisioning task, prospective recipients show a behavioral cascade reflecting increasing intensity. First, prospective receivers reach out for the food themselves, then they emit ultrasonic calls toward their partner, before finally showing noisy attention-grabbing behaviors. Food-deprived individuals communicate need more intensively than satiated ones. In return, donors provide help corresponding to the intensity of the recipients' communication. This indicates that rats communicate their need, which changes the helping propensity of potential donors. Communication of need and corresponding adjustment of cooperation may be a widespread proximate mechanism explaining the mutual exchange of services between animals. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
Directory of Open Access Journals (Sweden)
Margarida Cristo
1998-12-01
Full Text Available A comparative study of the feeding ecology of Nephrops norvegicus was carried out on a seasonal basis simultaneously in seven locations in the Eastern and Western Mediterranean and the adjacent Atlantic: the south coast of Portugal, Faro; the Alboran Sea, Malaga; the Catalan Sea, Barcelona; the Ligurian Sea, Genoa; theTyrrhenian Sea, Pisa; the Adriatic Sea, Ancona and the Aegean Sea, Gulf of Euboikos. The major groups observed (frequency of occurrence method in the stomachs of Nephrops norvegicus were decapod crustaceans, other crustaceans (euphausids and peracarids and fish. The results obtained showed no significant differences between sites or seasons, and can be considered very consistent. All major taxa were present in the diet at all sites and for all seasons, a fact that can be explained by the great similarity of the bathyal fauna in all sites, which provide a major trophic resource for N. norvegicus. The percentage of fullness was also estimated per site and season, and we registered a clear decrease of this value during the summer period for all sites, except the Tyrrheanian Sea, where the lowest value was found in autumn. PCA - analysis did not clearly separate the regions (sites. The Shannon-Weaver (H´, index of diversity, was also determined per site and season, and we found a significant difference between the values of the Atlantic coast and the Western Mediterranean when compared with those of the Eastern Mediterranean.
Directory of Open Access Journals (Sweden)
Susan I Jarvi
Full Text Available The nematode Angiostrongylus cantonensis is a zoonotic pathogen and the etiological agent of human angiostrongyliasis or rat lungworm disease. Hawai'i, particularly east Hawai'i Island, is the epicenter for angiostrongyliasis in the USA. Rats (Rattus spp. are the definitive hosts while gastropods are intermediate hosts. The main objective of this study was to collect adult A. cantonensis from wild rats to isolate protein for the development of a blood-based diagnostic, in the process we evaluated the prevalence of infection in wild rats. A total of 545 wild rats were sampled from multiple sites in the South Hilo District of east Hawai'i Island. Adult male and female A. cantonensis (3,148 were collected from the hearts and lungs of humanely euthanized Rattus rattus, and R. exulans. Photomicrography and documentation of multiple stages of this parasitic nematode in situ were recorded. A total of 45.5% (197/433 of rats inspected had lung lobe(s (mostly upper right which appeared granular indicating this lobe may serve as a filter for worm passage to the rest of the lung. Across Rattus spp., 72.7% (396/545 were infected with adult worms, but 93.9% (512/545 of the rats were positive for A. cantonensis infection based on presence of live adult worms, encysted adult worms, L3 larvae and/or by PCR analysis of brain tissue. In R. rattus we observed an inverse correlation with increased body mass and infection level of adult worms, and a direct correlation between body mass and encysted adult worms in the lung tissue, indicating that larger (older rats may have developed a means of clearing infections or regulating the worm burden upon reinfection. The exceptionally high prevalence of A. cantonensis infection in Rattus spp. in east Hawai'i Island is cause for concern and indicates the potential for human infection with this emerging zoonosis is greater than previously thought.
Directory of Open Access Journals (Sweden)
Biomechy Oktomalioputri
2016-01-01
Full Text Available AbstrakDiet tinggi kolesterol ini akan meningkatkan kadar Low Density Lipoprotein (LDL sebagai penanda hiperlipidemia yang berdampak pada terjadinya aterosklerosis. Transforming Growth Factor β (TGF-β memiliki peranan dalam proses terjadinya aterosklerosis ini. Keterlibatannya dalam hiperlipidemia sebagai faktor risiko utama aterosklerosis belum banyak diketahui. Tujuan penelitian ini adalah menentukan pengaruh lama permberian diet tinggi kolesterol terhadap kadar LDL dan TGF-β pada tikus putih (Rattus novergicus strain Wistar. Penelitian ini menggunakan metode post test only control group design yang dilakukan terhadap tikus Rattus novergicus jantan umur 3-4 bulan, berat 200-250 gram. Sampel penelitian terdiri dari 24 ekor tikus yang dibagi menjadi 4 kelompok, yaitu kelompok kontrol, A, B dan C. Selain kelompok kontrol, kelompok tikus diberi diet tinggi kolesterol berupa lemak kambing 10%, telur puyuh 5%, selama 10 hari untuk kelompok A, 20 hari untuk kelompok B dan 30 hari untuk kelompok C. Pada akhir percobaan darah tikus diambil dan dilakukan pemeriksaan kadar LDL dan TGF-β serum. Hasil penelitian diolah secara bivariat. Analisis yang digunakan yaitu uji oneway Anova. Hasil penelitian diketahui terdapat pengaruh lama pemberian diet tinggi kolesterol terhadap peningkatan kadar LDL serum tikus dengan p=0,01 (p<0,05. Terdapat pengaruh lama pemberian diet tinggi kolesterol terhadap penurunan kadar TGF-β dimana p=0,04 (p>0,05. Penelitian ini menyimpulkan bahwa terdapat pengaruh lama pemberian diet tinggi kolesterol terhadap kadar LDL dan tikus putih Rattus novergicus strain Wistar.Kata kunci: diet tinggi kolesterol, LDL, TGF-β AbstractHigh-cholesterol diet will increase Low Density Lipoprotein (LDL levels which impact to atherosclerosis. Transforming Growth Factor β (TGF-β play a role in atherosclerosis process. But its involvement in hyperlipidemia as the main risk factor of atherosclerosis still unknown. The objective of this study was
Zhong, Xue-Shan; Ge, Jing; Chen, Shao-Wei; Xiong, Yi-Quan; Zheng, Xue-Yan; Qiu, Min; Huo, Shu-Ting; Chen, Qing
2016-05-01
To investigate antimicrobial resistance of Klebsiella pneumoniae and Pseudomonas aeruginosa isolates in fecal samples from rat-like animals. Rat-like animals were captured using cages around a hospital and the neighboring residential area between March and October, 2015. K. pneumoniae and P. aeruginosa were isolated from the fecal samples of the captured animals. Antimicrobial susceptibility test was performed according to the guidelines of Clinical and Laboratory Standards Institute (2014). A total of 329 rat-like animals were captured, including 205 Suncus murinus, 111 Rattus norvegicus, 5 Rattus flavipectus and 8 Mus musculus. The positivity rates of K. pneumoniae and P. aeruginosa were 78.4% and 34.7% in the fecal samples from the captured animals, respectively. K. pneumoniae isolates from Suncus murinus showed a high resistance to ampicillin, cephazolin, nitrofurantoin, piperacillin and cefotaxime (with resistance rates of 100%, 51.2%, 44.2%, 37.2%, and 23.3%, respectively), and K. pneumoniae isolates from Rattus spp. showed a similar drug-resistance profile. The prevalence rates of multidrug resistance and ESBLs were 40.9% and 10.7%, respectively. P. aeruginosa from both Suncus murinus and Rattus spp. exhibited the highest resistance rates to aztreonam (12.4% and 16.0%, respectively), followed by penicillins and fluoroquinolones. P. aeruginosa isolates were susceptible to cephems, aminoglycosides and carbapenems (with resistance rates below 5%). K. pneumoniae and P. aeruginosa isolated from rat-like animals showed drug-resistance profiles similar to those of the strains isolated from clinical patients, suggesting that the possible transmission of K. pneumoniae and P. aeruginosa between rat-like animals and human beings.
Spahr, Carina; Ryll, René; Knauf-Witzens, Tobias; Vahlenkamp, Thomas W; Ulrich, Rainer G; Johne, Reimar
2017-12-01
Hepatitis E virus (HEV) is the causative agent of hepatitis E, an emerging infectious disease of humans. HEV infections have also been described in various animal species. Whereas domestic pigs and wild boars are well-known animal reservoirs for HEV, the knowledge on natural HEV infection in zoo animals is scarce so far. Here, we analysed 244 sera from 66 mammal species derived from three zoos in Germany using a commercial double antigen sandwich ELISA. HEV-specific antibodies were detected in 16 animal species, with the highest detection rates in suids (33.3%) and carnivores (27.0%). However, RNA of the human pathogenic HEV genotypes 1-4 was not detected in the serum samples from suids or carnivores. Using a broad spectrum RT-PCR, a ratHEV-related sequence was identified in a sample of a female Syrian brown bear (Ursus arctos syriacus). Subsequent serum samples within a period of five years confirmed a HEV seroconversion in this animal. No symptoms of hepatitis were recorded. In a follow-up investigation at the same location, closely related ratHEV sequences were identified in free-living Norway rats (Rattus norvegicus), whereas feeder rats (Rattus norvegicus forma domestica) were negative for HEV-specific antibodies and RNA. Therefore, a spillover infection of ratHEV from free-living Norway rats is most likely. The results indicate that a wide range of zoo animals can be naturally infected with HEV or HEV-related viruses. Their distinct role as possible reservoir animals for HEV and sources of HEV infection for humans and other animals remains to be investigated. Copyright © 2017 Elsevier B.V. All rights reserved.
Sodium selenite as a new rodenticide
Directory of Open Access Journals (Sweden)
Goran Jokić
2014-09-01
Full Text Available Rodents are the most destructive group of small mammalian pests considering the overall damage that they cause by feeding and other activities, or as vectors of many disease agents. In practice, chemical rodenticides have been the most widespread and most effective method of control of commensal (Mus musculus, Rattus norvegicus and R. rattus and most harmful field rodent pests (Apodemus sylvaticus, A. agrarius and Microtus arvalis. After anticoagulant and vitamin D3 rodenticides, which were introduced worldwide in the 1980s, no other chemical compound has had a comparable role as a rodenticide in practice. In the past decade, commercial baits containing 0.1% sodium selenite have also been registered in Serbia in various formulations both for controlling rodents indoors and in the field. Data on sodium selenite as a rodenticide have been scarce. The present paper surveys research data reported so far, analyzing and drawing conclusions regarding the validity and feasibility of sodium selenite as a method of rodent control with reference to the available ecotoxicological data.
Directory of Open Access Journals (Sweden)
Bharathalingam Sinniah
2014-01-01
Full Text Available Humans can get infected with several zoonotic diseases from being in close contact with rats. This study was aimed at determining the prevalence and histopathological changes caused by Calodium hepaticum and Cysticercus fasciolaris in infected livers of wild caught urban rats. Of the 98 urban rats (Rattus rattus diardii and Rattus norvegicus autopsied, 64.3% were infected; 44.9% were infected with Caladium hepatica, 39.3% were infected with Cysticercus fasciolaris, and 20.4% were infected with both parasites. High infection rates suggest that urban rats are common reservoir for both parasites, which are potentially a threat to man. Calodium hepaticum infections were identified by the presence of ova or adults in the liver parenchyma. They appear as yellowish white nodules, measuring 1–7 mm in diameter or in streaks scattered widely over the serosal surface of the liver. Cysticercus fasciolaris infections are recognized morphologically by their shape (round or oval and are creamy white in colour. Histological studies of Calodium hepaticum showed areas of granulomatous lesions with necrotic areas around the dead ova and adults. In almost all cases, the rats appeared robust, looked healthy, and showed no visible signs of hepatic failure despite the fact that more than 64.0% of their livers were infected by either one or both parasites.
Discovery of Novel Alphacoronaviruses in European Rodents and Shrews
Directory of Open Access Journals (Sweden)
Theocharis Tsoleridis
2016-03-01
Full Text Available Eight hundred and thirteen European rodents and shrews encompassing seven different species were screened for alphacoronaviruses using PCR detection. Novel alphacoronaviruses were detected in the species Rattus norvegicus, Microtus agrestis, Sorex araneus and Myodes glareolus. These, together with the recently described Lucheng virus found in China, form a distinct rodent/shrew-specific clade within the coronavirus phylogeny. Across a highly conserved region of the viral polymerase gene, the new members of this clade were up to 22% dissimilar at the nucleotide level to the previously described Lucheng virus. As such they might represent distinct species of alphacoronaviruses. These data greatly extend our knowledge of wildlife reservoirs of alphacoronaviruses.
Hématologie du rat : hémogramme et myélogramme
Descat, Fleur
2002-01-01
Le rat, Rattus norvegicus, rongeur de laboratoire consacré comme modèle expérimental dans de nombreux domaines de la recherche biomédicale, présente des caractèristiques hématologiques qualitatives et quantitatives particulières. La détermination de valeurs chiffrées de référence est toutefois délicate parce qu'il existe de très nombreux facteurs de variations physiologiques dépendant non seulement des qualités intrinsèques du sujet étudié mais aussi des techniques de prélèvements sanguins ou...
Genoud, Michel
2014-04-01
The thermal energetics of rodents from cool, wet tropical highlands are poorly known. Metabolic rate, body temperature and thermal conductance were measured in the moss-forest rat, Rattus niobe (Rodentia), a small murid endemic to the highlands of New Guinea. These data were evaluated in the context of the variation observed in the genus Rattus and among tropical murids. In 7 adult R. niobe, basal metabolic rate (BMR) averaged 53.6±6.6mLO2h(-1), or 103% of the value predicted for a body mass of 42.3±5.8g. Compared to other species of Rattus, R. niobe combines a low body temperature (35.5±0.6°C) and a moderately low minimal wet thermal conductance cmin (5.88±0.7mLO2h(-1)°C(-1), 95% of predicted) with a small size, all of which lead to reduced energy expenditure in a constantly cool environment. The correlations of mean annual rainfall and temperature, altitude and body mass with BMR, body temperature and cmin were analyzed comparatively among tropical Muridae. Neither BMR, nor cmin or body temperature correlated with ambient temperature or altitude. Some of the factors which promote high BMR in higher latitude habitats, such as seasonal exposure to very low temperature and short reproductive season, are lacking in wet montane tropical forests. BMR increased with rainfall, confirming a pattern observed among other assemblages of mammals. This correlation was due to the low BMR of several desert adapted murids, while R. niobe and other species from wet habitats had a moderate BMR. Copyright © 2014 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Darci Moraes Barros-Battesti
2000-03-01
Full Text Available The Atlantic Forest small mammal land fauna, except bats, and the abiotic factors that might have an influence on its composition, were studied in the Itapevi County, State of Sao Paulo, a forested region, partly altered by antropic action, from January, 1995 to June, 1996. The trapping effort consisted of 2,888 trap-nights, resulting in a 4.6% trapping success and consisted of monthly trappings, for five consecutive days. During this period, 134 specimens were captured, of which 46.3% were Didelphimorphia and 53.7% were Rodentia. Eleven species were registered: two Didelphimorphia: Didelphis marsupialis (Linnaeus, 1758 and Marmosops incanus (Lund, 1841, and nine Rodentia: Akodon cursor (Winge, 1887, Bolomys lasiurus (Lund, 1841, Oxymycterus hispidus Pictet, 1843, Oxymycterus nasutus (Waterhouse, 1837, Oligoryzomys nigripes (Olfers, 1818, Oryzomys angouya (Fischer, 1814, Raltus norvegicus (Berkenhout, 1769, Euryzygomatomys spinosus (G. Fischer, 1814 and Cavia aperea Erxleben, 1777. The relative density indices were correlated with meteorological data by Spearman and Pearson coefficients. For marsupials these correlations were not significant. For rodents, the correlations were significant and directly related to lower temperature and rainfall indices (p<0.05. During the dry season the occurrence of small mammals was 50% greater than during the wet season, probably due to foraging strategies in the studied fragment of Atlantic Forest.
Kimura, Yuri; Hawkins, Melissa T R; McDonough, Molly M; Jacobs, Louis L; Flynn, Lawrence J
2015-09-28
Time calibration derived from the fossil record is essential for molecular phylogenetic and evolutionary studies. Fossil mice and rats, discovered in the Siwalik Group of Pakistan, have served as one of the best-known fossil calibration points in molecular phylogenic studies. Although these fossils have been widely used as the 12 Ma date for the Mus/Rattus split or a more basal split, conclusive paleontological evidence for the nodal assignments has been absent. This study analyzes newly recognized characters that demonstrate lineage separation in the fossil record of Siwalik murines and examines the most reasonable nodal placement of the diverging lineages in a molecular phylogenetic tree by ancestral state reconstruction. Our specimen-based approach strongly indicates that Siwalik murines of the Karnimata clade are fossil members of the Arvicanthini-Otomyini-Millardini clade, which excludes Rattus and its relatives. Combining the new interpretation with the widely accepted hypothesis that the Progonomys clade includes Mus, the lineage separation event in the Siwalik fossil record represents the Mus/Arvicanthis split. Our test analysis on Bayesian age estimates shows that this new calibration point provides more accurate estimates of murine divergence than previous applications. Thus, we define this fossil calibration point and refine two other fossil-based points for molecular dating.
DEFF Research Database (Denmark)
Hornborg, Sara; Jonsson, Patrik; Sköld, Mattias
2017-01-01
-evaluations of current practice are important as a basis for management actions. The Swedish fishery for Norway lobster (Nephrops norvegicus) in the Kattegat–Skagerrak area provides an interesting case study of relevance to emerging policies. Sprung from an unbalance in available fish- and Nephrops quotas...
EFFECT OF PESTICIDES ON RAT (Rattus norvegicus ERYTHROCYTES ANTIOXIDANT ENZYMES IN VITRO
Directory of Open Access Journals (Sweden)
Jasna Friščić
2014-10-01
Full Text Available Abstract: In the last century, maximum in herbicide production was achieved. Growing use of herbicides initiated the need for continuous evaluation of damaging effects of herbicides on human health and environment. Paraquat is the trade name for N,N′-dimethyl-4,4′-bipyridinium dichloride and one of the most widely used herbicides in the world. Although mechanism of paraquat toxicity remains undefined, a great portion of toxicity is attributed to the process of redox cycling. In this research, rat erythrocytes were exposed to various paraquat concentrations (0, 0.25, 0.5, 0.75, 1.25 mM. Changes in antioxidant enzymes activity, catalase and superoxide dismutase were determined, and also the activity of erythrocyte acetylcholinesterase. Obtained results show damaging effects of paraquat on erythrocytes due to oxidative stress.
[Giardia muris infection in laboratory rats (Rattus norvegicus) and treatment with metronidazole].
Beyhan, Yunus Emre; Hökelek, Murat
2014-01-01
This study was conducted to determine the effectiveness of metronidazole for treatment of Giardia muris infection in laboratory rats. The feces of rats was yellow watery diarrhea and brought to the surgery research center of University of Ondokuz Mayis in order to be a study. Stool samples were examined by native examination, evaluation of infection rates was done with an X40 lens, and results were recorded as positive from 1 to 4. Metronidazole was administered to infected animals orally for 5 days with a 20 mg/kg dose. As a result of fecal examination of 64 rats held in groups of four in cages, 15 of the cages (60 rats) were found to be infected with G. muris. While agents were not observed in collected stool samples following 5, 7, and 14 days of drug administration of 14 groups, trophozoite density in one cage was decreased (75%), and adverse effects were not seen in rats. Metronidazole was found to be an effective drug for the treatment of giardiasis.
Variation in Protein and Calorie Consumption Following Protein Malnutrition in Rattus norvegicus
Jones, Donna C.; German, Rebecca Z.
2013-01-01
Simple Summary Catch-up growth following malnutrition is likely influenced by available protein and calories. We measured calorie and protein consumption following the removal of protein malnutrition after 40, 60 and 90 days, in laboratory rats. Following the transition in diet, animals self-selected fewer calories, implying elevated protein is sufficient to fuel catch-up growth, eventually resulting in body weights and bone lengths greater or equal to those of control animals. Rats rehabilitated at younger ages, had more drastic alterations in consumption. Variable responses in different ages and sex highlight the plasticity of growth and how nutrition affects body form. This work furthers our understanding of how humans and livestock can recover from protein-restriction malnutrition, which seems to employ different biological responses. Abstract Catch-up growth rates, following protein malnutrition, vary with timing and duration of insult, despite unlimited access to calories. Understanding changing patterns of post-insult consumption, relative rehabilitation timing, can provide insight into the mechanisms driving those differences. We hypothesize that higher catch-up growth rates will be correlated with increased protein consumption, while calorie consumption could remain stable. As catch-up growth rates decrease with age/malnutrition duration, we predict a dose effect in protein consumption with rehabilitation timing. We measured total and protein consumption, body mass, and long bone length, following an increase of dietary protein at 40, 60 and 90 days, with two control groups (chronic reduced protein or standard protein) for 150+ days. Immediately following rehabilitation, rats’ food consumption decreased significantly, implying that elevated protein intake is sufficient to fuel catch-up growth rates that eventually result in body weights and long bone lengths greater or equal to final measures of chronically fed standard (CT) animals. The duration of protein restriction affected consumption: rats rehabilitated at younger ages had more drastic alterations in consumption of both calories and protein. While rehabilitated animals did compensate with greater protein consumption, variable responses in different ages and sex highlight the plasticity of growth and how nutrition affects body form. PMID:26487308
A new polymorphic pepsinogen locus (Pg-2) in the rat (Rattus norvegicus).
Hamada, S; Yamada, J; Bender, K; Adams, M
1987-07-01
Only two types of pepsinogens, which are products of the Pg-1 locus, are present in rat urine. In gastric mucosa, however, additional pepsinogen isozymes are expressed. We have found a polymorphism for rat gastric mucosa pepsinogen using agarose gel electrophoresis. Some inbred rat strains expressed a pepsinogen band, while others did not. The trait was found to be controlled by a single autosomal locus. We tentatively designated the locus as Pg-2 with two alleles, Pg-2a for the one controlling presence of the band and Pg-2o for the one controlling absence. Linkage analysis using BN and TM strains revealed that Pg-2 was closely linked to Pg-1 (3.7 +/- 1.8 cM), and that it did not belong to LG I (Hbb and p), LG II (Acon-1 and Mup-1), LG IV (Hao-1 and Svp-1), LG V (Es-1 and Es-3), LG VI (Gc and h), LG IX (RT1), LG X (Fh and Pep-3), nor a LG containing Ahd-2 (as yet undetermined).
Development and testing of a separator frame in a Norway lobster Nephrops norvegicus fishery
DEFF Research Database (Denmark)
Madsen, Niels; Holst, René
2017-01-01
Norway lobster Nephrops norvegicus fisheries are often characterized by high bycatch and discard rates. However, fisheries species exhibit differences in vertical behaviour that can be used to develop selective devices. We developed a separator frame that can be inserted into the forward part...... the separator frame and ending up in the bottom cod-end, the top cod-end, or penetrating the window. The majority of Norway lobster and flatfish entered the bottom cod-end, and most gadoids entered the top cod-end. A relatively high proportion of gadoids and flatfish that entered the top cod-end penetrated...
International Nuclear Information System (INIS)
Naguib, N.I.; El-Dawi, E.F.
2011-01-01
This study was carried out to investigate the impact of environmental climate (temperature) on the corneal structure of two wild rodents; the nocturnal Norway rats (Rattus norvegicus) and the diurnal golden spiny mouse (Acomys russatus). Both rodents were collected from two extreme climatic environment and their dissected corneas were prepared for light, scanning and transmission electron microscopy. The corneas of both rodents are composed of three main layers; an outer epithelium, stroma, Descemet's membrane, and an inner endothelium. The mean thickness of the epithelium, stroma, Descemet's membrane and inner endothelium of both rodents were measured. The scanning electron microscopy revealed that in R. norvegicus and A. russatus; the outermost cells of the corneal epithelium, are mostly polygonal in shape with nearly regular borders and show dense pattern of microplicae with different scatter electron that exhibits three polymorphic appearances (A, B, C) and two (A, B), respectively. Numerous A-light cells with dense microplicae, many B-dark cells with a moderate density of microplicae and few C-dark cells with a less density of microplicae were observed. Using transmission electron microscope, the epithelial cells of both species possess glycocalyx and the cytokeratin filaments are more extensive in the apical epithelial cells in A. russatus. The stroma in R. norvegicus is formed of outer and inner lamellar zones with spaces in between its wavy bundles. In A. russatus, the stroma is formed of one lamellar zone of flattened bundles of highly wavy and branched collagen fibrils. On the other hand, the surface of the endothelial cells in R. norvegicus is slightly bulging with many blebs whereas it showed flattened and nearly smooth surface in A. russatus. In conclusion, the differences in the number of the superficial epithelial cells and the thickness of the stroma and structure of the endothelium of R. norvegicus (nocturnal) and A. russatus (diurnal) are most
Kimura, Yuri; Hawkins, Melissa T. R.; McDonough, Molly M.; Jacobs, Louis L.; Flynn, Lawrence J.
2015-01-01
Time calibration derived from the fossil record is essential for molecular phylogenetic and evolutionary studies. Fossil mice and rats, discovered in the Siwalik Group of Pakistan, have served as one of the best-known fossil calibration points in molecular phylogenic studies. Although these fossils have been widely used as the 12 Ma date for the Mus/Rattus split or a more basal split, conclusive paleontological evidence for the nodal assignments has been absent. This study analyzes newly reco...
Directory of Open Access Journals (Sweden)
Muhartono Muhartono
2017-04-01
Full Text Available Gelombang elektromagnetik handphone dapat menyebabkan peningkatan reactive oxygen species (ROS sehingga merubah struktur histopatologi testis. Untuk mengatasinya dibutuhkan senyawa antioksidan yang terkandung dalam kulit manggis. Penelitian ini bertujuan untuk mengetahui pengaruh ekstrak etanol kulit manggis (Garcinia mangostana L. dalam memperbaiki gambaran histopatologi testis terhadap sel spermatozoa dan spermatogenik tikus putih (Rattus norvegicus galur Sprague dawley yang diberi paparan gelombang elektromagnetik handphone. Penelitian ini menggunakan 25 ekor tikus putih galur Sprague dawley dengan berat badan 200-300 gram yang dibagi ke dalam 5 kelompok, yaitu kontrol 1 (K1 tikus yang tidak diberikan perlakuan, kontrol 2 (K2 diberikan NaCl 0,9% dan paparan gelombang elektromagnetik handphone, pada kelompok perlakuan (P1, (P2 dan (P3 diberikan ekstrak etanol kulit manggis dengan dosis bertingkat 50, 100, 200 mg/kgBB dan dilakukan paparan gelombang elektromagnetik handphone selama 3 jam/28 hari. Hasil penelitian ini didapatkan rerata jumlah sel spermatozoa pada K1=173,75±16,978 SD, K2=101,75±7,455 SD, P1=148,50±10,149 SD, P2=162,50±10,247 SD, P3=180,75±7,365 SD dan rerata jumlah sel spermatogenik pada K1=306,75±11,955 SD, K2=157,00±7,303 SD, P1=243,50±21,672 SD P2=266,75±10,340 SD P3=294,75±13,150 SD. Pada uji One Way Anova (p<0,005 didapatkan masing-masing sel spermatozoa dan sel spermatogenik menunjukkan hasil yang bermakna p=0,000. Ekstrak etanol kulit manggis (Garcinia mangostana L. dapat memperbaiki gambaran histopatologi testis dengan meningkatkan jumlah sel spermatozoa dan sel spermatogenik tikus putih (Rattus norvegicus galur Sprague dawley yang diberi paparan gelombang elektromagnetik handphone.
Lifescience Database Archive (English)
Full Text Available ne... 29 6.4 sp|P07335|KCRB_RAT Creatine kinase B-type OS=Rattus norvegicus G... 29 6.4 sp|Q04447|KCRB_MOUSE Creatine... kinase B-type OS=Mus musculus GN=C... 29 6.4 sp|P05122|KCRB_CHICK Creatine kinase B-type OS=Gallu...N=ARSH... 29 6.4 sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Sch... 29 8.3 sp|P24722|KCRT_ONCMY Creatine...6 LESGFDAQSRTKLSDLS 36 +ES +D +++ D+S Sbjct: 119 IESKYDVHTKSVTVDVS 135 >sp|P07335|KCRB_RAT Creatine...DGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPV 198 >sp|Q04447|KCRB_MOUSE Creatine kinase B-type OS=Mus musculus GN=Ckb PE
X radiation in parotid gland of young rats. Histopathological comparative evaluation
International Nuclear Information System (INIS)
Roslindo, E.B.; Utrilla, L.S.; Lia, R.C.C.; Roslindo, N.C.; Cerri, P.S.; Azoubel, R.
1992-01-01
The effects of X radiation on the structure of the parotid glands of young rats are studied by means of morphologic technique. Seventy male rats (Rattus norvegicus, albinus Holtzman) were distributed in two experimental groups: Group 1- irradiated and Group 2- control. The region of the parroted glands was irradiated with a dose of 300 rads from 48 to 48 hours up to an exposition of 1.200 rads. After predetermined periods the animals belonging to both groups were sacrificed and the parotid glands were removed for histopathologic evaluation. The serous acini showed to be radium sensitive and in the periods closer to the radiation, the glandular structure des organization and degeneration was noted. (M.A.C.)
Bender, K; Bissbort, S; Kuhn, A; Nagel, M; Günther, E
1986-02-01
A genetic locus controlling the electrophoretic mobility of an acid phosphatase in the rat (Rattus norvegicus) is described. The locus, designed Acp-2, is not expressed in erythrocytes but is expressed in all other tissues studied. The product of Acp-2 hydrolyzes a wide variety of phosphate monoesters and is inhibited by L(+)-tartaric acid. Inbred rat strains have fixed either allele Acp-2a or allele Acp-2b. Codominant expression is observed in the respective F1 hybrids. Backcross progenies revealed the expected 1:1 segregation ratio. Possible loose linkage was found between the Acp-2 and the Pep-3 gene loci at a recombination frequency of 0.36 +/- 0.06.
Electrophoretic variation in low molecular weight lens crystallins from inbred strains of rats.
Donner, M E; Skow, L C; Kunz, H W; Gill, T J
1985-10-01
Analysis of rat lens soluble proteins by analytical isoelectric focusing detected two inherited electrophoretic differences in low molecular weight (LM) crystallins from inbred strains of rats (Rattus norvegicus). The polymorphic lens crystallins were shown to be similar to a genetically variant LM crystallin, LEN-1, previously described in mice (Mus musculus) and encoded on chromosome 1, at a locus linked to Pep-3 (dipeptidase). Linkage analysis demonstrated that the rat crystallin locus was loosely linked to Pep-3 at a recombination distance of 38 +/- 4.5 U. These data suggest the conservation of a large chromosomal region during the evolution of Rodentia and support the hypothesis that the gamma-crystallins are evolving more rapidly than alpha- or beta-crystallins.
Relatedness decreases and reciprocity increases cooperation in Norway rats.
Schweinfurth, Manon K; Taborsky, Michael
2018-03-14
Kin selection and reciprocity are two mechanisms underlying the evolution of cooperation, but the relative importance of kinship and reciprocity for decisions to cooperate are yet unclear for most cases of cooperation. Here, we experimentally tested the relative importance of relatedness and received cooperation for decisions to help a conspecific in wild-type Norway rats ( Rattus norvegicus ). Test rats provided more food to non-kin than to siblings, and they generally donated more food to previously helpful social partners than to those that had refused help. The rats thus applied reciprocal cooperation rules irrespective of relatedness, highlighting the importance of reciprocal help for cooperative interactions among both related and unrelated conspecifics. © 2018 The Author(s).
Ectoparasites of Rodents Captured in Hamedan, Western Iran
Directory of Open Access Journals (Sweden)
Hamid Zendehfili
2015-10-01
Full Text Available Background: Rodents with a population greater than the entire population of other mammals on earth are the source of economic losses and health conflicts. One of the major health problems with the rodents is their role as reservoir hosts of zoonotic diseases. The aim of this study was to assess the infestation of commensal rodents with ectoparasites in Hamedan City, Western Iran.Methods: The samples were collected by live traps during years 2012–2013. After transferring the samples to the Entomological Laboratory of Hamedan University of Medical Sciences, their ectoparasites were collected andidentified.Results: A total of 171 slides were prepared from 105 captured commensal rodents: Mus musculus, Rattus rattus and R. norvegicus comprising three orders namely Mesostigmata: Hypoaspis (Laelaspis astronomica, Dermanyssius sp, Pachylaelapidae (male. Metastigmata: Rhipicephalus sp and Anoplura: Polyplax spinulosa were recovered in Hamedan City. Seventy (66.6% rodents were found infested with at least one species of ectoparasites.Conclusion: The results of our study indicate that ectoparasites infestation in commensal rodents of Hamedan city is high and more attention by local health authorities is needed to prevent zoonotic diseases.
Biscornet, Leon; Dellagi, Koussay; Pagès, Frédéric; Bibi, Jastin; de Comarmond, Jeanine; Mélade, Julien; Govinden, Graham; Tirant, Maria; Gomard, Yann; Guernier, Vanina; Lagadec, Erwan; Mélanie, Jimmy; Rocamora, Gérard; Le Minter, Gildas; Jaubert, Julien; Mavingui, Patrick; Tortosa, Pablo
2017-08-01
Leptospirosis is a bacterial zoonosis caused by pathogenic Leptospira for which rats are considered as the main reservoir. Disease incidence is higher in tropical countries, especially in insular ecosystems. Our objectives were to determine the current burden of leptospirosis in Seychelles, a country ranking first worldwide according to historical data, to establish epidemiological links between animal reservoirs and human disease, and to identify drivers of transmission. A total of 223 patients with acute febrile symptoms of unknown origin were enrolled in a 12-months prospective study and tested for leptospirosis through real-time PCR, IgM ELISA and MAT. In addition, 739 rats trapped throughout the main island were investigated for Leptospira renal carriage. All molecularly confirmed positive samples were further genotyped. A total of 51 patients fulfilled the biological criteria of acute leptospirosis, corresponding to an annual incidence of 54.6 (95% CI 40.7-71.8) per 100,000 inhabitants. Leptospira carriage in Rattus spp. was overall low (7.7%) but dramatically higher in Rattus norvegicus (52.9%) than in Rattus rattus (4.4%). Leptospira interrogans was the only detected species in both humans and rats, and was represented by three distinct Sequence Types (STs). Two were novel STs identified in two thirds of acute human cases while noteworthily absent from rats. This study shows that human leptospirosis still represents a heavy disease burden in Seychelles. Genotype data suggests that rats are actually not the main reservoir for human disease. We highlight a rather limited efficacy of preventive measures so far implemented in Seychelles. This could result from ineffective control measures of excreting animal populations, possibly due to a misidentification of the main contaminating reservoir(s). Altogether, presented data stimulate the exploration of alternative reservoir animal hosts.
Directory of Open Access Journals (Sweden)
Leon Biscornet
2017-08-01
Full Text Available Leptospirosis is a bacterial zoonosis caused by pathogenic Leptospira for which rats are considered as the main reservoir. Disease incidence is higher in tropical countries, especially in insular ecosystems. Our objectives were to determine the current burden of leptospirosis in Seychelles, a country ranking first worldwide according to historical data, to establish epidemiological links between animal reservoirs and human disease, and to identify drivers of transmission.A total of 223 patients with acute febrile symptoms of unknown origin were enrolled in a 12-months prospective study and tested for leptospirosis through real-time PCR, IgM ELISA and MAT. In addition, 739 rats trapped throughout the main island were investigated for Leptospira renal carriage. All molecularly confirmed positive samples were further genotyped.A total of 51 patients fulfilled the biological criteria of acute leptospirosis, corresponding to an annual incidence of 54.6 (95% CI 40.7-71.8 per 100,000 inhabitants. Leptospira carriage in Rattus spp. was overall low (7.7% but dramatically higher in Rattus norvegicus (52.9% than in Rattus rattus (4.4%. Leptospira interrogans was the only detected species in both humans and rats, and was represented by three distinct Sequence Types (STs. Two were novel STs identified in two thirds of acute human cases while noteworthily absent from rats.This study shows that human leptospirosis still represents a heavy disease burden in Seychelles. Genotype data suggests that rats are actually not the main reservoir for human disease. We highlight a rather limited efficacy of preventive measures so far implemented in Seychelles. This could result from ineffective control measures of excreting animal populations, possibly due to a misidentification of the main contaminating reservoir(s. Altogether, presented data stimulate the exploration of alternative reservoir animal hosts.
Effects of Acute Oral 5-aminotetrazole (5-AT) Exposure to Rats (Rattus norvegicus)
2015-02-12
g/dL), sodium (Na mmol/L), potassium (K mmol/L), and chlorine (Cl mmol/L). Cauda epididymal sperm counts were determined using a computer-assisted...mg/kg- day tissue weight (g) sperm y/n M sperm / gram % motile average % progressive average 13- 953 0.024 n - - - 13- 954 0.027 n - - - 13- 969 0.017 n...8 7.5 Sperm Analysis
Directory of Open Access Journals (Sweden)
Dina Supriyati
2014-01-01
Full Text Available ABSTRACTRats harm to human life, both in terms of economics and health. Rats transmitted disease, ectoparasites andendoparasites. Many potential sites where rat found in high enough quantities, one of those sites is a traditionalmarket. The purpose of this study was to know the presence of rats and fleas in the market town Banjarnegara,Banjarnegara District. This research is a descriptive study using survey methods. Research design using crosssectionalapproach. Rats data obtained by trapping rats using a live trap. Population was rats living in marketsBanjarnegara, Banjarnegara. The sample was rats that were caught using bait traps roasted coconut andcucumber. The collected data were analyzed descriptively. Result showed that 33 rats had been caught during thestudy. The most abundant species was Rattus tanezumi (84.85%, while the least is Rattus norvegicus (3.03%. Asmuch 20 (60.61% were male higger than female rat as much as 13 rats (39.39%. Rats in the market stalls(77,42% greater than the outside market stall (22,58%. The trap succes were 8.25% with the successful captureof the highest rats on day 2 (4.5%. While the success of trapping rats (trap success based on the location of thearrest shows that in the market stalls (6.5% greater than the outside market stall (1.75%. Number of fleas thatinfest species caught as many as 67 tails. Species of fleas that infest rats identified as Xenopsylla cheopis. Commonflea index as much 2,03 upper than standard. Control of rats and fleas (Xenopsylla cheopis was needed.Key words: trap success, rats, fleasABSTRAKTikus merugikan bagi kehidupan manusia, baik dari sisi ekonomi maupun kesehatan. Tikus membawa kumanpenyakit, ektoparasit dan endoparasit. Pasar tradisional merupakan tempat potensial ditemukan tikus dalamjumlah cukup tinggi. Tujuan penelitian untuk mengetahui keberadaan tikus, cecurut dan ektoparasit pinjal diPasar Kota Banjarnegara, Kabupaten Banjarnegara. Penelitian deskriptif dengan metode survei
The use of experimental animals in spa research
Directory of Open Access Journals (Sweden)
Iluta Alexandru
2011-05-01
Full Text Available A laboratory rat is a rat of species Rattus norvegicus which is bred and kept for scientific research. Laboratory rats have served as an important animal model for reaserch in psychology medicine , and other fields.Laboratory rats share origins with their cousins in domestication , the fancy rats. In 18th century Europe , wild Brown rats ran rampant and this infestation fueled the industry of rat-catching .Rat-cathcers would not only make money by trapping the rodents , but also by turning around and selling them for food , or more importantly , for rat-baiting . Rat-baiting was a popular sport which involved filling a pit with rats and timing how long it took for a terrier to kill them all.
Epidemiological role of a rodent in Morocco: Case of cutaneous leishmaniasis
Directory of Open Access Journals (Sweden)
Mohamed Echchakery
2015-08-01
Full Text Available Commensal rodents as well as wild ones may present a potential risk to public health. They are reservoirs or vectors of many pathogens. This review provides an update on their epidemiological role in the spread of leishmaniasis in Morocco. In Morocco, the order Rodentia is represented by 7 families and 32 species of which Rattus norvegicus, Psammomys obesus, Mastomys erythrolecus, Meriones shawi, Meriones crassus and Meriones libycus are considered reservoirs of leishmaniasis in Asia, Midle East and Africa. With the aim to define the extent of zoonotic leishmaniasis risk in Morocco, we represent and discuss the geographical distribution of these potential reservoirs in relation to that of Phlebotomus papatasi, proven vector of cutaneous leishmaniasis by Leishmania major in Morocco.
Rodent-borne diseases and their public health importance in Iran.
Directory of Open Access Journals (Sweden)
Mohammad Hasan Rabiee
2018-04-01
Full Text Available Rodents are reservoirs and hosts for several zoonotic diseases such as plague, leptospirosis, and leishmaniasis. Rapid development of industry and agriculture, as well as climate change throughout the globe, has led to change or increase in occurrence of rodent-borne diseases. Considering the distribution of rodents throughout Iran, the aim of this review is to assess the risk of rodent-borne diseases in Iran.We searched Google Scholar, PubMed, Science Direct, Scientific Information Database (SID, and Magiran databases up to September 2016 to obtain articles reporting occurrence of rodent-borne diseases in Iran and extract information from them. Out of 70 known rodent-borne diseases, 34 were reported in Iran: 17 (50% parasitic diseases, 13 (38% bacterial diseases, and 4 (12% viral diseases. Twenty-one out of 34 diseases were reported from both humans and rodents. Among the diseases reported in the rodents of Iran, plague, leishmaniasis, and hymenolepiasis were the most frequent. The most infected rodents were Rattus norvegicus (16 diseases, Mus musculus (14 diseases, Rattus rattus (13 diseases, Meriones persicus (7 diseases, Apodemus spp. (5 diseases, Tatera indica (4 diseases, Meriones libycus (3 diseases, Rhombomys opimus (3 diseases, Cricetulus migratorius (3 diseases, and Nesokia indica (2 diseases.The results of this review indicate the importance of rodent-borne diseases in Iran. Considering notable diversity of rodents and their extensive distribution throughout the country, it is crucial to pay more attention to their role in spreading infectious diseases for better control of the diseases.
Rodent-borne diseases and their public health importance in Iran
Mahmoudi, Ahmad; Siahsarvie, Roohollah; Kryštufek, Boris; Mostafavi, Ehsan
2018-01-01
Background Rodents are reservoirs and hosts for several zoonotic diseases such as plague, leptospirosis, and leishmaniasis. Rapid development of industry and agriculture, as well as climate change throughout the globe, has led to change or increase in occurrence of rodent-borne diseases. Considering the distribution of rodents throughout Iran, the aim of this review is to assess the risk of rodent-borne diseases in Iran. Methodology/Principal finding We searched Google Scholar, PubMed, Science Direct, Scientific Information Database (SID), and Magiran databases up to September 2016 to obtain articles reporting occurrence of rodent-borne diseases in Iran and extract information from them. Out of 70 known rodent-borne diseases, 34 were reported in Iran: 17 (50%) parasitic diseases, 13 (38%) bacterial diseases, and 4 (12%) viral diseases. Twenty-one out of 34 diseases were reported from both humans and rodents. Among the diseases reported in the rodents of Iran, plague, leishmaniasis, and hymenolepiasis were the most frequent. The most infected rodents were Rattus norvegicus (16 diseases), Mus musculus (14 diseases), Rattus rattus (13 diseases), Meriones persicus (7 diseases), Apodemus spp. (5 diseases), Tatera indica (4 diseases), Meriones libycus (3 diseases), Rhombomys opimus (3 diseases), Cricetulus migratorius (3 diseases), and Nesokia indica (2 diseases). Conclusions/Significance The results of this review indicate the importance of rodent-borne diseases in Iran. Considering notable diversity of rodents and their extensive distribution throughout the country, it is crucial to pay more attention to their role in spreading infectious diseases for better control of the diseases. PMID:29672510
International Nuclear Information System (INIS)
Camats, Nuria; Ruiz-Herrera, Aurora; Parrilla, Juan Jose; Acien, Maribel; Paya, Pilar; Giulotto, Elena; Egozcue, Josep; Garcia, Francisca; Garcia, Montserrat
2006-01-01
The Norwegian rat (Rattus norvegicus) is the most widely studied experimental species in biomedical research although little is known about its chromosomal structure. The characterisation of possible unstable regions of the karyotype of this species would contribute to the better understanding of its genomic architecture. The cytogenetic effects of ionising radiation have been widely used for the study of genomic instability, and the importance of interstitial telomeric-like sequences (ITSs) in instability of the genome has also been reported in previous studies in vertebrates. In order to describe the unstable chromosomal regions of R. norvegicus, the distribution of breakpoints induced by X-irradiation and ITSs in its karyotype were analysed in this work. For the X-irradiation analysis, 52 foetuses (from 14 irradiated rats) were studied, 4803 metaphases were analysed, and a total of 456 breakpoints induced by X-rays were detected, located in 114 chromosomal bands, with 25 of them significantly affected by X-irradiation (hot spots). For the analysis of ITSs, three foetuses (from three rats) were studied, 305 metaphases were analysed and 121 ITSs were detected, widely distributed in the karyotype of this species. Seventy-six percent of all hot spots analysed in this study were co-localised with ITSs
Energy Technology Data Exchange (ETDEWEB)
Camats, Nuria [Institut de Biotecnologia i Biomedicina (IBB), Universitat Autonoma de Barcelona, 08193 Barcelona (Spain); Departament de Biologia Cel.lular, Fisiologia i Immunologia Universitat Autonoma de Barcelona, 08193 Barcelona (Spain); Ruiz-Herrera, Aurora [Departament de Biologia Cel.lular, Fisiologia i Immunologia Universitat Autonoma de Barcelona, 08193 Barcelona (Spain); Parrilla, Juan Jose [Servicio de Ginecologia y Obstetricia, Hospital Universitario Virgen de la Arrixaca, Ctra, Madrid-Cartagena, s/n, El Palmar, 30120 Murcia (Spain); Acien, Maribel [Servicio de Ginecologia y Obstetricia, Hospital Universitario Virgen de la Arrixaca, Ctra, Madrid-Cartagena, s/n, El Palmar, 30120 Murcia (Spain); Paya, Pilar [Servicio de Ginecologia y Obstetricia, Hospital Universitario Virgen de la Arrixaca, Ctra, Madrid-Cartagena, s/n, El Palmar, 30120 Murcia (Spain); Giulotto, Elena [Dipartimento di Genetica e Microbiologia Adriano Buzzati Traverso, Universita degli Studi di Pavia, 27100 Pavia (Italy); Egozcue, Josep [Departament de Biologia Cel.lular, Fisiologia i Immunologia Universitat Autonoma de Barcelona, 08193 Barcelona (Spain); Garcia, Francisca [Institut de Biotecnologia i Biomedicina (IBB), Universitat Autonoma de Barcelona, 08193 Barcelona (Spain); Garcia, Montserrat [Institut de Biotecnologia i Biomedicina (IBB), Universitat Autonoma de Barcelona, 08193 Barcelona (Spain) and Departament de Biologia Cellular, Fisiologia i Immunologia Universitat Autonoma de Barcelona, 08193 Barcelona (Spain)]. E-mail: Montserrat.Garcia.Caldes@uab.es
2006-03-20
The Norwegian rat (Rattus norvegicus) is the most widely studied experimental species in biomedical research although little is known about its chromosomal structure. The characterisation of possible unstable regions of the karyotype of this species would contribute to the better understanding of its genomic architecture. The cytogenetic effects of ionising radiation have been widely used for the study of genomic instability, and the importance of interstitial telomeric-like sequences (ITSs) in instability of the genome has also been reported in previous studies in vertebrates. In order to describe the unstable chromosomal regions of R. norvegicus, the distribution of breakpoints induced by X-irradiation and ITSs in its karyotype were analysed in this work. For the X-irradiation analysis, 52 foetuses (from 14 irradiated rats) were studied, 4803 metaphases were analysed, and a total of 456 breakpoints induced by X-rays were detected, located in 114 chromosomal bands, with 25 of them significantly affected by X-irradiation (hot spots). For the analysis of ITSs, three foetuses (from three rats) were studied, 305 metaphases were analysed and 121 ITSs were detected, widely distributed in the karyotype of this species. Seventy-six percent of all hot spots analysed in this study were co-localised with ITSs.
Environmental Factors and Zoonotic Pathogen Ecology in Urban Exploiter Species.
Rothenburger, Jamie L; Himsworth, Chelsea H; Nemeth, Nicole M; Pearl, David L; Jardine, Claire M
2017-09-01
Knowledge of pathogen ecology, including the impacts of environmental factors on pathogen and host dynamics, is essential for determining the risk that zoonotic pathogens pose to people. This review synthesizes the scientific literature on environmental factors that influence the ecology and epidemiology of zoonotic microparasites (bacteria, viruses and protozoa) in globally invasive urban exploiter wildlife species (i.e., rock doves [Columba livia domestica], European starlings [Sturnus vulgaris], house sparrows [Passer domesticus], Norway rats [Rattus norvegicus], black rats [R. rattus] and house mice [Mus musculus]). Pathogen ecology, including prevalence and pathogen characteristics, is influenced by geographical location, habitat, season and weather. The prevalence of zoonotic pathogens in mice and rats varies markedly over short geographical distances, but tends to be highest in ports, disadvantaged (e.g., low income) and residential areas. Future research should use epidemiological approaches, including random sampling and robust statistical analyses, to evaluate a range of biotic and abiotic environmental factors at spatial scales suitable for host home range sizes. Moving beyond descriptive studies to uncover the causal factors contributing to uneven pathogen distribution among wildlife hosts in urban environments may lead to targeted surveillance and intervention strategies. Application of this knowledge to urban maintenance and planning may reduce the potential impacts of urban wildlife-associated zoonotic diseases on people.
KAJIAN EPIDEMIOLOGI KEJADIAN LEPTOSPIROSIS DI KOTA SEMARANG DAN KABUPATEN DEMAK TAHUN 2008
Directory of Open Access Journals (Sweden)
Bambang Yuniarto
2013-09-01
Full Text Available Leptospirosis is one of rodent borne neglected diseases, but health problem in day. Transmision of Leptospirosis occurs by contact with water or humid soil contaminated with urine from rodent infected with Leptospira. The aim of this research was to know epidemiology Leptospirosis in Semarang City and Demak District, in April-November 2008. The design of this research was cross sectional. The activity included Leptospirosis diagnosis with Rapid Diagostic Test (Leptotek Dri Dot and rat trappings. Data were analysed descriptively by using tables, graphics and maps. The result showed that in 2008, Leptospirosis incidence in the both areas was higher compared to the previous year. The Leptospirosis cases tended to increase in the rainy season. In Semarang City, Leptospirosis cases were mostly found in the age group of 0-19 years (44,1% and 51% of the total cases were female. In Demak District, the cases were mostly found in the age group of 40-49 years (25,7% and 75,7% from the total cases were male. The spesies rats found in this research were Rattus tanezumi, R.norvegicus, B.indica, Mus musculus, R.exculan and Suncus murinus. Kidney test of the rats caught in Semarang City showed Rattus tanezumi, R.norwegicus, B.indica, and R.exculan were infected with Leptospira sp.
A new species of Microphallus (Trematoda: Microphallidae from Venezuela
Directory of Open Access Journals (Sweden)
M.T Díaz
2004-06-01
Full Text Available During 1997-1999, a total of 94 crabs, Uca rapax were collected from La Sabana, La Ceiba and El Paujil, Sucre State, Venezuela. Of these 36 were infected with metacercariae. Two parasites were located in the abdominal muscles and one under the tissue of carapace and gonad. These metacercariae grew to adults in the following genera: Levinseniella, Microphallus and Maritrema, in the period of 2-5 days after feeding experimentally to the rat Rattus norvegicus, mice Mus musculus and duck Cairinia moschata. Specimens of the genus Microphallus were described herein as a new species M. sabanensis. The life cycle of M. sabanensis sp.nov. were studied experimentally using rat, mice and duck. All developmental stages and the adult are described. In addition, M. sabanensis was collected from wild birds Anas discors, Pluvialis squatarola, Butorides striatus, Egretta caerulea and Nycticorax violaceus from the same localitiesDurante 1997-1999, se recolectaron en La Sabana, La Ceiba y El Paujil del Distrito Cajigal, Estado Sucre, Venezuela, un total de 94 cangrejos Uca rapax, 36 de ellos estaban parasitados con tres especies de metacercarias de digéneos. Dos de ellos localizados en la musculatura del abdomen y una en el tejido que recubre internamente el caparazón y las gónadas. Estas metacercarias fueron dadas como alimento a ratones Mus musculus, ratas Rattus norvegicus, y patos Cairina moschata y tres genéros de microfálidos, Levinseniella, Microphallus y Maritrema fueron recuperados del intestino delgado de estos animales después de 2-5 días de la infección. Especimenes del genero Microphallus de este estudio se describen como Microphallus sabanensis sp.n. Se estudió experimentalmente los aspectos de ciclo vida de la especie, utilizando ratas, ratones y patos. Se describen todas las estapas larvales y los adultos. Además, M. sabanensis se encuentra naturalmente en las aves: Anas discors, Pluvialis squatarola, Butorides striatus, Egretta caerulea
Directory of Open Access Journals (Sweden)
Oswaldo Paulo Forattini
1970-06-01
Full Text Available São relatadas as investigações que levaram a efeito o encontro de foco natural da Tripanossomose Americana, na área ocupada pelo bairro denominado Chácara Flora, na cidade de São Paulo. Esse foco conta com o concurso do triatomíneo Panstrongylus megistus, de gambás Didelphis marsupialis e de ratos domésticos da espécie Rattus norvegicus. A presença destes últimos permite admitir maior aproximação da infecção no sentido do ambiente humano. O encontro de um espécimen adulto fêmea de P. megistus sugando ativamente o homem dentro da habitação, aliado à revisão da literatura, permite supor que não se trata de subespécie ecológica. A presença de diferenças essenciais de comportamento no norte e sul do Brasil, no estado atual dos conhecimentos, seria resultante, preponderantemente, da ação de fatôres ambientais, entre os quais, as condições climáticas.A natural focus of American Trypanosomiasis was found in the city of S. Paulo. It was localized in a forest area preserved for residential purposes. In this focus the participation of triatomids bugs Panstrongylus megistus, marsupials of Diaelphis marsupialis species and domestics rats Rattus norvegicus was observed. Natural infection of all of them was observed. The ecotopes were found mainly in the pinus trees Cryptomeria japonica. Beside this, an adult female of P. megistus was found suckling actively humans inside the house. Some considerations are made in this paper concerning the distribution area of that species of triatomid. The sylvatic population found currently in South Brazil, represents probably the action of environmental factors limiting the bugs to its natural ecotopes. Nevertheless, these findings suggest that, from the epidemiological point of view, some approximation of the infection to the human environment was performed, at least, in urban areas.
DEFF Research Database (Denmark)
Lund, H. S.; Wang, T.; Chang, E. S.
2009-01-01
Live Norway lobsters (Nephrops norvegicus L.) were trawled at depths of 30 to 55 m off the coast of Jutland (Denmark) in late winter (March) and in summer (August) in 2006. Water temperatures at the bottom and surface of the sea were 7 °C and 2 °C during the winter, and 12 °C and 21 °C in the sum......Live Norway lobsters (Nephrops norvegicus L.) were trawled at depths of 30 to 55 m off the coast of Jutland (Denmark) in late winter (March) and in summer (August) in 2006. Water temperatures at the bottom and surface of the sea were 7 °C and 2 °C during the winter, and 12 °C and 21 °C...... in the summer, respectively. The recovery of specific physiological and metabolic variables from the intense stresses associated with capture (trawling and air-exposure during sorting) was followed in seawater at 5 °C in winter or 18 °C in summer. Recovery was compared in lobsters held individually in two......-base status. In winter, a potential metabolic lactic acidosis was compensated by a marked respiratory alkalosis, with significantly increased haemolymph pH and decreased CO2 total content and partial pressure. These effects disappeared gradually over 96 h. Summer lobsters showed combined metabolic...
DEFF Research Database (Denmark)
Markussen, Mette Drude; Heiberg, Ann-Charlotte; Fredholm, Merete
2008-01-01
in European strains of Norway rats while high hepatic levels of calumenin has been suggested responsible for resistance in an US strain of rats. To characterize the resistance mechanism in a Danish strain of bromadiolone-resistant Norway rats (with an Y139C-VKORC1 mutation), we compared VKORC1 and Calumenin......Anticoagulant resistance in Norway rats (Rattus norvegicus) has been associated with two genes, VKORC1 and Calumenin, which encodes proteins essential to the vitamin K-dependent gamma-carboxylation system. Mutations in the VKORC1 gene are considered the genetic basis for anticoagulant resistance...... liver gene expression between resistant and anticoagulant-susceptible rats upon saline and bromadiolone-administration. The resistant male and female rats had significantly lower constitutive VKORC1 expression (57 % and 63 %) compared to the susceptible rats (100 %) while the constitutive Calumenin...
Rodrigues, Fernando Postalli; Angeli, José Pedro Friedmann; Mantovani, Mário Sérgio; Guedes, Carmen Luisa Barbosa; Jordão, Berenice Quinzani
2010-01-01
Polycyclic aromatic hydrocarbons (PAHs) are genotoxic chemicals commonly found in effluents from oil refineries. Bioassays using plants and cells cultures can be employed for assessing environmental safety and potential genotoxicity. In this study, the genotoxic potential of an oil refinery effluent was analyzed by means of micronucleus (MN) testing of Alium cepa, which revealed no effect after 24 h of treatment. On the other hand, primary lesions in the DNA of rat (Rattus norvegicus) hepatoma cells (HTC) were observed through comet assaying after only 2 h of exposure. On considering the capacity to detect DNA damage of a different nature and of these cells to metabolize xenobiotics, we suggest the association of the two bioassays with these cell types, plant (Allium cepa) and mammal (HTC) cells, for more accurately assessing genotoxicity in environmental samples.
Directory of Open Access Journals (Sweden)
Kafil Akhtar
2012-04-01
Full Text Available Human beings are increasingly being exposed to chloroacetic acid (CAA, a type of halo acetic acid. It would not be an exaggeration to say that almost the whole humankind today is affected by it or its metabolites. The concern over the carcinogenicity of haloacetic acids led the United States Environmental Protection Agency to regulate the allowable concentration of haloacetic acids in drinking water as part of the Disinfectants and Disinfection Byproducts Rule promulgated in 1998. Keeping this view in mind, the present study on histolopathological evaluation of different types of tissues viz., brain, kidney, liver, spleen and testes of Rattus norvegicus was performed, to find out the subacute toxicity of chloroacetic acid and correlation between CAA administration and changes in malondialdehyde (MDA level in blood.
Reproductive success of bromadiolone-resistant rats in absence of anticoagulant pressure
DEFF Research Database (Denmark)
Heiberg, Ann-Charlotte; Leirs, Herwig; Siegismund, Hans Redlef
2006-01-01
Resistance to anticoagulant rodenticides in brown rats (Rattus norvegicus Berk.) is associated with pleiotropic effects, notably with an increased dietary vitamin K requirement. Owing to this disadvantage, resistance is believed to be selected against if anticoagulant selection is absent. In small...... experimental populations of wild brown rats, an investigation was carried out to establish whether tolerance to anticoagulant exposure changed over a period of 2 years. In the same populations, DNA microsatellite markers were used to infer parentage, and this made it possible to estimate reproductive success...... of sensitive and resistant rats and estimate effective population size, Ne. Even though there was evidence for a selection against resistant rats with high vitamin K requirement, anticoagulant tolerance was not seen to be significantly influenced in the absence of bromadiolone selection. As the population size...
Directory of Open Access Journals (Sweden)
Roberta Lima Caldeira
2007-11-01
Full Text Available Seeking the identification of Angiostrongylus cantonensis as a potential etiological agent of three clinical cases of eosinophilic meningitis, mollusc specimens were collected in the state of Espírito Santo, Brazil. The snails were identified as Sarasinula marginata (45 specimens, Subulina octona (157, Achatina fulica (45 and Bradybaena similaris (23. Larvae obtained were submitted to polymerase chain reaction and restriction fragment length polymorphism diagnosis. Their genetic profile were corresponded to A. cantonensis. Rattus norvegicus experimentally infected with third-stage larvae, developed menigoencephalitis, and parasites became sexually mature in the lungs. Additionally, larvae obtained from A. fulica snails, from São Vicente, state of São Paulo, also showed genetic profiles of this nematode. This is the first record of Brazilian molluscs infected with this nematode species.
Histopathological effects of doxorubicin on pancreas in male albino rats
Directory of Open Access Journals (Sweden)
I.A. Ali
2015-06-01
Full Text Available The aim of this study was to investigate the histopathological side effects of doxorubicin on pancreas tissue in male albino rats Rattus norvegicus. This study were used 55 adult rats (2.5-3.5 month of age. The rats divided into two groups, the first group include (35 rats. The second group were (20 rats. Microscopial examination of pancreas lesion demonstrated oedema around the acini, swelling of the epithelial cells of acini, occurance of cystic fibrosis (mucoviscidosis at the concentration of (4,5 mg/kg of body weight ,occurrence of small islets that form of few cells and exocrine-endocrine transformation. There were thickness in the walls of blood vessels, thrombus, congestion of blood vessels, we conclude, that doxorubicin had histopathological effect on pancreas in sub-acute doses more than chronic doses.
DEFF Research Database (Denmark)
Madsen, Niels; Holst, René; Frandsen, Rikke
2012-01-01
A substantial improvement in the bycatch selectivity of Norway lobster Nephrops norvegicus trawls is required, particularly with respect to cod Gadus morhua , whose stocks are at low levels in several areas. Conventional escape windows are not adequate to properly release cod and other bycatch...... species caught in the trawls. To address this issue, we developed a novel sorting box concept consisting of a four-panel section with a window on the top in order to improve the escape of cod and other bycatch species through an escape window while retaining the target catch of Norway lobster. The concept....... The reduction in bycatch decreased with decreasing mesh size and increasing height of the sorting box. Escape of Norway lobster through the escape window was limited. A modified version of the sorting box concept was implemented in the Kattegat fishery from 2009 onwards...
Directory of Open Access Journals (Sweden)
de Campos Ciccone Carla
2013-01-01
Full Text Available Abstract Background In this study, we investigate the effects of microcurrent stimulation on the repair process of xiphoid cartilage in 45-days-old rats. Methods Twenty male rats were divided into a control group and a treated group. A 3-mm defect was then created with a punch in anesthetized animals. In the treated group, animals were submitted to daily applications of a biphasic square pulse microgalvanic continuous electrical current during 5 min. In each application, it was used a frequency of 0.3 Hz and intensity of 20 μA. The animals were sacrificed at 7, 21 and 35 days after injury for structural analysis. Results Basophilia increased gradually in control animals during the experimental period. In treated animals, newly formed cartilage was observed on days 21 and 35. No statistically significant differences in birefringent collagen fibers were seen between groups at any of the time points. Treated animals presented a statistically larger number of chondroblasts. Calcification points were observed in treated animals on day 35. Ultrastructural analysis revealed differences in cell and matrix characteristics between the two groups. Chondrocyte-like cells were seen in control animals only after 35 days, whereas they were present in treated animals as early as by day 21. The number of cuprolinic blue-stained proteoglycans was statistically higher in treated animals on days 21 and 35. Conclusion We conclude that microcurrent stimulation accelerates the cartilage repair in non-articular site from prepuberal animals.
Treatment of Partial Thickness Burns with a Novel Extracellular Matrix in Rats (Rattus norvegicus)
2016-12-20
partial thickness burn was produced using a brass scale weight. Groups of 10 rats were randomly assigned to the various treatments . Jackets made from...Objectives: The objective this study was to examine the cellular and immune responses to various extracellular matrices (ECM) in a rat burn model...significant difference between treatments in terms of mean wound area (p = 0.77). Histologic examination revealed that all of the grafts were infected, with
DEFF Research Database (Denmark)
Kogelman, Lisette Johanna Antonia; Christensen, Rikke Elgaard; Pedersen, Sara Hougaard
2017-01-01
The trigeminal ganglia (TG) subserving the head and the dorsal root ganglia (DRG) subserving the rest of the body are homologous handling sensory neurons. Differences exist, as a number of signaling substances cause headache but no pain in the rest of the body. To date, very few genes involved...... in this difference have been identified. We aim to reveal basal gene expression levels in TG and DRG and detect genes that are differentially expressed (DE) between TG and DRG. RNA-Sequencing from six naïve rats describes the whole transcriptome expression profiles of TG and DRG. Differential expression analysis...... was followed by pathway analysis to identify DE processes between TG and DRG. In total, 64 genes had higher and 55 genes had lower expressed levels in TG than DRG. Higher expressed genes, including S1pr5 and Gjc2, have been related to phospholipase activity. The lower expressed genes, including several Hox...
Directory of Open Access Journals (Sweden)
Diah Krisnansari
2016-09-01
Full Text Available Introduction: The prevalence of chronic liver disease continues to increase. One potentially hepatotoxic substances that cause chronic liver disease is carbon tetrachloride. The process of liver damage can be prevented by the antioxidant role of propolis. The aims of this research was to study the hepatoprotective potential of propolis toward hepar injury rats induced by carbon tetrachlorida. Method: This was an experimental study with pre-post test. Twenty five male Wistar rats aged 12–16 week old, weighing 125–200 gr were allocated into 5 groups. Group I: standard meal + aquadest-gavage; group II: standard meal + CCl4 1% 1 mL + aquadest-gavage, group III: standard meal + CCl4 1% 1 mL + 0,054 gr propolis-gavage, group IV: standard meal + CCl4 1% 1 mL + 0,108 gr propolis-gavage and group V: standard meal + CCl4 1% 1 mL + sylimarin 50 mg/kg-gavage. IL-6, SOD, NAS score+fibrotic were measured after treatment. Analysed of IL-6 and NAS score+fibrotic with Kruskal Wallis to Mann Whitney and analysed of SOD with One-Way ANOVA to LSD. Results: The study showed that there were significant differences in IL-6, SOD and NAS score + fibrotic between groups. Discussion: Provision of 0,054 gr and 0,108 gr have hepatoprotective potential toward hepar injury rats induced by carbon tetrachlorida. Further research need to identify antioxidants and hepatoprotective potential of propolis on human with liver disease. Keywords: IL-6, SOD, fibrotic, propolis
The prevalence of Leptospira sp in sewer rats (Rattus norvegicus)
DEFF Research Database (Denmark)
Krøigaard, Louise; Villumsen, Steen; Markussen, Mette Drude
Test). Preliminary results based on one fourth of the captured rats indicate, that the prevalence of pathogenic leptospira infected sewer rats are relatively high, as 28 out 48 rats were positive by PCR. This suggests that the sewer could be an environment representing high prevalence of leptospira...... among rats and thus an environment with high risk of transmission....
Directory of Open Access Journals (Sweden)
French Frank S
2006-02-01
Full Text Available Abstract Background beta-defensins are small cationic peptides that exhibit broad spectrum antimicrobial properties. The majority of beta-defensins identified in humans are predominantly expressed in the male reproductive tract and have roles in non-immunological processes such as sperm maturation and capacitation. Characterization of novel defensins in the male reproductive tract can lead to increased understanding of their dual roles in immunity and sperm maturation. Methods In silico rat genomic analyses were used to identify novel beta-defensins related to human defensins 118–123. RNAs isolated from male reproductive tract tissues of rat were reverse transcribed and PCR amplified using gene specific primers for defensins. PCR products were sequenced to confirm their identity. RT-PCR analysis was performed to analyze the tissue distribution, developmental expression and androgen regulation of these defensins. Recombinant defensins were tested against E. coli in a colony forming unit assay to analyze their antimicrobial activities. Results Novel beta-defensins, Defb21, Defb24, Defb27, Defb30 and Defb36 were identified in the rat male reproductive tract. Defb30 and Defb36 were the most restricted in expression, whereas the others were expressed in a variety of tissues including the female reproductive tract. Early onset of defensin expression was observed in the epididymides of 10–60 day old rats. Defb21-Defb36 expression in castrated rats was down regulated and maintained at normal levels in testosterone supplemented animals. DEFB24 and DEFB30 proteins showed potent dose and time dependent antibacterial activity. Conclusion Rat Defb21, Defb24, Defb27, Defb30 and Defb36 are abundantly expressed in the male reproductive tract where they most likely protect against microbial invasion. They are developmentally regulated and androgen is required for full expression in the adult epididymis.
Identifying polymorphisms in the Rattus norvegicus D3 dopamine receptor gene and regulatory region
Smits, B.M.; D'Souza, U.M.; Berezikov, E.; Cuppen, E.; Sluyter, F.
2004-01-01
The D(3) dopamine receptor has been implicated in several neuropsychiatric disorders, including schizophrenia, Parkinson's disease and addiction. Sequence variation in the D(3) gene can lead to subtle alteration in receptor structure or gene expression and thus to a different phenotype. In this
Effects of Acute and Subacute Oral Methylnitroguanidine (MeNQ) Exposure to Rats (Rattus norvegicus)
2016-04-20
white rabbits, however, it did cause mild conjunctival irritation [2]. Testing of MeNQ in a guinea pig indicated that MeNQ is a weak skin sensitizer... pig maximization test, where one guinea pig out of an unspecified number showed a sensitizing reaction. Additionally, MeNQ is potentially metabolized...assist in the identification of a specific product . ACKNOWLEDGEMENTS The authors gratefully acknowledge the support of Karl Kroeck and Emanuel Hignutt
CHRONIC ALCOHOLISM ON THE SEMINAL VESICLE AND TESTIS WEIGHT OF ADULT RATS (Rattus norvegicus)
Martinez, F. E.; Martinez, M.; Cagnon, V. H. A.; Mello Junior, W.; Padovani, C. R.; Garcia, P. J.
1997-01-01
Effects of experimental chronic alcoholism on the accessory sexual glands weight and testes weight were studied. Male adult albino rats received only sugar cane brandy at 30 Gay Lussac (v/v), while the controls received tap water. After periods of 60, 120, 180 and 240 days, rats from each group were anesthetized, weighed and sacrificed. Alterations in mean daily solid food intake and liquid, mean daily weight gain, mean prostate weight, mean seminal vesicle and coagulating gland weights and t...
de Campos Ciccone, Carla; Zuzzi, Denise Cristina; Neves, Lia Mara Grosso; Mendonça, Josué Sampaio; Joazeiro, Paulo Pinto; Esquisatto, Marcelo Augusto Marretto
2013-01-19
In this study, we investigate the effects of microcurrent stimulation on the repair process of xiphoid cartilage in 45-days-old rats. Twenty male rats were divided into a control group and a treated group. A 3-mm defect was then created with a punch in anesthetized animals. In the treated group, animals were submitted to daily applications of a biphasic square pulse microgalvanic continuous electrical current during 5 min. In each application, it was used a frequency of 0.3 Hz and intensity of 20 μA. The animals were sacrificed at 7, 21 and 35 days after injury for structural analysis. Basophilia increased gradually in control animals during the experimental period. In treated animals, newly formed cartilage was observed on days 21 and 35. No statistically significant differences in birefringent collagen fibers were seen between groups at any of the time points. Treated animals presented a statistically larger number of chondroblasts. Calcification points were observed in treated animals on day 35. Ultrastructural analysis revealed differences in cell and matrix characteristics between the two groups. Chondrocyte-like cells were seen in control animals only after 35 days, whereas they were present in treated animals as early as by day 21. The number of cuprolinic blue-stained proteoglycans was statistically higher in treated animals on days 21 and 35. We conclude that microcurrent stimulation accelerates the cartilage repair in non-articular site from prepuberal animals.
Hydrodynamic, non-photic modulation of biorhythms in the Norway lobster, Nephrops norvegicus (L.)
Aguzzi, J.; Puig, P.; Company, J. B.
2009-03-01
Data on biological rhythms of the Norway lobster Nephrops norvegicus (L.) are compared with new findings on inertial currents, a non-photic geophysical hydrodynamic fluctuation. Laboratory experiments on animal endogenous cardiac activity and locomotor rhythms using individuals from the middle slope (400-600 m depth) of the Mediterranean Sea revealed a consistent proportion of ultradian 18-h animals (20.6% and 12.0% of the studied cases for cardiac and locomotor tests, respectively). This characteristic, not reported in similar experiments with individuals from shallower depths (20-200 m) in the Atlantic Ocean, was initially considered meaningless from an ecological point of view. However, a close comparison with in situ oceanographic measurements over 1 year revealed a clear relationship between inertial current fluctuations and the observed 18-h behavioural and physiological rhythms. We propose a novel scenario involving potential non-photic (i.e. hydrodynamic) modulation of Nephrops biorhythms, and suggest that this may provide a paradigm for other benthic species in deep-water areas.
Effects of drilling cuttings on the behavior of the Norway lobster Nephrops norvegicus
Energy Technology Data Exchange (ETDEWEB)
Richardson, C A
1984-05-01
Small quantities of drilling cuttings (100 g/250 cm/sup 2/) were found to affect both the survival and general behavior of Nephrops norvegicus held in experimental aquaria. In one experiment volatile hydrocarbons released from the cuttings caused a significant decrease in the heat of the exopodite on the third maxilliped. Flicking rates of the antennule and the time taken to identify and capture food introduced into the tanks were unaffected by exposure to cuttings. When the water flow through the tanks was interrupted for 12 h, 58% of animals died after exposure to the highest concentration of cuttings but those at the lower concentrations survived. After the water flow was restored the remaining survivors showed disorientated behavior and uncoordinated movements which lasted for about 36 h. In this condition animals will be more vulnerable to predators. This unnatural behavior may have serious implications for natural populations exposed to cuttings discharge in the close vicinity of offshore drilling platforms. 11 references, 3 tables.
Directory of Open Access Journals (Sweden)
Pedro Marcos Linardi
1984-06-01
Full Text Available Um levantamento de ectoparasitos de roedores domesticos da região urbana de Belo Horizonte, Minas Gerais, Brasil, foi realizado no período de junho de 1980 a setembro de 1982. As espécies de ectoparasitos capturadas de 950 Rattus norvegicus foram: Xenopsylla cheopis, Ctenocephalides felis felis, Polyplax spinulosa, Laelaps nuttalli, Eschinolaelaps echidninus e Atricholaelaps glasgowi, esta ultima apenas representada por três exemplares intercambiados com roedores silvestres. As espécies P. spinulosa e L. nuttalli, embora cosmopolitas, sao registradas pela primeira vez no Estado de Minas Gerais. A relação entre os sexos dos ectoparasitos bem como a prevalência de pulgas, ácaros e piolho por sexos separados de roedores são apresentadas. 66,9% dos roedores estavam infestados por ácaros, quase duas vezes mais do que as infestações por pulgas e piolho conjuntamente (39%. L. nuttalli foi a espécie mais numerosa e a que apresentou o maior índice de infestação: 55,1%. As infestações simples e associadas se equivaleram numericamente. P. spinulosa, ao contrário de L. nuttalli, raramente ocorreu em infestações simples. Dados sobre a distribuição dos ectoparasitos nos roedores sao também assinalados. A infestação observada em Belo Horizonte e confrontada com aquelas obtidas por outros autores em algumas cidades do mundo.A rodent ectoparasite survey was made in the city of Belo Horizonte, Minas Gerais, Brazil, from June 1980 to September 1982. The species of ectoparasites captured from 950 Rattus norvegicus norvegicus were: Xenopsylla cheopis, Ctenocephalides felis felis, Polyplax spinulosa, Laelaps nuttalli, Echinolaelaps echidninus and Atricholaelaps glasgowi, the last species only represented by three specimens interchanged with wild rodent. P. spinulosa and L. nuttalli, although cosmopolitan, are recorded for the first time in State of Minas Gerais. The sex ratio of the ectoparasites, as well as the prevalence of fleas, mites
Furrianca, María Cristina; Vásquez, Bélgica; del Sol, Mariano
2008-01-01
El bazo es el órgano linfático periférico más grande del organismo y conocer sus aspectos morfológicos cuantitativos es importante para determinar posibles patologías. El objetivo del estudio fue determinar en dos especies: cuye (Cavia porcellus) y rata (Rattus novergicus Sprague Dawley), las características estereológicas del bazo, para obtener patrones de normalidad cuantitativos, los que servirán de base para futuros estudios morfofuncionales. Se utilizaron 5 bazos de cada especie, clínica...
The accumulation and retention of 95mTc by the Norway lobster, Nephrops norvegicus L
International Nuclear Information System (INIS)
Swift, D.
2001-01-01
Laboratory experiments were carried out to study bioaccumulation and determine a concentration factor (CF) for technetium ( 95m Tc) in the homarid crustacean Nephrops norvegicus L. The steady state CF for accumulation from seawater was estimated to be about 2000 and the biological half-time was about 50 days. The highest tissue Tc concentrations were found in the green gland and the digestive gland. Depuration following accumulation from water was slow with a half-time of about 165 days. Tc accumulation from labelled food followed a biphasic model with one compartment containing about 94 percent of the ingested activity and with a half-time of about 1 day and the second compartment containing about 6 percent of the ingested activity with a half-time of about 56 days. Most retained activity was found in the digestive gland
Directory of Open Access Journals (Sweden)
Frans Saputra
2017-01-01
Full Text Available Buah anggur merah diduga memiliki kandungan pterostilbene, resveratrol, proantosianidin dan likopen yang memiliki efek terhadap penurunan kadar trigliserida. Penelitian ini bersifat eksperimental laboratorium dengan metode pre and post test with control group design. Objek penelitian 25 ekor tikus putih jantan, Rattus Novergicus, berat badan 150-200 gram, berumur 3-4 bulan yang dibagi menjadi 5 kelompok dengan teknik simple random sampling, kontrol negatif (aquadest, kontrol positif (Simvastatin 0,2mg/200gramBB/hari, kelompok perlakuan dosis I (100mg/200gramBB/hari, dosis II (250mg/200gramBB/hari, dosis III (500mg/200gramBB/ hari. Ekstrak etanol anggur merah dosis I, dosis II, dosis IIIdapat menurunkan kadar trigliserida darah dengan rerata penurunan secara berturut-turut adalah 147,4mg/dL, 135,2mg/dL, 97,2mg/dL. Pada uji statistic menggunakan one-way ANOVA didapatkan nilai p=0,000 (p<0,05, sehingga terdapat perbedaan signifikan kadar trigliserida darah tikus putih antar kelompok. Ekstrak etanol 96% anggur merah dosis 100mg; 250 dan 500 /200 gramBB/hari dapat menurunkan kadar trigliserida darah tikus putih. Kata kunci :Ekstrak Anggur Merah, Trigliserida, Rattus Novergicus
Genotoxic evaluation of an industrial effluent from an oil refinery using plant and animal bioassays
Directory of Open Access Journals (Sweden)
Fernando Postalli Rodrigues
2010-01-01
Full Text Available Polycyclic aromatic hydrocarbons (PAHs are genotoxic chemicals commonly found in effluents from oil refineries. Bioassays using plants and cells cultures can be employed for assessing environmental safety and potential genotoxicity. In this study, the genotoxic potential of an oil refinery effluent was analyzed by means of micronucleus (MN testing of Alium cepa, which revealed no effect after 24 h of treatment. On the other hand, primary lesions in the DNA of rat (Rattus norvegicus hepatoma cells (HTC were observed through comet assaying after only 2 h of exposure. On considering the capacity to detect DNA damage of a different nature and of these cells to metabolize xenobiotics, we suggest the association of the two bioassays with these cell types, plant (Allium cepa and mammal (HTC cells, for more accurately assessing genotoxicity in environmental samples.
Viral persistence, liver disease and host response in Hepatitis C-like virus rat model
DEFF Research Database (Denmark)
Trivedi, Sheetal; Murthy, Satyapramod; Sharma, Himanshu
2018-01-01
The lack of a relevant, tractable, and immunocompetent animal model for hepatitis C virus (HCV) has severely impeded investigations of viral persistence, immunity and pathogenesis. In the absence of immunocompetent models with robust HCV infection, homolog hepaciviruses in their natural host could...... potentially provide useful surrogate models. We isolated a rodent hepacivirus (RHV) from wild rats (Rattus norvegicus), RHV-rn1, acquired the complete viral genome sequence and developed an infectious reverse genetics system. RHV-rn1 resembles HCV in genomic features including the pattern of polyprotein...... cleavage sites and secondary structures in the viral 5' and 3' UTRs. We used site-directed and random mutagenesis to determine that only the first of the two miR-122 seed sites in viral 5'UTR is required for viral replication and persistence in rats. Next, we used the clone derived virus progeny to infect...
Persistent pain after spinal cord injury is maintained by primary afferent activity.
Yang, Qing; Wu, Zizhen; Hadden, Julia K; Odem, Max A; Zuo, Yan; Crook, Robyn J; Frost, Jeffrey A; Walters, Edgar T
2014-08-06
Chronic pain caused by insults to the CNS (central neuropathic pain) is widely assumed to be maintained exclusively by central mechanisms. However, chronic hyperexcitablility occurs in primary nociceptors after spinal cord injury (SCI), suggesting that SCI pain also depends upon continuing activity of peripheral sensory neurons. The present study in rats (Rattus norvegicus) found persistent upregulation after SCI of protein, but not mRNA, for a voltage-gated Na(+) channel, Nav1.8, that is expressed almost exclusively in primary afferent neurons. Selectively knocking down Nav1.8 after SCI suppressed spontaneous activity in dissociated dorsal root ganglion neurons, reversed hypersensitivity of hindlimb withdrawal reflexes, and reduced ongoing pain assessed by a conditioned place preference test. These results show that activity in primary afferent neurons contributes to ongoing SCI pain. Copyright © 2014 the authors 0270-6474/14/3410765-05$15.00/0.
Prevalence of zoonotic Bartonella species among rodents and shrews in Thailand.
Pangjai, Decha; Maruyama, Soichi; Boonmar, Sumalee; Kabeya, Hidenori; Sato, Shingo; Nimsuphan, Burin; Petkanchanapong, Wimol; Wootta, Wattanapong; Wangroongsarb, Piyada; Boonyareth, Maskiet; Preedakoon, Poom; Saisongkorh, Watcharee; Sawanpanyalert, Pathom
2014-03-01
We investigated the prevalence of Bartonella species in 10 rodent and one shrew species in Thailand. From February 2008 to May 2010, a total of 375 small animals were captured in 9 provinces in Thailand. Bartonella strains were isolated from 57 rodents (54 from Rattus species and 3 from Bandicota indica) and one shrew (Suncus murinus) in 7 of the 9 provinces, and identified to the species level. Sequence analysis of the citrate synthase and RNA polymerase β subunit genes identified the 58 isolates from each Bartonella-positive animal as B. tribocorum in 27 (46.6%) animals, B. rattimassiliensis in 17 (29.3%) animals, B. elizabethae in 10 (17.2%) animals and B. queenslandensis in 4 (6.9%) animals. R. norvegicus, R. rattus, and Suncus murinus carried B. elizabethae, which causes endocarditis in humans. The prevalence of Bartonella bacteremic animals by province was 42.9% of the animals collected in Phang Nga, 26.8% in Chiang Rai, 20.4% in Sa Kaeo, 16.7% in Nakhon Si Thammarat, 12.0% in Surat Thani, 9.1% in Mae Hong Son and Loei Provinces. These results indicate that Bartonella organisms are widely distributed in small mammals in Thailand and some animal species may serve as important reservoirs of zoonotic Bartonella species in the country. Crown Copyright © 2013. Published by Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Wiwik Misaco Yuniarti
2014-08-01
Full Text Available The number of patients with chronic liver disease (fibrosis or cirrhosis of the liver is increasing fromtime to time. However, until now there is no therapy that really effective to overcome that disease. Therapyfor liver fibrosis typically use substance that have antioxidant activity, anti-inflammatory or anti fibrotic.Various efforts always done to find alternative therapies for liver fibrosis. One of them is the use ofpotential plants that suspected having such activity. Various parts of pomegranate have been shown tohave various activities that beneficial for health. This study was conducted to determine the effect ofpomegranate fruit extract standardized 40% ellagic acid on the improvement degree of liver fibrosis causedby cholestasis by measuring of serum alkaline phosphatase levels (ALP and gamma-glutamyl transferase(GGT, as a specific indicator of liver damage becaused of cholestasis. The research was conducted by using32 male rats, wistar strain, 2.5 month old, weighing between 150-200 grams. Animal models of liver fibrosis obtained by using BDL technique. Subjects were divided into a control group (P0 = without BDLand giving of pomegranate extract and treatment groups (P1 = BDL with administration of CMC, P2 =BDL with ellagic acid 90% and P3 = BDL with pomegranate fruit extract standardized 40% ellagic acid.CMC, extract (150 mg / kg BW / PO and ellagic acid (60 mg / kg BW / PO administered for 21 consecutivedays in the same volume. At the end of 21 days periods, biochemical evaluation was performed to measureserum levels of GGT and ALP. The result indicated that administration of pomegranate fruit extract ( P3significantly reduced GGT ( 10.5±9.2 mg/dl and ALP level ( 509.0±4.2 mg/dl close to normal level of GGTand ALP ( P0, GGT : 2.8 ± 1.4; ALP : 449.0±62.3 (p<0.05. The level of GGT and ALP in P3 group were lowercompared to the group ellagic acid (P2, GGT=48.5±4.8 and ALP = 691.0± 29.7 and group which only begiven CMC (P1, GGT 191.0±35.4 and ALP 890 ± 5.7 ( p<0.05. Extract of pomegranate fruit thatstandardized with 40% ellagic acid is potential as a antifibrotic agent.
DEFF Research Database (Denmark)
Madsen, Niels; Holst, René; Frandsen, Rikke
2017-01-01
Due to generally high discard rates in Norway lobster (Nephrops norvegicus) fisheries, a discard ban coming up and to the cod recovery plan in several areas, selective sorting grids have been tested in many areas and are specified by legislation for use in the Kattegat and Skagerrak area bordering...... Norway, Denmark and Sweden. Grids are very selective, but they can lead to loss of landable Norway lobster and valuable fish species. To improve retention of these species, we developed three new grids using made by polyurethane to make them flexible: One grid had horizontal bars, one had vertical bars....... More flatfish passed the grid with horizontal bars compared to that with vertical bars, but the retention rate was still low. Use of the guiding funnel increased the contact with the grid considerably for both target and unwanted species. In all three grid designs, there were losses of Norway lobster...
Directory of Open Access Journals (Sweden)
Jacopo Aguzzi
2009-12-01
Full Text Available There is growing interest in developing automated, non-invasive techniques for long-lasting, laboratory-based monitoring of behaviour in organisms from deep-water continental margins which are of ecological and commercial importance. We monitored the burrow emergence rhythms in the Norway lobster, Nephrops norvegicus, which included: a characterising the regulation of behavioural activity outside the burrow under monochromatic blue light-darkness (LD cycles of 0.1 lx, recreating slope photic conditions (i.e. 200-300 m depth and constant darkness (DD, which is necessary for the study of the circadian system; b testing the performance of a newly designed digital video-image analysis system for tracking locomotor activity. We used infrared USB web cameras and customised software (in Matlab 7.1 to acquire and process digital frames of eight animals at a rate of one frame per minute under consecutive photoperiod stages for nine days each: LD, DD, and LD (subdivided into two stages, LD1 and LD2, for analysis purposes. The automated analysis allowed the production of time series of locomotor activity based on movements of the animals’ centroids. Data were studied with periodogram, waveform, and Fourier analyses. For the first time, we report robust diurnal burrow emergence rhythms during the LD period, which became weak in DD. Our results fit with field data accounting for midday peaks in catches at the depth of slopes. The comparison of the present locomotor pattern with those recorded at different light intensities clarifies the regulation of the clock of N. norvegicus at different depths.
Kamani, Joshua; Baneth, Gad; Gutiérrez, Ricardo; Nachum-Biala, Yaarit; Mumcuoglu, Kosta Y; Harrus, Shimon
2018-01-01
Rodents are hosts of numerous pathogenic agents of public health importance globally. Their ability to harbor these pathogens without showing overt clinical signs of disease has epidemiologic consequences. In some rural settings in Nigeria, humans and rodents do not only share feeds and abode, but the latter may end up on the table of the former as a source of protein, thereby increasing the risks of disease transmission. Molecular assays were used to detect and characterize two agents of zoonotic importance, Coxiella burnetii and Rickettsia spp. in 194 peridomestic rodents captured in a peri-urban setting in Nigeria, and 32 pools of ectoparasites removed from them, to determine their possible role in the epidemiology of these diseases in this country. Targeting and characterizing the insertion sequence IS1111, C. burnetii DNA was detected in 4 out of 194 (2.1%) rodents comprising 3 out of 121 (2.5%) Rattus norvegicus and 1 out of 48 (2.1%) Rattus rattus screened in this study. Rickettsia spp. DNA was detected in two Rhipicephalus sanginueus sensu lato pools (i.e. RT1 and RT4) using the citrate synthase (gltA) gene and further characterized by amplification and sequence analysis of six genes to determine their identity. The RT1 sample consistently gave 98-100% identity to Rickettsia conorii str. Malish 7 for the various genes and loci studied. However, the identity of RT4 could not be definitively determined due to variable identities to different Rickettsia spp. according to the gene or loci under consideration. Further isolation study to determine if the RT4 characterized is a new variant or a mixture of sequences of different rickettsiae within the pool will be worthwhile. Copyright © 2017 Elsevier GmbH. All rights reserved.
International Nuclear Information System (INIS)
McLean, Christopher M.; Koller, Claudia E.; Rodger, John C.; MacFarlane, Geoff R.
2009-01-01
The current study represents the first investigation of the suitability of marsupial and eutherian mammalian hair as indicator tissue for metal exposure and accumulation within contaminated Australian terrestrial ecosystems. A soil metal contamination gradient was established across 22 sites at increasing distances from a decommissioned Lead/Zinc smelter in NSW, Australia. Within each site, soil and small mammal populations were sampled. An Australian native marsupial, the insectivorous Brown Antechinus, Antechinus stuartii: Dasyuridae, and introduced rodents, the omnivorous Brown or Norway Rat, Rattus norvegicus: Muridae and the Black Rat, Rattus rattus: Muridae were assessed for hair concentrations of Cadmium (Cd), Copper (Cu), Lead (Pb) and Zinc (Zn). Metals in soil were most elevated at sites within close proximity to the smelter, with soil metal concentrations decreasing with distance from the smelter. The non-essential metals Pb and Cd were accumulated in hair, both metals exhibiting positive linear relationships with environmental exposure (soil metal concentrations). When the variables of weight and snout-vent length were considered, no further contribution in terms of explaining the variability in hair Cd or Pb was observed for all species examined. The essential metals Cu and Zn were regulated in hair, remaining similar across the metal contamination gradient. A significant negative correlation between snout-vent length and hair Cu concentration was found for the Brown Rat; greater hair Cu concentrations were found in smaller individuals of this species. Accumulation of Pb to hair was similar among species while concentrations of Cd in Brown Rat hair were higher than both Black Rat and Brown Antechinus hair. As each of the three aforementioned species exhibit similar bioaccumulation relationships for Pb, we suggest that sampling hair from introduced rodents (pest species) may provide a suitable proxy for the assessment of Pb bioavailability for a range of
Energy Technology Data Exchange (ETDEWEB)
McLean, Christopher M. [Ecology and Ecotoxicology Laboratory, School of Environmental and Life Sciences, University of Newcastle, Callaghan, NSW Australia (Australia); Centre for the Risk Management of Bushfires, Institute for Conservation Biology and Law, University of Wollongong, Wollongong, NSW (Australia); Koller, Claudia E. [Ecology and Ecotoxicology Laboratory, School of Environmental and Life Sciences, University of Newcastle, Callaghan, NSW Australia (Australia); Rodger, John C. [Marsupial Research Laboratory, School of Environmental and Life Sciences, University of Newcastle, Callaghan, NSW Australia (Australia); MacFarlane, Geoff R., E-mail: geoff.macfarlane@newcastle.edu.au [Ecology and Ecotoxicology Laboratory, School of Environmental and Life Sciences, University of Newcastle, Callaghan, NSW Australia (Australia)
2009-05-15
The current study represents the first investigation of the suitability of marsupial and eutherian mammalian hair as indicator tissue for metal exposure and accumulation within contaminated Australian terrestrial ecosystems. A soil metal contamination gradient was established across 22 sites at increasing distances from a decommissioned Lead/Zinc smelter in NSW, Australia. Within each site, soil and small mammal populations were sampled. An Australian native marsupial, the insectivorous Brown Antechinus, Antechinus stuartii: Dasyuridae, and introduced rodents, the omnivorous Brown or Norway Rat, Rattus norvegicus: Muridae and the Black Rat, Rattus rattus: Muridae were assessed for hair concentrations of Cadmium (Cd), Copper (Cu), Lead (Pb) and Zinc (Zn). Metals in soil were most elevated at sites within close proximity to the smelter, with soil metal concentrations decreasing with distance from the smelter. The non-essential metals Pb and Cd were accumulated in hair, both metals exhibiting positive linear relationships with environmental exposure (soil metal concentrations). When the variables of weight and snout-vent length were considered, no further contribution in terms of explaining the variability in hair Cd or Pb was observed for all species examined. The essential metals Cu and Zn were regulated in hair, remaining similar across the metal contamination gradient. A significant negative correlation between snout-vent length and hair Cu concentration was found for the Brown Rat; greater hair Cu concentrations were found in smaller individuals of this species. Accumulation of Pb to hair was similar among species while concentrations of Cd in Brown Rat hair were higher than both Black Rat and Brown Antechinus hair. As each of the three aforementioned species exhibit similar bioaccumulation relationships for Pb, we suggest that sampling hair from introduced rodents (pest species) may provide a suitable proxy for the assessment of Pb bioavailability for a range of
Foronda, Pilar; López-González, Mercedes; Hernández, Mariano; Haukisalmi, Voitto; Feliu, Carlos
2011-09-26
In the Canary Islands there are no previous data about tapeworms (Cestoda) of rodents. In order to identify the hymenolepidid species present in these hosts, a survey of 1,017 murine (349 Rattus rattus, 13 Rattus norvegicus and 655 Mus musculus domesticus) was carried out in the whole Archipelago. Molecular studies based on nuclear ITS1 and mitochondrial COI loci were performed to confirm the identifications and to analyse the levels of genetic variation and differentiation. Three species of hymenolepidids were identified: Hymenolepis diminuta, Rodentolepis microstoma and Rodentolepis fraterna. Hymenolepis diminuta (in rats) and R. microstoma (in mice) showed a widespread distribution in the Archipelago, and R. fraterna was the least spread species, appearing only on five of the islands. The hymenolepidids found on Fuerteventura, Lanzarote and La Graciosa were restricted to one area. The COI network of H. diminuta showed that the haplotypes from Lanzarote and Fuerteventura are the most distant with respect to the other islands, but clearly related among them. Founder effects and biotic and abiotic factors could have played important role in the presence/absence of the hymenolepidid species in determined locations. The haplotypes from the eastern islands (Fuerteventura and Lanzarote) seem to have shared an ancestral haplotype very distant from the most frequent one that was found in the rest of the islands. Two colonization events or a single event with subsequent isolation and reduced gene flow between western-central and eastern islands, have taken place in the Archipelago. The three tapeworms detected are zoonotic species, and their presence among rodents from this Archipelago suggests a potential health risk to human via environmental contamination in high risk areas. However, the relatively low prevalence of infestations detected and the focal distribution of some of these species on certain islands reduce the general transmission risk to human.
Directory of Open Access Journals (Sweden)
Feliu Carlos
2011-09-01
Full Text Available Abstract Background In the Canary Islands there are no previous data about tapeworms (Cestoda of rodents. In order to identify the hymenolepidid species present in these hosts, a survey of 1,017 murine (349 Rattus rattus, 13 Rattus norvegicus and 655 Mus musculus domesticus was carried out in the whole Archipelago. Molecular studies based on nuclear ITS1 and mitochondrial COI loci were performed to confirm the identifications and to analyse the levels of genetic variation and differentiation. Results Three species of hymenolepidids were identified: Hymenolepis diminuta, Rodentolepis microstoma and Rodentolepis fraterna. Hymenolepis diminuta (in rats and R. microstoma (in mice showed a widespread distribution in the Archipelago, and R. fraterna was the least spread species, appearing only on five of the islands. The hymenolepidids found on Fuerteventura, Lanzarote and La Graciosa were restricted to one area. The COI network of H. diminuta showed that the haplotypes from Lanzarote and Fuerteventura are the most distant with respect to the other islands, but clearly related among them. Conclusions Founder effects and biotic and abiotic factors could have played important role in the presence/absence of the hymenolepidid species in determined locations. The haplotypes from the eastern islands (Fuerteventura and Lanzarote seem to have shared an ancestral haplotype very distant from the most frequent one that was found in the rest of the islands. Two colonization events or a single event with subsequent isolation and reduced gene flow between western-central and eastern islands, have taken place in the Archipelago. The three tapeworms detected are zoonotic species, and their presence among rodents from this Archipelago suggests a potential health risk to human via environmental contamination in high risk areas. However, the relatively low prevalence of infestations detected and the focal distribution of some of these species on certain islands reduce
Chakma, S; Picard, J; Duffy, R; Constantinoiu, C; Gummow, B
2017-02-01
In 1964, Brucella was isolated from rodents trapped in Wooroonooran National Park (WNP), in Northern Queensland, Australia. Genotyping of bacterial isolates in 2008 determined that they were a novel Brucella species. This study attempted to reisolate this species of Brucella from rodents living in the boundary area adjacent to WNP and to establish which endo- and ecto-parasites and bacterial agents were being carried by non-indigenous rodents at this interface. Seventy non-indigenous rodents were trapped [Mus musculus (52), Rattus rattus (17) and Rattus norvegicus (1)], euthanized and sampled on four properties adjacent to the WNP in July 2012. Organ pools were screened by culture for Salmonella, Leptospira and Brucella species, real-time PCR for Coxiella burnetii and conventional PCR for Leptospira. Collected ecto- and endo-parasites were identified using morphological criteria. The percentage of rodents carrying pathogens were Leptospira (40%), Salmonella choleraesuis ssp. arizonae (14.29%), ectoparasites (21.42%) and endoparasites (87%). Brucella and C. burnetii were not identified, and it was concluded that their prevalences were below 12%. Two rodent-specific helminthic species, namely Syphacia obvelata (2.86%) and Nippostrongylus brasiliensis (85.71%), were identified. The most prevalent ectoparasites belonged to Laelaps spp. (41.17%) followed by Polyplax spp. (23.53%), Hoplopleura spp. (17.65%), Ixodes holocyclus (17.64%) and Stephanocircus harrisoni (5.88%), respectively. These ectoparasites, except S. harrisoni, are known to transmit zoonotic pathogens such as Rickettsia spp. from rat to rat and could be transmitted to humans by other arthropods that bite humans. The high prevalence of pathogenic Leptospira species is of significant public health concern. This is the first known study of zoonotic agents carried by non-indigenous rodents living in the Australian wet-tropical forest interface. © 2015 Blackwell Verlag GmbH.
The accumulation and retention of {sup 95m}Tc by the Norway lobster, Nephrops norvegicus L
Energy Technology Data Exchange (ETDEWEB)
Swift, D. E-mail: d.j.swift@cefas.co.uk
2001-07-01
Laboratory experiments were carried out to study bioaccumulation and determine a concentration factor (CF) for technetium ({sup 95m}Tc) in the homarid crustacean Nephrops norvegicus L. The steady state CF for accumulation from seawater was estimated to be about 2000 and the biological half-time was about 50 days. The highest tissue Tc concentrations were found in the green gland and the digestive gland. Depuration following accumulation from water was slow with a half-time of about 165 days. Tc accumulation from labelled food followed a biphasic model with one compartment containing about 94 percent of the ingested activity and with a half-time of about 1 day and the second compartment containing about 6 percent of the ingested activity with a half-time of about 56 days. Most retained activity was found in the digestive gland.
I mammiferi dell'area di Capo Feto (Trapani
Directory of Open Access Journals (Sweden)
Massimiliano Di Vittorio
2003-10-01
campionamento sono stati analizzati attraverso l?Indice di concentrazione di Dominanza. Complessivamente, nei tre periodi, sono stati catturati e marcati un totale di 70 micromammiferi, di cui 29 Rattus norvegicus, 17 Mus musculus, 10 R. rattus e 14 Crocidura sicula. Scorporando i risultati delle catture nei diversi periodi e per i diversi transetti, si possono evincere alcune variazioni nei popolamenti dell?area in funzione delle stagioni. Durante i diversi periodi in cui sono stati effettuati i campionamenti, infatti, l?area di Capo Feto ha mostrato differenze importanti inerenti l?umidità del suolo, che avrebbe avuto conseguenze nella composizione vegetazionale e quindi nei popolamenti dei mammiferi studiati. Sono state rilevate variazioni nei popolamenti dell?intera area, più evidenti nei riguardi di R. norvegicus e R. rattus, di minore entità riguardo il M. musculus, mentre la C. sicula si mantiene entro valori quasi costanti. I risultati totali dei trappolamenti, in cui si ha la preponderanza di R. norvegicus e M. musculus, confermerebbero il degrado dell?area in questione. Inoltre, l?area di Capo Feto sembrerebbe caratterizzata da una bassa produttività, conseguenza dell?alterazione dell?habitat, e necessita, pertanto, di immediati e profondi interventi di ripristino ambientale.
Czech Academy of Sciences Publication Activity Database
Adamovský, O.; Kopp, Radovan; Ziková, A.; Blaha, L.; Kohoutek, J.; Ondráčková, P.; Paskerová, H.; Mareš, J.; Palíková, M.
2011-01-01
Roč. 32, suppl.1 (2011), s. 35-45 ISSN 0172-780X Institutional research plan: CEZ:AV0Z60050516 Keywords : cyanobacteria * microcystin * rat Subject RIV: EF - Botanics Impact factor: 1.296, year: 2011 http://www.nel.edu/Current_issue_0.htm
Vancomycin gene selection in the microbiome of urban Rattus norvegicus from hospital environment
DEFF Research Database (Denmark)
Arn Hansen, Thomas; Joshi, Tejal; Larsen, Anders Rhod
2016-01-01
for the presence of antibiotic resistance genes. We show that despite the shared resistome within samples from the same geographic locations, samples from hospital area carry significantly abundant vancomycin resistance genes. The observed pattern is consistent with a selection for vancomycin genes in the R...
International Nuclear Information System (INIS)
Saxena, Prabhu N.; Shukla, Aparna; Saxena, Nishi; Arya, Jyoti
2010-01-01
The protective effect of Eucalyptus tereticornis leaf extract and its potency has been compared with Liv.52 following V 2 O 5 , induced hepatotoxicity in albino rats. LD 50 estimated for V 2 O 5 , was 69.6 mg/kg b.wt. The administered doses of V 2 O 5 , were LD 50 /10 th for acute and 1/7 th , 1/14 th and 1/21 th of sublethal dose for subacute (7, 14 and 21 ds) respectively. Body weight, liver weight and hepatosomatic index were assessed. Hepatotoxicity was assessed in terms of hepatic total proteins, total lipids and total cholesterol. V 2 O 5 intoxication significantly increased liver weight, hepatosomatic index, total lipids and total cholesterol, while significantly decreased body weight and total proteins. Pretreatment with dose of 100 mg/kg b.wt of Eucalyptus tereticornis leaf extract and 0.125 ml/kg b.wt. of Liv.52 syrup restored the increased liver weight, hepatosomatic index, total lipids and total cholesterol and decreased parameters like body weight and total proteins toward normalcy. The results reveal that Eucalyptus tereticornis leaf extract modulates V 2 O 5 toxicity like well known hepatoprotectant, however the modulation is less than Liv.52. (author)
Resistance to anticoagulants in rats (Rattus norvegicus) in sewers in an urban area
DEFF Research Database (Denmark)
Lodal, Jens
2007-01-01
primarily tested for possible resistance to coumatetralyl, bromadiolone and difenacoum by Blood Clotting Response tests. Feeding test was used in tests for resistance to difethialone. A total of 24 rats trapped in sewers at 15 locations were tested. Resistance to bromadiolone was found among rats from all......Control of rats in sewers is, though of varying intensity, common practice in a majority of Danish municipalities and bromadiolone is the most preferred active ingredient. The results of sewer rat control is very difficult to register and very little is known about resistance among sewer rats...
Mites (acari) infesting commensal rats in Suez Canal zone, Egypt.
el Kady, G A; Shoukry, A; Ragheb, D A; el Said, A M; Habib, K S; Morsy, T A
1995-08-01
Mites are arthropods distinguished from ticks by usually being microscopical in size and have a hypostome unarmed with tooth-like anchoring processes. They are group in a number of suborders, each with super-families and families including many genera of medical and economic importance. In this paper, commensal rodents (Rattus norvegicus, R. r. alexandrinus and R. r. frugivorous) were surveyed in the Suez Canal Zone for their acari ectoparasites. Four species of mites were recovered. In a descending order of mite indices, they were Eulaelaps stabularis (4.83 on 6 rats), Laelaps nuttalli (3.11 on 27 rats), Ornithonyssus bacoti (1.66 on 9 rats) and Dermanyssus gallinae (0.66 on 24 rats). The overall mite indices in the three governorates were 3.66 in Suez, 2.82 in Ismailia and zero in Port Said. The medical and economic importance of the mites were discussed.
DEFF Research Database (Denmark)
Kilian, Mogens
2001-01-01
With reference to the first Principle of the International Code of Nomenclature of Bacteria, which emphasizes stability of names, it is proposed that the original names Streptococcus sanguis, Streptococcus rattus, Streptococcus cricetus, Erwinia ananas, Eubacterium tarantellus, Lactobacillus sake......, Nitrosococcus oceanus, Pseudomonas betle, Rickettsia canada and Streptomyces rangoon, all included in the Approved Lists of Bacterial Names, be conserved. Request for an Opinion...
Directory of Open Access Journals (Sweden)
MAURICIO CANALS
2002-06-01
Full Text Available La vía aérea ha sido propuesta como modelo de diseño óptimo desde una perspectiva física. Su diseño se ha asociado con un adecuado flujo de gases a los alvéolos, una mínima producción de entropía y un mínimo costo en materia y energía. Se ha propuesto un decrecimiento exponencial del diámetro de los bronquios (dG en función de la generación: dG = do·2-G/3, asociado a una mínima producción de entropía. También se ha propuesto un modelo de renormalización: dG = An·G-u donde u es un exponente y An una función que introduce desviaciones periódicas en la escala, es decir más de una escala, evitando la propagación distal de errores aleatorios en el calibre de un bronquio. Sin embargo, este último resultado podría ser consecuencia en árboles asimétricos de la relación entre el diámetro y el orden del bronquio y no de la generación. En este trabajo estudiamos la asimetría y el decrecimiento del diámetro bronquial en dos especies. Se utiliza el modelo de Zamir como un sistema externo de medida de la optimización. Encontramos una clara asimetría del árbol bronquial. Comprobamos que la relación exponencial diámetro-orden es siempre muy buena (R² ³ 0,8 y que en cambio la relación exponencial diámetro-generación es menos clara (R² From a physical perspective, the air way has been proposed as a model of optimal design. Its design has been associated with a optimal gases flow to the alveoli, a minimum entropy production and minimal costs of mass and energy. The decrease of the bronchial diameter (dG along the airway has been modeled by (i an exponential decay of the bronchial diameter (dG as function of its generation: dG = do·2-G/3, associated to a minimum entropy production, and (ii a renormalization model: dG = An·G-u where u is an exponent and An an harmonic function which introduces periodic variations in the scale, buffering the propagation of stochastic errors in the bronchial diameter. However, that the last result in asymmetric trees may be a consequence of a real relationship between diameter and order more than a relationship diameter-generation. In this work we explore this hypothesis in two species. We also use the Zamir model for vascular trees as an out method to explore the optimality degree of the bronchial ramification. We found a clear asymmetry of the analyzed bronchial trees. We shown that the relationship diameter-order is always very good (R² ³ 0,8. In contrast, the determination coefficients for the relationship diameter-generation were lower (R² < 0,6. The proposed harmonic modulation vanishes when changing generation by order. There were a high optimality degree of the bronchial junctions
Dusk but not dawn burrow emergence rhythms of Nephrops norvegicus (Crustacea: Decapoda
Directory of Open Access Journals (Sweden)
Valerio Sbragaglia
2013-10-01
Full Text Available The Norway lobster, Nephrops norvegicus, can be captured by haul nets only during the emergence from its burrow. In the last few decades, an extensive field research revealed distinct diel (24-h–based catchability patterns at different depths. Laboratory experiments suggested that burrow emergence (used as a proxy of catchability is endogenously controlled via a circadian system. Results were usually presented in terms of mean effects without a quantification of inter-individual variability and arrhythmia. Here, we studied the burrow emergence of 52 adult Nephrops by an infrared actograph endowed with an artificial burrow. Animals were exposed to 12-12 h light-darkness cycle, simulating photic condition of the lower shelf. Forty-five animals showed rhythmic emergence (87%, while seven were arrhythmic (13%. Rhythmic animals were clustered according to their timing of emergence: 54% at dusk and 4% at dawn. Moreover, other animals showed fully diurnal or nocturnal emergence (10% and 19%, respectively. The comparison of our results with those derived from temporally scheduled trawling indicates that bimodal catch patterns observed in shelf populations are poorly observed during individual experiments in the laboratory, where the same light conditions are simulated. Nephrops burrow emergence seems to be the result of a mixed endogenous-exogenous control, while arrhythmia could also be present in the wild.
Influence of household rat infestation on leptospira transmission in the urban slum environment.
Costa, Federico; Ribeiro, Guilherme S; Felzemburgh, Ridalva D M; Santos, Norlan; Reis, Renato Barbosa; Santos, Andreia C; Fraga, Deborah Bittencourt Mothe; Araujo, Wildo N; Santana, Carlos; Childs, James E; Reis, Mitermayer G; Ko, Albert I
2014-12-01
The Norway rat (Rattus norvegicus) is the principal reservoir for leptospirosis in many urban settings. Few studies have identified markers for rat infestation in slum environments while none have evaluated the association between household rat infestation and Leptospira infection in humans or the use of infestation markers as a predictive model to stratify risk for leptospirosis. We enrolled a cohort of 2,003 urban slum residents from Salvador, Brazil in 2004, and followed the cohort during four annual serosurveys to identify serologic evidence for Leptospira infection. In 2007, we performed rodent infestation and environmental surveys of 80 case households, in which resided at least one individual with Leptospira infection, and 109 control households. In the case-control study, signs of rodent infestation were identified in 78% and 42% of the households, respectively. Regression modeling identified the presence of R. norvegicus feces (OR, 4.95; 95% CI, 2.13-11.47), rodent burrows (2.80; 1.06-7.36), access to water (2.79; 1.28-6.09), and un-plastered walls (2.71; 1.21-6.04) as independent risk factors associated with Leptospira infection in a household. We developed a predictive model for infection, based on assigning scores to each of the rodent infestation risk factors. Receiver operating characteristic curve analysis found that the prediction score produced a good/excellent fit based on an area under the curve of 0.78 (0.71-0.84). Our study found that a high proportion of slum households were infested with R. norvegicus and that rat infestation was significantly associated with the risk of Leptospira infection, indicating that high level transmission occurs among slum households. We developed an easily applicable prediction score based on rat infestation markers, which identified households with highest infection risk. The use of the prediction score in community-based screening may therefore be an effective risk stratification strategy for targeting control
Puche, Rafael; Ferrés, Ignacio; Caraballo, Lizeth; Rangel, Yaritza; Picardeau, Mathieu; Takiff, Howard; Iraola, Gregorio
2018-02-01
Three strains, CLM-U50 T , CLM-R50 and IVIC-Bov1, belonging to the genus Leptospira, were isolated in Venezuela from a patient with leptospirosis, a domestic rat (Rattus norvegicus) and a cow (Bos taurus), respectively. The initial characterisation of these strains based on the rrs gene (16S rRNA) suggested their designation as a novel species within the 'intermediates' group of the genus Leptospira. Further phylogenomic characterisation based on single copy core genes was consistent with their separation into a novel species. The average nucleotide identity between these three strains was >99 %, but below 89 % with respect to any previously described leptospiral species, also supporting their designation as a novel species. Given this evidence, these three isolates were considered to represent a novel species, for which the name Leptospiravenezuelensis sp. nov. is proposed, with CLM-U50 T (=CIP 111407 T =DSM 105752 T ) as the type strain.
Barn Owl (Tyto alba Diet Composition on Intensively Used Agricultural Land in the Danube Lowland
Directory of Open Access Journals (Sweden)
Tomáš Veselovský
2017-01-01
Full Text Available Based on pellets analysis from five localities in south western Slovakia (Malá Mužla, Malé Ripňany, Obid, Opatovský Sokolec and Tešedíkovo, we studied the diet composition of Barn Owl (Tyto alba in intensively cultivated agricultural lands. A total of 6218 specimens of prey, 17 mammalian and 7 bird species were identified. The main prey species found in all food samples was the Common Vole (Microtus arvalis, varying between 56 % and 67 %. The proportion of synanthropic species (Rattus norvegicus, Passer domesticus and species inhabiting agricultural landscapes (Crocidura leucodon, Crocidura suaveolens, Mus sp. increases in localities with a lower ratio of the Common Vole. The results suggest land use affects the diet of Barn Owls, confirming conclusions which have been drawn in previous studies. From faunistic point of view, discovering the Pannonian Root Vole (Microtus oeconomus mehelyi in the diet from Malá Mužla was important.
Optical coherence tomography imaging of the basal ganglia: feasibility and brief review
Energy Technology Data Exchange (ETDEWEB)
Lopez, W. O. Contreras; Ângelos, J. S. [Divisão de Neurocirurgia Funcional, Departamento de Neurologia, Faculdade de Medicina, Universidade de São Paulo, São Paulo, SP (Brazil); Martinez, R. C. R. [Laboratório de Neuromodulação e Dor Experimental, Hospital Sírio-Libanes, São Paulo, SP (Brazil); Takimura, C. K. [Instituto do Coração, Universidade de São Paulo, São Paulo, SP (Brazil); Teixeira, M. J. [Divisão de Neurocirurgia Funcional, Departamento de Neurologia, Faculdade de Medicina, Universidade de São Paulo, São Paulo, SP (Brazil); Lemos, P. A. Neto [Instituto do Coração, Universidade de São Paulo, São Paulo, SP (Brazil); Fonoff, E. T., E-mail: fonoffet@usp.br [Divisão de Neurocirurgia Funcional, Departamento de Neurologia, Faculdade de Medicina, Universidade de São Paulo, São Paulo, SP (Brazil)
2015-09-29
Optical coherence tomography (OCT) is a promising medical imaging technique that uses light to capture real-time cross-sectional images from biological tissues in micrometer resolution. Commercially available optical coherence tomography systems are employed in diverse applications, including art conservation and diagnostic medicine, notably in cardiology and ophthalmology. Application of this technology in the brain may enable distinction between white matter and gray matter, and obtainment of detailed images from within the encephalon. We present, herein, the in vivo implementation of OCT imaging in the rat brain striatum. For this, two male 60-day-old rats (Rattus norvegicus, Albinus variation, Wistar) were stereotactically implanted with guide cannulas into the striatum to guide a 2.7-French diameter high-definition OCT imaging catheter (Dragonfly™, St. Jude Medical, USA). Obtained images were compared with corresponding histologically stained sections to collect imaging samples. A brief analysis of OCT technology and its current applications is also reported, as well as intra-cerebral OCT feasibility on brain mapping during neurosurgical procedures.
Directory of Open Access Journals (Sweden)
Solange Maria Gennari
Full Text Available Toxoplasma gondii is a protozoan parasite that infects a large spectrum of warm-blooded animals, including humans. Small rodents and marsupials play an important role in the epidemiology of T. gondii because they are sources of infection for domestic and feral cats. Serum samples from 151 rodents and 48 marsupials, captured in the Atlantic Forest, São Paulo State, southeastern Brazil, were analyzed for the presence of T. gondii antibodies. Antibodies detected by the modified agglutination test (MAT ≥ 25 were found in 8.6% (13/151 of the rodents and 10.4% (5/48 of the marsupials, with titers ranging from 25 to 6400 and from 25 to 3200, respectively for the rodents and marsupials. Three of the eight species of rodents (Akodon spp., Oligoryzomys nigripesand Rattus norvegicus, and one from the four marsupial species (Didelphis aurita presented positive animals. T. gondii was described for the first time in the rodent Oligoryzomys nigripes.
Enzootic Angiostrongyliasis in Guangzhou, China, 2008–2010
Yang, Xiao; Qu, Zhenyu; He, Hualiang; Zheng, Xiaoying; He, Ai; Wu, Yu; Liu, Qian; Zhang, Dongjing; Wu, Zhongdao; Li, Zhuoya; Zhan, Ximei
2012-01-01
This study was conducted to gain an understanding of the Angiostrongylus cantonensis infection status of rodent definitive host, snail intermediate host, and local residents in Guangzhou, China. A total of 430 rats were captured and 23 rats, from two species, were infected, with an average infection rate of 5.35%. A total of 795 Achatina fulica snails and 734 Pomacea canaliculata snails were collected. The average infection rates of these two species were 13.96% (111 of 795) and 1.50% (11 of 734), respectively. As for the seroprevalence of different occupations, the rate among the “general group” was significantly lower than the “occupational group.” From this survey, Guangzhou is implicated to be the natural focus of Angiostrongylus cantonensis. Rattus norvegicus and Achatina fulica play important roles in spreading this nematode in Guangzhou. Residents who live in Guangzhou, especially those working in certain industries such as agriculture, food-making, and aquaculture, face a higher risk of infection. PMID:22556086
Womack, J E; Cramer, D V
1980-10-01
Starch gel electrophoresis and histochemical staining with L-leucyl-L-tyrosine have revealed genetic variation for dipeptidase in Rattus norvegicus. The tissue distribution, substrate specificity, and heterozygous expression as a monmeric protein suggest homology of the variant peptidase to human PEP-C and mouse Pep-3 (Dip-1). We propose Peptidase-3 (Pep-3) as a name for this autosomal locus in the rat. The allele responsible for slower (less anodal) electrophoretic migration is designated Pep-3a and is characteristic of strain ACI/Pit. A faster (more anodal) electrophoretic mobility is the product of the Pep-3b allele in strain F344/Pit. Twenty-five additional inbred strains carry Pep-3a and 16 others carry Pep-3b. Wild rats trapped in Pittsburgh were polymorphic for this locus. Alleles at Pep-3 segregated independently of c (linkage group I), a (linkage group IV), RT2 and Es-1 (linkage group V), h (linkage group VI), and RTI (linkage group VIII).
Hemoglobin affinity in Andean rodents
Directory of Open Access Journals (Sweden)
HRVOJ OSTOJIC
2002-01-01
Full Text Available Blood hemoglobin oxygen affinity (P50 was measured in three Andean species and in the laboratory rat (control, all raised near sea level. Chinchilla lanigera (Molina, 1792 has an altitudinal habitat range from low Andean slopes up to 3000 m., while Chinchilla brevicaudata (Waterhouse, 1848 has an altitudinal range from 3000 to 5000 m. The laboratory type guinea pig, wild type guinea pig (Cavia porcellus, (Waterhouse, 1748, and laboratory rat (Rattus norvegicus were also raised at sea level. The Andean species had high hemoglobin oxygen affinities (low P50 compared with the rat. Chinchilla brevicaudata had a higher affinity than Chinchilla lanigera. The wild type guinea pig had a higher affinity than the laboratory type. As has been shown in other species, this is another example of an inverse correlation between the altitude level and the P50 values. This is the first hemoglobin oxygen affinity study in Chinchilla brevicaudata.
Zoratto, F; Oddi, G; Gori, E; Micucci, A; De Petrillo, F; Paglieri, F; Adriani, W; Laviola, G; Addessi, E
2018-02-24
Both human and non-human animals frequently deal with risky decisions in a social environment. Nevertheless, the influence of the social context on decision-making has been scarcely investigated. Here, we evaluated for the first time whether the presence of a conspecific influences risk preferences in rats and in tufted capuchin monkeys. Subjects received a series of choices between a constant, safe option and a variable, risky option, both alone (Alone condition) and when paired with a conspecific (Paired condition). The average payoff of the risky option was always lower than that of the safe option. Overall, the two species differed in their attitude towards risk: whereas rats were indifferent between options, capuchins exhibited a preference for the safe option. In both species, risk preferences changed in the Paired condition compared to the Alone condition, although in an opposite way. Whereas rats increased their risk preferences over time when paired with a conspecific, capuchins chose the risky option less in the Paired condition than in the Alone condition. Moreover, whereas anxiety-like behaviours decreased across sessions in rats, these behaviours where more represented in the Paired condition than in the Alone condition in capuchins. Thus, our findings extends to two distantly-related non-human species the evidence, so far available for human beings, that a decrease in anxiety corresponds to an increase in risk preferences, and vice versa. This suggests that the modulation of risk preferences by social influences observed in rats and capuchin monkeys may rely on a common, evolutionarily ancient, mechanism. Copyright © 2018 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Eni Harmayani, Deera Army Pramana, Sri Anggrahini dan Sutikarini
2012-12-01
Full Text Available Oyster mushroom is considered to have hypocholesterolemic and hypolipidemic activities. Therefore, it is classifiedas functional food. Prior to serving and consumption, oyster mushroom can be processed in various ways. Thisresearch studied the effect of three kinds of processing commonly used in cooking oyster mushroom; boiling,frying, and roasting. Thirty Sprague-Dawley male rats, 8 weeks old, were acclimated to laboratory condition,and then induced with high lipid diet. The rats were divided into five experiment groups; high-lipid diet (K,high-lipid diet + raw oyster mushroom (M, high-lipid diet + fried oyster mushroom (G, high-lipid diet + roastedoyster mushroom (P, and high-lipid diet + boiled oyster mushroom (R. Blood samples were obtained from orbitalplexus after acclimation, hypercholesterolemic induction, and 21 days of feeding. The blood serum was examinedfor total cholesterol (TC, triglyceride (TG, low-density lipoprotein cholesterol (LDL-c, dan high-densitylipoprotein cholesterol (HDL-c. The result showed that cooked oyster mushroom had better hypocholesterolemicand hypolipidemic activity than raw oyster mushroom. Among the three, the roasted oyster mushroom reduced thetotal cholesterol the most, while boiled oyster mushroom reduced triglyceride the most.
Crespo-Bojorque, Paola; Toro, Juan M
2015-02-01
Traditionally, physical features in musical chords have been proposed to be at the root of consonance perception. Alternatively, recent studies suggest that different types of experience modulate some perceptual foundations for musical sounds. The present study tested whether the mechanisms involved in the perception of consonance are present in an animal with no extensive experience with harmonic stimuli and a relatively limited vocal repertoire. In Experiment 1, rats were trained to discriminate consonant from dissonant chords and tested to explore whether they could generalize such discrimination to novel chords. In Experiment 2, we tested if rats could discriminate between chords differing only in their interval ratios and generalize them to different octaves. To contrast the observed pattern of results, human adults were tested with the same stimuli in Experiment 3. Rats successfully discriminated across chords in both experiments, but they did not generalize to novel items in either Experiment 1 or Experiment 2. On the contrary, humans not only discriminated among both consonance-dissonance categories, and among sets of interval ratios, they also generalized their responses to novel items. These results suggest that experience with harmonic sounds may be required for the construction of categories among stimuli varying in frequency ratios. However, the discriminative capacity observed in rats suggests that at least some components of auditory processing needed to distinguish chords based on their interval ratios are shared across species. PsycINFO Database Record (c) 2015 APA, all rights reserved.
Kang, Stacey C; Jampachaisri, Katechan; Seymour, Travis L; Felt, Stephen A; Pacharinsak, Cholawat
2017-01-01
The local anesthetic bupivacaine is valuable for perioperative analgesia, but its use in the postoperative period is limited by its short duration of action. Here, we evaluated the application of a slow-release liposomal formulation of bupivacaine for postoperative analgesia. The aim was to assess whether liposomal bupivacaine effectively attenuates postoperative mechanical and thermal hypersensitivity in a rat model of incisional pain. Rats (n = 36) were randomly assigned to 1 of 5 treatment groups: saline, 1 mL/kg SC every 12 h for 2 d; buprenorphine HCl, 0.05 mg/kg SC every 12 h for 2 d (Bup HCl); 0.5% bupivacaine, 2 mg/kg SC local infiltration once (Bupi); liposomal bupivacaine, 1 mg/kg SC local infiltration once (Exp1); and liposomal bupivacaine, 6 mg/kg SC local infiltration once (Exp6). Mechanical and thermal hypersensitivity were evaluated daily on days -1, 0, 1, 2, 3, and 4. The saline group exhibited both hypersensitivities through all 4 evaluated postoperative days. Bup HCl attenuated mechanical hypersensitivity for 2 d and thermal hypersensitivity for 1 d. Bupi attenuated only thermal hypersensitivity for 4 d. Rats in the Exp1 group showed attenuation of both mechanical and thermal hypersensitivity for 4 d, and those in the Exp6 group had attenuation of mechanical hypersensitivity on day 0 and thermal hypersensitivity for 4 d. These data suggest that a single local infiltration of liposomal bupivacaine at a dose of 1 mg/kg SC effectively attenuates postoperative mechanical and thermal hypersensitivity for 4 d in a rat model of incisional pain.
Irianti, E.; ilyas, S.; Rosidah; Hutahaean, S.
2017-03-01
Heat shock protein (Hsp) has long been known to protect cells from oxidative stress. In this case an increased expression is found on several cases of preeclampsia. One of the efforts to prevent preeclampsia is by giving antioxidants such as Extra Virgin Olive Oil (EVOO) or it’s better known as olive oil (Oleoa europaea), in the form of extra virgin known for its rich antioxidant content of tocopherols (vitamin E). The purpose of this study is to determine the expression levels of Hsp70 serum on pregnant white rat model of preeclampsia after being given EVOO. This type of research is true experiment; the subjects were female white rats and male virgin with Sprague Dawley, ± 8-11 weeks old, 180g BB s / d 200g, healthy and didn’t show any physical defects. Samples were 25 animals, divided into 5 groups, which consisted of different control and treatment given to T2 (rat model of preeclampsia), T3 (rat model of preeclampsia + EVOO 0.45g/bw/day), T4 (rat model of preeclampsia + EVOO 0.9g/bw/day) and T5 (rat model of preeclampsia + EVOO 1.8g/bw/day). The determination of each group was done by simple random sampling. Result on serum levels of Hsp70 that were tested by Elisa test in rats showed the average control was 14.64 mg / ml, group T2: 22:51 mg/ml, T3: 13.62 mg/ml, T4: 15.92 mg/ml, T5: 16:09 mg/ml. ANOVA test showed the P value was 0.001 <0.005, which meant there were significant differences on serum Hsp70 levels in the control and treatment pregnant rats group. It was known that there was a significant difference level of Hsp70 serum in group of control rats with T2 (P value <0.001) after LSD test was conducted, but not so with the group T3, T4, and T5, where the difference was not significant. There was a significant difference in the levels of Hsp70 serum on group T2 and T3 (P value 0.000), T4 (0004), T5 (0000). The gift of EVOO in the treatment group which was given EVOO with even low doses was able to control the induction of Hsp70 serum levels, which was not excessive, so the process of apoptosis did not occur excessively, especially in PE models. In this case, Hsp70 served as as an anti-apoptotic and it’s is suggested to further research to observe the relationship of Hsp70 and apoptotic index.
Makowska, I Joanna; Weary, Daniel M
2016-01-01
Laboratory rats are usually kept in relatively small cages, but research has shown that they prefer larger and more complex environments. The physiological, neurological and health effects of standard laboratory housing are well established, but fewer studies have addressed the sustained emotional impact of a standard cage environment. One method of assessing affective states in animals is to look at the animals' anticipatory behaviour between the presentation of a cue signalling the arrival of a reward and the arrival of that reward. The primary aim of this study was to use anticipatory behaviour to assess the affective state experienced by female rats a) reared and housed long-term in a standard laboratory cage versus a semi-naturalistic environment, and b) before and after treatment with an antidepressant or an anxiolytic. A secondary aim was to add to the literature on anticipatory behaviour by describing and comparing the frequency and duration of individual elements of anticipatory behaviour displayed by rats reared in these two systems. In all experiments, total behavioural frequency was higher in standard-housed rats compared to rats from the semi-naturalistic condition, suggesting that standard-housed rats were more sensitive to rewards and experiencing poorer welfare than rats reared in the semi-naturalistic environment. What rats did in anticipation of the reward also differed between housing treatments, with standard-housed rats mostly rearing and rats from the semi-naturalistic condition mostly sitting facing the direction of the upcoming treat. Drug interventions had no effect on the quantity or form of anticipatory behaviour, suggesting that the poorer welfare experienced by standard-housed rats was not analogous to depression or anxiety, or alternatively that the drug interventions were ineffective. This study adds to mounting evidence that standard laboratory housing for rats compromises rat welfare, and provides further scientific support for recommendations that current minimum standards be raised.
Directory of Open Access Journals (Sweden)
I Joanna Makowska
Full Text Available Laboratory rats are usually kept in relatively small cages, but research has shown that they prefer larger and more complex environments. The physiological, neurological and health effects of standard laboratory housing are well established, but fewer studies have addressed the sustained emotional impact of a standard cage environment. One method of assessing affective states in animals is to look at the animals' anticipatory behaviour between the presentation of a cue signalling the arrival of a reward and the arrival of that reward. The primary aim of this study was to use anticipatory behaviour to assess the affective state experienced by female rats a reared and housed long-term in a standard laboratory cage versus a semi-naturalistic environment, and b before and after treatment with an antidepressant or an anxiolytic. A secondary aim was to add to the literature on anticipatory behaviour by describing and comparing the frequency and duration of individual elements of anticipatory behaviour displayed by rats reared in these two systems. In all experiments, total behavioural frequency was higher in standard-housed rats compared to rats from the semi-naturalistic condition, suggesting that standard-housed rats were more sensitive to rewards and experiencing poorer welfare than rats reared in the semi-naturalistic environment. What rats did in anticipation of the reward also differed between housing treatments, with standard-housed rats mostly rearing and rats from the semi-naturalistic condition mostly sitting facing the direction of the upcoming treat. Drug interventions had no effect on the quantity or form of anticipatory behaviour, suggesting that the poorer welfare experienced by standard-housed rats was not analogous to depression or anxiety, or alternatively that the drug interventions were ineffective. This study adds to mounting evidence that standard laboratory housing for rats compromises rat welfare, and provides further scientific support for recommendations that current minimum standards be raised.
Directory of Open Access Journals (Sweden)
Oky Masir
2012-11-01
Full Text Available AbstrakLatar belakang:Metode penyembuhan luka telah mengalami perkembangan, baik berupa suatu produk atau stimulan terhadap proses biologis tubuh dalam menkompensasi luka. Fibroblas merupakan salah satu komponen penyembuhan yang berperan penting dalam proses fibroplasia. Culture Filtrate Fibroblast (CFF merupakan hasil kultur fibroblas yang akan dibuktikan efeknya terhadap proses percepatan penyembuhan luka pada penelitian ini. Metode. Penelitian ini menggunakan desain eksperimental dengan metode post test only control group design dan rancangan acak kelompok (RAK dengan menggunakan tikus putih wistar. Hewan coba dibagi menjadi 4 kelompok, yaitu 2 kelompok perlakuan yang diberikan CFF ke area eksisi luka dan kelompok kontrol yang diberikan larutan NaCl 0,9% ke area eksisi luka. Data diolah dengan SPSS 16.0. Data Kategori dianalisa dengan Chi-squared dan data numerik dengan Independent T-test. Hasil. Dari tingkat penyembuhan tidak ditemukan perbedaan pada kedua kelompok, namun perubahan restriksi jaringan lebih besar pada kelompok perlakuan. Pada skor pembentukan kolagen, derajat epitelisasi serta jumlah pembentukan pembuluh darah baru pada hari ke-3 tidak ditemukan perbedaan antara kedua kelompok. Namun pada pengamatan hari ke-7 memperlihatkan pembentukan kolagen, derajat epitelisasi serta jumlah pembentukan pembuluh darah baru lebih banyak pada kelompok perlakuan. Pada fibrosis hari ke-3 dan hari ke-7 memperlihatkan terjadinya fibrosis lebih banyak pada kelompok perlakuan dibanding kontrol. Pada pengamatan terjadinya infeksi hari ke-3 memperlihatkan infeksi lebih sedikit pada kelompok perlakuan dan terjadinya infeksi sama pada hari ke-7. Kesimpulan. CFF memberikan tingkat penyembuhan luka yang lebih baik dibanding NaCl.Kata kunci: CFF, NaCl 0,9 %, tingkat penyembuhan luka.Abstract Background: Wound healing methods have been developed, either a product or a stimulant to the body's biological processes in wound compensation. Fibroblasts is one component that plays an important role in the healing process of fibroplasia. Culture filtrat Fibroblast (CFF is a result of fibroblast culture to be proven effect on the acceleration of wound healing in this study.Methods. This study used an experimental design method post test only control group design and randomized block design (RBD by using wistar mice. Experimental animals were divided into 4 groups, the two groups of treatment given to the area of excision wound CFF and the control group were given 0.9% NaCl solution to the excision wound area. Data processed with SPSS 16.0. Data were analyzed with categories Chi squared and numerical data by the Independent T-test.Result. From degree of wound healing is not found differences in both groups, but the changes in the network restriction greater in the treatment group. The score formation of collagen, the degree of epithelialization and the amount of neovascularisation formation at 3rd day there was no difference between the two groups. However, the observation of 7th day shows the formation of collagen, the degree of epithelialization and the amount of neovascularisation formation more in the treatment group. On the 3rd day fibrosis and 7th day showed more fibrosis in the treatment group compared to controls. In observation of the 3rd day infection showed fewer infections in the treatment group and the same infection between the two group at 7th day.Conclusion. CFF give wound healing better than NaCl.Keywords:CFF, NaCl 0,9 %, degree of wound healing.
Allen-Worthington, Krystal H; Brice, Angela K; Marx, James O; Hankenson, F Claire
2015-11-01
Compassion, professional ethics, and public sensitivity require that animals are euthanized humanely and appropriately under both planned and emergent situations. According to the 2013 AVMA Guidelines for the Euthanasia of Animals, intraperitoneal injection of ethanol is "acceptable with conditions" for use in mice. Because only limited information regarding this technique is available, we sought to evaluate ethanol by using ECG and high-definition video recording. Mice (n = 85) and rats (n = 16) were treated with intraperitoneal ethanol (70% or 100%), a positive-control agent (pentobarbital-phenytoin combination [Pe/Ph]), or a negative-control agent (saline solution). After injection, animals were assessed for behavioral and physiologic responses. Pain-assessment techniques in mice demonstrated that intraperitoneal injection of ethanol was not more painful than was intraperitoneal Pe/Ph. Median time to loss of consciousness for all mice that received ethanol or Pe/Ph was 45 s. Median time to respiratory arrest was 2.75, 2.25, and 2.63 min, and time (mean ± SE) to cardiac arrest was 6.04 ± 1.3, 2.96 ± 0.6, and 4.03 ± 0.5 min for 70% ethanol, 100% ethanol, and Pe/Ph, respectively. No mouse that received ethanol or Pe/Ph regained consciousness. Although successful in mice, intraperitoneal ethanol at the doses tested (9.2 to 20.1 g/kg) was unsuitable for euthanasia of rats (age, 7 to 8 wk) because of the volume needed and prolonged time to respiratory effects. For mice, intraperitoneal injection of 70% or 100% ethanol induced rapid and irreversible loss of consciousness, followed by death, and should be considered as "acceptable with conditions."
Directory of Open Access Journals (Sweden)
Kurnia Retnowati
2014-08-01
Full Text Available Tempuyung (Sonchus arvensis consisted of fiavonoid were effect as obstruct xantine oksidase enzyme, antioxidant captur superoxsidase radical. The fiavonoid total in leave of tempuyung is 0,1044%, in its root have 0,5% fiavonoid and the more is apigenin-7-O-glikosida (3,4,5. This research aim to know effect of infusa root of tempuyung (Sonchus arvensis to lower the uric acid level at blood serum and infusa root of Tempuyung (Sonchus arvensis to lower the uric acid level at mouse blood serum compared to allopurinol.This research is laboratory experimental method. The object were 25 Wistar male mice 2-3 months old, 150-200 gr divided into 5 groups. Negative Control group given potassium oxonate by intraperitoneal, Positive Control group given potassium oxonate by intraperitoneal, added by allopurinol 18mg/kgBB, Infusa Concentrated Group 1 given potassium oxonate by intraperitoneal added by infusa root of tempuyung 1,25g/kgBB, Infusa Concentrated Group 2 given potassium oxonate by intraperitoneal added by infusa root of tempuyung 2,5g/kgBB, Infusa Concentrated Group 3 given potassium oxonate by intraperitoneal added by infuse root of tempuyung 5g/kgBB. Executed until one day, where measurement of uric acid of mouse blood serum done before and after treatment. Measurement of uric acid level is done by using spectrophotometer. Obtained to be data to be analysed with Kolgomorov-Smirnov test, One-Way ANOVA and continued with LSD (Least Significant Difference test with 95% confidence interval (CI. Result of statistical test of research shoe that infusa root of Tempuyung (Sonchus arvensis dose 1,25g/kgBB, 2,5g/ kgBB, 5g/kgBB have effect to lower the uric acid level at mouse blood serum. Infusa root of Tempuyung (Sonchus arvensis concentrated 5g/kgBB proportional wih dose allopurinol 18mg/kgBB to lower the uric acid level at mouse blood serum. Keyword: Infusa, root of Tempuyung (Sonchus arvensis, uric acid
Directory of Open Access Journals (Sweden)
Veronica Elisa Pimenta Vicentini
2004-04-01
Full Text Available O intenso desenvolvimento industrial e crescimento populacional têm promovido alterações na qualidade da água, sendo esta fonte de muitos estudos para análise desses efeitos no ser humano. Devido a contaminação dos rios por agrotóxicos, herbicidas, pesticidas e demais aditivos químicos utilizados nas lavouras, e pelas indústrias que despejam através de esgotos, resíduos de sua produção, que não são devidamente tratados, torna-se importante a investigação da atividade citotóxica e mutagênica da água dos rios. Neste estudo foi utilizado como sistema teste animal as células da medula óssea de ratos Wistar (,em>Rattus norvegicus, tratados in vivo, via gavagem, de forma subcrônica (7 dias, para investigação dos efeitos das águas do poço, e dos rios Ficha e Minas Gerais, próximos à Ubiratã, Estado do Paraná, Brasil, analisando-se o ciclo de divisão celular e os cromossomos metafásicos. A análise estatística demonstrou que as águas não alteraram o ciclo de divisão celular dos ratos Wistar e também não provocaram aumento no número de aberrações cromossômicas, mostrando não terem neste tratamento, efeito citotóxico e nem clastogênicoIntense industrial development and population growth have been altering the quality of water and innumerous studies have been undertaken to analyze their effects on humans. Due to rivers contamination with agrotoxics, herbicides, pesticides, excess of farming chemical additives and through sewers spilling not properly treated industrial waste, investigating cytotoxic and mutagenic activity of river water becomes all-important. Bone marrow cells of Wistar rats (Rattus norvegicus, treated in vivo, through gavage, in subchronic treatment (7 days, were used as experimental animal test system to investigate the effects of well water and water from the rivers Ficha and Minas Gerais, close to the municipality of Ubiratã, State of Paraná, southern Brazil. Cell division index and
Directory of Open Access Journals (Sweden)
Mohammad Javad RANJBAR
2017-12-01
Full Text Available AbstractBackground: Rodents are considered as reservoirs of various zoonotic diseases including helminthic infections. The current study aimed to evaluate the prevalence of helminth infections in rodents, in Boyer-Ahmad district, Southwestern Iran.Methods: Overall, 52 rodents were captured from various areas of the district by Sherman live traps. The animals were then euthanized and dissected. During necropsy, each organ was examined macroscopically for presence of any cyst or visible parasite. The gastrointestinal tract was removed and their contents were evaluated for larva or adult worms. Trichinella larvae in the rodents’ muscles were investigated by both digestion and pathological methods.Results: Twenty-eight (53.8% of the trapped rodents were male. The rodents were including 25 (48.1% Meriones persicus, 1(1.9% Calomyscus bailwardi, 1 (1.9% Arvicola terresterris, 7 (13.5% Rattus rattus, 8 (15.4% R. norvegicus, and 10 (19.2% Apodemus sylvaticus. Of them, 38 (73.0% were infected with at least one helminth. Collected rodents were infected with Hymenolepis diminuta (50%, Hymenolepis nana fraterna (28.8%, Skrjabinotaenia sp. (15.4%, Anoplocephalidae sp. (15.4%, Cysticercus fasciolaris (5.8%, Trichuris muris (36.5%, Aspiculuris tetraptera (15.4%, Syphacia sp. (5.7%, Rictularia sp. (15.4%, Trichostrongylus sp. (3.8%, and Gongylonema sp. (3.8%. M. persicus was the most (84% infected rodent, yet the differences between rodent genus and helminth infectivity were not statistically significant (P>0.05.Conclusion: The rodents in Boyer-Ahmad district are infected with different helminths infections that some of them are recognized as threat to human health.
Ranjbar, Mohammad Javad; Sarkari, Bahador; Mowlavi, Gholam Reza; Seifollahi, Zeinab; Moshfe, Abdolali; Abdolahi Khabisi, Samaneh; Mobedi, Iraj
2017-01-01
Rodents are considered as reservoirs of various zoonotic diseases including helminthic infections. The current study aimed to evaluate the prevalence of helminth infections in rodents, in Boyer-Ahmad district, Southwestern Iran. Overall, 52 rodents were captured from various areas of the district by Sherman live traps. The animals were then euthanized and dissected. During necropsy, each organ was examined macroscopically for presence of any cyst or visible parasite. The gastrointestinal tract was removed and their contents were evaluated for larva or adult worms. Trichinella larvae in the rodents' muscles were investigated by both digestion and pathological methods. Twenty-eight (53.8%) of the trapped rodents were male. The rodents were including 25 (48.1%) Meriones persicus , 1(1.9%) Calomyscus bailwardi , 1 (1.9%) Arvicola terresterris , 7 (13.5%) Rattus rattus , 8 (15.4%) R. norvegicus , and 10 (19.2%) Apodemus sylvaticus . Of them, 38 (73.0%) were infected with at least one helminth. Collected rodents were infected with Hymenolepis diminuta (50%), Hymenolepis nana fraterna (28.8%), Skrjabinotaenia sp. (15.4%), Anoplocephalidae sp. (15.4%), Cysticercus fasciolaris (5.8%), Trichuris muris (36.5%), Aspiculuris tetraptera (15.4%), Syphacia sp. (5.7%), Rictularia sp. (15.4%), Trichostrongylus sp. (3.8%), and Gongylonema sp. (3.8%). M. persicus was the most (84%) infected rodent, yet the differences between rodent genus and helminth infectivity were not statistically significant ( P >0.05). The rodents in Boyer-Ahmad district are infected with different helminths infections that some of them are recognized as threat to human health.
Mulford, A. L.; Zhang, X. H.; Xu, H. S.; Austin, B.
2002-04-01
Vibrio harveyi cells (dose—25 μmg mL-1 of total protein concentration) destroyed haematopoietic cultures of Nephrops norvegicus within 24 h of exposure. Cytopathic effects (CPE) started after 4h of exposure to the bacterial cells, with some granularity in the cytoplasm, mostly in cells in the outer periphery of the explant growth. At the end of the infection, a considerable number of nuclei remained attached to the substrate, apparently unaffected. Following exposure to ECP, initial deterioration was observed at 2 h with the presence of granularity in the cytoplasm of<20% cells, and few cells displayed small vacuoles around the nuclei. Parallel results were obtained using whole animal experiments, with V. harveyi cells being lethal to nephrops within 24 h.
Visciano, Pierina; Perugini, Monia; Manera, Maurizio; Abete, Maria Cesarina; Tarasco, Renata; Salese, Carmine; Amorena, Michele
2013-12-18
The distribution of total arsenic in different portions of Norway lobster (Nephrops norvegicus L., Crustacea) was studied both in fresh samples and after a boiling process. All individuals (n = 80) were selected of medium standard commercial size (13-15 cm). The highest mean concentrations (26.86 ± 1.57 mg/kg wet weight (ww)) were found in the raw brown meat of the crustacean, probably due to its detoxification role, whereas the lowest mean values (15.97 ± 0.85 mg/kg ww) were in the raw exoskeleton. The raw white meat reported mean values of 16.09 ± 0.61 mg/kg ww. The levels of arsenic contamination detected in the boiled portions showed a significant (p < 0.01) decrease compared to the raw portions, as a consequence of solubilization phenomena. In fact, a large amount of arsenic from raw lobsters was transferred to the corresponding boiling broth. In the most commonly consumed portion, the white meat, only slight losses (7.22%) in total arsenic content were observed compared to the raw portion.
Directory of Open Access Journals (Sweden)
Jacopo Aguzzi
2005-09-01
Full Text Available The effects of trawling on cardiac rhythmicity of Nephrops norvegicus (L. are still mostly unknown. Ultradian rhythms reported in previous studies may result from trawling capture stress, thus disappearing following acclimatisation to laboratory conditions. To test this hypothesis, 34 time series of cardiac activity data recorded in constant darkness were studied by Fourier analysis. Spectral decomposition of time series was obtained by defining the fundamental or circadian harmonic (CH in 24-h together with 9 submultiples of this period. The power content (PC of each harmonic was estimated in data segments of 24-h duration (days, giving graphic matrices of PC values over consecutive days. Values of PC for 9 submultiples were summed and studied in a block named ultradian band (UB. The modification in the PC of the CH and of the UB was evaluated during laboratory acclimatisation. A significant increase in the PC of the circadian harmonic component (CH over consecutive days of testing was observed. These findings suggest that, rather than being a product of dim light environmental fluctuations experienced by the animals from the deep waters of the continental slope, ultradian periodicity could well be caused by the stress of capture.
Institute of Scientific and Technical Information of China (English)
Mulford A.L.; ZHANG X.H.; XU H. S.; Austin B.
2002-01-01
Vibrio harveyi cells (dose = > 103 cells mL 1) and extracellular products (ECP; >25μg m L-1 of total protein concentration) destroyed haematopoietic cultures of Nephrops norvegicus within 24 h of exposure. Cytopathic effects (CPE)started after 4 h of exposure to the bacterial cells, with some granularity in the cytoplasm, mostly in cells in the outer periphery of the explant growth. At the end of the infection, a considerable number of nuclei remained attached to the substrate,apparently unaffected. Following exposure to ECP, initial deterioration was observed at 2 h with the presence of granularity in the cytoplasm of< 20% cells, and few cells displayed small vacuoles around the nuclei. Parallel results were obtained using whole animal experiments, with V. harveyi cells being lethal to nephrops within 24 h.
DEFF Research Database (Denmark)
Laaksonen, Sakari; Nevalainen, Timo; Ketola, Jukka
2017-01-01
.2% less than their AL counterparts. The DB rats of both sexes had 19% increased cage exploration during daytime and 20% reduced grooming during night-time compared to the AL rats. The increased FCMs may indicate slight stress in DB females. The EPM results indicate there was no anxiety due to DB feeding...... at six months. The cage behaviour could point to mild chronic stress in DB rats, but the lack of effect on escape-related behaviour and agonism suggests that there were no substantial welfare problems. DB feeding did not seem to disturb the circadian rhythm. The smaller food requirements of DB females...
Hodson-Tole, E F; Wakeling, J M
2007-07-01
Motor units are generally considered to follow a set, orderly pattern of recruitment within each muscle with activation occurring in the slowest through to the fastest units. A growing body of evidence, however, suggests that recruitment patterns may not always follow such an orderly sequence. Here we investigate whether motor unit recruitment patterns vary within and between the ankle extensor muscles of the rat running at 40 cm s(-1) on a level treadmill. In the past it has been difficult to quantify motor unit recruitment patterns during locomotion; however, recent application of wavelet analysis techniques has made such detailed analysis of motor unit recruitment possible. Here we present methods for quantifying the interplay of fast and slow motor unit recruitment based on their myoelectric signals. Myoelectric data were collected from soleus, plantaris and medial gastrocnemius muscles representing populations of slow, mixed and fast fibres, respectively, and providing a good opportunity to relate myoelectric frequency content to motor unit recruitment patterns. Following wavelet transformation, principal component analysis quantified signal intensity and relative frequency content. Significant differences in signal frequency content occurred between different time points within a stride (Pmotor units. The goodness-of-fit of the optimised wavelets to the signal intensity was high for all three muscles (r2>0.98). The low-frequency band had a significantly better fit to signals from the soleus muscle (P<0.001), while the high-frequency band had a significantly better fit to the medial gastrocnemius (P<0.001).
2015-07-16
outcome or training benefit the DoD/USAF? Yes. This study provided evidence that extracellular matrix made from swine small intestinal submucosa does...Isometric functional testing was implemented prior to euthanasia 2 FDGXXX at 10 months to further evaluate healing at later time points
Sepehrimanesh, Masood; Saeb, Mehdi; Nazifi, Saeed; Kazemipour, Nasrin; Jelodar, Gholamali; Saeb, Saeedeh
2014-09-01
This work analyzes the effects of radiofrequency-electromagnetic field (RF-EMF) exposure on the reproductive system of male rats, assessed by measuring circulating levels of FSH, LH, inhibin B, activin B, prolactin, and testosterone. Twenty adult male Sprague-Dawley rats (180 ± 10 g) were exposed to 900 MHz RF-EMF in four equal separated groups. The duration of exposure was 1, 2, and 4 h/day over a period of 30 days and sham-exposed animals were kept under the same environmental conditions as the exposed group except with no RF-EMF exposure. Before the exposure, at 15 and 30 days of exposure, determination of the abovementioned hormone levels was performed using ELISA. At the end of the experiment, FSH and LH values of the long time exposure (LTE) group were significantly higher than the sham-exposed group ( p reproductive hormone levels are disturbed as a result of RF-EMF exposure and it may possibly affect reproductive functions. However, testosterone and inhibin B concentrations as a fertility marker and spermatogenesis were decreased significantly.
Directory of Open Access Journals (Sweden)
Benjamin Nnamdi Okolonkwo
2013-06-01
Full Text Available Paraquat (PQ is one of the most used herbicide globally; applied around trees in orchards and between crop rows to control broad-leaved and grassy weeds. Its oxidation results in the formation of superoxides which causes damage to cellular components. In this study, we determined the antioxidant effect vitamin C has on hemograms [hemoglobin (Hb, packed cell volume (PCV and total white blood cells count] of rats under these toxic insults. The animals grouped (A-D, comprising subgroups without vitamin C (A1, B1, C1, D1 and subgroups on vitamin C (A2, B2, C2, D2, received different sub-lethal doses of PQ administered intraperitoneally monthly to the animals over a period of three months. The Hb values obtained were significantly reduced (P≤0.05 at month 1 and (P≤0.001 at months 2 and 3. These changes became more pronounced with increased dose and time. Vitamin C treated subgroups (B2, C2 and D2 had better Hb values than those without it (B1, C1 and D1 but the values were still significantly low when compared to the control subgroups (A1 and A2. This same trend was observed in the PCV results obtained. The Control subgroups showed that vitamin C treated subgroup (A2 had a more improved hemogram values than subgroup on water only (A1, but they were all higher than that of the test subgroups. These PQ induced anaemia were ameliorated by the subsequent administration of vitamin C, and continuous treatment with vitamin C restored the health status of the animals so treated.
Silitonga, Melva; Silitonga, Pasar M.
2017-08-01
Plectranthus amboinicus Lour Spreng is a medicinal plant that has many benefits, such as an antioxidant, hepatoprotective and immunostimulan. Immune status can be seen from hematological profile. This study aims to investigate hematology profile on rats induced BCG and leaf extract of Plectranthus amboinicus. 24 male rats aged 3 months and weighing between 140-200 grams divided equally into six groups, P0, P1, P2, P3, P4 and P5. P0 as controle was given aquadest. The P1, P2, P3, P4 and P5 treatment groups were given 19 g / kg AEP + BCG, 31.5 g / kg AEP + BCG, 19g / kg AEP, 31.5 g / kg AEP and BCG consecutively. The BCG were used as antigen. The AEP was administered orally for 30 days and 100 µl BCG were intramusculary administered on day 14 th and day 21. On day 31st, the rats we decapitated and their blood were collected for hematology (leucocyte (WBC), Erythrocyte (RBC), thrombocyte (PLT) count, Haemoglobin (Hb), erythrocyte sedimentation rate (ESR), MCV, MHC, and MHCH analysis. Data were analyzed with ANOVA. WBC increased significantly in treatment AEP 31.5 g / kg bw, 31.5 g AEP / kg bw + BCG and so were only given BCG. RBC tend to increase in all AEP treatment but tends to increase again when given a BCG. Hb increased in treatment P1, P2, T3 and P4, but the improvement was significant only in treatment P1. While PLT increase significantly in all treatments compared to the controls. HCT did not show significant differences but all of them were in the normal range. EAP without BCG and with the addition of BCG lowered ESR significantly, whereas BCG alone increased the ESR significantly. MCV increased significantly only in the treatment of P1 and show the same pattern with the MHC and MHCH. The conclusion that Plectranthus amboinicus Lour a positive impact on blood profiles with and without BCG. Plectranthus amboinicus Lour managed blood profile when administered together with BCG
Coumatetralyl resistance of Rattus tanezumi infesting oil palm plantations in Indonesia.
Andru, J; Cosson, J F; Caliman, J P; Benoit, E
2013-03-01
Rodent control is an important issue in human health and agriculture. Oil palm plantations are rapidly expanding in Indonesia and this is having a major economic and ecological impact. Rodent control in oil palm plantations is based principally on the use of anti-vitamin K (AVK), the main anticoagulant used being coumatetralyl, a first-generation AVK. We conducted a comparative study in two well established oil palm plantations in Indonesia: (1) one without chemical control in Riau and (2) another with intensive coumatetralyl use on Bangka Island. Rat species were identified by the molecular barcoding method. Susceptibility to coumatetralyl was then assessed within the two populations and we screened for mutations in vkorc1, which encodes the molecular target of AVK. Different species were found in the two areas: Rattus tiomanicus in Riau, and a mix of R. tanezumi and a close relative one in Bangka. The rats in Riau were much more susceptible to coumatetralyl than those in Bangka. This study is the first to demonstrate physiological tolerance to AVK in these species. vkorc1 displayed low levels of polymorphism, and no SNP was associated with the high-tolerance phenotypes of R. tanezumi clade, even those exposed to very high concentrations (32 × the effective dose of 0.36 mg kg(-1)). The biochemical basis of this tolerance remains unknown, but may involve the vkorc1 promoter and/or cytochrome P450 metabolism. We discuss our results and the selective role of anticoagulant use in the occurrence of phenotypic tolerance.
Directory of Open Access Journals (Sweden)
Diah Savitri Ernawati
2018-03-01
Full Text Available Aim: The aim of this study was to determine the effect of Apis mellifera propolis extract gel on vascular endothelial growth factor (VEGF and matrix metalloproteinase-9 (MMP-9 expression in the traumatic ulcers of rats afflicted with diabetes mellitus (DM. Materials and Methods: The study was conducted on 24 male Wistar rats (Rattus norvegicus induced with DM by injecting 50 mg/kg of Streptozotocin, intraperitoneally, and a traumatic ulcer on their lower lip mucosa. These were divided into eight groups: Four each for control and treatment groups. Each control and treatment group consisted of three rats. The control groups treated with hydroxypropyl methylcellulose 5% gel and treatment groups were administered with propolis extract gel. The expression of VEGF and MMP-9 was observed on days 3, 5, 7, and 9. Furthermore, mice sacrificed and the lower lip labial mucosa tissue of mice has been taken to make the histopathology anatomy preparation by means of immunohistochemical examination with monoclonal antibodies anti-VEGF and anti-MMP-9. Results: This experiment revealed higher VEGF expression and lower MMP-9 expression in the treatment group as compared to that of the control group. Analysis of Variance showed significant differences (p<0.01 of both VEGF expression and MMP-9 expression between the two groups. A Tukey's analysis did not find strong contrasts in VEGF and MMP-9 expressions between various treatment groups. However, those between treatment and control groups were found to be considerable. Conclusion: Propolis extract gel increased the expression of VEGF and decreased that of MMP-9 during the healing process of traumatic ulcers on the oral mucosa of diabetes afflicted Wistar rats (R. norvegicus.
Molecular genetic evidence for the place of origin of the Pacific rat, Rattus exulans.
Directory of Open Access Journals (Sweden)
Vicki Thomson
Full Text Available Commensal plants and animals have long been used to track human migrations, with Rattus exulans (the Pacific rat a common organism for reconstructing Polynesian dispersal in the Pacific. However, with no knowledge of the homeland of R. exulans, the place of origin of this human-commensal relationship is unknown. We conducted a mitochondrial DNA phylogeographic survey of R. exulans diversity across the potential natural range in mainland and Island Southeast Asia in order to establish the origin of this human-commensal dyad. We also conducted allozyme electrophoresis on samples from ISEA to obtain a perspective on patterns of genetic diversity in this critical region. Finally, we compared molecular genetic evidence with knowledge of prehistoric rodent faunas in mainland and ISEA. We find that ISEA populations of R. exulans contain the highest mtDNA lineage diversity including significant haplotype diversity not represented elsewhere in the species range. Within ISEA, the island of Flores in the Lesser Sunda group contains the highest diversity in ISEA (across all loci and also has a deep fossil record of small mammals that appears to include R. exulans. Therefore, in addition to Flores harboring unusual diversity in the form of Homo floresiensis, dwarfed stegodons and giant rats, this island appears to be the homeland of R. exulans.
Santos, Norlan de Jesus; Sousa, Erica; Reis, Mitermayer G; Ko, Albert I; Costa, Federico
2017-03-09
We analyzed environmental factors that provide food, water and harborage to rodents and the risk of household rodent infestation in a slum community with a high risk of leptospirosis transmission. Detailed environmental surveys were performed in 221 households. Multivariate regression models evaluated the association between rodent infestation and socioeconomic status and environmental attributes obtained from Geographical Information System surveys. The general household infestation rate was 45.9%. Rattus norvegicus signs were the most prevalent, present in 74% of the infested households. The risk for rodent infestation was associated with environmental factors supporting harborage for rats, such as dilapidated fences/walls (OR: 8.95; 95%CI: 2.42-33.12) and households built on an earthen slope (OR: 4.68; 95%CI: 2.23-9.81). An increase of 1 meter from the nearest sewer was associated with a 3% (95%CI: 1%-5%) decrease in the risk of rodent infestation. A lack of sanitation where poor people live provides factors for rat infestation and could the target of educational interventions.
Directory of Open Access Journals (Sweden)
Rojas Cortéz Mirko G
1998-01-01
Full Text Available The present work aims at learning the period of resistance to starvation (molting/death of Triatoma rubrofasciata in different stages of development and the respective loss of weight until death. Eggs of specimens from the greater area of the city of São Luis in the State of Maranhão, Brazil, yielded approximately 300 nymphs. These nymphs were placed in labelled Borrel glasses, in which they were weekly fed on rats (Rattus norvegicus, until reaching the stage to be observed. The experiments were conducted in a climatic chamber regulated at 29 ± 1° C, 70% relative humidity and 12 hr photoperiod. The resistance to starvation increased according to the stage of development, except for adult bugs, whose results were similar to the 3rd stage nymphs. In all these development stages there was an abrupt loss of weight in the first week, followed by a gradual loss until death. Comparing this work with those of other authors, it was observed that T. rubrofasciata is among the less resistant triatomine species.
O'Connor, K; Ison, J R
1991-10-01
Memory for tones (1100 vs. 2330 Hz) was studied in 4 rats (Rattus norvegicus), as affected by the durations of both target tones (30 to 620 ms) and noise-filled retention intervals (0 to 480 ms). With a 0-ms delay, performance was near asymptotic with the 30-ms tone, but the memory of this brief tone suffered a massive decrement at retention intervals as brief as 60 ms; in contrast, memory for the 340-ms tone was stable for at least 240 ms. If the retention interval was filled by band-stop noise (with targets presented in the spectral gap), then the rat's memory for brief tones was superior to that obtained with the standard broad-band noise filler, and band-stop noise was better than a band-pass noise that had the tones embedded in the region of its spectral energy. These findings are consistent with the hypotheses that auditory memory in the rat consists of a transient sensorylike echoic store and a short-term store more resistant to the effects of retroactive interference.
[Cloning and characterization of Caveolin-1 gene in pigeon, Columba livia domestica].
Zhang, Ying; Yu, Jian-Feng; Yang, Li; Wang, Xing-Guo; Gu, Zhi-Liang
2010-10-01
Caveolins, a class of principal proteins forming the structure of caveolae in plasmalemma, were encoded by caveolins gene family. Caveolin-1 gene is a member of caveolins gene family. In the present study, a full-length of 2605 bp caveolin-1 cDNA sequence in Columba livia domestica, which included a 537 bp complete ORF encoding a 178 amino acids long putative peptide, were obtained by using RT-PCR and RACE technique. The Columba livia domestica caveolin-1 CDS shared 80.1% - 93.4% homology with Bos taurus, Canis lupus familiaris, Gallus gallus and Rattus norvegicus. Meanwhile, the putative amino acid sequence of Columba livia domestica caveolin-1 shared 85.4% - 97.2% homology with the above species. The semi-quantity RT-PCR revealed that Caveolin-1 expressions were detectable in all the Columba livia domestica tissues and the expressional level of caveolin-1 gene was high in adipose, medium in various muscles, low in liver. These results demonstrated that Caveolin-1 gene was potentially involved in some metabolic pathways in adipose and muscle.
Evolution of mammalian endothermic metabolism: leaky membranes as a source of heat
International Nuclear Information System (INIS)
Else, P.L.; Hulbert, A.J.
1987-01-01
O 2 consumption was measured at 37/degrees/C in tissue slices of liver, kidney, and brain from Amphilbolurus vitticeps and Rattus norvegicus (a reptile and mammal with same weight and body temperature) both in the presence and absence of ouabain. O 2 consumption of the mammalian tissues was two to four times that of the reptilian tissues and the mammalian tissues used three to six times the energy for Na + -K + transport than the reptilian tissues. Passive permeability to 42 K + was measured at 37/degrees/C in liver and kidney slices, and passive permeability to 22 Na + was measured at 37/degrees/C in isolated and cultured liver cells from each species. The mammalian cell membrane was severalfold leakier to both these ions than was the reptilian cell membrane, and thus the membrane pumps must use more energy to maintain the transmembrane ion gradients. It is postulated that this is a general difference between the cells of ectotherms and endotherms and thus partly explains the much higher levels of metabolism found in endothermic mammals
Directory of Open Access Journals (Sweden)
Elcio Juliato Piovesan
2011-02-01
Full Text Available The purpose of this study was to investigate if botulinum neurotoxin type-A (BoNT/A had a preemptive antinociceptive effect in a formalin-induced orofacial pain model (FT. To test this hypothesis, male Rattus norvegicus were injected with isotonic saline solution 0.9% or BoNT/A administered as a 40 μl bolus, lateral to their nose, at 24 hours, 8, 15, 22, 29 or 36 days pre-FT. The procedures were repeated 42 days later. Influence on motor activity was assessed through the open-field test. Pain scores corresponded to the time spent rubbing and flicking the injected area. Animals pre-treated with BoNT/A at the first protocol (8 days subgroup showed reduced inflammatory scores (p=0.011. For the other groups no significant results were observed at any phase. Motor activity was similar in both groups. BoNT/A showed to be effective preventing inflammatory pain up to eight days after the first treatment, an effect not reproduced on the second dose administration.
Sleiman, Sama F; Langley, Brett C; Basso, Manuela; Berlin, Jill; Xia, Li; Payappilly, Jimmy B; Kharel, Madan K; Guo, Hengchang; Marsh, J Lawrence; Thompson, Leslie Michels; Mahishi, Lata; Ahuja, Preeti; MacLellan, W Robb; Geschwind, Daniel H; Coppola, Giovanni; Rohr, Jürgen; Ratan, Rajiv R
2011-05-04
Oncogenic transformation of postmitotic neurons triggers cell death, but the identity of genes critical for degeneration remain unclear. The antitumor antibiotic mithramycin prolongs survival of mouse models of Huntington's disease in vivo and inhibits oxidative stress-induced death in cortical neurons in vitro. We had correlated protection by mithramycin with its ability to bind to GC-rich DNA and globally displace Sp1 family transcription factors. To understand how antitumor drugs prevent neurodegeneration, here we use structure-activity relationships of mithramycin analogs to discover that selective DNA-binding inhibition of the drug is necessary for its neuroprotective effect. We identify several genes (Myc, c-Src, Hif1α, and p21(waf1/cip1)) involved in neoplastic transformation, whose altered expression correlates with protective doses of mithramycin or its analogs. Most interestingly, inhibition of one these genes, Myc, is neuroprotective, whereas forced expression of Myc induces Rattus norvegicus neuronal cell death. These results support a model in which cancer cell transformation shares key genetic components with neurodegeneration.
Morphogenesis in bat wings: linking development, evolution and ecology.
Adams, Rick A
2008-01-01
The evolution of powered flight in mammals required specific developmental shifts from an ancestral limb morphology to one adapted for flight. Through studies of comparative morphogenesis, investigators have quantified points and rates of divergence providing important insights into how wings evolved in mammals. Herein I compare growth,development and skeletogenesis of forelimbs between bats and the more ancestral state provided by the rat (Rattus norvegicus)and quantify growth trajectories that illustrate morphological divergence both developmentally and evolutionarily. In addition, I discuss how wing shape is controlled during morphogenesis by applying multivariate analyses of wing bones and wing membranes and discuss how flight dynamics are stabilized during flight ontogeny. Further, I discuss the development of flight in bats in relation to the ontogenetic niche and how juveniles effect populational foraging patterns. In addition, I provide a hypothetical ontogenetic landscape model that predicts how and when selection is most intense during juvenile morphogenesis and test this model with data from a population of the little brown bat, Myotis lucifugus. (c) 2007 S. Karger AG, Basel
Effect of sodium selenite on bone repair in tibiae of irradiated rats
International Nuclear Information System (INIS)
Rocha, Anna Silvia Setti da; Ramos-Perez, Flavia Maria de Moraes; Boscolo, Frab Norberto; Almeida, Solange Maria; Manzi, Flavio Ricardo; Chicareli, Mariliani
2009-01-01
This study evaluated the radioprotective effect of sodium selenite on the bone repair process in tibiae of female rats. For such purpose, 100 female Wistar rats (Rattus norvegicus, albinus) were randomly assigned to 4 groups (n=25), according to the treatment received: administration of distilled water (control); administration of sodium selenite; gamma radiation; and administration of sodium selenite plus gamma radiation. A bone defect was prepared on both tibiae of all animals. Three days after surgery, the gamma radiation and selenium/ gamma radiation groups received 8 Gy gamma rays on the lower limbs. Five animals per group were sacrificed 7, 14, 21, 28 days after surgery for evaluation of the repair process by bone volumetric density analysis. The 5 animals remaining in each group were sacrificed 45 days postoperatively for examination of the mature bone by scanning electron microscopy. Based on all analyzed parameters, the results of the present study suggest that sodium selenite exerted a radioprotective effect in the bone repair of tibia of irradiated rats. (author)
Directory of Open Access Journals (Sweden)
Hassina Khaldoun Oularbi
2014-04-01
Full Text Available Lambda-cyhalothrin (LCT is a type II pyrethroid insecticide widely used in pest management. This study was undertaken to evaluate the toxic effects of LCT on the kidneys and adrenal glands of rats after subacute exposure. Twenty-eight 6-week-old male albino Rattus norvegicus rats were randomly assigned to four groups. Group 1 was the control group, which received distilled water. The experimental groups 2, 3 and 4 received 20.4, 30.6 and 61.2 mg/kg body weight, respectively, of LCT, administered orally over 28 days. The effects of the insecticide on various biochemical parameters were evaluated at 14 and 28 days. Histopathological studies were carried out in the kidneys and adrenal glands at the end of the experiment. Lambda-cyhalothrin, as a pyrethroid insecticide, induced significant increases (P≤0.05 in plasma urea, creatinine, uric acid and glucose concentrations, and alanine aminotransferase and aspartate aminotransferase activities after 14 and 28 days. In the rat plasma samples after 28 days, residual concentrations of LCT 1R, cis,
Directory of Open Access Journals (Sweden)
Ricardo D’Oliveira Albanus
2014-01-01
Full Text Available Chemoreception is among the most important sensory modalities in animals. Organisms use the ability to perceive chemical compounds in all major ecological activities. Recent studies have allowed the characterization of chemoreceptor gene families. These genes present strikingly high variability in copy numbers and pseudogenization degrees among different species, but the mechanisms underlying their evolution are not fully understood. We have analyzed the functional networks of these genes, their orthologs distribution, and performed phylogenetic analyses in order to investigate their evolutionary dynamics. We have modeled the chemosensory networks and compared the evolutionary constraints of their genes in Mus musculus, Homo sapiens, and Rattus norvegicus. We have observed significant differences regarding the constraints on the orthologous groups and network topologies of chemoreceptors and signal transduction machinery. Our findings suggest that chemosensory receptor genes are less constrained than their signal transducing machinery, resulting in greater receptor diversity and conservation of information processing pathways. More importantly, we have observed significant differences among the receptors themselves, suggesting that olfactory and bitter taste receptors are more conserved than vomeronasal receptors.
The effect of ionizing radiations on rat serum albumin on in vivo and in vitro
International Nuclear Information System (INIS)
Portakal, S.
1984-01-01
The effect of ionizing radiations on rat serum albumin was studied on in vivo and in vitro. Male rats (rattus norvegicus) were exposed to 225 roentgen wholebody X-irradiation on in vivo experiments. Time-course effects of irradiation on albumin level examined at immediately, 2.5 hours and 3 days after irradiation. Albumin level decreased above control level 2.5 hours after irradiation and rised within 3 days reaching control level. Pre-albumin/albumin ratio enhanced after x-irradiation. Aqueous solutions (0.5 percent) of rat serum albumin was exposed to various doses (0.2, 0.5, 1.0 and 1.9 Mrad) of 60 Co gamma irradiation on in vitro experiments. Results showed that electrophoretic mobility of serum albumin decreased after gamma irradiation. No significant change in albumin UV absorption spectrum was observed at 0.2, 0.5, 1.0 and 1.9 Mrad doses. Albumin becomes progressively less soluble in water as the radiation doses is increased. Radiation induced transformation into insoluble albumin agregates and scission products. (author)
Effect of sodium selenite on bone repair in tibiae of irradiated rats
Energy Technology Data Exchange (ETDEWEB)
Rocha, Anna Silvia Setti da [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR, (Brazil). Dept. of Physics; Ramos-Perez, Flavia Maria de Moraes; Boscolo, Frab Norberto; Almeida, Solange Maria [Universidade Estadual de Campinas (UNICAMP), Piracicaba, SP (Brazil). Piracicaba Dental School. Dept. of Oral Diagnosis], e-mail: flaviamaria@fop.unicamp.br; Manzi, Flavio Ricardo [Pontifical Catholic University of Minas Gerais (PUC-MG), Belo Horizonte, MG (Brazil). Dept. of Stomatology; Chicareli, Mariliani [State Univ. of Maringa, PR (Brazil). Dept. of Oral Diagnosis
2009-07-01
This study evaluated the radioprotective effect of sodium selenite on the bone repair process in tibiae of female rats. For such purpose, 100 female Wistar rats (Rattus norvegicus, albinus) were randomly assigned to 4 groups (n=25), according to the treatment received: administration of distilled water (control); administration of sodium selenite; gamma radiation; and administration of sodium selenite plus gamma radiation. A bone defect was prepared on both tibiae of all animals. Three days after surgery, the gamma radiation and selenium/ gamma radiation groups received 8 Gy gamma rays on the lower limbs. Five animals per group were sacrificed 7, 14, 21, 28 days after surgery for evaluation of the repair process by bone volumetric density analysis. The 5 animals remaining in each group were sacrificed 45 days postoperatively for examination of the mature bone by scanning electron microscopy. Based on all analyzed parameters, the results of the present study suggest that sodium selenite exerted a radioprotective effect in the bone repair of tibia of irradiated rats. (author)
Nakata, Hokuto; Nakayama, Shouta M M; Oroszlany, Balazs; Ikenaka, Yoshinori; Mizukawa, Hazuki; Tanaka, Kazuyuki; Harunari, Tsunehito; Tanikawa, Tsutomu; Darwish, Wageh Sobhy; Yohannes, Yared B; Saengtienchai, Aksorn; Ishizuka, Mayumi
2017-01-10
Although Japan has been considered to have little lead (Pb) pollution in modern times, the actual pollution situation is unclear. The present study aims to investigate the extent of Pb pollution and to identify the pollution sources in Japan using stable Pb isotope analysis with kidneys of wild rats. Wild brown ( Rattus norvegicus , n = 43) and black ( R. rattus , n = 98) rats were trapped from various sites in Japan. Mean Pb concentrations in the kidneys of rats from Okinawa (15.58 mg/kg, dry weight), Aichi (10.83), Niigata (10.62), Fukuoka (8.09), Ibaraki (5.06), Kyoto (4.58), Osaka (4.57), Kanagawa (3.42), and Tokyo (3.40) were above the threshold (2.50) for histological kidney changes. Similarly, compared with the previous report, it was regarded that even structural and functional kidney damage as well as neurotoxicity have spread among rats in Japan. Additionally, the possibility of human exposure to a high level of Pb was assumed. In regard to stable Pb isotope analysis, distinctive values of stable Pb isotope ratios (Pb-IRs) were detected in some kidney samples with Pb levels above 5.0 mg/kg. This result indicated that composite factors are involved in Pb pollution. However, the identification of a concrete pollution source has not been accomplished due to limited differences among previously reported values of Pb isotope composition in circulating Pb products. Namely, the current study established the limit of Pb isotope analysis for source identification. Further detailed research about monitoring Pb pollution in Japan and the demonstration of a novel method to identify Pb sources are needed.
Statistical modelling of transcript profiles of differentially regulated genes
Directory of Open Access Journals (Sweden)
Sergeant Martin J
2008-07-01
Full Text Available Abstract Background The vast quantities of gene expression profiling data produced in microarray studies, and the more precise quantitative PCR, are often not statistically analysed to their full potential. Previous studies have summarised gene expression profiles using simple descriptive statistics, basic analysis of variance (ANOVA and the clustering of genes based on simple models fitted to their expression profiles over time. We report the novel application of statistical non-linear regression modelling techniques to describe the shapes of expression profiles for the fungus Agaricus bisporus, quantified by PCR, and for E. coli and Rattus norvegicus, using microarray technology. The use of parametric non-linear regression models provides a more precise description of expression profiles, reducing the "noise" of the raw data to produce a clear "signal" given by the fitted curve, and describing each profile with a small number of biologically interpretable parameters. This approach then allows the direct comparison and clustering of the shapes of response patterns between genes and potentially enables a greater exploration and interpretation of the biological processes driving gene expression. Results Quantitative reverse transcriptase PCR-derived time-course data of genes were modelled. "Split-line" or "broken-stick" regression identified the initial time of gene up-regulation, enabling the classification of genes into those with primary and secondary responses. Five-day profiles were modelled using the biologically-oriented, critical exponential curve, y(t = A + (B + CtRt + ε. This non-linear regression approach allowed the expression patterns for different genes to be compared in terms of curve shape, time of maximal transcript level and the decline and asymptotic response levels. Three distinct regulatory patterns were identified for the five genes studied. Applying the regression modelling approach to microarray-derived time course data
Directory of Open Access Journals (Sweden)
Gunawan Gunawan
2015-01-01
Full Text Available AbstrakSchistosomiasis merupakan penyakit parasitik jaringan yang terabaikan. Schistosomiasis adalah penyakit parasitik yang bersifat zoonosis, selain menginfeksi manusia juga menginfeksi hewan mamalia lainnya. Ada 13 mamalia yang diketahui dapat terinfeksi oleh schistosomiasis antara lain sapi(Bos sundaicus, kerbau (Bubalus bubalis, kuda (Equus cabalus, anjing (Canis familiaris, babi (Sus sp, musang (Vivera tangalunga, rusa (Carvus timorensis, dan berbagai jenis tikus (Rattus exulans, R. hoffmani, R. chysomomusrallus, R. marmosurus, R norvegicus, R palallae. Di Indonesia schistosomiasis disebabkan oleh cacing Schistosoma japonicum dan hanya ditemukan endemik di Sulawesi Tengah yaitu di dataran tinggi Lindu, Napu dan Bada.Penelitian ini bertujuan untuk mengetahui kontribusi reservoir dalam penularan schistosomiasis di Kecamatan Lindu, Kabupaten Sigi, Propinsi Sulawesi Tengah. Metode penelitian ini adalah deskriptif observational dengan pendekatan cross sectional. Pengumpulan data primer dilakukan dengan mengobservasi mamalia yang berisiko,dengan pengambilan dan pemeriksaan sampel tinja hewan mamali tersebut. Sejumlah 219 sampel tinja hewan mamalia yang terdiri dari sapi, kerbau, anjing, babi dan kuda diperiksa dengan menggunakan metode sentrifugasi formalin-eter. Dari hasil pemeriksaan tinja yang dilakukan dilaboratorium Parasitologi Balai Litbang P2B2 Donggala sebanyak 54 sampel tinja hewan mamalia (sapi, kerbau, anjing, babi dan kuda positif terinfeksi S.japonicum.Kata kunci : Schistosomiasis, hewan mamalia, Schistosoma japonicumAbstractSchistosomiasis is one of neglected parasitic diseaseds and also a zoonosic disease, in addition to humans it also infect mammals. There were 13 known mammals that can be infected by schistosomiasis, i.e. cattle (Bos sundaicus, buffalo (Bubalus bubalis, horse (Equus Cabalus, dog (Canis familiaris, pig(Sus sp, civet cat(Vivera tangalunga, deer (Cervus timorensis, and various types of rat (Rattus exulans, R
Directory of Open Access Journals (Sweden)
Danilo dos Santos Silva
2011-04-01
Full Text Available PURPOSE: To investigate the function of an experimental cranium trauma model in rats. METHODS: The equipment, already described in the literature and under discreet adaptations, is composed by a platform that produces closed head impact controlled by weight drop with pre-defined and known energy. 25 Wistar male rats (Rattus norvegicus albinus were divided into five equal groups that received different quantities of cranial impact energy: G1, G2, G3 and G4 with 0,234J, 0,5J, 0,762J and 1J respectively and G5 (Sham. Under intense analgesia, each group was evaluated clinically in a sequence of intervals and had their encephalon removed for pathologic analysis. RESULTS: Important clinical alterations (convulsions, bradycardia, bradypnea and abnormal postures and focal pathologic (hematomas and hemorrhages kept proportion with the intensity of the impact. No fracture was observed and the group 4 had 80% mortality rate. CONCLUSION: The experimental cranium trauma animal model by weight drop is an alternative of low cost and easy reproduction that allows evaluating clinical and pathological alterations in accordance with studies in experimental surgery aims for new traumatic brain injury approach in rats.OBJETIVO: Investigar o uso de um modelo de trauma craniano experimental em ratos. MÉTODOS: O equipamento, já descrito na literatura e sob discretas adaptações, contitui-se de uma plataforma para produção de lesão craniana fechada controlada por queda de peso com energia pré-definida e conhecida. 25 ratos Wistar machos (Rattus norvegicus albinus foram divididos em cinco grupos iguais que receberam níveis diferentes de energia de impacto craniano: G1, G2, G3 e G4 com 0,234J, 0,5J, 0, 762J e 1J respectivamente e G5 (Sham. Sob intensa analgesia, cada grupo foi avaliado clinicamente em uma seqüência de intervalos e tiveram seus encéfalos removidos para análise patológica. RESULTADOS: Alterações clínicas importantes (convulsões, bradicardia
Directory of Open Access Journals (Sweden)
Kadek Karina Dewi Wijayanthi
2017-02-01
Full Text Available Deksametason telah diketahui sebagai obat kortikosteroid sintetik yang banyak digunakan oleh masyarakat. Jika deksametason digunakan dalam jangka waktu panjang dan pemakaian dosis besar, menyebabkan stres oksidatif pada sel akibat akumulasi radikal bebas yang menyebabkan kematian sel pada jaringan organ tubuh. Vitamin E diketahui memiliki peran yang baik sebagai antioksidan. Saat ini belum diketahui efek samping pemberian deksametason dan vitamin E terhadap kerusakan usus halus tikus putih (Rattus norvegicus. Penelitian ini menggunakan sampel 25 ekor tikus putih jantan, dibagi dalam 5 kelompok perlakuan, yaitu kontrol negatif (P0, kontrol positif (P1 diberikan deksametason Harsen 0.13 mg/kg, dan perlakuan diberikan deksametason Harsen 0.13 mg/kg dengan variasi vitamin E (Natur-E bertingkat yaitu P2 (100 mg/kg, P3 (150 mg/kg, dan P4 (200 mg/kg. Setelah perlakuan diberikan selama 2 minggu, tikus dinekropsi dan usus halus diambil untuk selanjutnya dibuat sediaan histopatologi dengan pewarnaan hematoksilin-eosin (HE. Hasil menunjukkan perlakuan P1 terlihat nekrosis berat (kaseosa pada usus halus, sedangkan seluruh perlakuan P2, P3, dan P4 berpengaruh terhadap perbaikan kerusakan akibat efek samping deksametason. Perlakuan 4 (P4 sebagai hasil paling baik dalam mengurangi efek samping deksametason. Dexamethasone it’s in period a synthetic corticosteroid drug that widely used by the public. If it used for long time and the use of large doses, causing oxidative stress in cells due to the accumulation of free radicals which may cause cell death in the body organs tissues. Vitamin E was known to have a good role as an antioxidant effect. Currently, unknown effects of dexamethasone and vitamin E administration on damage of the small intestine of rat (Rattus norvegicus. This study used an experimental design. Samples 25 male rats were divided into 5 groups, namely the negative control or no treatment (P0, positive control (P1 was given
Directory of Open Access Journals (Sweden)
Gilson Teles Boaventura
2003-09-01
Full Text Available Avaliou-se o suplemento alimentar alternativo adicionado à Dieta de Quissamã, consumida por crianças desnutridas inscritas no Subprograma da Multimistura da Secretaria de Saúde do município de Quissamã, RJ. O ensaio biológico foi desenvolvido durante 28 dias com 42 Rattus norvegicus, Wistar, machos (26 dias, do Laboratório de Nutrição Experimental da Universidade Federal Fluminense, divididos em sete grupos: 1 Grupo Controle (dieta à base de caseína adicionado de vitaminas e minerais; 2 GCvm adicionado do Suplemento Alimentar; 3 Grupo Controle adicionado do Suplemento Alimentar; 4 Grupo Quissamã, à base da Dieta de Quissamã; 5 Grupo Quissamã adicionado de vitaminas e minerais; 6 GQvm adicionado do Suplemento Alimentar; e 7 Grupo Quissamã adicionado do Suplemento Alimentar. Água e ração foram ofertados com livre acesso, e o pesos dos animais e o consumo de ração foram medidos a cada dois dias. O sangue foi coletado no 28º dia para análise. O Grupo Controle adicionado do Suplemento Alimentar apresentou perda de peso significativa (pThis study evaluated an alternative food supplement added to the Quissamã's diet, which is consumed by malnourished children who participate in the Multimixture Subprogram, developed by Quissamã Municipal Health Authority, in the state of Rio de Janeiro. The biological assay was carried out during 28 days with 42 male Rattus norvegicus, Wistar, 26 days old, obtained from the Experimental Nutrition Laboratory at the Fluminense Federal University, divided into seven groups: 1 Control Group (diet based on casein added with vitamins and minerals; 2 CGvm added with Food Supplement; 3 Control Group added with Food Supplement; 4 Quissamã Group, based on Quissamã's Diet; 5 QG added with vitamins and minerals; 6 QGvm added with Food Supplement; and 7 QG added with Food Supplement. Water and food were offered ad libitum, and the weight of the animals and the food consumption were measured every two
DEFF Research Database (Denmark)
Markussen, Mette; Heiberg, Ann-Charlotte; Fredholm, Merete
2008-01-01
over-express the Cyp2a1 gene. TGhe altered gene expression has been suggested to be involved in the bromadiolone resistance by facilitating enhanced anticoagulant metabolism. To investigate the gene expression of these cytochrome P450 genes in rats of different developmental stages we compared...... expression profiles, from 8-, 12- and 20-week-old resistant rats of the Danish strain to profiles of anticoagulant-susceptible rats of same ages. The three age-groups were selected to represent a group of pre-pubertal, pubertal and adult rats. We found expression profiles of the pre-pubertal and pubertal...... resistant rats to concur with profiles of the adults suggesting that cytochrome P450 enzymes are involved in the Danish bromadiolone resistance regardless of developmental stage. We also investigated the relative importance of the six cytochrome P450s in the different development stages of the resistant...
ani, andri
2018-01-01
Perubahan pola demografi di negara maju dan negara berkembang, angka kejadian infertilitas di negara maju dilaporkan sekitar 5%-8% dan di negara berkembang sekitar 30%.WHO memperkirakan sekitar 8%-10% atau sekitar 50-80 juta pasangan suami istri di seluruh dunia mengalami masalah infertilitas, sehingga membuat infertilitas menjadi masalah mendesak. Untuk itu diperlukan pengendalian infertilitas, salah satunya adalah kewaspadaan perubahan gaya hidup, perubahan ini juga mempengaruhi pola konsum...
Fukuzato, Yoko; Matsuura, Tetsuro; Ozaki, Kiyokazu; Matsuura, Masahiro; Sano, Tomoya; Nakahara, Yutaka; Kodama, Yasushi; Nakagawa, Akihito; Okamura, Sumie; Suido, Hirohisa; Torii, Kayo; Makino, Taketoshi; Narama, Isao
2009-10-01
In our previous studies, WBN/KobSlc was characterized as a rat strain in which only males began to develop pancreatitis, and then presented with diabetic symptoms. In the course of studying their pancreatic inflammation, we detected molar caries in prediabetic males feeding on a standard diet (CRF-1) widely used for experimental animals. The purpose of this study is to confirm whether the WBN/KobSlc strain is caries-susceptible to the diet reported to be non-cariogenic, and to examine the effect of a prediabetic condition on their dental caries. For a morphological study, 25 male WBN/KobSlc rats aged 3.2-7.8 months and 24 females of the same strain aged 3.3-6.6 months were used, along with 10 males and 10 females of 8.2-month-old F344 rats. Marked dental caries were detected in the mandibular molars of male and female WBN/KobSlc rats regardless of pancreatitis, although no similar changes were observed in any teeth of the F344 strain fed the same diet. Soft X-ray examination revealed that the caries began in the crown and progressed horizontally and vertically, and that a severe radiolucent lesion extensively expanded to the entire crown, corresponding to a macroscopically deleted molar. The caries had gradually developed mainly in the second mandibular molar from more than 3.5 months of age, while none were seen in any rats before that time. The WBN/KobSlc rats were caries-susceptible even to the standard laboratory diet, and pancreatitis was not directly associated with the onset of dental caries in this strain.
Directory of Open Access Journals (Sweden)
Victor Masekaven Ahur
2013-12-01
Full Text Available In vitro antioxidant and erythrocyte protecting activities by aqueous extract of Ficus thonningii leaves on blood cells were studied in acetaminophen treated rats. The extract was safe at limit dose of 5000 mg kg-1body weight. The extract demonstrated dose dependent antihemolytic effect at dose levels between 50 and 200 mg kg-1 body weight. The lowest antihemolytic effect was observed at dose level of 200 mg kg-1 body given the lowest percentage hemolysis of 10.53 ± 1.76%, whereas the highest percentage hemolysis at dose level of 50 mg kg-1 was 29.02 ± 7.45%. Hematology revealed erythrocytosis at dose levels of 100 and 200 mg kg-1 body weight. Hyper-globinemia and lymphocytopenia were observed at dose levels of 100 mg kg-1 and 200 mg kg-1, respectively. The extract effectively showed scavenging activity on a stable oxidative radical diphenylpicrylhydrazyl (DPPH and a significant ferric reducing antioxidant power (FRAP activity. The plausible erythrocyte membrane protective effect may be due to its free radical scavenging activity and hence the extract can be used to improve hematological parameters and ameliorate oxidative stress.
Saxena, Beenam; Sharma, Shiv
2014-01-01
Objective: The present study was carried out to evaluate the toxic effect of blend of some food colors on Swiss albino rats. Materials and Methods: A blend (1:1:1) of sunset yellow, metanil yellow and tartrazine showed additive effects on serological parameters which indicate that addition of these dye together in food stuff may give rise to more toxic effects than are produced by each dye individually. Animals were divided into four groups (I, II, III, and IV). First group was treated as con...
Saxena, Beenam; Sharma, Shiv
2014-01-01
The present study was carried out to evaluate the toxic effect of blend of some food colors on Swiss albino rats. A blend (1:1:1) of sunset yellow, metanil yellow and tartrazine showed additive effects on serological parameters which indicate that addition of these dye together in food stuff may give rise to more toxic effects than are produced by each dye individually. Animals were divided into four groups (I, II, III, and IV). First group was treated as control and respective group of animals received 25, 50 and 75 mg/kg body weight blend of food colors by gavaging up to 30 days. The serological study showed a decrease in total protein and albumin and an increase in alkaline phosphatase, SGPT and total bilirubin. The results revealed that oral administration of these blend did not affect the body weight gain. The prolonged consumption of the blend may cause adverse effect on human health.
Invasive rats on tropical islands: Their population biology and impacts on native species
Directory of Open Access Journals (Sweden)
Grant A. Harper
2015-01-01
Full Text Available The three most invasive rat species, black or ship rat Rattus rattus, brown or Norway rats, R. norvegicus and Pacific rat, R. exulans have been incrementally introduced to islands as humans have explored the world’s oceans. They have caused serious deleterious effects through predation and competition, and extinction of many species on tropical islands, many of which are biodiversity hotspots. All three rat species are found in virtually all habitat types, including mangrove and arid shrub land. Black rats tend to dominate the literature but despite this the population biology of invasive rats, particularly Norway rats, is poorly researched on tropical islands. Pacific rats can often exceed population densities of well over 100 rats ha−1 and black rats can attain densities of 119 rats ha−1, which is much higher than recorded on most temperate islands. High densities are possibly due to high recruitment of young although the data to support this are limited. The generally aseasonally warm climate can lead to year-round breeding but can be restricted by either density-dependent effects interacting with resource constraints often due to aridity. Apparent adverse impacts on birds have been well recorded and almost all tropical seabirds and land birds can be affected by rats. On the Pacific islands, black rats have added to declines and extinctions of land birds caused initially by Pacific rats. Rats have likely caused unrecorded extinctions of native species on tropical islands. Further research required on invasive rats on tropical islands includes the drivers of population growth and carrying capacities that result in high densities and how these differ to temperate islands, habitat use of rats in tropical vegetation types and interactions with other tropical species, particularly the reptiles and invertebrates, including crustaceans.
Directory of Open Access Journals (Sweden)
Roberto Federici
1986-12-01
Full Text Available Abstract A research on micromammals in the area of "Valle dell'Inferno" (in the north-west of Rome was carried out. The study was based on a previous phytosociological survey which describes a Quercus suber population in the valley (a once larger residua1 of a roman cork-tree wood which is now included in the town. Specimens from Rodents (Apodemus sylvaticus, Mus domesticus, Rattus rattus, R. norvegicus, Pitymys savii and Insectivores (Crocidura suaveolens, Erinaceus europaeus were captured by live traps. Most of Insectivores specimens are represented by C. suaveolens. Generally C. suaveolens lives in sympatry with C. leucodon but no specimens of the latter were found in this area. Three different kinds of landscape are present in the "Inferno" valley, namely, the wood, the meadow, and the bottom valley (with high anthropic impact; we have compared these three landscapes with biotic indexes (index of faunistic affinity, index of biocoenotic affinity and index of environmental evaluation. We have also compared through the same indexes, the micromammal fauna of the "Inferno" valley with six other differently polluted localities in Latium, where animals were captured with the same live traps. This area retains its natura1 environment in despite of the high anthropic impact. Riassunto È stato effettuato uno studio sulla micromammalofauna terrestre della Valle dell'Inferno situata a nord-ovest di Roma. Lo studio è basato su una precedente indagine fitosociologica effettuata per la caratterizzazione vegetazionale di una sughereta un tempo molto estesa ed ora racchiusa nell'abitato cittadino. È stato pertanto possibile tracciare, tramite gli indici biotici, una correlazione tra microteriocenosi ed effetti dell'impatto antropico.
Directory of Open Access Journals (Sweden)
LUÍS FERNANDO TIRAPELLI
2000-03-01
Full Text Available Adult male rats (Wistar lineage were alcoholized with sugar cane liquor diluted at 30(0 GL during 300 days and sacrificed every 60 days in 5 stages. Samples of choroid plexuses of lateral ventricles were collected and examined at transmission electronic microscope to detect possible ultrastructural alterations and to raise possible pathological correlations. Gradual changes were observed in these animals during all the experiment: dilatation and enlargement of cisternae of Golgi complex, dilatation of RER, presence of digestive vacuoles and a large amount of pinocytic vesicles as well as vesicles with electronlucent content throughout cytoplasm, as well as an enlargement of intercellular space between basolateral interdigitation of the cells and of the connective tissue. The changes observed in the epithelium and connective tissue of choroid plexuses specially in 240 and 300 days of treatment are presumably due to a disturbance in hydroelectrolitic homeostasis, contributing to several morpho-functional disturbs of central nervous system. No changes were observed in the control group animals.Ratos machos adultos (linhagem Wistar foram alcoolizados com aguardente de cana diluída a 30(0 GL durante 300 dias e sacrificados a cada 60 dias em 5 etapas. Amostras dos plexos coróides dos ventrículos laterais foram coletadas e examinadas ao microscópio eletrônico de transmissão para detectar possíveis alterações ultraestruturais e suas correlações patológicas. Alterações graduais foram observadas nestes animais durante todo o experimento: dilatação e aumento das cisternas de complexo de Golgi, dilatação do retículo endoplasmático rugoso, presença de vacúolos digestivos e grande quantidade de vesículas pinocíticas assim como de vesículas de conteúdo elétron-lúcido por todo o citoplasma, além de aumento do espaço intercelular, entre as interdigitações das células assim como no tecido conjuntivo. As alterações observadas no epitélio e no tecido conjuntivo dos plexos coróides, especialmente aos 240 e 300 dias de tratamento, são devidas possivelmente a distúrbios na homeostase hidro-eletrolítica, podendo assim contribuir para vários distúrbios morfo-funcionais do sistema nervoso central. Nenhuma alteração foi observada nos animais do grupo controle.
Directory of Open Access Journals (Sweden)
I Komang Angga Kristiawan
2017-03-01
Full Text Available This study aimed to determine the effect of juwet fruit extract on histological structure of rat(Rattus sp trachea which exposed to cigarette smoke. This research used Completely Randomized Design (CRD, with four treatments: the control group (K0 treated with 0.5 % CMC–Na, (K1 group is exposed to cigarette smoke, (K2 group were given juwetfruit extract, and (K3 group is exposed to cigarette smoke and juwet fruit extracts. Each treatment consisted of 6 rats as replication. The exposure to cigarette smoke is given from an aerator pump lit cigarettes. Juwet fruit extract and 0.5 % CMC - Na was orally administered (gavage method for 48 days. The existence of comperative descriptive observed cilia. And goblet number, high epithelium and lumen diameter Data were analyzed with ANOVA and If they were 5 % significantly different would be followed by Duncan test. Results showed that the extract of the fruit juwet significant effect on the histological structure of the trachea mice that had been exposed to smoke.
The role of black rice (Oryza sativa L.) in the control of hypercholesterolemia in rats.
Salgado, Jocelem Mastrodi; Oliveira, Anderson Giovanni Candido de; Mansi, Débora Niero; Donado-Pestana, Carlos M; Bastos, Candido Ricardo; Marcondes, Fernanda Klein
2010-12-01
Cardiovascular disease is a serious public health problem; it is the first "cause of death" in Brazil and in developed countries. Thus, it is essential to search for alternative sources such as some functional foods to prevent and control the risks of this disease. The purpose of this study was to evaluate the lipidemic parameters in hypercholesterolemic rats fed diets containing black rice variety IAC 600 or unrefined rice. Adult male Wistar rats (Rattus norvegicus var. albinos) were used, weighing about 200-220 g. The animals were divided into four groups: the first received a control casein diet, the second received hypercholesterolemic diet, and the other two groups, after induction of hypercholesterolemia, received the test diets, the first containing 20% black rice and the second 20% unrefined, for 30 days. It was observed that diet containing black rice reduced the level of plasma cholesterol, triglycerides, and low-density lipoprotein. For high-density lipoprotein values, the diet that provided an increase in the levels was the black rice. The diet containing black rice was more effective in controlling the lipidemia in rats compared with the whole rice diet.
Directory of Open Access Journals (Sweden)
Lada Hurková
2000-12-01
Full Text Available Eimeria motelo sp. n. is described from faeces of the yellow-footed tortoise, Geochelone denticulata (L.. Oocysts are irregularly ellipsoidal or cylindrical, with slightly expressed lobed protrusions and irregularities at the poles, possibly caused by wrinkling of the oocyst wall, 17 (15-19 × 9.4 (8.5-11 µm, shape index (length/width being 1.81 (1.45-2. The oocyst wall is smooth, single-layered, 0.5 µm thick with no micropyle. There are no polar bodies. Sporocysts are ellipsoidal, 8.9 (7.5-10 × 4.4 (4-5 µm, shape index 2.03 (1.7-2.5. A sporocyst residuum is present, composed of many granules of irregular size. The sporozoites are elongate, lying lengthwise in the sporocysts. Comparison with other species of the genus Eimeria parasitising members of family Testudinidae indicates that the presently described coccidium represents a new species. The name of Eimeria carinii Lainson, Costa & Shaw, 1990 is found to be preoccupied by a homonym, Eimeria carinii Pinto 1928 given to a coccidium from Rattus norvegicus. Therefore, it is replaced by Eimeria lainsoni nom. nov.
Laude, Jennifer R; Pattison, Kristina F; Rayburn-Reeves, Rebecca M; Michler, Daniel M; Zentall, Thomas R
2016-01-01
Pigeons given a simultaneous spatial discrimination reversal, in which a single reversal occurs at the midpoint of each session, consistently show anticipation prior to the reversal as well as perseveration after the reversal, suggesting that they use a less effective cue (time or trial number into the session) than what would be optimal to maximize reinforcement (local feedback from the most recent trials). In contrast, rats (Rattus norvegicus) and humans show near-optimal reversal learning on this task. To determine whether this is a general characteristic of mammals, in the present research, pigeons (Columba livia) and dogs (Canis familiaris) were tested with a simultaneous spatial discrimination mid-session reversal. Overall, dogs performed the task more poorly than pigeons. Interestingly, both pigeons and dogs employed what resembled a timing strategy. However, dogs showed greater perseverative errors, suggesting that they may have relatively poorer working memory and inhibitory control with this task. The greater efficiency shown by pigeons with this task suggests they are better able to time and use the feedback from their preceding choice as the basis of their future choice, highlighting what may be a qualitative difference between the species.
Directory of Open Access Journals (Sweden)
IP da Costa
2002-07-01
Full Text Available A total of 128 ticks of the genus Amblyomma were recovered from 5 marsupials (Didelphis albiventris - with 4 recaptures - and 17 rodents (16 Bolomys lasiurus and 1 Rattus norvegicus captured in an urban forest reserve in Campo Grande, State of Mato Grosso do Sul, Brazil. Of the ticks collected, 95 (78.9% were in larval form and 22 (21.1% were nymphs; the only adult (0.8% was identified as A. cajennense. Viewed under dark-field microscopy in the fourth month after seeding, 9 cultures prepared from spleens and livers of the rodents, blood of the marsupials, and macerates of Amblyomma sp. nymphs revealed spiral-shaped, spirochete-like structures resembling those of Borrelia sp. Some of them showed little motility, while others were non-motile. No such structures could be found either in positive Giemsa-stained culture smears or under electron microscopy. No PCR amplification of DNA from those cultures could be obtained by employing Leptospira sp., B. burgdorferi, and Borrelia sp. primers. These aspects suggest that the spirochete-like structures found in this study do not fit into the genera Borrelia or Leptospira, requiring instead to be isolated for proper identification.
Düsman, E; Almeida, I V; Pinto, E P; Lucchetta, L; Vicentini, V E P
2017-05-31
Integral grape juice is extracted from the grape through processes that allow the retention of their natural composition. However, due to the severity of some processes, fruit juices can undergo changes in their quality. The present study evaluated the cytotoxic and mutagenic effects of integral grape juice by a cytokinesis-blocked micronucleus assay in Rattus norvegicus hepatoma cells (HTC) in vitro. Vitis labrusca L. (variety Concord) were produced organically and by a conventional system, and their juice was extracted by a hot extraction process. The organic grapes were subjected to ultraviolet-type C radiation (UV-C). Experiments were performed after production and after 6 months in storage. Physicochemical analyses revealed that UV-C irradiation of organic grapes, the juice production process, and storage resulted in nutraceutical alterations. However, none of the juice concentrations were cytotoxic to HTC cells by the cytokinesis-blocked proliferation index results or were mutagenic, because the formation of micronucleated cells was not induced. In general, juice induced cell proliferation, possibly due to the presence of vitamins and sugar content (total soluble solid). The data increased the understanding of food technology and confirmed the quality and safety consumption of these juices.
Directory of Open Access Journals (Sweden)
Kafejian Andréa Paula
1997-01-01
Full Text Available A importância das biopróteses na medicina abrange diversas áreas cirúrgicas. Com o objetivo de comparar a reação tecidual do implante de silicone, um dos mais utilizados, com o implante de politetrafluoroetileno expandido (PTFE-E, de uso mais recente, nos propusemos a realizar este estudo. Foram utilizados trinta ratos (Rattus norvegicus albinus machos, distribuídos em três grupos iguais, com implantes de fragmentos discóides dos materiais citados, no dorso de cada rato. Os grupos diferiram entre si quanto ao período de eutanásia: três, sete e trinta dias. Com base no modelo experimental e utilizando metodologia morfométrica, do ponto de vista histológico não houve reação inflamatória aguda importante que se pudesse correlacionar aos materiais de implantes. A proliferação vascular e a presença de fibrose foram prolongadas em relação à cicatrização normal. A irregularidade do PTFE-E, provavelmente relaciona-se à maior quantidade de vasos e de fibrose tardia constatada neste material, quando comparado ao implante de silicone.