WorldWideScience

Sample records for rapid healing occurred

  1. Rapid self-healing hydrogels

    Science.gov (United States)

    Phadke, Ameya; Zhang, Chao; Arman, Bedri; Hsu, Cheng-Chih; Mashelkar, Raghunath A.; Lele, Ashish K.; Tauber, Michael J.; Arya, Gaurav; Varghese, Shyni

    2012-01-01

    Synthetic materials that are capable of autonomous healing upon damage are being developed at a rapid pace because of their many potential applications. Despite these advancements, achieving self-healing in permanently cross-linked hydrogels has remained elusive because of the presence of water and irreversible cross-links. Here, we demonstrate that permanently cross-linked hydrogels can be engineered to exhibit self-healing in an aqueous environment. We achieve this feature by arming the hydrogel network with flexible-pendant side chains carrying an optimal balance of hydrophilic and hydrophobic moieties that allows the side chains to mediate hydrogen bonds across the hydrogel interfaces with minimal steric hindrance and hydrophobic collapse. The self-healing reported here is rapid, occurring within seconds of the insertion of a crack into the hydrogel or juxtaposition of two separate hydrogel pieces. The healing is reversible and can be switched on and off via changes in pH, allowing external control over the healing process. Moreover, the hydrogels can sustain multiple cycles of healing and separation without compromising their mechanical properties and healing kinetics. Beyond revealing how secondary interactions could be harnessed to introduce new functions to chemically cross-linked polymeric systems, we also demonstrate various potential applications of such easy-to-synthesize, smart, self-healing hydrogels. PMID:22392977

  2. Rapid identification of slow healing wounds.

    Science.gov (United States)

    Jung, Kenneth; Covington, Scott; Sen, Chandan K; Januszyk, Michael; Kirsner, Robert S; Gurtner, Geoffrey C; Shah, Nigam H

    2016-01-01

    Chronic nonhealing wounds have a prevalence of 2% in the United States, and cost an estimated $50 billion annually. Accurate stratification of wounds for risk of slow healing may help guide treatment and referral decisions. We have applied modern machine learning methods and feature engineering to develop a predictive model for delayed wound healing that uses information collected during routine care in outpatient wound care centers. Patient and wound data was collected at 68 outpatient wound care centers operated by Healogics Inc. in 26 states between 2009 and 2013. The dataset included basic demographic information on 59,953 patients, as well as both quantitative and categorical information on 180,696 wounds. Wounds were split into training and test sets by randomly assigning patients to training and test sets. Wounds were considered delayed with respect to healing time if they took more than 15 weeks to heal after presentation at a wound care center. Eleven percent of wounds in this dataset met this criterion. Prognostic models were developed on training data available in the first week of care to predict delayed healing wounds. A held out subset of the training set was used for model selection, and the final model was evaluated on the test set to evaluate discriminative power and calibration. The model achieved an area under the curve of 0.842 (95% confidence interval 0.834-0.847) for the delayed healing outcome and a Brier reliability score of 0.00018. Early, accurate prediction of delayed healing wounds can improve patient care by allowing clinicians to increase the aggressiveness of intervention in patients most at risk. © 2015 by the Wound Healing Society.

  3. Rapid Self-healing Nanocomposite Hydrogel with Tunable Dynamic Mechanics

    Science.gov (United States)

    Li, Qiaochu; Mishra, Sumeet; Chapman, Brian; Chen, Pangkuan; Tracy, Joseph; Holten-Andersen, Niels

    The macroscopic healing rate and efficiency in self-repairing hydrogel materials are largely determined by the dissociation dynamics of their polymer network, which is hardly achieved in a controllable manner. Inspired by mussel's adhesion chemistry, we developed a novel approach to assemble inorganic nanoparticles and catechol-decorated PEG polymer into a hydrogel network. When utilized as reversible polymer-particle crosslinks, catechol-metal coordination bonds yield a unique gel network with dynamic mechanics controlled directly by interfacial crosslink structure. Taking advantage of this structure-property relationship at polymer-particle interfaces, we designed a hierarchically structured hybrid gel with two distinct relaxation timescales. By tuning the relative contribution of the two relaxation modes, we are able to finely control the gel's dynamic mechanical behavior from a viscoelastic fluid to a stiff solid, yet preserving its rapid self-healing property without the need for external stimuli.

  4. Common cellular events occur during wound healing and organ regeneration in the sea cucumber Holothuria glaberrima

    Directory of Open Access Journals (Sweden)

    García-Arrarás José E

    2007-10-01

    Full Text Available Abstract Background All animals possess some type of tissue repair mechanism. In some species, the capacity to repair tissues is limited to the healing of wounds. Other species, such as echinoderms, posses a striking repair capability that can include the replacement of entire organs. It has been reported that some mechanisms, namely extracellular matrix remodeling, appear to occur in most repair processes. However, it remains unclear to what extent the process of organ regeneration, particularly in animals where loss and regeneration of complex structures is a programmed natural event, is similar to wound healing. We have now used the sea cucumber Holothuria glaberrima to address this question. Results Animals were lesioned by making a 3–5 mm transverse incision between one of the longitudinal muscle pairs along the bodywall. Lesioned tissues included muscle, nerve, water canal and dermis. Animals were allowed to heal for up to four weeks (2, 6, 12, 20, and 28 days post-injury before sacrificed. Tissues were sectioned in a cryostat and changes in cellular and tissue elements during repair were evaluated using classical dyes, immmuohistochemistry and phalloidin labeling. In addition, the temporal and spatial distribution of cell proliferation in the animals was assayed using BrdU incorporation. We found that cellular events associated with wound healing in H. glaberrima correspond to those previously shown to occur during intestinal regeneration. These include: (1 an increase in the number of spherule-containing cells, (2 remodeling of the extracellular matrix, (3 formation of spindle-like structures that signal dedifferentiation of muscle cells in the area flanking the lesion site and (4 intense cellular division occurring mainly in the coelomic epithelium after the first week of regeneration. Conclusion Our data indicate that H. glaberrima employs analogous cellular mechanisms during wound healing and organ regeneration. Thus, it is possible

  5. Holokinetic centromeres and efficient telomere healing enable rapid karyotype evolution.

    Science.gov (United States)

    Jankowska, Maja; Fuchs, Jörg; Klocke, Evelyn; Fojtová, Miloslava; Polanská, Pavla; Fajkus, Jiří; Schubert, Veit; Houben, Andreas

    2015-12-01

    Species with holocentric chromosomes are often characterized by a rapid karyotype evolution. In contrast to species with monocentric chromosomes where acentric fragments are lost during cell division, breakage of holocentric chromosomes creates fragments with normal centromere activity. To decipher the mechanism that allows holocentric species an accelerated karyotype evolution via chromosome breakage, we analyzed the chromosome complements of irradiated Luzula elegans plants. The resulting chromosomal fragments and rearranged chromosomes revealed holocentromere-typical CENH3 and histone H2AThr120ph signals as well as the same mitotic mobility like unfragmented chromosomes. Newly synthesized telomeres at break points become detectable 3 weeks after irradiation. The presence of active telomerase suggests a telomerase-based mechanism of chromosome healing. A successful transmission of holocentric chromosome fragments across different generations was found for most offspring of irradiated plants. Hence, a combination of holokinetic centromere activity and the fast formation of new telomeres at break points enables holocentric species a rapid karyotype evolution involving chromosome fissions and rearrangements.

  6. Integrative Priming Occurs Rapidly and Uncontrollably during Lexical Processing

    Science.gov (United States)

    Estes, Zachary; Jones, Lara L.

    2009-01-01

    Lexical priming, whereby a prime word facilitates recognition of a related target word (e.g., "nurse" [right arrrow] "doctor"), is typically attributed to association strength, semantic similarity, or compound familiarity. Here, the authors demonstrate a novel type of lexical priming that occurs among unassociated, dissimilar,…

  7. Rapid hemostatic and mild polyurethane-urea foam wound dressing for promoting wound healing.

    Science.gov (United States)

    Liu, Xiangyu; Niu, Yuqing; Chen, Kevin C; Chen, Shiguo

    2017-02-01

    A novel rapid hemostatic and mild polyurethane-urea foam (PUUF) wound dressing was prepared by the particle leaching method and vacuum freeze-drying method using 4, 4-Methylenebis(cyclohexyl isocyanate), 4,4-diaminodicyclohexylmethane and poly (ethylene glycol) as raw materials. And X-ray diffraction (XRD), tensile test, differential scanning calorimetry (DSC) and thermogravimetry (TG) were used to its crystallinity, stress and strain behavior, and thermal properties, respectively. Platelet adhesion, fibrinogen adhesion and blood clotting were performed to evaluate its hemostatic effect. And H&E staining and Masson Trichrome staining were used to its wound healing efficacy. The results revealed the pore size of PUUF is 50-130μm, and its porosity is 71.01%. Porous PUUF exhibited good water uptake that was benefit to adsorb abundant wound exudates to build a regional moist environment beneficial for wound healing. The PUUF wound dressing exhibit better blood coagulation effect than commercial polyurethane dressing (CaduMedi). Though both PUUF and CaduMedi facilitated wound healing generating full re-epithelialization within 13days, PUUF was milder and lead to more slight inflammatory response than CaduMedi. In addition, PUUF wound dressing exhibited lower cytotoxicity than CaduMedi against NIH3T3 cells. Overall, porous PUUF represents a novel mild wound dressing with excellent water uptake, hemostatic effect and low toxicity, and it can promote wound healing and enhance re-epithelialization. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. Tachyphylaxis of human forearm vascular responses does not occur rapidly after exposure to isoproterenol.

    Science.gov (United States)

    Stein, C M; Nelson, R; Deegan, R; He, H; Inagami, T; Frazer, M; Badr, K F; Wood, M; Wood, A J

    1995-06-01

    In vitro and limited in vivo data suggest that rapid desensitization of beta-adrenoceptor responses occurs after exposure to agonist. Tachyphylaxis to a beta-adrenoceptor agonist would represent a potentially important mechanism for the short-term regulation of vascular tone. The effects of a 4-hour infusion of 400 ng/min intra-arterial isoproterenol on forearm blood flow and presynaptic beta-adrenoceptor-mediated norepinephrine release were determined in eight healthy volunteers. Intra-arterial isoproterenol at 400 ng/min resulted in a significant increase in forearm blood flow in all eight subjects at all time points, with no evidence of tachyphylaxis. In fact, forearm blood flow after 4 hours of the isoproterenol infusion (22.8 +/- 3.3 mL/100 mL per minute) was significantly greater than after 7 minutes (14.6 +/- 2.8 mL/100 mL per minute), 15 minutes (15.4 +/- 2.4 mL/100 mL per minute), and 30 minutes (17.4 +/- 3.0 mL/100 mL per minute) of the infusion (P < .05). Similarly, presynaptic beta-adrenoceptor responses showed no evidence of tachyphylaxis, so forearm norepinephrine spillover values after 7 minutes (6.6 +/- 0.94 ng/min), 15 minutes (7.6 +/- 1.5 ng/min), and 4 hours (8.8 +/- 1.1 ng/min) of isoproterenol infusion were increased and similar. Minimal systemic effects were observed, and there was no evidence of tolerance, there being no difference in heart rate after 7 minutes (70.7 +/- 2.7 beats per minute) and 4 hours (72.2 +/- 3.6 beats per minute) of isoproterenol infusion.(ABSTRACT TRUNCATED AT 250 WORDS)

  9. Fibrous dysplasia: rapid malignant transformation into osteogenic sarcoma - A rare occurance

    Directory of Open Access Journals (Sweden)

    S Gon

    2012-09-01

    Full Text Available Malignant transformation of fibrous dysplasia is rare, occurring in less than 1% of cases with a mean lag period of 13.5 years. We report a case of Osteogenic Sarcoma with chondroid differentiation in a pre-existing Fibrous Dysplasia occurring within one year of surgical resection and without any history of exposure to radiation. To the best of our knowledge and extensive search of literature, malignant transformation of Fibrous Dysplasia in such a short period of time, and without history of radiation exposure has never been reported from India.Journal of Pathology of Nepal (2012 Vol. 2, 335-337DOI: http://dx.doi.org/10.3126/jpn.v2i4.6891

  10. Rapid bursts of androgen-binding protein (Abp) gene duplication occurred independently in diverse mammals.

    Science.gov (United States)

    Laukaitis, Christina M; Heger, Andreas; Blakley, Tyler D; Munclinger, Pavel; Ponting, Chris P; Karn, Robert C

    2008-02-12

    The draft mouse (Mus musculus) genome sequence revealed an unexpected proliferation of gene duplicates encoding a family of secretoglobin proteins including the androgen-binding protein (ABP) alpha, beta and gamma subunits. Further investigation of 14 alpha-like (Abpa) and 13 beta- or gamma-like (Abpbg) undisrupted gene sequences revealed a rich diversity of developmental stage-, sex- and tissue-specific expression. Despite these studies, our understanding of the evolution of this gene family remains incomplete. Questions arise from imperfections in the initial mouse genome assembly and a dearth of information about the gene family structure in other rodents and mammals. Here, we interrogate the latest 'finished' mouse (Mus musculus) genome sequence assembly to show that the Abp gene repertoire is, in fact, twice as large as reported previously, with 30 Abpa and 34 Abpbg genes and pseudogenes. All of these have arisen since the last common ancestor with rat (Rattus norvegicus). We then demonstrate, by sequencing homologs from species within the Mus genus, that this burst of gene duplication occurred very recently, within the past seven million years. Finally, we survey Abp orthologs in genomes from across the mammalian clade and show that bursts of Abp gene duplications are not specific to the murid rodents; they also occurred recently in the lagomorph (rabbit, Oryctolagus cuniculus) and ruminant (cattle, Bos taurus) lineages, although not in other mammalian taxa. We conclude that Abp genes have undergone repeated bursts of gene duplication and adaptive sequence diversification driven by these genes' participation in chemosensation and/or sexual identification.

  11. Effect of a single injection of autologous conditioned serum (ACS) on tendon healing in equine naturally occurring tendinopathies.

    Science.gov (United States)

    Geburek, Florian; Lietzau, Maren; Beineke, Andreas; Rohn, Karl; Stadler, Peter M

    2015-06-26

    Autologous blood-derived biologicals, including autologous conditioned serum (ACS), are frequently used to treat tendinopathies in horses despite limited evidence for their efficacy. The purpose of this study was to describe the effect of a single intralesional injection of ACS in naturally occurring tendinopathies of the equine superficial digital flexor tendon (SDFT) on clinical, ultrasonographic, and histological parameters. Fifteen horses with 17 naturally occurring tendinopathies of forelimb SDFTs were examined clinically and ultrasonographically (day 0). Injured tendons were randomly assigned to the ACS-treated group (n = 10) receiving a single intralesional ACS injection or included as controls (n = 7) which were either untreated or injected with saline on day 1. All horses participated in a gradually increasing exercise programme and were re-examined nine times at regular intervals until day 190. Needle biopsies were taken from the SDFTs on days 0, 36 and 190 and examined histologically and for the expression of collagen types I and III by immunohistochemistry. In ACS-treated limbs lameness decreased significantly until day 10 after treatment. Swelling (scores) of the SDFT region decreased within the ACS group between 50 and 78 days after treatment. Ultrasonographically, the percentage of the lesion in the tendon was significantly lower and the echogenicity of the lesion (total echo score) was significantly higher 78 and 106 days after intralesional ACS injection compared to controls. Histology revealed that, compared to controls, tenocyte nuclei were more spindle-shaped 36 days after ACS injection. Immunohistochemistry showed that collagen type I expression significantly increased between days 36 and 190 after ACS injection. Single intralesional ACS injection of equine SDFTs with clinical signs of acute tendinopathy contributes to an early significant reduction of lameness and leads to temporary improvement of ultrasonographic parameters of repair tissue

  12. Design and Fabrication of a Novel Stimulus-Feedback Anticorrosion Coating Featured by Rapid Self-Healing Functionality for the Protection of Magnesium Alloy.

    Science.gov (United States)

    Ding, ChenDi; Xu, JianHua; Tong, Ling; Gong, GuangCai; Jiang, Wei; Fu, Jiajun

    2017-06-21

    Corrosion potential stimulus-responsive smart nanocontainers (CP-SNCs) are designed and synthesized based on the installation of the supramolecular assemblies (bipyridinium ⊂ water-soluble pillar[5]arenes) onto the exterior surface of magnetic nanovehicles (Fe 3 O 4 @mSiO 2 ), linked by disulfide linkers. The supramolecular assemblies with high binding affinity as gatekeepers effectively block the encapsulated organic corrosion inhibitor, 8-hydroxyquinoline (8-HQ), within the mesopores of Fe 3 O 4 @mSiO 2 . When the corrosion potential of the magnesium alloy (-1.5 V vs SHE) is exerted, 8-HQ is released instantly because of the cleavage of disulfide linkers and the removal of the supramolecular assemblies. CP-SNCs were incorporated into the hybrid organic-inorganic sol-gel coating to construct a corrosion potential stimulus-feedback anticorrosion coating (CP-SFAC) that was then deposited on the magnesium alloy, AZ31B. With the aid of a magnetic field, CP-SNCs were gathered in the proximity of the surface of AZ31B. CP-SFAC showed a satisfactory anticorrosion performance, more importantly, through the evaluation of microzone electrochemical techniques. CP-SFAC presented the rapid self-healing functionality when the localized corrosion occurred. Shortening the distance between CP-SNCs and the surface of AZ31B enhances the availability of the incorporated CP-SNCs and makes most of the CP-SNCs to timely respond to the corrosion potential stimulus and facilitates the formation of a compact molecular protective film before the corrosion products pile up. The characteristics of fast response time and quick self-healing rate meet the requirements of the magnesium alloy for self-healing in local regions.

  13. Patients With Co-Occurring Bipolar Disorder and Posttraumatic Stress Disorder: A Rapid Review of the Literature.

    Science.gov (United States)

    Cerimele, Joseph M; Bauer, Amy M; Fortney, John C; Bauer, Mark S

    2017-05-01

    To summarize the current literature on epidemiology, clinical correlates, and treatment of individuals with co-occurring bipolar disorder and posttraumatic stress disorder (PTSD). We conducted a focused, time-sensitive review called "rapid review" in November 2015, using keyword searches (including keywords bipolar disorder, post-traumatic stress disorder, PTSD, and others) in PubMed for studies of adults with co-occurring bipolar disorder and PTSD. Results were sorted and systematically searched. An article was excluded if it did not describe adult patients with co-occurring PTSD and bipolar disorder or did not report original data on epidemiology, clinical correlates, or treatment. Information on study characteristics including population studied and key findings were extracted onto a data collection tool. Thirty-two articles were included. Over two-thirds of articles reported epidemiology of co-occurring bipolar disorder and PTSD. Prevalence of PTSD among individuals with bipolar disorder ranged from 4% to 40%, with women and those with bipolar I versus bipolar II disorder experiencing higher prevalence of PTSD. Prevalence of bipolar disorder among individuals with PTSD ranged from 6% to 55%. Baseline PTSD or bipolar disorder was associated with incidence of the other illness. Individuals with co-occurring bipolar disorder and PTSD experienced high symptom burden and low quality of life. No studies evaluated prospective treatment of patients with co-occurring bipolar disorder and PTSD. Bipolar disorder and PTSD commonly co-occur and result in greater symptom burden than either condition alone. Few published treatment strategies exist for patients with both conditions.

  14. Rapid healing of cutaneous leishmaniasis by high-frequency electrocauterization and hydrogel wound care with or without DAC N-055: a randomized controlled phase IIa trial in Kabul.

    Directory of Open Access Journals (Sweden)

    Ahmad Fawad Jebran

    2014-02-01

    Full Text Available Anthroponotic cutaneous leishmaniasis (CL due to Leishmania (L. tropica infection is a chronic, frequently disfiguring skin disease with limited therapeutic options. In endemic countries healing of ulcerative lesions is often delayed by bacterial and/or fungal infections. Here, we studied a novel therapeutic concept to prevent superinfections, accelerate wound closure, and improve the cosmetic outcome of ACL.From 2004 to 2008 we performed a two-armed, randomized, double-blinded, phase IIa trial in Kabul, Afghanistan, with patients suffering from L. tropica CL. The skin lesions were treated with bipolar high-frequency electrocauterization (EC followed by daily moist-wound-treatment (MWT with polyacrylate hydrogel with (group I or without (group II pharmaceutical sodium chlorite (DAC N-055. Patients below age 5, with facial lesions, pregnancy, or serious comorbidities were excluded. The primary, photodocumented outcome was the time needed for complete lesion epithelialization. Biopsies for parasitological and (immunohistopathological analyses were taken prior to EC (1(st, after wound closure (2(nd and after 6 months (3(rd. The mean duration for complete wound closure was short and indifferent in group I (59 patients, 43.1 d and II (54 patients, 42 d; p = 0.83. In patients with Leishmania-positive 2(nd biopsies DAC N-055 caused a more rapid wound epithelialization (37.2 d vs. 58.3 d; p = 0.08. Superinfections occurred in both groups at the same rate (8.8%. Except for one patient, reulcerations (10.2% in group I, 18.5% in group II; p = 0.158 were confined to cases with persistent high parasite loads after healing. In vitro, DAC N-055 showed a leishmanicidal effect on pro- and amastigotes.Compared to previous results with intralesional antimony injections, the EC plus MWT protocol led to more rapid wound closure. The tentatively lower rate of relapses and the acceleration of wound closure in a subgroup of patients with parasite persistence warrant

  15. Rapid Healing of Cutaneous Leishmaniasis by High-Frequency Electrocauterization and Hydrogel Wound Care with or without DAC N-055: A Randomized Controlled Phase IIa Trial in Kabul

    Science.gov (United States)

    Steiner, Reto; Wentker, Pia; Mahfuz, Farouq; Stahl, Hans-Christian; Amin, Faquir Mohammad; Bogdan, Christian; Stahl, Kurt-Wilhelm

    2014-01-01

    Background Anthroponotic cutaneous leishmaniasis (CL) due to Leishmania (L.) tropica infection is a chronic, frequently disfiguring skin disease with limited therapeutic options. In endemic countries healing of ulcerative lesions is often delayed by bacterial and/or fungal infections. Here, we studied a novel therapeutic concept to prevent superinfections, accelerate wound closure, and improve the cosmetic outcome of ACL. Methodology/Principal Findings From 2004 to 2008 we performed a two-armed, randomized, double-blinded, phase IIa trial in Kabul, Afghanistan, with patients suffering from L. tropica CL. The skin lesions were treated with bipolar high-frequency electrocauterization (EC) followed by daily moist-wound-treatment (MWT) with polyacrylate hydrogel with (group I) or without (group II) pharmaceutical sodium chlorite (DAC N-055). Patients below age 5, with facial lesions, pregnancy, or serious comorbidities were excluded. The primary, photodocumented outcome was the time needed for complete lesion epithelialization. Biopsies for parasitological and (immuno)histopathological analyses were taken prior to EC (1st), after wound closure (2nd) and after 6 months (3rd). The mean duration for complete wound closure was short and indifferent in group I (59 patients, 43.1 d) and II (54 patients, 42 d; p = 0.83). In patients with Leishmania-positive 2nd biopsies DAC N-055 caused a more rapid wound epithelialization (37.2 d vs. 58.3 d; p = 0.08). Superinfections occurred in both groups at the same rate (8.8%). Except for one patient, reulcerations (10.2% in group I, 18.5% in group II; p = 0.158) were confined to cases with persistent high parasite loads after healing. In vitro, DAC N-055 showed a leishmanicidal effect on pro- and amastigotes. Conclusions/Significance Compared to previous results with intralesional antimony injections, the EC plus MWT protocol led to more rapid wound closure. The tentatively lower rate of relapses and the acceleration of

  16. Rapid healing of cutaneous leishmaniasis by high-frequency electrocauterization and hydrogel wound care with or without DAC N-055: a randomized controlled phase IIa trial in Kabul.

    Science.gov (United States)

    Jebran, Ahmad Fawad; Schleicher, Ulrike; Steiner, Reto; Wentker, Pia; Mahfuz, Farouq; Stahl, Hans-Christian; Amin, Faquir Mohammad; Bogdan, Christian; Stahl, Kurt-Wilhelm

    2014-02-01

    Anthroponotic cutaneous leishmaniasis (CL) due to Leishmania (L.) tropica infection is a chronic, frequently disfiguring skin disease with limited therapeutic options. In endemic countries healing of ulcerative lesions is often delayed by bacterial and/or fungal infections. Here, we studied a novel therapeutic concept to prevent superinfections, accelerate wound closure, and improve the cosmetic outcome of ACL. From 2004 to 2008 we performed a two-armed, randomized, double-blinded, phase IIa trial in Kabul, Afghanistan, with patients suffering from L. tropica CL. The skin lesions were treated with bipolar high-frequency electrocauterization (EC) followed by daily moist-wound-treatment (MWT) with polyacrylate hydrogel with (group I) or without (group II) pharmaceutical sodium chlorite (DAC N-055). Patients below age 5, with facial lesions, pregnancy, or serious comorbidities were excluded. The primary, photodocumented outcome was the time needed for complete lesion epithelialization. Biopsies for parasitological and (immuno)histopathological analyses were taken prior to EC (1(st)), after wound closure (2(nd)) and after 6 months (3(rd)). The mean duration for complete wound closure was short and indifferent in group I (59 patients, 43.1 d) and II (54 patients, 42 d; p = 0.83). In patients with Leishmania-positive 2(nd) biopsies DAC N-055 caused a more rapid wound epithelialization (37.2 d vs. 58.3 d; p = 0.08). Superinfections occurred in both groups at the same rate (8.8%). Except for one patient, reulcerations (10.2% in group I, 18.5% in group II; p = 0.158) were confined to cases with persistent high parasite loads after healing. In vitro, DAC N-055 showed a leishmanicidal effect on pro- and amastigotes. Compared to previous results with intralesional antimony injections, the EC plus MWT protocol led to more rapid wound closure. The tentatively lower rate of relapses and the acceleration of wound closure in a subgroup of patients with parasite persistence warrant

  17. Healing effects of Musa sapientum var. paradisiaca in diabetic rats with co-occurring gastric ulcer: cytokines and growth factor by PCR amplification.

    Science.gov (United States)

    Kumar, Mohan; Gautam, Manish Kumar; Singh, Amit; Goel, Raj Kumar

    2013-11-05

    The present study evaluates the effects of extract of Musa sapientum fruit (MSE) on ulcer index, blood glucose level and gastric mucosal cytokines, TNF-α and IL-1β and growth factor, TGF-α (affected in diabetes and chronic ulcer) in acetic acid (AA)-induced gastric ulcer (GU) in diabetic (DR) rat. MSE (100 mg/kg, oral), omeprazole (OMZ, 2.0 mg/kg, oral), insulin (INS, 4 U/kg, sc) or pentoxyphylline (PTX, 10 mg/kg, oral) were given once daily for 10 days in 14 days post-streptozotocin (60 mg/kg, intraperitoneal)-induced diabetic rats while, the normal/diabetic rats received CMC for the same period after induction of GU with AA. Ulcer index was calculated based upon the product of length and width (mm2/rat) of ulcers while, TNF-α, IL-1β and TGF-α were estimated in the gastric mucosal homogenate from the intact/ulcer region. Phytochemical screening and HPTLC analysis of MSE was done following standard procedures. An increase in ulcer index, TNF-α and IL-1β were observed in normal (NR)-AA rat compared to NR-normal saline rat, which were further increased in DR-AA rat while, treatments of DR-AA rat with MSE, OMZ, INS and PTX reversed them, more so with MSE and PTX. Significant increase in TGF-α was found in NR-AA rat which did not increase further in DR-AA rat. MSE and PTX tended to increase while, OMZ and INS showed little or no effect on TGF-α in AA-DR rat. Phytochemical screening of MSE showed the presence of saponins, flavonoids, glycosides, steroids and alkaloids and HPTLC analysis indicated the presence of eight active compounds. MSE showed antidiabetic and better ulcer healing effects compared with OMZ (antiulcer) or INS (antidiabetic) in diabetic rat and could be more effective in diabetes with concurrent gastric ulcer.

  18. Attempts using cryotherapy to achieve more rapid healing in patients with cutaneous leishmaniasis due to L. braziliensis braziliensis

    Directory of Open Access Journals (Sweden)

    Elmer Alejandro Llanos Cuentas

    1983-06-01

    Full Text Available The use of cryotherapy as an adjunct to systemic antimonial therapy (Clucantime was studied in 17 patients with a total of23 skin lesions of leishmaniasis in an area where L. braziliensis braziliensis is the species in circulation. Cryotherapy did not speed healing and has been discarded as an auxiliary therapeutic measure in our practice. However this technique may be suitable for species o/Leishmania causing more limited superficial lesions in man without the danger of metastasis.

  19. Rapid screening of natually occurring radioactive nuclides({sup 2}'3{sup 8}U, {sup 232}Th) in raw materials and by-products samples using XRF

    Energy Technology Data Exchange (ETDEWEB)

    Park, Ji Young; Lim, Chung Sup [Radiation Biotechnology and Applied Radioiostope Science, University of Science and Technology, Daejeon (Korea, Republic of); Lim, Jong Myoung; Ji, Young Yong; Chung, Kun Ho; Lee, Wan No; Kang, Mun Ja [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Jang, Byung Uck [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2016-12-15

    As new legislation has come into force implementing radiation safety management for the use of naturally occurring radioactive materials (NORM), it is necessary to establish a rapid and accurate measurement technique. Measurement of {sup 238}U and {sup 232}Th using conventional methods encounter the most significant difficulties for pretreatment (e.g., purification, speciation, and dilution/enrichment) or require time-consuming processes. Therefore, in this study, the applicability of ED-XRF as a non-destructive and rapid screening method was validated for raw materials and by-product samples. A series of experiments was conducted to test the applicability for rapid screening of XRF measurement to determine activity of {sup 238}U and {sup 23{sup 2}}Th based on certified reference materials (e.g., soil, rock, phosphorus rock, bauxite, zircon, and coal ash) and NORM samples commercially used in Korea. Statistical methods were used to compare the analytical results of ED-XRF to those of certified values of certified reference materials (CRM) and inductively coupled plasma mass spectrometry (ICP-MS). Results of the XRF measurement for {sup 238}U and {sup 232}Th showed under 20% relative error and standard deviation. The results of the U-test were statistically significant except for the case of U in coal fly ash samples. In addition, analytical results of {sup 238}U and {sup 232}Th in the raw material and by-product samples using XRF and the analytical results of those using ICP-MS (R{sup 2}≥0.95) were consistent with each other. Thus, the analytical results rapidly derived using ED-XRF were fairly reliable. Based on the validation results, it can be concluded that the ED-XRF analysis may be applied to rapid screening of radioactivities ({sup 238}U and {sup 232}Th) in NORM samples.

  20. Early vascular healing with rapid breakdown biodegradable polymer sirolimus-eluting versus durable polymer everolimus-eluting stents assessed by optical coherence tomography

    Energy Technology Data Exchange (ETDEWEB)

    Tada, Tomohisa, E-mail: tomohisa@dhm.mhn.de [Deutsches Herzzentrum, Technische Universität, München (Germany); Byrne, Robert A. [Deutsches Herzzentrum, Technische Universität, München (Germany); Schuster, Tibor [Institut für Medizinische Statistik und Epidemiologie, München (Germany); Cuni, Rezarta [Deutsches Herzzentrum, Technische Universität, München (Germany); Kitabata, Hironori [Wakayama Medical University, Wakayama (Japan); Tiroch, Klaus [Deutsches Herzzentrum, Technische Universität, München (Germany); Dirninger, Alfred; Gratze, Franz; Kaspar, Klaus; Zenker, Gerald [Landeskrankenhaus Bruck/Mur (Austria); Joner, Michael; Schömig, Albert; Kastrati, Adnan [Deutsches Herzzentrum, Technische Universität, München (Germany)

    2013-03-15

    Background: Differences in early arterial healing patterns after stent implantation between biodegradable and durable polymer based new generation drug-eluting stents are not well understood. The aim of this study was to compare the healing patterns of a novel rapid breakdown (≤ 8 weeks) biodegradable polymer sirolimus-eluting stent (BP-SES) with a durable polymer everolimus-eluting stent (EES) using intravascular optical coherence tomography (OCT) at 4 months. Methods: A total of 20 patients were randomly assigned to stenting with BP-SES (n = 11) or EES (n = 9). Overall intravascular imaging was available for 15 (75%) patients. The primary endpoint was the difference in rate of uncovered struts between BP-SES and EES. To account for strut-level clustering, the results in both treatment groups were compared using a generalized linear mixed model approach. Results: Regarding the primary endpoint, BP-SES as compared to EES showed similar rates of uncovered struts (37 [6.8%] versus 167 [17.5%], odds ratio (OR) 0.45 (95% CI 0.09-2.24), p = 0.33). There were no malapposed struts in BP-SES group and 14 malapposed struts in EES group (p = 0.97). No difference in percent neointimal volume (14.1 ± 8.2% vs. 11.4 ± 6.4%, p = 0.56) was observed. Conclusions: Although rapid-breakdown BP-SES as compared to EES showed signs of improved early tissue coverage, after adjustment for strut-level clustering these differences were not statistically significant. No differences in ability to suppress neointimal hyperplasia after stent implantation between 2 stents were observed.

  1. Attempts using cryotherapy to achieve more rapid healing in patients with cutaneous leishmaniasis due to L. braziliensis braziliensis

    Directory of Open Access Journals (Sweden)

    Elmer Alejandro Llanos Cuentas

    1983-06-01

    Full Text Available The use of cryotherapy as an adjunct to systemic antimonial therapy (Clucantime was studied in 17 patients with a total of23 skin lesions of leishmaniasis in an area where L. braziliensis braziliensis is the species in circulation. Cryotherapy did not speed healing and has been discarded as an auxiliary therapeutic measure in our practice. However this technique may be suitable for species o/Leishmania causing more limited superficial lesions in man without the danger of metastasis.O uso da crioterapia associada ao Glucantime na terapia da leishmaniose tegumentar foi estudado em 17 pacientes com um total de 23 lesões de pele por leishmaniose, em uma área onde Leishmania braziliensis braziliensis é a espécie em circulação. A crioterapia não influenciou a rapidez da cicatrização. Ela foi abandonada como método de terapia auxiliar em nossa prática, embora possa ser útil para espécies de Leishmania causando lesões mais superficiais e limitads no homem, sem o perigo de metástase.

  2. Use of Bioresorbable Hydrogels and Genetic Engineering to Accomplish Rapid Stabilization and Healing in Segmental Long Bone Defects

    Science.gov (United States)

    2013-04-29

    Pediatrics, Pediatrics- Nutrition , Baylor College of Medicine, Houston, TX, USA 5Department of Pediatrics, Hematology-Oncology, Baylor College of...undergoing differentiation (Fig. 7A–F). DISCUSSION Heterotopic ossification is a disorder involving rapid bone formation within muscle, tendon , and

  3. A rapid and systematic review of the clinical effectiveness and cost-effectiveness of debriding agents in treating surgical wounds healing by secondary intention

    NARCIS (Netherlands)

    Lewis, R.; Whiting, P.; ter Riet, G.; O'Meara, S.; Glanville, J.

    2001-01-01

    BACKGROUND: Most surgically sutured wounds heal without any complication. However, in some cases wound healing can be delayed due to the presence of infection or wound breakdown. This can result in the wounds becoming cavity wounds and thus necessitate healing by secondary intention. Other surgical

  4. Rapid Changes in Scores on Principal Components of the EEG Spectrum do not Occur in the Course of "Drowsy" Sleep of Varying Length.

    Science.gov (United States)

    Putilov, Arcady A

    2015-04-01

    Wakefulness is separated from a well-established sleep by an onset period. This is characterized by dramatic changes in scores on the first and second principal components of the electroencephalographic (EEG) spectrum, which reflects the kinetics of sleep- and wake-promoting processes. The present analysis examined whether significant buildups and declines of the first and second scores can occur throughout stage 1 sleep, or only on its boundaries with stage 2 and wakefulness. Twenty-seven adults participated in multiple 20-minute attempts to nap in the course of 24-hour wakefulness after either deprivation, restriction or ad lib night sleep. Power spectra were calculated on 1-minute intervals of 251 EEG records. Irrespective of accumulated sleep debt and duration of stage 1 sleep (from 5 minutes), the first principal component score was permanently attenuated across this stage as well as during preceding wakefulness. It showed rapid buildup only on the boundary with stage 2. The second principal component score always started its decline earlier, on the wake-sleep boundary. It did not show further decline throughout the following intervals of stages 1 and 2. It seems that stage 1 sleep occurs due to a delay of the buildup of the sleep-promoting process relative to the decline of the wake-promoting process which coincide, with initiation of stage 2 sleep and termination of wakefulness. Therefore, "drowsy" sleep can be regarded as occupying "no man's land", between the opponent driving forces for wake and sleep. © EEG and Clinical Neuroscience Society (ECNS) 2014.

  5. Factors Affecting Wound Healing

    Science.gov (United States)

    Guo, S.; DiPietro, L.A.

    2010-01-01

    Wound healing, as a normal biological process in the human body, is achieved through four precisely and highly programmed phases: hemostasis, inflammation, proliferation, and remodeling. For a wound to heal successfully, all four phases must occur in the proper sequence and time frame. Many factors can interfere with one or more phases of this process, thus causing improper or impaired wound healing. This article reviews the recent literature on the most significant factors that affect cutaneous wound healing and the potential cellular and/or molecular mechanisms involved. The factors discussed include oxygenation, infection, age and sex hormones, stress, diabetes, obesity, medications, alcoholism, smoking, and nutrition. A better understanding of the influence of these factors on repair may lead to therapeutics that improve wound healing and resolve impaired wounds. PMID:20139336

  6. Astrocyte Structural and Molecular Response to Elevated Intraocular Pressure Occurs Rapidly and Precedes Axonal Tubulin Rearrangement within the Optic Nerve Head in a Rat Model.

    Directory of Open Access Journals (Sweden)

    Shandiz Tehrani

    Full Text Available Glaucomatous axon injury occurs at the level of the optic nerve head (ONH in response to uncontrolled intraocular pressure (IOP. The temporal response of ONH astrocytes (glial cells responsible for axonal support to elevated IOP remains unknown. Here, we evaluate the response of actin-based astrocyte extensions and integrin-based signaling within the ONH to 8 hours of IOP elevation in a rat model. IOP elevation of 60 mm Hg was achieved under isoflurane anesthesia using anterior chamber cannulation connected to a saline reservoir. ONH astrocytic extension orientation was significantly and regionally rearranged immediately after IOP elevation (inferior ONH, 43.2° ± 13.3° with respect to the anterior-posterior axis versus 84.1° ± 1.3° in controls, p<0.05, and re-orientated back to baseline orientation 1 day post IOP normalization. ONH axonal microtubule filament label intensity was significantly reduced 1 and 3 days post IOP normalization, and returned to control levels on day 5. Phosphorylated focal adhesion kinase (FAK levels steadily decreased after IOP normalization, while levels of phosphorylated paxillin (a downstream target of FAK involved in focal adhesion dynamics were significantly elevated 5 days post IOP normalization. The levels of phosphorylated cortactin (a downstream target of Src kinase involved in actin polymerization were significantly elevated 1 and 3 days post IOP normalization and returned to control levels by day 5. No significant axon degeneration was noted by morphologic assessment up to 5 days post IOP normalization. Actin-based astrocyte structure and signaling within the ONH are significantly altered within hours after IOP elevation and prior to axonal cytoskeletal rearrangement, producing some responses that recover rapidly and others that persist for days despite IOP normalization.

  7. Treatment of anastomotic leakage after rectal resection with transrectal vacuum-assisted drainage (VAC). A method for rapid control of pelvic sepsis and healing

    DEFF Research Database (Denmark)

    Nagell, Carl Frederik Otto; Holte, Kathrine

    2006-01-01

    OBJECTIVE: Anastomotic leakage after rectal resection is associated with high morbidity and mortality. Patients without peritonitis can be treated conservatively by transrectal rinsing and drainage. However, healing is often very slow, and formation of abundant scar tissue resulting in a poor...... healing time 336 days (52-1434). CONCLUSION: VAC treatment may possibly shorten healing time of anastomotic leakages after rectal resection. However, the presented results are preliminary, with only few patients included, and obviously, larger, randomized, clinical trials are needed to confirm...... these results and establish the indication for VAC treatment in clinical practice. We believe VAC therapy is a promising treatment of anastomotic leakage after rectal resection....

  8. How wounds heal

    Science.gov (United States)

    How cuts heal; How scrapes heal; How puncture wounds heal; How burns heal; How pressure sores heal; How lacerations heal ... For major wounds, follow your doctor's instructions on how to care for your injury. Avoid picking at ...

  9. Archetypal healing.

    Science.gov (United States)

    Jones, D; Churchill, J E

    1994-01-01

    With emphasis on healing versus curing, the authors draw from a wide assortment of treatment methods for psychospiritual relief of pain in the terminally ill. These archetypal methods include: life-review therapy; ministry of presence; clinical hypnosis; myths, symbols, rituals, and community; creative therapies. In life-review therapy, the ill person shares his/her life story with the provider much like the healing rituals of the ancient storyteller did in his community. In the ministry of presence, the caregiver focuses on sharing his vulnerability, not his professional skills. Clinical hypnosis emphasizes the naturalness and simplicity of accessing the unconscious along with problem areas of the hypnoclinician. Myths, symbols, rituals, and community serve as nurturing agents in the intervention of pain, while creative therapies such as music, drama, crafts, and art continue to be powerful healing instruments. Archetypal healing produces relief of pain in the caregiver, as well as the ill, with emphasis on healing versus curing.

  10. Treatment of anastomotic leakage after rectal resection with transrectal vacuum-assisted drainage (VAC). A method for rapid control of pelvic sepsis and healing

    DEFF Research Database (Denmark)

    Nagell, Carl Frederik Otto; Holte, Kathrine

    2006-01-01

    functional result is not uncommon. Vacuum-assisted closure (VAC) has been shown to accelerate wound healing by increasing local blood flow, reducing bacterial load and stimulating growth of granulation tissue. In this paper, we describe VAC as a method for treating anastomotic leakage after rectal resection...

  11. Dynamically Cross-linked Elastomer Hybrids with Light-Induced Rapid and Efficient Self-Healing Ability and Reprogrammable Shape Memory Behavior.

    Science.gov (United States)

    Bai, Jing; Shi, Zixing

    2017-08-16

    Pristine carbon nanotubes (CNTs) were activated to exhibit Diels-Alder (DA) reactivity in a polymer matrix, which was modified with monomers containing furan groups. The DA-active polymer matrix was transferred into a dynamic reversible cross-linked inorganic-organic network via a Diels-Alder reaction with CNTs, where pristine CNTs were used as dienophile chemicals and furan-modified SBS acted as the macromolecular diene. In this system, the mechanical properties as well as resilience and solvent resistance were greatly improved even with the presence of only 1 wt % CNTs. Meanwhile, the hybrids retained recyclability and exhibited some smart behaviors, including self-healing and reprogrammable shape memory properties. Furthermore, due to the photothermal effect of CNTs, a retro-Diels-Alder (rDA) reaction was activated under laser irradiation, and healing of a crack on the hybrid surface was demonstrated in approximately 10 s with almost complete recovery of the mechanical properties. Such fast and efficient self-healing performance provides a new concept in designing self-healing nanocomposites with tunable structures and mechanical properties. Furthermore, the DA and rDA reactions could be combined to reprogram the shape memory behavior under laser irradiation or thermal treatment, wherein the temporary shape of the sample could be transferred to a permanent shape via the rDA reaction at high temperature.

  12. Evaluation of rapid dual-tracer 62Cu-PTSM + 62Cu-ATSM PET in dogs with spontaneously occurring tumors

    Science.gov (United States)

    Black, Noel F.; McJames, Scott; Rust, Thomas C.; Kadrmas, Dan J.

    2008-01-01

    We are developing methods for imaging multiple PET tracers in a single scan with staggered injections, where imaging measures for each tracer are separated and recovered using differences in tracer kinetics and radioactive decay. In this work, signal separation performance for rapid dual-tracer 62Cu-PTSM (blood flow) + 62Cu-ATSM (hypoxia) tumor imaging was evaluated in a large animal model. Four dogs with pre-existing tumors received a series of dynamic PET scans with 62Cu-PTSM and 62Cu-ATSM, permitting evaluation of a rapid dual-tracer protocol designed by previous simulation work. Several imaging measures were computed from the dual-tracer data and compared with those from separate, single-tracer imaging. Static imaging measures (e.g. SUV) for each tracer were accurately recovered from dual-tracer data. The wash-in (k1) and wash-out (k2) rate parameters for both tracers were likewise well recovered (r = 0.87-0.99), but k3 was not accurately recovered for PTSM (r = 0.19) and moderately well recovered for ATSM (r = 0.70). Some degree of bias was noted, however, which may potentially be overcome through further refinement of the signal separation algorithms. This work demonstrates that complementary information regarding tumor blood flow and hypoxia can be acquired by a single dual-tracer PET scan, and also that the signal separation procedure works effectively for real physiologic data with realistic levels of kinetic model mismatch. Rapid multi-tracer PET has the potential to improve tumor assessment for image-guide therapy and monitoring, and further investigation with these and other tracers is warranted.

  13. Evaluation of rapid dual-tracer {sup 62}Cu-PTSM + {sup 62}Cu-ATSM PET in dogs with spontaneously occurring tumors

    Energy Technology Data Exchange (ETDEWEB)

    Black, Noel F; McJames, Scott; Rust, Thomas C; Kadrmas, Dan J [Utah Center of Advanced Imaging Research, University of Utah, 729 Arapeen Drive, Salt Lake City, UT 84108-1218 (United States)

    2008-01-07

    We are developing methods for imaging multiple PET tracers in a single scan with staggered injections, where imaging measures for each tracer are separated and recovered using differences in tracer kinetics and radioactive decay. In this work, signal separation performance for rapid dual-tracer {sup 62}Cu-PTSM (blood flow) + {sup 62}Cu-ATSM (hypoxia) tumor imaging was evaluated in a large animal model. Four dogs with pre-existing tumors received a series of dynamic PET scans with {sup 62}Cu-PTSM and {sup 62}Cu-ATSM, permitting evaluation of a rapid dual-tracer protocol designed by previous simulation work. Several imaging measures were computed from the dual-tracer data and compared with those from separate, single-tracer imaging. Static imaging measures (e.g. SUV) for each tracer were accurately recovered from dual-tracer data. The wash-in (k{sub 1}) and wash-out (k{sub 2}) rate parameters for both tracers were likewise well recovered (r = 0.87-0.99), but k{sub 3} was not accurately recovered for PTSM (r = 0.19) and moderately well recovered for ATSM (r = 0.70). Some degree of bias was noted, however, which may potentially be overcome through further refinement of the signal separation algorithms. This work demonstrates that complementary information regarding tumor blood flow and hypoxia can be acquired by a single dual-tracer PET scan, and also that the signal separation procedure works effectively for real physiologic data with realistic levels of kinetic model mismatch. Rapid multi-tracer PET has the potential to improve tumor assessment for image-guide therapy and monitoring, and further investigation with these and other tracers is warranted.

  14. Healing Architecture

    DEFF Research Database (Denmark)

    Folmer, Mette Blicher; Mullins, Michael; Frandsen, Anne Kathrine

    2012-01-01

    The project examines how architecture and design of space in the intensive unit promotes or hinders interaction between relatives and patients. The primary starting point is the relatives. Relatives’ support and interaction with their loved ones is important in order to promote the patients healing...... process. Therefore knowledge on how space can support interaction is fundamental for the architect, in order to make the best design solutions. Several scientific studies document that the hospital's architecture and design are important for human healing processes, including how the physical environment...... architectural and design solutions in order to improve quality of interaction between relative and patient in the hospital's intensive unit....

  15. Self-healing of polymer modified concrete

    Directory of Open Access Journals (Sweden)

    Abd_Elmoaty M. Abd_Elmoaty

    2011-06-01

    Full Text Available Self healing phenomenon of concrete has been observed in traditional, fibrous, self compacting concrete. This phenomenon occurred mainly due to the presence of unhydrated cement particles in the presence of water. Mechanism of polymer in concrete depends on creating a layer and net of polymer around cement particles which enhances the properties of polymer modified concrete. This mechanism may affect the self healing of this type of concrete. This work aims to study the presence of the self healing phenomenon in polymer modified concrete and the related parameters. An experimental investigation on self healing of polymer modified concrete was undertaken. In this research work, effect of polymer type, polymer dose, cement content, cement type, w/cm ratio and age of damage were studied. The healing process extended up to 60 days. Ultrasonic pulse velocity measurements were used to evaluate the healing process. Results indicated that, the self healing phenomenon existed in polymer modified concrete as in traditional concrete. The increase of polymer dose increases the healing degree at the same healing time. This increase depends on polymer type. Also, the decrease of w/cm ratio reduces the self healing degree while the use of Type V Portland cement improves the self healing process compared with Type I Portland cement. Cement content has an insignificant effect on healing process for both concrete with and without polymer. In addition, the increase of damage age decreases the efficiency of self healing process.

  16. Regenerative healing, scar-free healing and scar formation across the species: current concepts and future perspectives.

    Science.gov (United States)

    Ud-Din, Sara; Volk, Susan W; Bayat, Ardeshir

    2014-09-01

    All species have evolved mechanisms of repair to restore tissue function following injury. Skin scarring is an inevitable and permanent endpoint for many postnatal organisms except for non-amniote vertebrates such as amphibians, which are capable of tissue regeneration. Furthermore, mammalian foetuses through mid-gestation are capable of rapid wound repair in the absence of scar formation. Notably, excessive cutaneous scar formation, such as hypertrophic and keloid scars, is a species limited clinical entity as it occurs only in humans, although wounds on the distal limbs of horses are also prone to heal with fibroproliferative pathology known as equine exuberant granulation tissue. Currently, there are no reliable treatment options to eradicate or prevent scarring in humans and vertebrates. The limited number of vertebrate models for either hypertrophic or keloid scarring has been an impediment to mechanistic studies of these diseases and the development of therapies. In this viewpoint essay, we highlight the current concepts of regenerative, scar-free and scar-forming healing compared across a number of species and speculate on areas for future research. Furthermore, in-depth investigative research into the mechanisms of scarless repair may allow for the development of improved animal models and novel targets for scar prevention. As the ability to heal in both a scarless manner and propensity for healing with excessive scar formation is highly species dependent, understanding similarities and differences in healing across species as it relates to the regenerative process may hold the key to improve scarring and guide translational wound-healing studies. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  17. Autologous platelet rich plasma in the management of non-healing vasculitic ulcers.

    Science.gov (United States)

    Sriram, Sankaran; Sankaralingam, Rajeswari; Mani, Madeshwaran; Tamilselvam, Tiruchengode Natesan

    2016-12-01

    To determine the role and efficacy of platelet rich plasma (PRP) in the healing of recalcitrant vasculitic ulcers and to study the rapidity of ulcer healing with respect to platelet concentration in the prepared PRP. This is a pilot study which included 20 patients with biopsy-proven vasculitic ulcers after excluding human immunodeficiency virus, uncontrolled diabetes mellitus, hypertension, obesity, active smoking and platelet abnormalities in peripheral smear. PRP was prepared from whole blood by centrifugation and activated using 10% calcium chloride. Activated PRP was applied over the ulcer by spraying using a syringe. Weekly dressing was done until the ulcer healed and healing was monitored using the Leg Ulcer Measurement Tool (LUMT). The total number of patients were 20 (male four; female 16). The mean age was 34.5 ± 15.36 years (2.0 SD). Mean duration of illness was 8.6 ± 2.9 months(2.0 SD). Ulcers were located in the lower third of the leg (n = 13), ankle (n = 4) and foot (n = 3) in the descending order of frequency. On average, epithelization of the wound occurred at 4.4 weeks. Faster healing was seen in mixed connective tissue disease (average 3.5 weeks) and delayed healing in systemic lupus erythematosus (average 4.7 weeks). Average platelet count obtained in the PRP was 5.52 lakhs/mm(3) to 18.6 lakhs/mm(3) with an increase in platelet count of 3.4- to 6-fold, respectively. Duration of healing corresponded with the platelet concentration in the prepared PRP. All the 20 patients showed complete healing within 6 weeks. PRP is a safe, effective, outpatient procedure for the treatment of chronic recalcitrant vasculitic ulcers which improves the quality of life of patients and reduces their financial burden. © 2016 Asia Pacific League of Associations for Rheumatology and John Wiley & Sons Australia, Ltd.

  18. Advances in Wound Healing: A Review of Current Wound Healing Products

    Directory of Open Access Journals (Sweden)

    Patrick S. Murphy

    2012-01-01

    Full Text Available Successful wound care involves optimizing patient local and systemic conditions in conjunction with an ideal wound healing environment. Many different products have been developed to influence this wound environment to provide a pathogen-free, protected, and moist area for healing to occur. Newer products are currently being used to replace or augment various substrates in the wound healing cascade. This review of the current state of the art in wound-healing products looks at the latest applications of silver in microbial prophylaxis and treatment, including issues involving resistance and side effects, the latest uses of negative pressure wound devices, advanced dressings and skin substitutes, biologic wound products including growth factor applications, and hyperbaric oxygen as an adjunct in wound healing. With the abundance of available products, the goal is to find the most appropriate modality or combination of modalities to optimize healing.

  19. Prescription for herbal healing

    National Research Council Canada - National Science Library

    Balch, Phyllis A; Bell, Stacey J

    2012-01-01

    .... From the most trusted name in natural healing, Phyllis A. Balch's new edition of Prescription for Herbal Healing provides the most current research and comprehensive facts in an easy-to-read A- to-Z format, including...

  20. Wound Healing and Care

    Science.gov (United States)

    ... Arrhythmias Abuse Love and Romance Understanding Other People Wound Healing and Care KidsHealth > For Teens > Wound Healing ... stitches or a hospital stay? Different Types of Wounds Most of us think of wounds happening because ...

  1. Saliva and wound healing

    NARCIS (Netherlands)

    Brand, H.S.; Ligtenberg, A.J.M.; Veerman, E.C.I.; Ligtenberg, A.J.M.; Veerman, E.C.I.

    2014-01-01

    Oral wounds heal faster and with less scar formation than skin wounds. One of the key factors involved is saliva, which promotes wound healing in several ways. Saliva creates a humid environment, thus improving the survival and functioning of inflammatory cells that are crucial for wound healing. In

  2. Naturally occurring cardiac glycosides.

    Science.gov (United States)

    Radford, D J; Gillies, A D; Hinds, J A; Duffy, P

    1986-05-12

    Cardiac glycoside poisoning from the ingestion of plants, particularly of oleanders, occurs with reasonable frequency in tropical and subtropical areas. We have assessed a variety of plant specimens for their cardiac glycoside content by means of radioimmunoassays with antibodies that differ in their specificity for cardiac glycosides. Significant amounts of immunoreactive cardiac glycoside were found to be present in the ornamental shrubs: yellow oleander (Thevetia peruviana); oleander (Nerium oleander); wintersweet (Carissa spectabilis); bushman's poison (Carissa acokanthera); sea-mango (Cerbera manghas); and frangipani (Plumeria rubra); and in the milkweeds: redheaded cotton-bush (Asclepias curassavica); balloon cotton (Asclepias fruiticosa); king's crown (Calotropis procera); and rubber vine (Cryptostegia grandifolia). The venom gland of the cane toad (Bufo marinus) also contained large quantities of cardiac glycosides. The competitive immunoassay method permits the rapid screening of specimens that are suspected to contain cardiac glycosides. Awareness of the existence of these plant and animal toxins and their dangers allows them to be avoided and poisoning prevented. The method is also useful for the confirmation of the presence of cardiac glycosides in serum in cases of poisoning.

  3. Tlr2, Tjp1 genes expression during wound healing dynamics – with melanin treatment

    Directory of Open Access Journals (Sweden)

    Dranitsina Alevtina

    2017-06-01

    Full Text Available Wound healing is the complex and dynamic process of replacing devitalized and missing cellular structures and tissue layers. We have previously shown that melanin, herein, produced by the Antarctic black yeast fungi Pseudonadsoniella brunea (Nadsoniella nigra sp. X-1, has expressed a cyto-protective effect, promoted rapid wound healing of various ethiology and can be offered as a new dermatropic drug. The current study was conducted on a rat model of purulent necrotic wound. In each model, one group was a control, while in the others, wound healing occurred without drug application or with administration of 0,5% carbopol or with both 0,5% carbopol and 0,1% melanin. The pro-oxidant-antioxidant balance in skin gomogenate in dynamics on 3, 6, 9, 14 and day of full epithelization was estimated using the spectrophotometric biochemical method. Moreover, so as to understand the role played by the Tlr2 and Tjp1 in the process of wound healing and scar formation, Tlr2, Tjp1gene expression and genetic mRNA was determined with quantitative RT-PCR. The application of our pharmacological composition stimulated the decrease of Tlr2 and Tjp1 gene expression against the background of suppression of free radical processes (reduction of superoxide anion radical content with epithelization and without scarring. The results of this study have shown the positive effects of melanin on wound healing. The obtained results indicate the advisability of applying melanin for the treatment of inflammatory processes.

  4. Self-healing of polymer modified concrete

    OpenAIRE

    Abd_Elmoaty M. Abd_Elmoaty

    2011-01-01

    Self healing phenomenon of concrete has been observed in traditional, fibrous, self compacting concrete. This phenomenon occurred mainly due to the presence of unhydrated cement particles in the presence of water. Mechanism of polymer in concrete depends on creating a layer and net of polymer around cement particles which enhances the properties of polymer modified concrete. This mechanism may affect the self healing of this type of concrete. This work aims to study the presence of the self h...

  5. Microcapsule-Type Organogel-Based Self-Healing System Having Secondary Damage Preventing Capability.

    Science.gov (United States)

    Yang, Hye-In; Kim, Dong-Min; Yu, Hwan-Chul; Chung, Chan-Moon

    2016-05-04

    We have developed a novel microcapsule-type organogel-based self-healing system in which secondary damage does not occur in the healed region. A mixture of an organogelator, poor and good solvents for the gelator is used as the healing agent; when the good solvent evaporates from this agent, a viscoelastic organogel forms. The healing agent is microencapsulated with urea-formaldehyde polymer, and the resultant microcapsules are integrated into a polymer coating to prepare self-healing coatings. When the coatings are scratched, they self-heal, as demonstrated by means of corrosion testing, electrochemical testing, optical microscopy, and scanning electron microscopy (SEM). After the healed coatings are subjected to vigorous vibration, it is demonstrated that no secondary damage occurs in the healed region. The secondary damage preventing capability of the self-healing coating is attributable to the viscoelasticity of the organogel. The result can give insight into the development of a "permanent" self-healing system.

  6. A current affair: electrotherapy in wound healing

    Science.gov (United States)

    Hunckler, Jerome; de Mel, Achala

    2017-01-01

    New developments in accelerating wound healing can have immense beneficial socioeconomic impact. The wound healing process is a highly orchestrated series of mechanisms where a multitude of cells and biological cascades are involved. The skin battery and current of injury mechanisms have become topics of interest for their influence in chronic wounds. Electrostimulation therapy of wounds has shown to be a promising treatment option with no-device-related adverse effects. This review presents an overview of the understanding and use of applied electrical current in various aspects of wound healing. Rapid clinical translation of the evolving understanding of biomolecular mechanisms underlying the effects of electrical simulation on wound healing would positively impact upon enhancing patient’s quality of life. PMID:28461755

  7. Faith healing and faith in healing.

    Science.gov (United States)

    Gopichandran, Vijayaprasad

    2015-01-01

    Sarkar and Seshadri have presented an interesting paper in this issue on the ethical approach that a physician should take when faced with requests for faith healing (1). The paper describes four approaches that the physician can take. These are rejecting the request, keeping oneself detached from the issue, endorsing the request and trying to understand the practices concerned so as to make a reasoned decision. This commentary attempts to explore the issue of faith healing further, from the point of view of clinical care. It shall discuss five important dimensions which can supplement the arguments by Sarkar and Seshadri. These are the concepts of faith, spirituality and religion and faith healing; the difference between cure and healing; patient-centred care; the various factors influencing a doctor's response to requests for faith healing; and finally, the ethical issues to be considered while making a decision. Before launching into the discussion, it should be made clear that this commentary refers mainly to those faith healing practices which are not overtly harmful, such as prayers, and wearing rings and amulets.

  8. Coating of Tungsten Wire with Ni/Al Multilayers for Self-Healing Applications

    OpenAIRE

    Ana Sofia Ramos; Lukasz Maj; Jerzy Morgiel; Maria Teresa Vieira

    2017-01-01

    Self-healing materials are able to partially or completely reverse the damage inflicted on them. The possibility of self-healing mechanical and chemical failures that occur during service will improve the lifetime and reliability of structural materials. For this purpose, two main steps must be considered: (i) detection, and (ii) repairing (healing) of cracks. The exothermic character of reactive multilayers has potential for self-healing applications, namely in the healing step. In this cont...

  9. Self-healing materials.

    Science.gov (United States)

    Hager, Martin D; Greil, Peter; Leyens, Christoph; van der Zwaag, Sybrand; Schubert, Ulrich S

    2010-12-14

    Self-healing materials are able to partially or completely heal damage inflicted on them, e.g., crack formation; it is anticipated that the original functionality can be restored. This article covers the design and generic principles of self-healing materials through a wide range of different material classes including metals, ceramics, concrete, and polymers. Recent key developments and future challenges in the field of self-healing materials are summarised, and generic, fundamental material-independent principles and mechanism are discussed and evaluated.

  10. Stem Cell Therapy in Wound Healing and Tissue Regeneration

    Directory of Open Access Journals (Sweden)

    Anna Meiliana

    2016-08-01

    a novel approach to many diseases. SUMMARY: Wound healing therapies continue to rapidly evolve, with advances in basic science and engineering research heralding the development of new therapies, as well as ways to modify existing treatments. Stem cell-based therapy is one of the most promising therapeutic concepts for wound healing. Advances in stem cell biology have enabled researchers and clinicians alike with access to cells capable of actively modulating the healing response.  KEYWORDS: wound healing, tissue regeneration, stem cells therapy

  11. Healing spirits of South Kanara.

    Science.gov (United States)

    Shields, N K

    1987-12-01

    In South Kanara, India (formerly the kingdom of Tulunadu), and area stretching some 150 miles along the Arabian Sea and 25 to 50 miles inland, ancient forms of rural pageantry in honor of particular local Spirits are enacted yearly. These ritualized performances include elements of masked folk drama and epic recitation and serve a valued social role as a form of healing and counselling within village communities. Contemporary practitioner-patient interactions are part of an intricate tapestry partaking of customs occurring since times long past, such as the kinship structure (aliya-santana or nephew inheritance), the geopolitical milieu and the myths of Tulunadu. The power of these healing Spirits lies in their ability to reproduce social form through the cultural idiom of therapeutic efficacy.

  12. Wound healing in total joint arthroplasty.

    Science.gov (United States)

    Jones, Richard E

    2010-09-07

    Obtaining primary wound healing in total joint arthroplasty is essential to a good result. Wound healing problems can occur and the consequences can be devastating. Determination of the host healing capacity can be useful in predicting complications. Cierney and Mader classified patients as type A, no healing compromises; and type B, systemic or local healing compromising factors present. Local factors include traumatic arthritis, multiple previous incisions, extensive scarring, lymphedema, poor vascular perfusion. Systemic compromising factors include diabetes, rheumatic diseases, renal or liver disease, immunocompromise, steroids, smoking, and poor nutrition. In high-risk patients, the surgeon should encourage positive choices such as smoking cessation and nutritional supplementation to elevate the total lymphocyte count and total albumin. Careful planning of incisions, particularly in patients with scarring or multiple previous operations, is productive. Around the knee the vascular viability is better in the medial flap. Thus, use the most lateral previous incision, do minimal undermining, and handle tissue meticulously. We perform all potentially complicated total knee arthroplasties without tourniquet to enhance blood flow and tissue viability. The use of perioperative anticoagulation will increase wound problems. If wound drainage or healing problems occur, immediate action is required. Deep sepsis can be ruled out with a joint aspiration and cell count (>2000), differential (>50% polys), and negative culture and sensitivity. All hematomas should be evacuated and necrosis or dehiscence should be managed by debridement to obtain a live wound. Copyright 2010, SLACK Incorporated.

  13. How photons modulate wound healing via the immune system

    Science.gov (United States)

    Dyson, Mary

    2009-02-01

    The immune system is a diverse group of cells that recognize and attack foreign substances, pathogenic organisms and cancer cells. It also produces inflammation, an essential component of the wound healing process and, following the resolution of inflammation, plays a crucial role in the control of granulation tissue formation. Granulation tissue is the precursor of scar tissue. Injured skin and mucous membranes generally heal rapidly. However, some wounds are either slow to heal or fail to heal while in others overgrowth of scar tissue occurs, resulting in the production of either hypertophic or keloid scars. The modulation of wound healing in such conditions is clinically important and may even be vital. Evidence will be presented that phototherapy can modulate wound healing, and that changes induced in the immune system, in particular the secretion of soluble protein mediators including cytokines, may be involved in this modulation. The immune system has peripheral and deep components. The former, being located mainly in the skin and mucous membranes, are readily accessible to photons, which can affect them directly. The components of the immune system are linked by lymphatic vessels and blood vessels, which include many capillaries located in the sub-epithelial connective tissues of the skin and mucous membranes. The superficial location of these capillaries provides the immune cells and molecules in transit through them with ready access to photons. When these cells and molecules, some modified by exposure to photons, reach susceptible cells such as lymphocytes in the deeper parts of the immune system and cells of injured tissues, they can modify their activity. In addition to having direct effects on peripheral cells, photons can thus also produce indirect effects on cells too distant for the photons to reach them. For example, cytokines released from peripheral macrophages in response to the direct action of photons can be transported to and affect other

  14. Wound healing in animal models: review article

    Directory of Open Access Journals (Sweden)

    Fariba Jaffary

    2017-10-01

    Full Text Available Wound healing and reduction of its recovery time is one of the most important issues in medicine. Wound is defined as disruption of anatomy and function of normal skin. This injury could be the result of physical elements such as  surgical incision, hit or pressure cut of the skin and gunshot wound. Chemical or caustic burn is another category of wound causes that can be induced by acid or base contact irritation. Healing is a process of cellular and extracellular matrix interactions that occur in the damaged tissue. Wound healing consists of several stages including hemostasis, inflammatory phase, proliferative phase and new tissue formation which reconstructs by new collagen formation. Wounds are divided into acute and chronic types based on their healing time. Acute wounds have sudden onset and in normal individuals usually have healing process of less than 4 weeks without any residual side effects. In contrast, chronic wounds have gradual onset. Their inflammatory phase is prolonged and the healing process is stopped due to some background factors like diabetes, ischemia or local pressure. If the healing process lasts more than 4 weeks it will be classified as chronic wound. Despite major advances in the treatment of wounds, still finding effective modalities for healing wounds in the shortest possible time with the fewest side effects is a current challenge. In this review different phases of wound healing and clinical types of wound such as venous leg ulcer, diabetic foot ulcer and pressure ulcer are discussed. Also acute wound models (i.e burn wounds or incisional wound and chronic wound models (such as venous leg ulcers, diabetic foot ulcer, pressure ulcers or bedsore in laboratory animals are presented. This summary can be considered as a preliminary step to facilitate designing of more targeted and applied research in this area.

  15. Interior design and healing architecture

    DEFF Research Database (Denmark)

    Mogensen, Jeppe; Poulsen, Søren Bolvig; Hansen, Allan Grutt

    2015-01-01

    Hospital design is today influenced by the design concept healing architecture, stating that the patients’ healing process is promoted through accommodating physical surroundings. However, despite the increasing amount of research in the field of healing architecture, research on interior design...

  16. Saliva and wound healing

    NARCIS (Netherlands)

    Brand, H.S.; Veerman, E.C.I.

    2013-01-01

    Wounds in the oral cavity heal faster and with less scarring than wounds in other parts of the body. One of the factors implicated in this phenomenon is the presence of saliva, which promotes the healing of oral wounds in several ways. Saliva creates a humid environment, which improves the survival

  17. A special healing pattern in stable metaphyseal fractures.

    Science.gov (United States)

    Chen, Wen Tao; Han, Da Cheng; Zhang, Pei Xun; Han, Na; Kou, Yu Hui; Yin, Xiao Feng; Jiang, Bao Guo

    2015-04-01

    Metaphyseal fractures heal in a rapid fashion that is different from the bone shaft healing process. Animal studies have focused on diaphyseal fractures. We investigated the metaphyseal fracture-healing process in rabbits. 60 rabbits (divided into 12 groups) underwent proximal tibial osteotomy, anatomical reduction, and fixation with screws. After surgery, the proximal tibiae were harvested at different time points for histology. No obvious osteonecrosis or bone resorption were found 2 weeks after surgery. From day 5 to week 5, woven bone or new trabeculae formed. From week 2, remodeling into lamellar bone started and reached a peak at week 6. These 3 stages overlapped. Histomorphometry showed that the structure changed as a unimodal curve. The healing process of metaphyseal fractures appears to differ from the commonly studied healing process in diaphyseal fractures. It is rapid, and can be divided into 4 histological stages: cellular activation and differentiation, formation of woven bone, transformation of woven bone into lamellar bone, and further remodeling.

  18. Sarcoidosis Occurring After Lymphoma

    Science.gov (United States)

    London, Jonathan; Grados, Aurélie; Fermé, Christophe; Charmillon, Alexandre; Maurier, François; Deau, Bénédicte; Crickx, Etienne; Brice, Pauline; Chapelon-Abric, Catherine; Haioun, Corinne; Burroni, Barbara; Alifano, Marco; Le Jeunne, Claire; Guillevin, Loïc; Costedoat-Chalumeau, Nathalie; Schleinitz, Nicolas; Mouthon, Luc; Terrier, Benjamin

    2014-01-01

    Abstract Sarcoidosis is a granulomatous disease that most frequently affects the lungs with pulmonary infiltrates and/or bilateral hilar and mediastinal lymphadenopathy. An association of sarcoidosis and lymphoproliferative disease has previously been reported as the sarcoidosis-lymphoma syndrome. Although this syndrome is characterized by sarcoidosis preceding lymphoma, very few cases of sarcoidosis following lymphoma have been reported. We describe the clinical, biological, and radiological characteristics and outcome of 39 patients presenting with sarcoidosis following lymphoproliferative disease, including 14 previously unreported cases and 25 additional patients, after performing a literature review. Hodgkin lymphoma and non-Hodgkin lymphoma were equally represented. The median delay between lymphoma and sarcoidosis was 18 months. Only 16 patients (41%) required treatment. Sarcoidosis was of mild intensity or self-healing in most cases, and overall clinical response to sarcoidosis was excellent with complete clinical response in 91% of patients. Sarcoidosis was identified after a follow-up computerized tomography scan (CT-scan) or 18fluorodeoxyglucose-positron emission tomography/computerized tomography (18FDG-PET/CT) evaluation in 18/34 patients (53%). Sarcoidosis is therefore a differential diagnosis to consider when lymphoma relapse is suspected on a CT-scan or 18FDG-PET/CT, emphasizing the necessity to rely on histological confirmation of lymphoma relapse. PMID:25380084

  19. Impaired Fracture Healing after Hemorrhagic Shock

    Directory of Open Access Journals (Sweden)

    Philipp Lichte

    2015-01-01

    Full Text Available Impaired fracture healing can occur in severely injured patients with hemorrhagic shock due to decreased soft tissue perfusion after trauma. We investigated the effects of fracture healing in a standardized pressure controlled hemorrhagic shock model in mice, to test the hypothesis that bleeding is relevant in the bone healing response. Male C57/BL6 mice were subjected to a closed femoral shaft fracture stabilized by intramedullary nailing. One group was additionally subjected to pressure controlled hemorrhagic shock (HS, mean arterial pressure (MAP of 35 mmHg for 90 minutes. Serum cytokines (IL-6, KC, MCP-1, and TNF-α were analyzed 6 hours after shock. Fracture healing was assessed 21 days after fracture. Hemorrhagic shock is associated with a significant increase in serum inflammatory cytokines in the early phase. Histologic analysis demonstrated a significantly decreased number of osteoclasts, a decrease in bone quality, and more cartilage islands after hemorrhagic shock. μCT analysis showed a trend towards decreased bone tissue mineral density in the HS group. Mechanical testing revealed no difference in tensile failure. Our results suggest a delay in fracture healing after hemorrhagic shock. This may be due to significantly diminished osteoclast recruitment. The exact mechanisms should be studied further, particularly during earlier stages of fracture healing.

  20. Gastronomy healing after transgastric peritoneoscopy

    DEFF Research Database (Denmark)

    Donatsky, Anders Meller; Andersen, Luise; Nielsen, Ole Lerberg

    2015-01-01

    were allowed 14 POD of follow-up, and 4 pigs were allowed 28 POD of follow-up. Survival was achieved in 6 of the 7 animals; 1 pig was euthanized due to diffuse peritonitis. Based on our definition, full-thickness healing had only been achieved in a single pig allowed 28 POD. With respect to clinical...... adhering to the per protocol definition. Endoscopic ultrasonography-guided access was difficult. It lacks reproducibility and needs refinement. Despite a combined decontamination regimen, infectious complications still occurred....

  1. Naturally occurring hazardous materials.

    Science.gov (United States)

    2011-12-01

    The study of naturally occurring hazardous materials (NOHMs) was conceived as a proactive response to assure that the Oregon : Department of Transportation (ODOT) maintenance and construction activities take the presence of NOHMs into account. The la...

  2. Emerging drugs for the treatment of wound healing.

    Science.gov (United States)

    Zielins, Elizabeth R; Brett, Elizabeth A; Luan, Anna; Hu, Michael S; Walmsley, Graham G; Paik, Kevin; Senarath-Yapa, Kshemendra; Atashroo, David A; Wearda, Taylor; Lorenz, H Peter; Wan, Derrick C; Longaker, Michael T

    2015-06-01

    Wound healing can be characterized as underhealing, as in the setting of chronic wounds, or overhealing, occurring with hypertrophic scar formation after burn injury. Topical therapies targeting specific biochemical and molecular pathways represent a promising avenue for improving and, in some cases normalizing, the healing process. A brief overview of both normal and pathological wound healing has been provided, along with a review of the current clinical guidelines and treatment modalities for chronic wounds, burn wounds and scar formation. Next, the major avenues for wound healing drugs, along with drugs currently in development, are discussed. Finally, potential challenges to further drug development, and future research directions are discussed. The large body of research concerning wound healing pathophysiology has provided multiple targets for topical therapies. Growth factor therapies with the ability to be targeted for localized release in the wound microenvironment are most promising, particularly when they modulate processes in the proliferative phase of wound healing.

  3. Differential Apoptosis in Mucosal and Dermal Wound Healing.

    Science.gov (United States)

    Johnson, Ariel; Francis, Marybeth; DiPietro, Luisa Ann

    2014-12-01

    Objectives: Dermal and mucosal healing are mechanistically similar. However, scarring and closure rates are dramatically improved in mucosal healing, possibly due to differences in apoptosis. Apoptosis, nature's preprogrammed form of cell death, occurs via two major pathways, extrinsic and intrinsic, which intersect at caspase3 (Casp3) cleavage and activation. The purpose of this experiment was to identify the predominant pathways of apoptosis in mucosal and dermal wound healing. Approach: Wounds (1 mm biopsy punch) were made in the dorsal skin (n=3) or tongue (n=3) of female Balb/C mice aged 6 weeks. Wounds were harvested at 6 h, 24 h, day 3 (D3), D5, D7, and D10. RNA was isolated and analyzed using real time reverse transcriptase-polymerase chain reaction. Expression levels for genes in the intrinsic and extrinsic apoptotic pathways were compared in dermal and mucosal wounds. Results: Compared to mucosal healing, dermal wounds exhibited significantly higher expression of Casp3 (at D5; pInnovation: Our observations indicate differential execution of apoptosis in oral wound healing compared to skin. Conclusion: Expression patterns of key regulators of apoptosis in wound healing indicate that apoptosis occurs predominantly through the intrinsic pathway in the healing mucosa, but predominantly through the extrinsic pathway in the healing skin. The identification of differences in the apoptotic pathways in skin and mucosal wounds may allow the development of therapeutics to improve skin healing.

  4. Healing Childhood Trauma Worldwide

    Science.gov (United States)

    Kuban, Caelan

    2012-01-01

    Millions of the world's children are exposed to traumatic events and relationships every day. Whatever the cause, this overwhelming stress produces a host of unsettling symptoms and reactions. The author highlights six practical principles that undergird healing interventions.

  5. A current affair: electrotherapy in wound healing

    Directory of Open Access Journals (Sweden)

    Hunckler J

    2017-04-01

    Full Text Available Jerome Hunckler, Achala de Mel UCL Division of Surgery and Interventional Sciences, Faculty of Medical Sciences, University College London, London, UK Abstract: New developments in accelerating wound healing can have immense beneficial socioeconomic impact. The wound healing process is a highly orchestrated series of mechanisms where a multitude of cells and biological cascades are involved. The skin battery and current of injury mechanisms have become topics of interest for their influence in chronic wounds. Electrostimulation therapy of wounds has shown to be a promising treatment option with no-device-related adverse effects. This review presents an overview of the understanding and use of applied electrical current in various aspects of wound healing. Rapid clinical translation of the evolving understanding of biomolecular mechanisms underlying the effects of electrical simulation on wound healing would positively impact upon enhancing patient’s quality of life. Keywords: electrotherapy, wound healing, infection, bioelectric current, exogenous current, bioelectric medicine, electrical stimulation, chronic wound, acute wound

  6. Application of platelet-rich plasma accelerates the wound healing process in acute and chronic ulcers through rapid migration and upregulation of cyclin A and CDK4 in HaCaT cells.

    Science.gov (United States)

    Kim, Sung-Ae; Ryu, Han-Won; Lee, Kyu-Suk; Cho, Jae-We

    2013-02-01

    Application of autologous platelet-rich plasma (PRP) has been used for chronic wound healing. The aim of this study was to evaluate the effect of PRP on the wound healing processes of both acute and chronic ulcers and the underlying molecular mechanisms involved. We treated 16 patients affected by various acute and chronic ulcers with PRP. We performed molecular studies of cell proliferation, migration assays, immunoblotting and chloramphenicol acetyltransferase (CAT) assays in PRP-treated HaCaT keratinocyte cells. PRP treatment induced increased rates of cell proliferation and cell migration of HaCaT cells. In addition, the expression of cyclin A and cyclin dependent kinase (CDK) 4 proteins was markedly increased with a low concentration (0.5%) of PRP treatment in HaCaT cells. In 11 patients with chronic ulcers, including stasis ulcers, diabetic ulcers, venous leg ulcers, livedoid vasculitis, claw foot and traumatic ulcers, 9 patients showed 90-100% epithelization after 15.18 days. In 5 patients with acute ulcers, such as dehiscence, open wound and burn wound, 80-100% epithelization was achieved between 4 to 20 days. Topical application of PRP to acute and chronic skin ulcers significantly accelerated the epithelization process, likely through upregulation of the cell cycle regulatory proteins cyclin A and CDK4.

  7. Study of the thermal and hydraulic phenomena occurring during power excursion on a heated test section; Etude des phenomenes thermiques et hydrauliques accompagnant une excursion rapide de puissance sur un canal chauffant

    Energy Technology Data Exchange (ETDEWEB)

    Nyer, M. [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1969-07-01

    The thermal and hydrodynamic phenomena occurring during a power excursion were studied in an out-of-pile loop with a water cooled channel at low pressure (1 to 4 atm. abs. ). Circular and rectangular test sections with electrically heated walls of two different thermal diffusivity materials(aluminium and stainless steel) were used. The rectangular test sections were 600 mm long, 35 mm wide and had a 2, 9 mm gap; they simulate two half plates of the M.T.R. fuel element. Natural or forced convection are possible in the test section; the water height above it can be varied from 2.8 to 8 meters and the maximum allowed pressure at its outlet is 4 atm. abs.The heating source is a series of lead batteries which is able to generate, for short periods of time, 85 volts and 25000 amperes; linear, square or exponential power rise versus time can be realized. A 14 channels tape recorder (0-10 000 Hz bandwidth; is used for the measurements of temperature (8/100 mm diameter thermocouple), pressure ('Statham' pressure transducers) and void fraction (X rays). More than 500 tests have been carried out. The influence of the initial water temperature, flow rate, pressure, water height on the water ejections, pressure variations and void fraction in the test section were studied. Tests with energies up to 3000 W/cm in 50 milliseconds were attempted. The energy above which the instabilities appear was determined. An interpretation of the observed phenomena and a simplified theoretical model are presented. [French] Les phenomenes thermiques et hydrodynamiques qui apparaissent au cours d'une excursion de puissance ont ete etudies sur un canal refroidi par de l'eau a basse pression situe sur une installation hors pile. On a utilise des sections d'essais de geometrie cylindrique ou parallipedique dont les parois chauffees par effet Joule sont constituees de materiaux de diffusivite calorifique differente (aluminium et acier inoxydable). La section d

  8. Differential Apoptosis in Mucosal and Dermal Wound Healing

    Science.gov (United States)

    Johnson, Ariel; Francis, Marybeth; DiPietro, Luisa Ann

    2014-01-01

    Objectives: Dermal and mucosal healing are mechanistically similar. However, scarring and closure rates are dramatically improved in mucosal healing, possibly due to differences in apoptosis. Apoptosis, nature's preprogrammed form of cell death, occurs via two major pathways, extrinsic and intrinsic, which intersect at caspase3 (Casp3) cleavage and activation. The purpose of this experiment was to identify the predominant pathways of apoptosis in mucosal and dermal wound healing. Approach: Wounds (1 mm biopsy punch) were made in the dorsal skin (n=3) or tongue (n=3) of female Balb/C mice aged 6 weeks. Wounds were harvested at 6 h, 24 h, day 3 (D3), D5, D7, and D10. RNA was isolated and analyzed using real time reverse transcriptase–polymerase chain reaction. Expression levels for genes in the intrinsic and extrinsic apoptotic pathways were compared in dermal and mucosal wounds. Results: Compared to mucosal healing, dermal wounds exhibited significantly higher expression of Casp3 (at D5; phealing compared to skin. Conclusion: Expression patterns of key regulators of apoptosis in wound healing indicate that apoptosis occurs predominantly through the intrinsic pathway in the healing mucosa, but predominantly through the extrinsic pathway in the healing skin. The identification of differences in the apoptotic pathways in skin and mucosal wounds may allow the development of therapeutics to improve skin healing. PMID:25493209

  9. Heat transfer and fluid flow analysis of self-healing in metallic materials

    Science.gov (United States)

    Martínez Lucci, J.; Amano, R. S.; Rohatgi, P. K.

    2017-03-01

    This paper explores imparting self-healing characteristics to metal matrices similar to what are observed in biological systems and are being developed for polymeric materials. To impart self-healing properties to metal matrices, a liquid healing method was investigated; the met hod consists of a container filled with low melting alloy acting as a healing agent, embedded into a high melting metal matrix. When the matrix is cracked; self-healing is achieved by melting the healing agent allowing the liquid metal to flow into the crack. Upon cooling, solidification of the healing agent occurs and seals the crack. The objective of this research is to investigate the fluid flow and heat transfer to impart self-healing property to metal matrices. In this study, a dimensionless healing factor, which may help predict the possibility of healing is proposed. The healing factor is defined as the ratio of the viscous forces and the contact area of liquid metal and solid which prevent flow, and volume expansion, density, and velocity of the liquid metal, gravity, crack size and orientation which promote flow. The factor incorporates the parameters that control self-healing mechanism. It was observed that for lower values of the healing factor, the liquid flows, and for higher values of healing factor, the liquid remains in the container and healing does not occur. To validate and identify the critical range of the healing factor, experiments and simulations were performed for selected combinations of healing agents and metal matrices. The simulations were performed for three-dimensional models and a commercial software 3D Ansys-Fluent was used. Three experimental methods of synthesis of self-healing composites were used. The first method consisted of creating a hole in the matrices, and liquid healing agent was poured into the hole. The second method consisted of micro tubes containing the healing agent, and the third method consisted of incorporating micro balloons containing

  10. BIOTECHNOLOGY BIOPRODUCTS "HEALING-1"

    Directory of Open Access Journals (Sweden)

    S. I. Artiukhova

    2014-01-01

    Full Text Available Summary. The article presents data on the development of technology and qualitative research, bio-products «Healing-1». One of the promising directions in food biotechnology is the development of new integrated starter-based consortia of microorganisms, which have higher activity compared with cultures prepared using pure cultures. So it was interesting studies on the development of new biotechnology and bio-based microbial consortium of lactic acid bacteria. Based on the analysis of biotechnological properties of native cultures created a new consortium of microorganisms containing lactic acid streptococci and bacilli, allowing the maximum extent possible to implement the physiological, biochemical and technological potential of microorganisms. Scientifically substantiated and experimentally developed a new biotechnology production of bioproducts «Healing-1», obtained on the basis of microbial consortium with broad spectrum antimicrobial activity. Experimentally investigated quality parameters of organic food «Healing-1» using a new microbial consortium as freshly prepared and during storage. Found that antagonistic activity of microflora bio «Healing-1» with respect to pathogenic and conditionally pathogenic bacteria, as well as its resistance to substances in the gastrointestinal tract of man is more pronounced compared to bioproducts obtained using a separate starter, members of the microbial consortium. It should be noted a more pronounced synthesis of exopolysaccharides in bioproduct «Healing-1», which leads to increased viscosity of the system and improves the consistency of bio. New bioproducts have good organoleptic characteristics and contain a high number of viable cells of lactic acid bacteria. High stability and survival of lactic acid bacteria during storage. In the study of attacked proteins bioproducts digestive proteinases «in vitro» found that the fermentation of milk microbial consortium increases the digestibility

  11. Look Up for Healing: Embodiment of the Heal Concept in Looking Upward.

    Directory of Open Access Journals (Sweden)

    N D Leitan

    Full Text Available Conceptual processing may not be restricted to the mind. The heal concept has been metaphorically associated with an "up" bodily posture. Perceptual Symbol Systems (PSS theory suggests that this association is underpinned by bodily states which occur during learning and become instantiated as the concept. Thus the aim of this study was to examine whether processing related to the heal concept is promoted by priming the bodily state of looking upwards.We used a mixed 2x2 priming paradigm in which 58 participants were asked to evaluate words as either related to the heal concept or not after being primed to trigger the concept of looking up versus down (Direction--within subjects. A possible dose-response effect of priming was investigated via allocating participants to two 'strengths' of prime, observing an image of someone whose gaze was upward/downward (low strength and observing an image of someone whose gaze was upward/downward while physically tilting their head upwards or downwards in accord with the image (high strength (Strength--between subjects.Participants responded to words related to heal faster than words unrelated to heal across both "Strength" conditions. There was no evidence that priming was stronger in the high strength condition.The present study found that, consistent with a PSS view of cognition, the heal concept is embodied in looking upward, which has important implications for cognition, general health, health psychology, health promotion and therapy.

  12. Comparison of wound-healing characteristics with feedback circuit electrosurgical generators in a porcine model.

    Science.gov (United States)

    Pollinger, Harrison S; Mostafa, Gamal; Harold, Kristi L; Austin, Catherine E; Kercher, Kent W; Matthews, Brent D

    2003-12-01

    The type of incisional instrument used to create a surgical wound can influence the rate of wound healing and overall wound strength. The purpose of this study was to evaluate several facets of wound healing within incisions created in the small intestine, uterus, and skin in a porcine model by using feedback circuit electrosurgical generators and a standard steel scalpel blade in a porcine model. Eighteen pigs were evaluated by creating surgical incisions in the skin, uterus, and small intestine utilizing 2 computerized electrosurgical generators (FX, ValleyLab, Boulder, CO, and PEGASYS, Ethicon Endo-Surgery, Inc., Cincinnati, OH) and a scalpel blade. All incisions were reapproximated with absorbable suture. Incision sites were evaluated histologically at 3, 7, or 14 days postincision according to randomization. The skin and small intestine samples were tested for wound tensile strength at 7 and 14 days. There were no statistically significant differences demonstrated with tensile strength testing comparing the electrosurgical devices to the scalpel-blade incisions for skin or small intestine at all time points. The only significant difference detected with respect to wound tensile strength was when different organ types were compared, regardless of device used (i.e., skin, 19.5 N/cm2 vs. small intestine, 5.78 N/cm2). Histologic evaluation demonstrated that the wounds created by the electrosurgical generators displayed decreased overall wound healing at 3, 7, and 14 days compared to the scalpel group. These findings indicate that the electrosurgical devices tested delay wound healing at the surgical site, but fail to demonstrate any significant difference in overall wound tensile strength. Wound healing may occur at a more rapid rate when a traditional scalpel blade is used to create the surgical incision, but no difference in global wound dynamics could be detected.

  13. Healing Invisible Wounds

    Science.gov (United States)

    Adams, Erica J.

    2010-01-01

    As many as 9 in 10 justice-involved youth are affected by traumatic childhood experiences. According to "Healing Invisible Wounds: Why Investing in Trauma-Informed Care for Children Makes Sense," between 75 and 93 percent of youth currently incarcerated in the justice system have had at least one traumatic experience, including sexual…

  14. Current management of wound healing

    DEFF Research Database (Denmark)

    Gottrup, F; Karlsmark, T

    2009-01-01

    While the understanding of wound pathophysiology has progressed considerably over the past decades the improvements in clinical treatment has occurred to a minor degree. During the last years, however, new trends and initiatives have been launched, and we will continue to attain new information...... in the next decade. It is the hope that increasing parts of the new knowledge from basic wound healing research will be implemented in daily clinical practice. The development of new treatment products will also continue, and especially new technologies with combined types of dressing materials or dressing...... containing active substances will be accentuated. Further developments in the management structure and education will also continue and consensus of treatment guidelines, recommendations and organization models will hopefully be achieved....

  15. All-printed magnetically self-healing electrochemical devices

    Science.gov (United States)

    Bandodkar, Amay J.; López, Cristian S.; Vinu Mohan, Allibai Mohanan; Yin, Lu; Kumar, Rajan; Wang, Joseph

    2016-01-01

    The present work demonstrates the synthesis and application of permanent magnetic Nd2Fe14B microparticle (NMP)–loaded graphitic inks for realizing rapidly self-healing inexpensive printed electrochemical devices. The incorporation of NMPs into the printable ink imparts impressive self-healing ability to the printed conducting trace, with rapid (~50 ms) recovery of repeated large (3 mm) damages at the same or different locations without any user intervention or external trigger. The permanent and surrounding-insensitive magnetic properties of the NMPs thus result in long-lasting ability to repair extreme levels of damage, independent of ambient conditions. This remarkable self-healing capability has not been reported for existing man-made self-healing systems and offers distinct advantages over common capsule and intrinsically self-healing systems. The printed system has been characterized by leveraging crystallographic, magnetic hysteresis, microscopic imaging, electrical conductivity, and electrochemical techniques. The real-life applicability of the new self-healing concept is demonstrated for the autonomous repair of all-printed batteries, electrochemical sensors, and wearable textile-based electrical circuits, indicating considerable promise for widespread practical applications and long-lasting printed electronic devices. PMID:27847875

  16. Blacktip reef sharks (Carcharhinus melanopterus) show high capacity for wound healing and recovery following injury

    OpenAIRE

    Chin, Andrew; Mourier, Johann; Rummer, Jodie L.

    2015-01-01

    International audience; Wound healing is important for sharks from the earliest life stages, for example, as the 'umbilical scar' in viviparous species heals, and throughout adulthood, when sharks can incur a range of external injuries from natural and anthropogenic sources. Despite anecdotal accounts of rapid healing in elasmobranchs, data regarding recovery and survival of individuals from different wound or injury types has not been systematically collected. The present study documented: (...

  17. Development of self-healing coatings for corrosion protection on metallic structures

    OpenAIRE

    Stankiewicz, Alicja.; Barker, Michael B.

    2016-01-01

    Inspired by biological systems, artificial self-healing materials are designed for repairing local damage caused by external factors. The rapidly expanding field of self-healing systems contains, among others, materials with well-defined surface properties. Undoubtedly, enhancing surface functionalisation, by applying smart coatings, enjoys an extensive interest. The self-healing ability is particularly essential property for corrosion protection strategies, especially when the use of one of ...

  18. Functional tissue engineering of ligament healing

    Directory of Open Access Journals (Sweden)

    Hsu Shan-Ling

    2010-05-01

    Full Text Available Abstract Ligaments and tendons are dense connective tissues that are important in transmitting forces and facilitate joint articulation in the musculoskeletal system. Their injury frequency is high especially for those that are functional important, like the anterior cruciate ligament (ACL and medial collateral ligament (MCL of the knee as well as the glenohumeral ligaments and the rotator cuff tendons of the shoulder. Because the healing responses are different in these ligaments and tendons after injury, the consequences and treatments are tissue- and site-specific. In this review, we will elaborate on the injuries of the knee ligaments as well as using functional tissue engineering (FTE approaches to improve their healing. Specifically, the ACL of knee has limited capability to heal, and results of non-surgical management of its midsubstance rupture have been poor. Consequently, surgical reconstruction of the ACL is regularly performed to gain knee stability. However, the long-term results are not satisfactory besides the numerous complications accompanied with the surgeries. With the rapid development of FTE, there is a renewed interest in revisiting ACL healing. Approaches such as using growth factors, stem cells and scaffolds have been widely investigated. In this article, the biology of normal and healing ligaments is first reviewed, followed by a discussion on the issues related to the treatment of ACL injuries. Afterwards, current promising FTE methods are presented for the treatment of ligament injuries, including the use of growth factors, gene delivery, and cell therapy with a particular emphasis on the use of ECM bioscaffolds. The challenging areas are listed in the future direction that suggests where collection of energy could be placed in order to restore the injured ligaments and tendons structurally and functionally.

  19. Functional tissue engineering of ligament healing

    Science.gov (United States)

    2010-01-01

    Ligaments and tendons are dense connective tissues that are important in transmitting forces and facilitate joint articulation in the musculoskeletal system. Their injury frequency is high especially for those that are functional important, like the anterior cruciate ligament (ACL) and medial collateral ligament (MCL) of the knee as well as the glenohumeral ligaments and the rotator cuff tendons of the shoulder. Because the healing responses are different in these ligaments and tendons after injury, the consequences and treatments are tissue- and site-specific. In this review, we will elaborate on the injuries of the knee ligaments as well as using functional tissue engineering (FTE) approaches to improve their healing. Specifically, the ACL of knee has limited capability to heal, and results of non-surgical management of its midsubstance rupture have been poor. Consequently, surgical reconstruction of the ACL is regularly performed to gain knee stability. However, the long-term results are not satisfactory besides the numerous complications accompanied with the surgeries. With the rapid development of FTE, there is a renewed interest in revisiting ACL healing. Approaches such as using growth factors, stem cells and scaffolds have been widely investigated. In this article, the biology of normal and healing ligaments is first reviewed, followed by a discussion on the issues related to the treatment of ACL injuries. Afterwards, current promising FTE methods are presented for the treatment of ligament injuries, including the use of growth factors, gene delivery, and cell therapy with a particular emphasis on the use of ECM bioscaffolds. The challenging areas are listed in the future direction that suggests where collection of energy could be placed in order to restore the injured ligaments and tendons structurally and functionally. PMID:20492676

  20. Custom anatomic healing abutments

    Directory of Open Access Journals (Sweden)

    Vinayak S Gowda

    2016-01-01

    Full Text Available Dental implants with their increasing success rates and predictability of final outcome are fast becoming the treatment of choice for replacing missing teeth. Considering the success of immediate implant placement in reducing tissue loss and achieving good esthetic results, is making it a more popular treatment modality in implant dentistry. Understanding the management of gingival tissues in relation to implants to obtain maximum esthetics is of utmost importance. The use of provisional abutments and immediate temporization has a proven track record of their ability to produce optimal esthetics and to guide the tissue response during the healing phase. With careful patient selection and execution, customized healing abutments can provide an effective method to enhance the esthetic and emergence profile for anterior implant restorations.

  1. Self-healing polymers

    Science.gov (United States)

    Klein, Daniel J. (Inventor)

    2011-01-01

    A three dimensional structure fabricated from a self-healing polymeric material, comprising poly(ester amides) obtained from ethylene glycol, azelaic acid and 1,1-aminoundecanoic acid, wherein polymeric material has a melt index above 2.5 g/10 min. as determined by ASTM D1238 at 190.degree. C. and 2.16kg, impact resistance and ductility sufficient to resist cracking and brittle fracture upon impact by a 9 mm bullet fired at a temperature of about 29.degree. C. at subsonic speed in a range from about 800 feet/sec to about 1000 feet/sec. It has been determined that the important factors necessary for self-healing behavior of polymers include sufficient impact strength, control of the degree of crystallinity, low melting point and the ability to instantly melt at impacted area.

  2. Understanding traditional African healing.

    Science.gov (United States)

    Mokgobi, M G

    2014-09-01

    Traditional African healing has been in existence for many centuries yet many people still seem not to understand how it relates to God and religion/spirituality. Some people seem to believe that traditional healers worship the ancestors and not God. It is therefore the aim of this paper to clarify this relationship by discussing a chain of communication between the worshipers and the Almighty God. Other aspects of traditional healing namely types of traditional healers, training of traditional healers as well as the role of traditional healers in their communities are discussed. In conclusion, the services of traditional healers go far beyond the uses of herbs for physical illnesses. Traditional healers serve many roles which include but not limited to custodians of the traditional African religion and customs, educators about culture, counselors, social workers and psychologists.

  3. Understanding traditional African healing

    Science.gov (United States)

    MOKGOBI, M.G.

    2015-01-01

    Traditional African healing has been in existence for many centuries yet many people still seem not to understand how it relates to God and religion/spirituality. Some people seem to believe that traditional healers worship the ancestors and not God. It is therefore the aim of this paper to clarify this relationship by discussing a chain of communication between the worshipers and the Almighty God. Other aspects of traditional healing namely types of traditional healers, training of traditional healers as well as the role of traditional healers in their communities are discussed. In conclusion, the services of traditional healers go far beyond the uses of herbs for physical illnesses. Traditional healers serve many roles which include but not limited to custodians of the traditional African religion and customs, educators about culture, counselors, social workers and psychologists. PMID:26594664

  4. Applied Literature for Healing,

    Directory of Open Access Journals (Sweden)

    Susanna Marie Anderson

    2014-11-01

    Full Text Available In this qualitative research study interviews conducted with elite participants serve to reveal the underlying elements that unite the richly diverse emerging field of Applied Literature. The basic interpretative qualitative method included a thematic analysis of data from the interviews yielding numerous common elements that were then distilled into key themes that elucidated the beneficial effects of engaging consciously with literature. These themes included developing a stronger sense of self in balance with an increasing connection with community; providing a safe container to engage challenging and potentially overwhelming issues from a stance of empowered action; and fostering a healing space for creativity. The findings provide grounds for uniting the work being done in a range of helping professions into a cohesive field of Applied Literature, which offers effective tools for healing, transformation and empowerment.

  5. Biomimetic Self-Healing

    Science.gov (United States)

    2015-07-21

    healing have also been developed.[60] Increasing the membrane thickness raises the stability of the capsules and reduces their permeability . However, it...This approach was used to create a 3D vascular system using a “fugitive organic ink ” scaffold that was deposited using a 3D printer (Figure 14).[133...The “fugitive organic ink ” is a mixture of high- and low-molecular-weight hydrocarbons that partially crystallizes upon deposition and becomes solid

  6. Healing with humor.

    Science.gov (United States)

    Sherman, K M

    1998-04-01

    A sense of humor can be a positive coping tool in times of stress, illness, and pain. Perioperative nurses are in the unique position to assess the patient's ability to cope and to suggest and model a repertoire of coping strategies that use humor. This article also explores self-care knowledge and ways that nurses can tap into their own resource potential for healing through humor.

  7. Effects of genistein on early-stage cutaneous wound healing

    Energy Technology Data Exchange (ETDEWEB)

    Park, Eunkyo [Department of Home Economics Education, Chung-Ang University, Seoul 156-756 (Korea, Republic of); Lee, Seung Min [Research Institute of Health Sciences, Korea University, Seoul 136-701 (Korea, Republic of); Jung, In-Kyung [Department of Home Economics Education, Chung-Ang University, Seoul 156-756 (Korea, Republic of); Lim, Yunsook [Department of Foods and Nutrition, Kyung Hee University, Seoul 130-701 (Korea, Republic of); Kim, Jung-Hyun, E-mail: jjhkim@cau.ac.kr [Department of Home Economics Education, Chung-Ang University, Seoul 156-756 (Korea, Republic of)

    2011-07-08

    Highlights: {yields} We examine the effect of genistein on cutaneous wound healing. {yields} Genistein enhanced wound closure during the early stage of wound healing. {yields} These genistein effects on wound closure were induced by reduction of oxidative stress through increasing antioxidant capacity and modulation of pro-inflammatory cytokine expression. -- Abstract: Wound healing occurs in three sequential phases: hemostasis and inflammation, proliferation, and remodeling. Inflammation, the earliest phase, is considered a critical period for wound healing because immune cells remove damaged tissues, foreign debris, and remaining dead tissue. Wound healing would be delayed without inflammation, and this phase is affected by antioxidation capacity. Therefore, we hypothesized that genistein, which has an antioxidant effect, might modulate the wound healing process by altering the inflammatory response. After three days of acclimation, mice were divided into three groups: control, 0.025% genistein, and 0.1% genistein. After two weeks of an experimental diet, skin wounds were induced. Wounded skin areas were imaged, and the healing rate calculated. To measure lipid peroxidation, antioxidant enzyme expression and activity, and pro-inflammatory cytokine expression, skin and liver tissues were harvested at 12, 24, 48, and 72 h. Genistein did not affect body weight. The rate of wound closure in mice fed genistein was significantly faster than in the control group during the early stage of wound healing, especially in first three days. Cu, Zn-SOD and Mn-SOD expression in wound skin tissue in the 0.1% genistein group was lower than in the control group. However, CAT expression did not differ among groups. We also found that genistein modulated NF-{kappa}B and TNF-{alpha} expression during the early stage of wound healing. The genistein group had significantly lower hepatic lipid peroxidation and higher SOD, CAT, and GPx activities than the control group. These results

  8. A unified theory of bone healing and nonunion: BHN theory.

    Science.gov (United States)

    Elliott, D S; Newman, K J H; Forward, D P; Hahn, D M; Ollivere, B; Kojima, K; Handley, R; Rossiter, N D; Wixted, J J; Smith, R M; Moran, C G

    2016-07-01

    This article presents a unified clinical theory that links established facts about the physiology of bone and homeostasis, with those involved in the healing of fractures and the development of nonunion. The key to this theory is the concept that the tissue that forms in and around a fracture should be considered a specific functional entity. This 'bone-healing unit' produces a physiological response to its biological and mechanical environment, which leads to the normal healing of bone. This tissue responds to mechanical forces and functions according to Wolff's law, Perren's strain theory and Frost's concept of the "mechanostat". In response to the local mechanical environment, the bone-healing unit normally changes with time, producing different tissues that can tolerate various levels of strain. The normal result is the formation of bone that bridges the fracture - healing by callus. Nonunion occurs when the bone-healing unit fails either due to mechanical or biological problems or a combination of both. In clinical practice, the majority of nonunions are due to mechanical problems with instability, resulting in too much strain at the fracture site. In most nonunions, there is an intact bone-healing unit. We suggest that this maintains its biological potential to heal, but fails to function due to the mechanical conditions. The theory predicts the healing pattern of multifragmentary fractures and the observed morphological characteristics of different nonunions. It suggests that the majority of nonunions will heal if the correct mechanical environment is produced by surgery, without the need for biological adjuncts such as autologous bone graft. Cite this article: Bone Joint J 2016;98-B:884-91. ©2016 The British Editorial Society of Bone & Joint Surgery.

  9. A three-dimensional numerical research on probability characteristics of a crack hitting capsules for self-healing concrete

    NARCIS (Netherlands)

    Pan, Z.; Schlangen, E.

    2015-01-01

    In self-healing concrete, healing agents (including the bacteria and nutrients for the bacteria) are often sealed in capsules to survive the mixing of concrete. When the crack occurs, these capsules can be damaged, the healing agents can be released and the chemical actions can be activated. This

  10. The molecular biology in wound healing & non-healing wound.

    Science.gov (United States)

    Qing, Chun

    2017-08-01

    The development of molecular biology and other new biotechnologies helps us to recognize the wound healing and non-healing wound of skin in the past 30 years. This review mainly focuses on the molecular biology of many cytokines (including growth factors) and other molecular factors such as extracellular matrix (ECM) on wound healing. The molecular biology in cell movement such as epidermal cells in wound healing was also discussed. Moreover many common chronic wounds such as pressure ulcers, leg ulcers, diabetic foot wounds, venous stasis ulcers, etc. usually deteriorate into non-healing wounds. Therefore the molecular biology such as advanced glycation end products (AGEs) and other molecular factors in diabetes non-healing wounds were also reviewed. Copyright © 2017 Daping Hospital and the Research Institute of Surgery of the Third Military Medical University. Production and hosting by Elsevier B.V. All rights reserved.

  11. The Advantages of Traditional Chumash Healing

    Directory of Open Access Journals (Sweden)

    James D. Adams

    2005-01-01

    Full Text Available Chumash healing has been practiced in California for ∼13 000 years. Chumash healers treat their patients with prayer, laughter, dreaming, phytotherapy, aromatherapy, healing ceremonies and other techniques. Healing involves first healing the spirit, then healing the body. Chumash people still maintain their unique identity. Chumash Healers still practice the ancient healing arts in California. This lecture is a brief introduction to Chumash Healing.

  12. Mucosal healing in ulcerative colitis

    DEFF Research Database (Denmark)

    Seidelin, Jakob Benedict; Coskun, Mehmet; Nielsen, Ole Haagen

    2013-01-01

    . With the introduction of the tumor necrosis factor-alpha inhibitors for the treatment of UC, it has become increasingly evident that the disease course is influenced by whether or not the patient achieves mucosal healing. Thus, patients with mucosal healing have fewer flare-ups, a decreased risk of colectomy......, and a lower probability of developing colorectal cancer. Understanding the mechanisms of mucosal wound formation and wound healing in UC, and how they are affected therapeutically is therefore of importance for obtaining efficient treatment strategies holding the potential of changing the disease course of UC....... This review is focused on the pathophysiological mechanism of mucosal wound formation in UC as well as the known mechanisms of intestinal wound healing. Regarding the latter topic, pathways of both wound healing intrinsic to epithelial cells and the wound-healing mechanisms involving interaction between...

  13. Effects of hyperbaric oxygen therapy in enhancing expressions of e-NOS, TNF-α and VEGF in wound healing

    Science.gov (United States)

    Susilo, Imam; Devi, Anita; Purwandhono, Azham; Hadi Warsito, Sunaryo

    2017-05-01

    Wound healing is a physiological process that occurs progressively through overlapping phases. Tissue oxygenation is an important part of the complex regulation for wound healing. Hyperbaric Oxygen (HBO) therapy is a method of increasing oxygen delivery to tissues. The therapy improves tissue oxygenation and stimulates the formation of H2O2 as a secondary messenger for Tumour Necrosis Factor alpha (TNF α), e-NOS, VEGF and Nuclear Factor Kappa Beta phosphorylation (NF-Kb) which play an important role in the rapid transcription of a wide variety of genes in response to extracellular stimuli. This study aims to determine the effects of Hyperbaric Oxygen therapy in enhancing the expressions of e-NOS, TNF-α, VEGF and wound healing. This study is an animal study with a ‘randomized control group of pre-test and post test design’ on 28 Wistar rats. Randomly, the rats were divided into 4 groups with 7 rats in each group. The HBO treatment group 1 received 5 sessions of HBO 2.4 ATA in 3 × 30 minutes; the HBO treatment group 2 received 10 sessions of HBO 2.4 ATA in 3 × 30 minutes; and each of the control groups were without HBO. Each of the 28 male rats were given a full thickness excisional wound of 1 × 1cm. Examinations of e-NOS, TNF-α, VEGF expressions and wound healing were performed on day-0 (pre-HBO) and day-5 HBO or on day-0 (pre-HBO) and day-10 HBO. The resultsshowthat the Hyperbaric Oxygen therapy can improve e-NOS (p=0.02), TNF-α (p= 0.02), VEGF expression (p=0.02) and wound healing (p=0.002) significantly in the provision of HBO 2.4 ATA for 3 × 30 minutes in 5 sessions over 5 consecutive days. While the 10 sessions of HBO 2.4 ATA for 3 × 30 minutes over 10 consecutive days only increase e-NOS (p=0.02), TNF-α (p=0.04), VEGF expression significantly (p=0.03) but do not improve wound healing significantly (p=0.3) compared with no HBO. The study concludes that HBO can improve the expressions of e-NOS, TNF-α, VEGF and wound healing in the provision of HBO

  14. Assessment of Composite Delamination Self-Healing Under Cyclic Loading

    Science.gov (United States)

    O'Brien, T. Kevin

    2009-01-01

    Recently, the promise of self-healing materials for enhanced autonomous durability has been introduced using a micro-encapsulation technique where a polymer based healing agent is encapsulated in thin walled spheres and embedded into a base polymer along with a catalyst phase. For this study, composite skin-stiffener flange debonding specimens were manufactured from composite prepreg containing interleaf layers with a polymer based healing agent encapsulated in thin-walled spheres. Constant amplitude fatigue tests in three-point bending showed the effect of self-healing on the fatigue response of the skin-stiffener flange coupons. After the cycling that created debonding, fatigue tests were held at the mean load for 24 hours. For roughly half the specimens tested, when the cyclic loading was resumed a decrease in compliance (increase in stiffness) was observed, indicating that some healing had occurred. However, with continued cycling, the specimen compliance eventually increased to the original level before the hold, indicating that the damage had returned to its original state. As was noted in a prevoius study conducted with specimens tested under monotonically increasing loads to failure, healing achieved via the micro-encapsulation technique may be limited to the volume of healing agent available relative to the crack volume.

  15. Ferrets: wound healing and therapy.

    Science.gov (United States)

    Pilny, Anthony A; Hess, Laurie

    2004-01-01

    In all species of mammals, the stages of wound healing are the same, and both host factors and wound characteristics affect how wounds heal. The basic principles of wound care in ferrets, such as lavage, bandaging, and surgical closure, are similar to those in other species; however, knowledge of ferrets' anatomy and pathophysiology, as well as skin conditions commonly seen in ferrets, will help ensure proper wound healing.

  16. Parathyroid hormone and bone healing

    DEFF Research Database (Denmark)

    Ellegaard, M; Jørgensen, N R; Schwarz, P

    2010-01-01

    , no pharmacological treatments are available. There is therefore an unmet need for medications that can stimulate bone healing. Parathyroid hormone (PTH) is the first bone anabolic drug approved for the treatment of osteoporosis, and intriguingly a number of animal studies suggest that PTH could be beneficial...... in the treatment of fractures and could thus be a potentially new treatment option for induction of fracture healing in humans. Furthermore, fractures in animals with experimental conditions of impaired healing such as aging, estrogen withdrawal, and malnutrition can heal in an expedited manner after PTH treatment...

  17. Innovation and wound healing.

    Science.gov (United States)

    Harding, Keith

    2015-04-01

    Innovation in medicine requires unique partnerships between academic research, biotech or pharmaceutical companies, and health-care providers. While innovation in medicine has greatly increased over the past 100 years, innovation in wound care has been slow, despite the fact that chronic wounds are a global health challenge where there is a need for technical, process and social innovation. While novel partnerships between research and the health-care system have been created, we still have much to learn about wound care and the wound-healing processes.

  18. Effects and mechanisms of a microcurrent dressing on skin wound healing: a review.

    Science.gov (United States)

    Yu, Chao; Hu, Zong-Qian; Peng, Rui-Yun

    2014-01-01

    The variety of wound types has resulted in a wide range of wound dressings, with new products frequently being introduced to target different aspects of the wound healing process. The ideal wound dressing should achieve rapid healing at a reasonable cost, with minimal inconvenience to the patient. Microcurrent dressing, a novel wound dressing with inherent electric activity, can generate low-level microcurrents at the device-wound contact surface in the presence of moisture and can provide an advanced wound healing solution for managing wounds. This article offers a review of the effects and mechanisms of the microcurrent dressing on the healing of skin wounds.

  19. Healing agent for self-healing cementious material

    NARCIS (Netherlands)

    Jonkers, H.M.

    2011-01-01

    The invention provides a process for the production of a cementious material. The process comprises mixing cement starting materials and a particulate healing agent to provide the cementious material. The healing agent comprises coated particles, wherein the coated particles comprise bacterial

  20. Humor's healing potential.

    Science.gov (United States)

    Seaward, B L

    1992-04-01

    In the past three decades the medical world has begun to take more serious notice of the healing power of humor and the positive emotions associated with it. Humor and laughter are currently being employed by psychotherapists and other care givers as tools to promote and maintain health, as well as intervention and rehabilitation tools for a host of maladies and illnesses related to stress and life-style. Although this empirical medical approach is relatively new, the study of humor has revealed a complex psychological phenomenon. Senses of humor have been categorized in types associated with personality. Humor has many styles and can be found in almost any situation, on any occasion. Theories of humor include the superiority theory, the incongruity theory, the release/relief theory, and the divinity theory. Laughter has many clinical benefits, promoting beneficial physiological changes and an overall sense of well-being. Humor even has long-term effects that strengthen the effectiveness of the immune system. In healthcare, humor therapy can help relieve stress associated with disease and illness. It serves as a diversionary tactic, a therapeutic tool for disorders such as depression, and a coping mechanism. It also is a natural healing component for care givers trying to cope with the stress and personal demands of their occupations.

  1. Risk factors for delayed healing at the free anterolateral thigh flap donor site

    Directory of Open Access Journals (Sweden)

    Yoshiro Abe

    2018-01-01

    Full Text Available Background The free anterolateral thigh (ALT flap has been widely used for various kinds of reconstructions. However, delayed healing at the donor site occasionally occurs due to wound dehiscence or the partial loss of grafted skin at the donor site. The aim of the present study was to identify reliable predictive factors for delayed healing at the donor site after the harvest of a free ALT flap. Methods This study included 52 patients who underwent reconstructive procedures using free ALT flaps. The delayed healing group included patients with wounds at the donor site that had not healed over 3 weeks after surgery, and the normal healing group included patients who showed wound healing within 3 weeks after surgery. Multivariate logistic regression models were created to identify the risk factors for delayed healing at the ALT flap donor site. Results Among the 52 patients, 24 (46.2% showed delayed healing at the donor site, and 6 patients required additional operative treatment. A high preoperative body mass index (BMI, smoking, and skin grafting were found to be significantly associated with delayed healing at the ALT donor site. Of the 37 patients who underwent skin grafting, 23 (62% experienced delayed healing at the donor site. Conclusions A high preoperative BMI, smoking, and skin grafting were risk factors for delayed healing at the free ALT donor site. Skin grafting at the ALT donor site should be avoided in patients with a high BMI or a habit of smoking.

  2. Clinical aspects of tendon healing

    NARCIS (Netherlands)

    J.C.H.M. van der Meulen (Jacques)

    1974-01-01

    textabstractWe know that healing of a tendon wound takes place by an invasion of fibreblasts from the surrounding tissues; the tendon itself has no intrinsic healing capacity. lt was Potenza (1962) who proved that a traumatic suture of the tendons within their sheath is followed by disintegration of

  3. Our Pathway toward Healing Racism

    Science.gov (United States)

    Honour, Robert

    2013-01-01

    In this article, Robert Honour, Training and Staff Development Manager, at the Fairfax, Virginia, Department of Family Services (DFS), reports on the outcome of "Healing Racism" training at his organization. Participants in "Healing Racism Institutes" are transforming relationships and creating an organizational culture that…

  4. Scar-free cutaneous wound healing in the leopard gecko, Eublepharis macularius.

    Science.gov (United States)

    Peacock, Hanna M; Gilbert, Emily A B; Vickaryous, Matthew K

    2015-11-01

    Cutaneous wounds heal with two possible outcomes: scarification or near-perfect integumentary restoration. Whereas scar formation has been intensively investigated, less is known about the tissue-level events characterising wounds that spontaneously heal scar-free, particularly in non-foetal amniotes. Here, a spatiotemporal investigation of scar-free cutaneous wound healing following full-thickness excisional biopsies to the tail and body of leopard geckos (Eublepharis macularius) is provided. All injuries healed without scarring. Cutaneous repair involves the development of a cell-rich aggregate within the wound bed, similar to scarring wounds. Unlike scar formation, scar-free healing involves a more rapid closure of the wound epithelium, and a delay in blood vessel development and collagen deposition within the wound bed. It was found that, while granulation tissue of scarring wounds is hypervascular, scar-free wound healing conspicuously does not involve a period of exuberant blood vessel formation. In addition, during scar-free wound healing the newly formed blood vessels are typically perivascular cell-supported. Immunohistochemistry revealed widespread expression of both the pro-angiogenic factor vascular endothelial growth factor A and the anti-angiogenic factor thrombospondin-1 within the healing wound. It was found that scar-free wound healing is an intrinsic property of leopard gecko integument, and involves a modulation of the cutaneous scar repair program. This proportional revascularisation is an important factor in scar-free wound healing. © 2015 Anatomical Society.

  5. Management of impaired fracture healing: Historical aspects

    OpenAIRE

    Gajdobranski Đorđe; Micić Ivan; Mitković Milorad B.; Mladenović Desimir; Milankov Miroslav

    2005-01-01

    Introduction Establishing continuity of long bones in cases of impaired bone healing and pseudo-arthrosis is one of the most complex problems in orthopedics. Impaired bone healing The problem of impaired fracture healing is not new. As in other areas of human life, the roots of modern treatment of impaired bone healing lie in ancient medicine. A relatively high percentage of impaired bone healing, as well as unsatisfactory results of standard therapies of impaired bone healing and pseudoarthr...

  6. Synthetic Self-Healing Methods

    Energy Technology Data Exchange (ETDEWEB)

    Bello, Mollie [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-06-02

    Given enough time, pressure, temperature fluctuation, and stress any material will fail. Currently, synthesized materials make up a large part of our everyday lives, and are used in a number of important applications such as; space travel, under water devices, precise instrumentation, transportation, and infrastructure. Structural failure of these material scan lead to expensive and dangerous consequences. In an attempt to prolong the life spans of specific materials and reduce efforts put into repairing them, biologically inspired, self-healing systems have been extensively investigated. The current review explores recent advances in three methods of synthesized self-healing: capsule based, vascular, and intrinsic. Ideally, self-healing materials require no human intervention to promote healing, are capable of surviving all the steps of polymer processing, and heal the same location repeatedly. Only the vascular method holds up to all of these idealities.

  7. Unveiling Cebuano Traditional Healing Practices

    Directory of Open Access Journals (Sweden)

    ZachiaRaiza Joy S. Berdon

    2016-02-01

    Full Text Available This study aims to identify the features of Cebuano’s traditional healing practices. Specifically, it also answers the following objectives: analyze traditional healing in Cebuano’s perspectives, explain the traditional healing process practiced in terms of the traditional healers’ belief, and extrapolate perceptions of medical practitioners toward traditional healing. This study made use of qualitative approach, among five traditional healers who performed healing for not less than ten years, in the mountain barangays of Cebu City. These healers served as the primary informants who were selected because of their popularity in healing. The use of open-ended interview in local dialect and naturalistic observation provided a free listing of their verbatim accounts were noted and as primary narratives. Participation in the study was voluntary and participants were interviewed privately after obtaining their consent. The Cebuano traditional healing practices or “panambal” comprise the use of “himolso” (pulse-checking, “palakaw” (petition, “pasubay” (determining what causes the sickness and its possible means of healing, “pangalap” (searching of medicinal plants for “palina” (fumigation, “tayhop” (gentle-blowing, “tutho” (saliva-blowing,“tuob” (boiling, “orasyon” (mystical prayers, “hilot” (massage, and “barang” (sorcery. Though traditional with medical science disapproval, it contributes to a mystical identity of Cebuano healers, as a manifestation of folk Catholicism belief, in order to do a good legacy to the community that needs help. For further study, researchers may conduct further the studies on the: curative effects of medicinal plants in Cebu, psychological effect pulsechecking healed persons by the mananambal, and unmasking the other features of traditional healing.

  8. Exploring Inpatients' Experiences of Healing and Healing Spaces

    Directory of Open Access Journals (Sweden)

    Lorissa MacAllister PhD, AIA

    2016-12-01

    Full Text Available In order to understand a patient’s healing experience it is essential to understand the elements that they, the patient, believes contributed to their healing. Previous research has focused on symptom reducers or contributors through environment such as stress. A person’s experience of healing happens over time not instantaneous. Therefore, in this study, the interviews with patients happened after forty-eight hours of hospitalization. This mixed methods study describes the experiences of seventeen inpatients from two healthcare systems using a phenomenological approach combined with evidence based design evaluation methods to document the setting. The qualitative data was analyzed first for reoccurring themes then further explored and defined through quantitative environmental observations. The seventeen patients defined healing as “getting better/well.” Seventy three statements were recorded about contributors and detractors to healing in the physical environment. Three primary themes emerged from the data as positive influencers of a healing experience: being cared for, being comfortable and experiencing something familiar or like home. These results demonstrate that patients perceive their inpatient healing experience through a supported environment.

  9. Tendon healing in vivo. An experimental model.

    Science.gov (United States)

    Abrahamsson, S O; Lundborg, G; Lohmander, L S

    1989-01-01

    Flexor tendon segments were incubated in a diffusion chamber in the subcutis of rabbits. Tendons incubated up to 6 weeks in the diffusion chamber showed proliferating and migrating cells from the epitenon cell layer as well as viable endotenon cells. Explants frozen in liquid nitrogen prior to incubation showed no signs of extrinsic cell contamination and remained non-viable indicating that no cell penetration occurred through the Millipore filter and that cell division seen in non-frozen and incubated tendons was an expression of intrinsic cellular proliferative capacity of the tendon. In tendon segments incubated in chambers for three weeks, collagen synthesis was reduced by 50% and the rate of cell proliferation measured as 3H-thymidine incorporation, was 15 times that of native tendons. Frozen and incubated tendons showed only traces of remaining matrix synthesis or cell proliferation. With this experimental model we have histologically and biochemically shown that tendons may survive and heal while the nutrition exclusively could be based on diffusion and the tendons have an intrinsic capacity of healing. The described model enables further studies on tendon healing and its regulation.

  10. Heat Transfer in Health and Healing.

    Science.gov (United States)

    Diller, Kenneth R

    2015-10-01

    Our bodies depend on an exquisitely sensitive and refined temperature control system to maintain a state of health and homeostasis. The exceptionally broad range of physical activities that humans engage in and the diverse array of environmental conditions we face require remarkable strategies and mechanisms for regulating internal and external heat transfer processes. On the occasions for which the body suffers trauma, therapeutic temperature modulation is often the approach of choice for reversing injury and inflammation and launching a cascade of healing. The focus of human thermoregulation is maintenance of the body core temperature within a tight range of values, even as internal rates of energy generation may vary over an order of magnitude, environmental convection, and radiation heat loads may undergo large changes in the absence of any significant personal control, surface insulation may be added or removed, all occurring while the body's internal thermostat follows a diurnal circadian cycle that may be altered by illness and anesthetic agents. An advanced level of understanding of the complex physiological function and control of the human body may be combined with skill in heat transfer analysis and design to develop life-saving and injury-healing medical devices. This paper will describe some of the challenges and conquests the author has experienced related to the practice of heat transfer for maintenance of health and enhancement of healing processes.

  11. Coordinated sensing and active repair for self-healing

    Science.gov (United States)

    Hurley, D. A.; Huston, D. R.

    2011-02-01

    Self-repairing structural systems have the potential for improved performance ranges and lifetimes over conventional systems. Self-healing materials are not a new phenomenon and have been used in automotive and aeronautical applications for over a century. The bulk of these systems operate by using damage to directly initiate a repair response without any supervisory coordination. Integrating sensing and supervisory control technologies with self-healing may improve the safety and reliability of critical components and structures. This project illustrates the benefit of an integrated sensing, control, and self-healing system using laboratory scale test beds. A thermoplastic polymer embedded with resistive heating wires acts as the self-healing material. Damage is detected using an electro-optical sensing scheme based on photoresistors and a PC handling control duties. As damage occurs it is detected, located, and characterized. The key to this project is the integration of sensor feedback to control healing so that repairs are executed, monitored, and completed on the basis of continuous sensor data. This proof-of-concept prototype can likely be expanded and improved with alternative sensor options, self-healing materials, and system architecture.

  12. Microbial symbionts accelerate wound healing via the neuropeptide hormone oxytocin.

    Directory of Open Access Journals (Sweden)

    Theofilos Poutahidis

    Full Text Available Wound healing capability is inextricably linked with diverse aspects of physical fitness ranging from recovery after minor injuries and surgery to diabetes and some types of cancer. Impact of the microbiome upon the mammalian wound healing process is poorly understood. We discover that supplementing the gut microbiome with lactic acid microbes in drinking water accelerates the wound-healing process to occur in half the time required for matched control animals. Further, we find that Lactobacillus reuteri enhances wound-healing properties through up-regulation of the neuropeptide hormone oxytocin, a factor integral in social bonding and reproduction, by a vagus nerve-mediated pathway. Bacteria-triggered oxytocin serves to activate host CD4+Foxp3+CD25+ immune T regulatory cells conveying transplantable wound healing capacity to naive Rag2-deficient animals. This study determined oxytocin to be a novel component of a multi-directional gut microbe-brain-immune axis, with wound-healing capability as a previously unrecognized output of this axis. We also provide experimental evidence to support long-standing medical traditions associating diet, social practices, and the immune system with efficient recovery after injury, sustained good health, and longevity.

  13. Improvement of fatigue resistance of epoxy composite with microencapsulated epoxy-SbF5 self-healing system

    Directory of Open Access Journals (Sweden)

    X. J. Ye

    2017-11-01

    Full Text Available Rapid retardation and arresting of fatigue crack are successfully realized in the epoxy composite containing microencapsulated epoxy and ethanol solution of antimony pentafluoride-ethanol complex (SbF5·HOC2H5/HOC2H5. The effects of (i microcapsules induced-toughening, (ii hydrodynamic pressure crack tip shielding offered by the released healing agent, and (iii polymeric wedge and adhesive bonding of cured healing agent account for extension of fatigue life of the material. The two components of the healing agent can quickly react with each other soon after rupture of the microcapsules, and reconnect the crack only 20 seconds as of the test. The applied stress intensity range not only affects the healing efficiency, but also can be used to evaluate the healing speed. The present work offers a very fast healing system, and sets up a framework for characterizing speed of self-healing.

  14. Progress in corneal wound healing

    Science.gov (United States)

    Ljubimov, Alexander V.; Saghizadeh, Mehrnoosh

    2015-01-01

    Corneal wound healing is a complex process involving cell death, migration, proliferation, differentiation, and extracellular matrix remodeling. Many similarities are observed in the healing processes of corneal epithelial, stromal and endothelial cells, as well as cell-specific differences. Corneal epithelial healing largely depends on limbal stem cells and remodeling of the basement membrane. During stromal healing, keratocytes get transformed to motile and contractile myofibroblasts largely due to activation of transforming growth factor-β system. Endothelial cells heal mostly by migration and spreading, with cell proliferation playing a secondary role. In the last decade, many aspects of wound healing process in different parts of the cornea have been elucidated, and some new therapeutic approaches have emerged. The concept of limbal stem cells received rigorous experimental corroboration, with new markers uncovered and new treatment options including gene and microRNA therapy tested in experimental systems. Transplantation of limbal stem cell-enriched cultures for efficient re-epithelialization in stem cell deficiency and corneal injuries has become reality in clinical setting. Mediators and course of events during stromal healing have been detailed, and new treatment regimens including gene (decorin) and stem cell therapy for excessive healing have been designed. This is a very important advance given the popularity of various refractive surgeries entailing stromal wound healing. Successful surgical ways of replacing the diseased endothelium have been clinically tested, and new approaches to accelerate endothelial healing and suppress endothelial-mesenchymal transformation have been proposed including Rho kinase (ROCK) inhibitor eye drops and gene therapy to activate TGF-β inhibitor SMAD7. Promising new technologies with potential for corneal wound healing manipulation including microRNA, induced pluripotent stem cells to generate corneal epithelium, and

  15. Self-Healing anticorrosive coatings

    DEFF Research Database (Denmark)

    Nesterova, Tatyana

    Self-healing anticorrosive coatings are multi-component so-called smart materials, which have been proposed as a way to long-lasting corrosion protection of steel structures. The presently most promising technology route is based on microcapsules, filled with active healing agents, and has been...... to capillary forces. The healing agents then start to react, form a polymer network, and =glue‘ the crack. The approach has been applied to development of an epoxy-based self-healing anticorrosive coating for above water heavy duty corrosion protection. Emphasis has been on investigation of practical issues...... associated with development and testing of this type of coating. A laboratory investigation, to identify the most suitable method for production of mechanically stable (filled with industrially relevant core materials) and forming a free-flowing powder upon drying microcapsules, has been performed. Four...

  16. Versatile use of vacuum-assisted healing in fifty patients

    Science.gov (United States)

    Al Fadhli, Ahmad; Alexander, George; Kanjoor, James Roy

    2009-01-01

    Context: Wound management can often be a challenging experience, especially in the presence of diabetes mellitus, vascular or immunological compromise. While no single technique can be considered by itself to be ideal, vacuum-assisted healing, which is a recent innovation, is fast becoming a necessary addition as adjuvant therapy to hasten wound healing. Aims: To determine the efficacy of vacuum-assisted healing. Settings and Design: Plastic surgery centre. Ministry of Health Hospital, Kuwait. Materials and Methods: Patients from Kuwait in a wide variety of clinical situations were chosen for study: Patients (n=50) were classified by diagnosis: Group 1: pressure sore- sacral (n= 3), trochanteric (n=6), ischial (n= 2); Group 2: ulcers (n= 11); Group 3: traumatic soft tissue wounds (n =15); Group 4: extensive tissue loss from the abdominal wall perineum, thigh and axilla (n =5); Group 5: sternal dehiscence wounds (n =4) and Group 6: wounds from flap necrosis (n =4). All wounds were subjected to vacuum by wall unit or portable unit, using pressure of 100-125 mm - continuous or intermittent. Closure of wounds, significant reduction in size and refusal by patient for continuation of vacuum-assisted closure therapy were end points of vacuum application. Results: Sixteen per cent of patients showed complete healing of the wound. Seventy per cent of patients showed 20-78% reduction in wound size. In 14% of patients treatment had to be discontinued. All patients showed improvement in granulation tissue and reduction in bacterial isolates and tissue oedema. Conclusions: The application of subatmospheric pressure or negative pressure promotes healing in a wide range of clinical settings and is an advanced wound healing therapy that can optimize patient care, promote rapid wound healing and help manage costs. It may be used in most instances in both hospital and community settings. PMID:20368850

  17. Versatile use of vacuum-assisted healing in fifty patients

    Directory of Open Access Journals (Sweden)

    Al Fadhli Ahmad

    2009-01-01

    Full Text Available Context: Wound management can often be a challenging experience, especially in the presence of diabetes mellitus, vascular or immunological compromise. While no single technique can be considered by itself to be ideal, vacuum-assisted healing, which is a recent innovation, is fast becoming a necessary addition as adjuvant therapy to hasten wound healing. Aims: To determine the efficacy of vacuum-assisted healing. Settings and Design: Plastic surgery centre. Ministry of Health Hospital, Kuwait. Materials and Methods: Patients from Kuwait in a wide variety of clinical situations were chosen for study: Patients (n=50 were classified by diagnosis: Group 1: pressure sore- sacral (n= 3, trochanteric (n=6, ischial (n= 2; Group 2: ulcers (n= 11; Group 3: traumatic soft tissue wounds (n =15; Group 4: extensive tissue loss from the abdominal wall perineum, thigh and axilla (n =5; Group 5: sternal dehiscence wounds (n =4 and Group 6: wounds from flap necrosis (n =4. All wounds were subjected to vacuum by wall unit or portable unit, using pressure of 100-125 mm - continuous or intermittent. Closure of wounds, significant reduction in size and refusal by patient for continuation of vacuum-assisted closure therapy were end points of vacuum application. Results: Sixteen per cent of patients showed complete healing of the wound. Seventy per cent of patients showed 20-78% reduction in wound size. In 14% of patients treatment had to be discontinued. All patients showed improvement in granulation tissue and reduction in bacterial isolates and tissue oedema. Conclusions: The application of subatmospheric pressure or negative pressure promotes healing in a wide range of clinical settings and is an advanced wound healing therapy that can optimize patient care, promote rapid wound healing and help manage costs. It may be used in most instances in both hospital and community settings.

  18. A healing curriculum.

    Science.gov (United States)

    Boudreau, J Donald; Cassell, Eric J; Fuks, Abraham

    2007-12-01

    The banner of patient-centredness flies over many academic institutions; however, the practice and teaching of medicine remain oriented to disease. This incongruence is the result of an original Flexnerian dichotomy between the basic and clinical sciences and is maintained by a more recent distinction between disease and illness. One mind-set emphasises basic science and pathology pedagogically, whilst clinical medicine becomes a search for disease. The second introduces the patient as the focal point, underlining the personal and social contexts of illness. We must orient ourselves to a single central theme, namely, the well-being of the individual patient. Doing so does not deny the importance of the scientific understanding of biological function. Indeed, recent advances in genetics may permit a richer view of the individual as a unique product of genetic, developmental and experiential forces. The foregoing provide a coherent framework for a scientifically guided and humanistic medicine, which replaces the false dichotomies that have plagued medical school curricula with a congruent and stereoscopic view of medical education. We describe an undergraduate programme, entitled 'Physicianship', based on the fundamental premise that healing is the doctor's primary obligation. Explicit training in a specific clinical method, whose cardinal features include observation, attentive listening and clinical reasoning, emphasises the knowledge and skills necessary to effect this theoretical framework. The understanding of illnesses emphasises loss of homeostasis, whereas the physical examination highlights impairments of function. The educational experience is enriched with numerous opportunities for self-reflection.

  19. Failure to Heal of Thyroidectomy Wound Due to Gossypiboma and ...

    African Journals Online (AJOL)

    used, due to its physical and natural properties,[2,3] as well as breach in the sterile procedure. Furthermore, iatrogenic operative complications do occur when surgical materials like gauze, sponges, or surgical instruments are forgotten intraoperation ― leading to various complications, such as failure of the wound to heal, ...

  20. Writing to Heal Thyself: Physician as Person & Person as Physician

    Science.gov (United States)

    Kasman, Deborah L.

    2006-01-01

    An experienced physician-teacher shares her own experiences with loss in medicine and loss in her personal life. Through personal writings during her divorce, she exemplifies the healing effect writing can have during difficult transformations that occur in life. She shares her bias that physicians need to accept and own their emotions and can use…

  1. Self-Healing Wire Insulation

    Science.gov (United States)

    Parrish, Clyde F. (Inventor)

    2012-01-01

    A self-healing system for an insulation material initiates a self-repair process by rupturing a plurality of microcapsules disposed on the insulation material. When the plurality of microcapsules are ruptured, reactants within the plurality of microcapsules react to form a replacement polymer in a break of the insulation material. This self-healing system has the ability to repair multiple breaks in a length of insulation material without exhausting the repair properties of the material.

  2. The Effect of Control-released Basic Fibroblast Growth Factor in Wound Healing: Histological Analyses and Clinical Application

    Directory of Open Access Journals (Sweden)

    Shigeru Matsumoto, MD

    2013-09-01

    Conclusions: These findings suggest that control-released bFGF using gelatin sheet is effective for promoting wound healing. Such therapeutic strategy was considered to offer several clinical advantages including rapid healing and reduction of the dressing change with less patient discomfort.

  3. Cold atmospheric plasma (CAP changes gene expression of key molecules of the wound healing machinery and improves wound healing in vitro and in vivo.

    Directory of Open Access Journals (Sweden)

    Stephanie Arndt

    Full Text Available Cold atmospheric plasma (CAP has the potential to interact with tissue or cells leading to fast, painless and efficient disinfection and furthermore has positive effects on wound healing and tissue regeneration. For clinical implementation it is necessary to examine how CAP improves wound healing and which molecular changes occur after the CAP treatment. In the present study we used the second generation MicroPlaSter ß® in analogy to the current clinical standard (2 min treatment time in order to determine molecular changes induced by CAP using in vitro cell culture studies with human fibroblasts and an in vivo mouse skin wound healing model. Our in vitro analysis revealed that the CAP treatment induces the expression of important key genes crucial for the wound healing response like IL-6, IL-8, MCP-1, TGF-ß1, TGF-ß2, and promotes the production of collagen type I and alpha-SMA. Scratch wound healing assays showed improved cell migration, whereas cell proliferation analyzed by XTT method, and the apoptotic machinery analyzed by protein array technology, was not altered by CAP in dermal fibroblasts. An in vivo wound healing model confirmed that the CAP treatment affects above mentioned genes involved in wound healing, tissue injury and repair. Additionally, we observed that the CAP treatment improves wound healing in mice, no relevant side effects were detected. We suggest that improved wound healing might be due to the activation of a specified panel of cytokines and growth factors by CAP. In summary, our in vitro human and in vivo animal data suggest that the 2 min treatment with the MicroPlaSter ß® is an effective technique for activating wound healing relevant molecules in dermal fibroblasts leading to improved wound healing, whereas the mechanisms which contribute to these observed effects have to be further investigated.

  4. The effects of social isolation on wound healing mechanisms in female mice.

    Science.gov (United States)

    Pyter, Leah M; Yang, Linglan; da Rocha, José M; Engeland, Christopher G

    2014-03-29

    Various stressors impair wound healing in humans and rodents. For example, social isolation delays wound closure in rodents, but the healing mechanisms that underlie this delay have yet to be identified. Here, the effects of three weeks of social isolation on hypothalamic-pituitary-adrenal axis responses and healing factors involved in the inflammatory and proliferative phases of wound healing were assessed in adult female hairless mice. Social isolation reduced basal circulating corticosterone concentrations and increased body and thymus weights compared with group-housed controls. Isolation impaired dermal wound closure by up to 30% and reduced initial total wound bacterial load relative to controls. Inflammatory gene expression in the wounds was not affected by the observed differences in wound bacterial load. However, isolation reduced wound gene expression of keratinocyte growth factor and vascular endothelial growth factor, which are involved in keratinocyte proliferation/migration and angiogenesis during the proliferative phase of healing. These data indicate that social isolation induces healing impairments that may be attributed to reductions in growth factors necessary for proper skin cell proliferation and blood vessel growth during healing. This healing impairment occurred in the absence of both high wound bacterial load and elevated circulating glucocorticoids, which have previously been hypothesized to be required for stress-impaired healing in mice. Copyright © 2014 Elsevier Inc. All rights reserved.

  5. Assessment of Composite Delamination Self-Healing Via Micro-Encapsulation

    Science.gov (United States)

    O'Brien, T. Kevin; White, Scott R.

    2008-01-01

    Composite skin/stringer flange debond specimens manufactured from composite prepreg containing interleaf layers with a polymer based healing agent encapsulated in thin walled spheres were tested. As a crack develops and grows in the base polymer, the spheres fracture releasing the healing agent. The agent reacts with catalyst and polymerizes healing the crack. In addition, through-thickness reinforcement, in the form of pultruded carbon z-pins were included near the flange tips to improve the resistance to debonding. Specimens were manufactured with 14 plies in the skin and 10 plies in the stiffener flange. Three-point bend tests were performed to measure the skin/stiffener debonding strength and the recovered strength after healing. The first three tests performed indicated no healing following unloading and reloading. Micrographs showed that delaminations could migrate to the top of the interleaf layer due to the asymmetric loading, and hence, bypass most of the embedded capsules. For two subsequent tests, specimens were clamped in reverse bending before reloading. In one case, healing was observed as evidenced by healing agent that leaked to the specimen edge forming a visible "scar". The residual strength measured upon reloading was 96% of the original strength indicating healing had occurred. Hence, self-healing is possible in fiber reinforced composite material under controlled conditions, i.e., given enough time and contact with pressure on the crack surfaces. The micro-encapsulation technique may prove more robust when capsule sizes can be produced that are small enough to be embedded in the matrix resin without the need for using an interleaf layer. However, in either configuration, the amount of healing that can occur may be limited to the volume of healing agent available relative to the crack volume that must be filled.

  6. Physical chemistry of self-organization and self-healing in metals.

    Science.gov (United States)

    Nosonovsky, Michael; Amano, Ryoichi; Lucci, Jose M; Rohatgi, Pradeep K

    2009-11-07

    Wear occurs at most solid surfaces that come in contact with other solid surfaces. While biological surfaces and tissues usually have the ability to repair minor wear damage, engineered self-healing materials only started to emerge recently. An example of a smart self-healing material is the material with imbedded microcapsules or microtubes, which rupture during crack propagation and release a healing agent that repairs the crack. Self-healing mechanisms are hierarchical in the sense that they involve interactions with different characteristic scale lengths. While traditional models of self-healing require equations with many degrees of freedom, taking into account the hierarchical organization allows us to reduce the number of equations to a few degrees of freedom. We discuss the conditions under which the self-healing occurs and provide a general theoretical framework and criteria for self-healing using the concept of multiscale organization of entropy and non-equilibrium thermodynamics. The example of a self-healed Al alloy reinforced with microtubes filled with Sn60Pb40 solder is discussed as a case study.

  7. Self-healing fuse

    Science.gov (United States)

    Jones, N. D.; Kinsinger, R. E.; Harris, L. P.

    1974-01-01

    Fast-acting current limiting device provides current overload protection for vulnerable circuit elements and then re-establishes conduction path within milliseconds. Fuse can also perform as fast-acting switch to clear transient circuit overloads. Fuse takes advantage of large increase in electrical resistivity that occurs when liquid metal vaporizes.

  8. Angiodysplasia Occurring in Jejunal Diverticulosis

    OpenAIRE

    Edward A Jones; Hugh Chaun; Phillip Switzer; David J Clow; Ronald J Hancock

    1990-01-01

    The first case of angiodysplasia occurring in acquired jejunal diverticulosis is reported. The patient presented with occult gastrointestinal bleeding and chronic anemia, and was created successfully by resection of a 25 cm long segment of jejunum. Possible pathogenetic mechanisms for both angiodysplasia and jejunal diverticulosis are discussed.

  9. Naturally Occurring Radioactive Materials (NORM)

    Energy Technology Data Exchange (ETDEWEB)

    Gray, P. [ed.

    1997-02-01

    This paper discusses the broad problems presented by Naturally Occuring Radioactive Materials (NORM). Technologically Enhanced naturally occuring radioactive material includes any radionuclides whose physical, chemical, radiological properties or radionuclide concentration have been altered from their natural state. With regard to NORM in particular, radioactive contamination is radioactive material in an undesired location. This is a concern in a range of industries: petroleum; uranium mining; phosphorus and phosphates; fertilizers; fossil fuels; forestry products; water treatment; metal mining and processing; geothermal energy. The author discusses in more detail the problem in the petroleum industry, including the isotopes of concern, the hazards they present, the contamination which they cause, ways to dispose of contaminated materials, and regulatory issues. He points out there are three key programs to reduce legal exposure and problems due to these contaminants: waste minimization; NORM assesment (surveys); NORM compliance (training).

  10. Self-healing epoxy composites: preparation, characterization and healing performance

    Directory of Open Access Journals (Sweden)

    Reaz A. Chowdhury

    2015-01-01

    Full Text Available Low velocity impact damage is common in fiber reinforced composites, which leads to micro-crack and interfacial debonding, where damage is microscopic and invisible. The concept of self-healing composites can be a way of overcoming this limitation and extending the life expectancy while expanding their usage in structural applications. In the current study, extrinsic self-healing concept was adopted using urea-formaldehyde microcapsules containing room temperature curing epoxy resin system (SC-15 as the healing agent prepared by in situ polymerization. Microcapsules were characterized using Fourier transform infrared spectroscopy (FTIR for structural analysis. Size and shape of microcapsules were studied using optical microscopy and scanning electron microscopy (SEM. Size of the microcapsules was between 30 and 100 μm. Thermal characterization was carried out using thermogravimetric analysis. Microcapsules were thermally stable till 210 °C without any significant decomposition. Fiber reinforced composite fabrication was carried out in three different steps. In the first step, epoxy resin was encapsulated in urea-formaldehyde shell material, which was confirmed by FTIR analysis. In the next step, encapsulation of amine hardener was achieved by vacuum infiltration method. These two different microcapsules were added with epoxy at 10:3 ratio and composite fabrication was done with hand layup method. Finally, healing performance was measured in terms of low velocity impact test and thermoscopy analysis. Low velocity impact test with 30 J and 45 J impact loads confirmed the delamination and micro-crack in composite materials and subsequent healing recovery observed in terms of damaged area reduction and restoration of mechanical properties.

  11. Self Healing Coating/Film Project

    Science.gov (United States)

    Summerfield, Burton; Thompson, Karen; Zeitlin, Nancy; Mullenix, Pamela; Calle, Luz; Williams, Martha

    2015-01-01

    Kennedy Space Center (KSC) has been developing self healing materials and technologies. This project seeks to further develop self healing functionality in thin films for applications such as corrosion protective coatings, inflatable structures, space suit materials, and electrical wire insulation.

  12. Self-Healing Composite of Thermoset Polymer and Programmed Super Contraction Fibers

    Science.gov (United States)

    Li, Guoqiang (Inventor); Meng, Harper (Inventor)

    2016-01-01

    A composition comprising thermoset polymer, shape memory polymer to facilitate macro scale damage closure, and a thermoplastic polymer for molecular scale healing is disclosed; the composition has the ability to resolve structural defects by a bio-mimetic close-then heal process. In use, the shape memory polymer serves to bring surfaces of a structural defect into approximation, whereafter use of the thermoplastic polymer for molecular scale healing allowed for movement of the thermoplastic polymer into the defect and thus obtain molecular scale healing. The thermoplastic can be fibers, particles or spheres which are used by heating to a level at or above the thermoplastic's melting point, then cooling of the composition below the melting temperature of the thermoplastic. Compositions of the invention have the ability to not only close macroscopic defects, but also to do so repeatedly even if another wound/damage occurs in a previously healed/repaired area.

  13. Calcium alginate dressings promote healing of split skin graft donor sites.

    LENUS (Irish Health Repository)

    O'Donoghue, J M

    2012-02-03

    A prospective controlled trial was carried out to assess the healing efficacy of calcium alginate and paraffin gauze on split skin graft donor sites. Thirty patients were randomised to the calcium alginate group and 21 to the paraffin gauze group. The donor sites were assessed at 10 days post harvesting to determine if they were completely healed (100%) or not. Twenty one of the 30 patients dressed with calcium alginate were completely healed at day 10, while only 7\\/21 in the paraffin gauze group were healed (p < 0.05). There were two infections in the study, both occurring in the alginate group while there was no difference in dressing slippage between the two groups. Calcium alginate dressings provide a significant improvement in healing split skin graft donor sites.

  14. Main Puteri Traditional Malay Healing Ceremony

    OpenAIRE

    M. G. Nasuruddin; S. Ishak

    2014-01-01

    This paper deals with the traditional Malay healing ritualistic ceremony known as Main Puteri. This non-invasive intervention uses the vehicle of performance to administer the healing process. It employs the performance elements of Makyung, that is, music, movements/dance and dramatic dialogue to heal psychosomatic maladies. There are two perspectives to this therapeutic healing process, one traditional and the other scientific. From the traditional perspective, the psychosomatic illness is a...

  15. Collagen: Benefits in wound Healing

    Indian Academy of Sciences (India)

    First page Back Continue Last page Overview Graphics. Collagen: Benefits in wound Healing. As substrate for haemostasis. As chemotactic to cellular elements. As scaffold for transition to mature collagen production & alignment. Resistant to degradation. As template for cellular attachment, migration and proliferation.

  16. Computational simulation of bone fracture healing under inverse dynamisation.

    Science.gov (United States)

    Wilson, Cameron J; Schütz, Michael A; Epari, Devakara R

    2017-02-01

    Adaptive finite element models have allowed researchers to test hypothetical relationships between the local mechanical environment and the healing of bone fractures. However, their predictive power has not yet been demonstrated by testing hypotheses ahead of experimental testing. In this study, an established mechano-biological scheme was used in an iterative finite element simulation of sheep tibial osteotomy healing under a hypothetical fixation regime, "inverse dynamisation". Tissue distributions, interfragmentary movement and stiffness across the fracture site were compared between stiff and flexible fixation conditions and scenarios in which fixation stiffness was increased at a discrete time-point. The modelling work was conducted blind to the experimental study to be published subsequently. The simulations predicted the fastest and most direct healing under constant stiff fixation, and the slowest healing under flexible fixation. Although low fixation stiffness promoted more callus formation prior to bridging, this conferred little additional stiffness to the fracture in the first 5 weeks. Thus, while switching to stiffer fixation facilitated rapid subsequent bridging of the fracture, no advantage of inverse dynamisation could be demonstrated. In vivo data remains necessary to conclusively test this treatment protocol and this will, in turn, provide an evaluation of the model's performance. The publication of both hypotheses and their computational simulation, prior to experimental testing, offers an appealing means to test the predictive power of mechano-biological models.

  17. Burn injury and wound healing in X-linked ichthyosis.

    Science.gov (United States)

    Yancon, Andrea R; Wahl, Wendy L

    2010-01-01

    X-linked ichthyosis is a skin condition of decreased keratin degradation and hyperkeratosis resulting from a deficiency of steroid sulfatase causing scaly skin. Burns in these patients may require skin grafting and harvesting from diseased donor sites. No descriptions of the outcomes of attempted grafting, donor site healing, and burn recovery in patients with X-linked ichthyosis exist. The authors describe split-thickness skin grafting in one patient with X-linked ichthyosis who sustained a burn with crush injury to his bilateral lower extremities. Although he developed cellulitis, there is no evidence that patients with ichthyosis have higher rates of infection. The patient exhibited rapid healing at postgrafting clinic visits with a much flatter texture than expected early after meshed skin grafting. This could be a benefit of the excess keratin state. Wound healing was not impaired by the ichthyosis. Concerns over skin harvest were alleviated by aggressive topical emollients, which did not negatively impact harvest of donor skin or primary burn site healing.

  18. X-ray computed microtomography of three-dimensional microcracks and self-healing in engineered cementitious composites

    Science.gov (United States)

    Fan, Shuai; Li, Mo

    2015-01-01

    Concrete cracking and deterioration can potentially be addressed by innovative self-healing cementitious materials, which can autogenously regain transport properties and mechanical characteristics after the damage self-healing process. For the development of such materials, it is crucial, but challenging, to precisely characterize the extent and quality of self-healing due to a variety of factors. This study adopted x-ray computed microtomography (μCT) to derive three-dimensional morphological data on microcracks before and after healing in engineered cementitious composite (ECC). Scanning electron microscope and energy dispersive x-ray spectroscopy were also used to morphologically and chemically analyze the healing products. This work showed that the evolution of the microcrack 3D structure due to self-healing in cementitious materials can be directly and quantitatively characterized by μCT. A detailed description of the μCT image analysis method applied to ECC self-healing was presented. The results revealed that the self-healing extent and rate strongly depended on initial surface crack width, with smaller crack width favoring fast and robust self-healing. We also found that the self-healing mechanism in cementitious materials is dependent on crack depth. The region of a crack close to the surface (from 0 to around 50-150 μm below the surface) can be sealed quickly with crystalline precipitates. However, at greater depths the healing process inside the crack takes a significantly longer time to occur, with healing products more likely resulting from continued hydration and pozzolanic reactions. Finally, the μCT method was compared with other self-healing characterization methods, with discussions on its importance in generating new scientific knowledge for the development of robust self-healing cementitious materials.

  19. Ultrasound stimulation of maxillofacial bone healing

    NARCIS (Netherlands)

    Schortinghuis, J; Stegenga, B; Raghoebar, GM; de Bont, LGM

    A substantial part of the maxillofacial surgery practice deals with maxillofacial bone healing. In the past decades, low-intensity ultrasound treatment has been shown to reduce the healing time of fresh fractures of the extremities up to 38%, and to heal delayed and non-unions up to 90% and 83%,

  20. Evaluating Self Healing Capability of Bituminous Mastics

    NARCIS (Netherlands)

    Qiu, J.; Van de Ven, M.; Wu, S.; Yu, J.; Molenaar, A.

    2012-01-01

    The self-healing capability of bituminous materials has been known for many years. Researches were mostly focused on the self healing behaviour during load repetitions. The tests are either time consuming and/or complex. In this paper, a simple self healing test procedure is presented combining the

  1. On Southern African Indigenous Healing | Edwards | Indilinga ...

    African Journals Online (AJOL)

    ... role of rhythm, music, song, dance and various forms of empathy as for example facilitated in Nguni divine healing and San healing dances. The need for future in-depth research into related psychological themes and issues is identified and explicated. Keywords: Indigenous healing, illness prevention, health promotion.

  2. Does reconsolidation occur in humans?

    Directory of Open Access Journals (Sweden)

    Daniela eSchiller

    2011-05-01

    Full Text Available Evidence for reconsolidation in non-human animals has accumulated rapidly in the last decade, providing compelling` demonstration for this phenomenon across species and memory paradigms. In vast contrast, scant evidence exists for human reconsolidation to date. A major reason for this discrepancy is the invasive nature of current techniques used to investigate reconsolidation, which are difficult to apply in humans. Pharmacological blockade of reconsolidation, for example, has been typically used in animals as a proof of concept. However, most compounds used in these studies are toxic for humans, and those compounds that are safe target related, but not direct mechanisms of reconsolidation.Thus, although human reconsolidation has been hypothesized, there is limited evidence it actually exists, with the best evidence emerging from non-invasive techniques that ‘update’ memory during reconsolidation rather than block it, a technique only rarely used in animal research. Here we discuss the current state of human reconsolidation and the challenges ahead. We review findings on reconsolidation of emotional associative, episodic and procedural memories, using invasive and non-invasive techniques. We discuss the possible interpretation of these results, attempt to reconcile some inconsistencies, and suggest a conceptual framework for future research.

  3. Course and rate of post-fracture bone healing in correlation with bone-specific alkaline phosphatase and bone callus formation.

    Science.gov (United States)

    Muljacić, Ante; Poljak-Guberina, Renata; Zivković, Ognjen; Bilić, Vide; Guberina, Marko; Crvenković, Dalibor

    2013-12-01

    Alkaline phosphatase (ALP) and bone-specific alkaline phosphatase (S-bone ALP) activities may serve as markers of the course and rate of bone healing after sustained fractures. The aim of this study was to examine whether the assessment of S-bone ALP as a biochemical parameter in the early posttraumatic phase may indicate the course of fracture healing. To date, the methods used to monitor the bone healing process have been based on the patients' assessment and the radiographic findings. In view of the fact that patient opinion is highly subjective, that the radiographic findings depend on the radiologist's experience and that the monitoring of bone healing is a long-lasting process, measurements of biochemical parameters appear to be the only objective evidence of the changes occurring during bone regeneration. In this study, the activity of bone-specific alkaline phosphatase was measured in the serum of 41 patients who had sustained long bone fractures. The participants included 26 males and 15 females, aged 15 to 80 years. All patients were treated surgically. The activity of S-bone ALP was assessed every seven days over a period of 4 weeks. The study patients were followed up radiologically for several months. Our research showed that the increase of alkaline phosphatase correlated with an increase of S-bone ALP levels. In addition, changes in ALP levels on days 7 and 14 as compared to those on day 1 post injury were associated with changes in S-bone ALP levels on the same day. Likewise, the callus volume correlated with the decrease, no change or increase in the levels of ALP and S-bone ALP in the same way. Based on these results, it may be concluded that monitoring changes in the biochemical parameters alkaline phosphatase and bone-specific alkaline phosphatase allows early detection of fracture healing rates. A minor increase in the activity or no change in the level of the biochemical parameters ALP and S-bone ALP in the period of the first two weeks

  4. Sacred space and the healing journey.

    Science.gov (United States)

    Alt, Paul L

    2017-07-01

    Sacred space and spirituality have long been used to heal the mind, body, and spirit. This article illuminates the origins of sacred space and its role as a healing environment from the first human construct, the burial mound, to the 5th Century BCE Greek healing city of Epidaurus. It then examines the role of spirituality as one of the necessary human institutions for a healthy society, according to the Italian philosopher Giambattista Vico. The conclusion then surveys three contemporary healing environments' architecture, the Department of Veteran Affairs Healing Environment Design Guideline (VAHEDG), and how these sacred spaces mend individual and community ailments.

  5. Sigmund Freud: pioneer in energy healing.

    Science.gov (United States)

    Edwards, Stephen D; Edwards, David J

    2010-02-01

    Energy healing is a popular contemporary term for forms of healing that facilitate a natural healing process through harmonizing, rebalancing, and releasing energy flow disturbed or blocked by disease and illness. Biographical evidence indicates that Freud used physical, suggestive, and radiant forms of energy healing, and that his personal life, metapsychology, and psychoanalysis were founded on dynamic, energetic experiences and conceptualizations. Analysis of Freud's life and work leads to the conclusion that in experience, theory, and practice, Freud typified the traditional role of therapist and was a pioneer in modern forms of energy healing.

  6. Self-Healing of Polymer Networks with Reversible Bonds

    Science.gov (United States)

    Rubinstein, Michael

    2015-03-01

    Self-healing polymeric materials are systems that after damage can revert to their original state with full or partial recovery of mechanical strength. Using scaling theory we study a simple model of autonomic self-healing of polymer networks. In this model one of the two end monomers of each polymer chain is fixed in space mimicking dangling chains attachment to a polymer network, while the sticky monomer at the other end of each chain can form pairwise reversible bond with the sticky end of another chain. We study the reaction kinetics of reversible bonds in this simple model and analyze the different stages in the self-repair process. The formation of bridges and the recovery of the material strength across the fractured interface during the healing period occur appreciably faster after shorter waiting time, during which the fractured surfaces are kept apart. We observe the slowest formation of bridges for self-adhesion after bringing into contact two bare surfaces with equilibrium (very low) density of open stickers in comparison with self-healing. The primary role of anomalous diffusion in material self-repair for short waiting times is established, while at long waiting times the recovery of bonds across fractured interface is due to hopping diffusion of stickers between different bonded partners. Acceleration in bridge formation for self-healing compared to self-adhesion is due to excess nonequilibrium concentration of open stickers. Full recovery of reversible bonds across fractured interface (formation of bridges) occurs after appreciably longer time than the equilibration time of the concentration of reversible bonds in the bulk. The model is extended to describe enhanced toughness of dual networks with both permanent and reversible cross-links. This work was done in collaboration with Drs. Ludwik Leibler, Li-Heng Cai, Evgeny B. Stukalin, N. Arun Kumar and supported by the National Science Foundation.

  7. Is there a trade-off between wound-healing and chemical defenses among Caribbean reef sponges?

    Science.gov (United States)

    Walters, Kyle D; Pawlik, Joseph R

    2005-04-01

    On Caribbean coral reefs, some sponge species produce chemical defenses, while others do not and are non-fatally grazed by predatory fishes. It has been hypothesized that the latter may compensate for fish grazing by growing faster or rapidly healing wounds. Rates of wound-healing were measured for chemically defended and undefended tubular and vase-shaped sponges on patch reefs in the Florida Keys and Bahamas in 2002. Healing rates were significantly faster during the first few days of the experiment, with rates leveling off after the third day. Chemically undefended sponges healed at significantly faster rates (Callyspongia plicifera, 8% area regenerated per day; Callyspongia vaginalis, 6%; Niphates digitalis, 6%; Xestospongia muta, 6.5%) than chemically defended sponges (Cribrochalina vasculum, 2%; Ircinia campana, 2%; Verongula gigantea, 0%). Orientation of wounds relative to the tidal current had no influence on healing rates. Specimens of Niphates digitalis growing in tubular form had faster healing rates than individuals with vasiform shapes. Our results suggest that Caribbean reef sponges followed two different evolutionary trajectories: chemically defended species deter fish predation and have slow healing rates, while chemically undefended species allocate resources to rapid wound-healing in response to grazing.

  8. Spiritual healing in the treatment of rheumatoid arthritis

    DEFF Research Database (Denmark)

    Bliddal, Henning; Christensen, Robin; Højgaard, Lars

    2014-01-01

    Our objective was to investigate the efficacy of "energy/spiritual healing" in rheumatoid arthritis (RA). Eligible patients were women with RA on stable medication. The design was a randomised, blinded, sham-controlled trial; the third group included an external unblinded control of the natural c...... between groups occurred in Doppler ultrasound. There are no clear physiological or psychological explanations for the findings in this tightly controlled study. The trial data indicates a need for independent replication....

  9. Self-Healing Characteristics of Damaged Rock Salt under Different Healing Conditions.

    Science.gov (United States)

    Chen, Jie; Ren, Song; Yang, Chunhe; Jiang, Deyi; Li, Lin

    2013-08-12

    Salt deposits are commonly regarded as ideal hosts for geologic energy reservoirs. Underground cavern construction-induced damage in salt is reduced by self-healing. Thus, studying the influencing factors on such healing processes is important. This research uses ultrasonic technology to monitor the longitudinal wave velocity variations of stress-damaged rock salts during self-recovery experiments under different recovery conditions. The influences of stress-induced initial damage, temperature, humidity, and oil on the self-recovery of damaged rock salts are analyzed. The wave velocity values of the damaged rock salts increase rapidly during the first 200 h of recovery, and the values gradually increase toward stabilization after 600 h. The recovery of damaged rock salts is subjected to higher initial damage stress. Water is important in damage recovery. The increase in temperature improves damage recovery when water is abundant, but hinders recovery when water evaporates. The presence of residual hydraulic oil blocks the inter-granular role of water and restrains the recovery under triaxial compression. The results indicate that rock salt damage recovery is related to the damage degree, pore pressure, temperature, humidity, and presence of oil due to the sealing integrity of the jacket material.

  10. Self-Healing Characteristics of Damaged Rock Salt under Different Healing Conditions

    Directory of Open Access Journals (Sweden)

    Lin Li

    2013-08-01

    Full Text Available Salt deposits are commonly regarded as ideal hosts for geologic energy reservoirs. Underground cavern construction-induced damage in salt is reduced by self-healing. Thus, studying the influencing factors on such healing processes is important. This research uses ultrasonic technology to monitor the longitudinal wave velocity variations of stress-damaged rock salts during self-recovery experiments under different recovery conditions. The influences of stress-induced initial damage, temperature, humidity, and oil on the self-recovery of damaged rock salts are analyzed. The wave velocity values of the damaged rock salts increase rapidly during the first 200 h of recovery, and the values gradually increase toward stabilization after 600 h. The recovery of damaged rock salts is subjected to higher initial damage stress. Water is important in damage recovery. The increase in temperature improves damage recovery when water is abundant, but hinders recovery when water evaporates. The presence of residual hydraulic oil blocks the inter-granular role of water and restrains the recovery under triaxial compression. The results indicate that rock salt damage recovery is related to the damage degree, pore pressure, temperature, humidity, and presence of oil due to the sealing integrity of the jacket material.

  11. Self-Healing Characteristics of Damaged Rock Salt under Different Healing Conditions

    Science.gov (United States)

    Chen, Jie; Ren, Song; Yang, Chunhe; Jiang, Deyi; Li, Lin

    2013-01-01

    Salt deposits are commonly regarded as ideal hosts for geologic energy reservoirs. Underground cavern construction-induced damage in salt is reduced by self-healing. Thus, studying the influencing factors on such healing processes is important. This research uses ultrasonic technology to monitor the longitudinal wave velocity variations of stress-damaged rock salts during self-recovery experiments under different recovery conditions. The influences of stress-induced initial damage, temperature, humidity, and oil on the self-recovery of damaged rock salts are analyzed. The wave velocity values of the damaged rock salts increase rapidly during the first 200 h of recovery, and the values gradually increase toward stabilization after 600 h. The recovery of damaged rock salts is subjected to higher initial damage stress. Water is important in damage recovery. The increase in temperature improves damage recovery when water is abundant, but hinders recovery when water evaporates. The presence of residual hydraulic oil blocks the inter-granular role of water and restrains the recovery under triaxial compression. The results indicate that rock salt damage recovery is related to the damage degree, pore pressure, temperature, humidity, and presence of oil due to the sealing integrity of the jacket material. PMID:28811444

  12. Identifying the trends in wound-healing patents for successful investment strategies.

    Science.gov (United States)

    Gwak, Jae Ha; Sohn, So Young

    2017-01-01

    Recently, the need for rapid wound-healing has significantly increased because of the increasing number of patients who are diagnosed with diabetes and obesity. These conditions have contributed to a surge in the number of patients with chronic wounds worldwide. Furthermore, many cost-effective wound-healing technologies have been developed in order to keep up with the increased demand. In this paper, we performed a quantitative study of the trends associated with wound-healing technologies using patent data. We analyzed the trends considering four different groups of patent applicants: firms, universities, research institutes, and individuals using a structural topic model. In addition, we analyzed the knowledge flow between patent applicants using citation analysis, and confirmed the role of applicants in the knowledge-flow network using k-means clustering. As a result, the primary wound-healing technology patents applied for by the four groups varied considerably, and we classified the roles of patent applicants were found in the knowledge-flow network. Our results showed the organizations that are leading each area of wound-healing technology. Furthermore, from the results, we identified specific institutions that are efficient for spreading knowledge related to wound-healing technology based on the patents. This information can contribute to the planning of investment strategies and technology policies related to wound-healing.

  13. Stable gastric pentadecapeptide BPC 157 heals rat colovesical fistula.

    Science.gov (United States)

    Grgic, Tihomir; Grgic, Dora; Drmic, Domagoj; Sever, Anita Zenko; Petrovic, Igor; Sucic, Mario; Kokot, Antonio; Klicek, Robert; Sever, Marko; Seiwerth, Sven; Sikiric, Predrag

    2016-06-05

    To establish the effects of BPC 157 on the healing of rat colovesical fistulas, Wistar Albino male rats were randomly assigned to different groups. BPC 157, a stable gastric pentadecapeptide, has been used in clinical applications-specifically, in ulcerative colitis-and was successful in treating both external and internal fistulas. BPC 157 was provided daily, perorally, in drinking water (10µg/kg, 12ml/rat/day) until sacrifice or, alternatively, 10µg/kg or 10ng/kg intraperitoneally, with the first application at 30min after surgery and the last at 24h before sacrifice. Controls simultaneously received an equivolume of saline (5.0ml/kg ip) or water only (12ml/rat/day). Assessment (i.e., colon and vesical defects, fistula leaking, fecaluria and defecation through the fistula, adhesions and intestinal obstruction as healing processes) took place on days 7, 14 and 28. Control colovesical fistulas regularly exhibited poor healing, with both of the defects persisting; continuous fistula leakage; fecaluria and defecation through the fistula; advanced adhesion formation; and intestinal obstruction. By contrast, BPC 157 given perorally or intraperitoneally and in µg- and ng-regimens rapidly improved the whole presentation, with both colon and vesical defects simultaneously ameliorated and eventually healed. The maximal instilled volume was continuously raised until it reached the values of healthy rats, there were no signs of fecaluria and no defecation through the fistula, there was counteraction of advanced adhesion formation or there was an intestinal obstruction. In conclusion, BPC 157 effects appear to be suited to inducing full healing of colocutaneous fistulas in rats. Copyright © 2016 Elsevier B.V. All rights reserved.

  14. Stable gastric pentadecapeptide BPC 157 heals rectovaginal fistula in rats.

    Science.gov (United States)

    Baric, Marko; Sever, Anita Zenko; Vuletic, Lovorka Batelja; Rasic, Zarko; Sever, Marko; Drmic, Domagoj; Pavelic-Turudic, Tatjana; Sucic, Mario; Vrcic, Hrvoje; Seiwerth, Sven; Sikiric, Predrag

    2016-03-01

    Rectovaginal fistula is a devastating condition providing more than 99% of patients for surgical treatment. We hypothesized that rectovaginal fistula may be healed by therapy with stable gastric pentadecapeptide BPC 157, in consistence with its initial clinical application and effect on external fistulas. BPC 157 (10μg/kg or 10ng/kg) was given perorally, in drinking water (0.16μg/ml or 0.16ng/ml, 12ml/rat/day) till sacrifice, or alternatively, intraperitoneally, first application at 30min after surgery, last at 24h before sacrifice. Controls simultaneously received an equivolume of saline (5.0ml/kg ip) or water only (12ml/rat/day). The assessment (i.e., rectal and vaginal defect, fistula leakage, defecation through the fistula, adhesions and intestinal obstruction as healing processes) was at day 1, 3, 5, 7, 10, 14 and 21. Regularly, rectovaginal fistulas exhibited poor healing, with both of the defects persisting, continuous fistula leakage, defecation through the fistula, advanced adhesion formation and intestinal obstruction. By contrast, BPC 157 given perorally or intraperitoneally, in μg- and ng-regimens rapidly improved the whole presentation, with both rectal and vaginal defects simultaneously ameliorated and eventually healed. The maximal instilled volume was continuously raised till the values of healthy rats were achieved, there were no signs of defecation through the fistula. A counteraction of advanced adhesion formation and intestinal obstruction was achieved. Microscopic improvement was along with macroscopic findings. BPC 157 effects appear to be suited to induce a full healing of rectovaginal fistulas in rats. Copyright © 2016 Elsevier Inc. All rights reserved.

  15. The healing of fractured bones

    Energy Technology Data Exchange (ETDEWEB)

    Bacon, G.E. [Central Electricity Generating Board, Cheltenham (United Kingdom)

    1997-04-01

    A method utilising neutron beams of width 1 mm, used on D1B (2.4 A) and D20 (1.3 A) to study the healing of fractured bones is presented. It is found that the callus bone uniting the fractured tibia of a sheep, whose healing had been encouraged by daily mechanical vibration over a period of three months, showed no trace of the large preferential vertical orientation of the apatite crystals which is characteristic of the normal bone. Nevertheless the bone had regained about 60% of its mechanical strength and the callus bone, although not oriented, was well crystallized. It is considered that the new monochromator for D20, expected to give increased intensity at 2.5 A, will be of considerable advantage. (author). 2 refs.

  16. Fracture healing: mechanisms and interventions

    Science.gov (United States)

    Einhorn, Thomas A.; Gerstenfeld, Louis C.

    2015-01-01

    Fractures are the most common large-organ, traumatic injuries to humans. The repair of bone fractures is a postnatal regenerative process that recapitulates many of the ontological events of embryonic skeletal development. Although fracture repair usually restores the damaged skeletal organ to its pre-injury cellular composition, structure and biomechanical function, about 10% of fractures will not heal normally. This article reviews the developmental progression of fracture healing at the tissue, cellular and molecular levels. Innate and adaptive immune processes are discussed as a component of the injury response, as are environmental factors, such as the extent of injury to the bone and surrounding tissue, fixation and the contribution of vascular tissues. We also present strategies for fracture treatment that have been tested in animal models and in clinical trials or case series. The biophysical and biological basis of the molecular actions of various therapeutic approaches, including recombinant human bone morphogenetic proteins and parathyroid hormone therapy, are also discussed. PMID:25266456

  17. Collagen-Nanoparticles Composites for Wound Healing and Infection Control

    Directory of Open Access Journals (Sweden)

    Mădălina Elena Grigore

    2017-11-01

    Full Text Available Nowadays, the world is facing a serious crisis represented by the rapid emergence of resistant bacteria, which jeopardizes the efficacy of antibiotics. This crisis has been attributed to the overuse and misuse of antibiotics, as well as the cessation of new drug production by the pharmaceutical industry. Therefore, bacterial strains with resistance to multiple antibiotic classes have appeared, such as Staphylococcus aureus, Acinetobacter spp. and Pseudomonas aeruginosa. This review aims to provide an updated summary of the current approach to the treatment of infections due to resistant microorganisms, with a focus on the application of the antimicrobial effects of inorganic nanoparticles in combination with collagen to promote wound healing. In addition, the paper describes the current approaches in the field of functionalized collagen hydrogels capable of wound healing and inhibiting microbial biofilm production.

  18. A nonterminal equine mandibular model of bone healing.

    Science.gov (United States)

    Sarrafian, Tiffany L; Garcia, Tanya C; Dienes, Erin E; Murphy, Brian; Stover, Susan M; Galuppo, Larry D

    2015-04-01

    To develop a nonterminal large animal bone defect model for assessing the efficacy of regenerative and pharmacologic treatments designed to enhance bone healing. In vivo experimental. Adult gelding horses (n = 6). Under general anesthesia, using radiographic guidance, 13.5 mm diameter bilateral, full thickness mandibular defects were created in 6 horses using a custom surgical jig and coring bit. After 16 weeks, under general anesthesia, 23 mm diameter cores that encompassed the original healing defects and surrounding parent bone material were removed for evaluation. Oxytetracycline was administered 14 days before final core harvest to label bone-forming surfaces. Healing was qualitatively assessed from decalcified hematoxylin and eosin (H&E) stained and undecalcified fluorescent labeled sections. Trabecular to cortical bone fraction (Tb.V/Ct.V), bone volume fraction (BV/TV), tissue mineral density (TMD), and apparent bone mineral density (aBMD) were quantified using microcomputed tomography and compared between left and right sides using Wilcoxon signed rank test. BV/TV was not significantly different between left and right-sided defects. Bone deposition occurred centripetally from the border of the original defect, filling 67% ± 16% (SD) of the defect at 16 weeks. This model has potential use for comparison of regenerative and pharmacologic products aimed to augment bone healing. © Copyright 2014 by The American College of Veterinary Surgeons.

  19. New Uses of Traditional Healing in Contemporary Irish Literature

    Directory of Open Access Journals (Sweden)

    Patricia A. Lynch

    2013-03-01

    Full Text Available This is a comparative study in two ways.  After a summary of the historical and cultural research into traditional healing which is relevant to this article, then some comments about the general usage of such themes in contemporary Irish literature, the article moves on to examine the role and function of traditional healing as a motif in four specific literary texts.  These are: two Irish plays, Brian Friel’s Faith Healer, and Jim Nolan’s Blackwater Angel, and two pieces of Irish fiction, P.J. Curtis’ novel The Lightning Tree and Claire Keegan’s short story “The Night of the Quicken Trees”.  Strong similarities are found on many fronts between the texts, especially in the acceptance of healing and the mystery associated with it.  However, differences also occur, depending on the artistic choices of the authors, the gender and community emphasis used, and the relative importance of healing in the context of the work.  Women healers seem to be more rooted and less tragic than their male counterparts, but all healers are seen paradoxically as both an asset and a potential threat to society. When these texts are compared with research into historical and cultural aspects of Irish folk medicine, they clearly draw on tradition for their plot elements, but only in the fiction and plays can the full dramatic potential of these life and death situations be explored.

  20. Smear Layer Outcome on Healing

    Science.gov (United States)

    2015-07-31

    microbial flora was the main factor in the healing of exposed pulp tissue. This study proved that pulp necrosis was due to bacterial infection. Since the...or should not, be removed prior to obturation. A survey by Moss et al. (2001) revealed that only 51 % of endodontists and just 24% of dental...increasing trend among endodontists to routinely remove the smear layer during non-surgical root canal treatment ( Moss et al. 2001; Dutner et al. 2012

  1. Microcapsule-based self-healing anticorrosive coatings: Capsule size, coating formulation, and exposure testing

    DEFF Research Database (Denmark)

    Nesterova, Tatyana; Dam-Johansen, Kim; Pedersen, Lars Thorslund

    2012-01-01

    a decrease in microcapsule size but were accompanied by excessive formation of nanoparticles. Thus, isolation of too large microcapsules has been performed by filtration utilizing a novel low-energy fluoropolymer-coated steel sieve. An estimation of the critical pigment (microcapsule) volume concentration......Self-healing coatings is a rapidly growing research area, where focus has mainly been on development of new approaches to the mechanism of self-healing. However, there is a growing need for investigation of practical issues related to formulation, application, and testing of true self......-healing coatings. In this work, ways of reducing the size of poly(urea–formaldehyde) microcapsules, filled with linseed oil and intended for a microcapsule-based self-healing anticorrosive coating (above water exposure), are explored. The influence of microcapsules on epoxy coating performance is also studied...

  2. Self-healing of fatigue crack in epoxy materials with epoxy/mercaptan system

    Directory of Open Access Journals (Sweden)

    2011-01-01

    Full Text Available Successful retardation or arrest of fatigue crack is observed in self-healing epoxy composite containing dual encapsulated healant, i.e. two types of microcapsules that respectively include epoxy prepolymer and mercaptan/tertiary amine hardener. Fast curing of the released healing agent from the broken capsules leads to rapid development of its bonding strength and fracture toughness at room temperature. It is found that the effects of microcapsules induced-toughening, hydrodynamic pressure crack tip shielding, polymeric wedge and adhesive bonding of the healing agent are responsible for the extension of fatigue life. Depending on the applied stress intensity range, ΔKI, and the competition between polymerization kinetics of the healing agent and crack growth rate, the above mechanisms exert different influences on crack retardation. The results might serve as a reference for further improving the performance of the healant system under fatigue circumstances.

  3. Extracellular matrix and wound healing.

    Science.gov (United States)

    Maquart, F X; Monboisse, J C

    2014-04-01

    Extracellular matrix has been known for a long time as an architectural support for the tissues. Many recent data, however, have shown that extracellular matrix macromolecules (collagens, elastin, glycosaminoglycans, proteoglycans and connective tissue glycoproteins) are able to regulate many important cell functions, such as proliferation, migration, protein synthesis or degradation, apoptosis, etc., making them able to play an important role in the wound repair process. Not only the intact macromolecules but some of their specific domains, that we called "Matrikines", are also able to regulate many cell activities. In this article, we will summarize main findings showing the effects of extracellular matrix macromolecules and matrikines on connective tissue and epithelial cells, particularly in skin, and their potential implication in the wound healing process. These examples show that extracellular matrix macromolecules or some of their specific domains may play a major role in wound healing. Better knowledge of these interactions may suggest new therapeutic targets in wound healing defects. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  4. Preparation and evaluation of squid ink polysaccharide-chitosan as a wound-healing sponge.

    Science.gov (United States)

    Huang, Na; Lin, Jiali; Li, Sidong; Deng, Yifeng; Kong, Songzhi; Hong, Pengzhi; Yang, Ping; Liao, Mingneng; Hu, Zhang

    2018-01-01

    A new type of wound healing agent was developed using two marine biomaterials (squid ink polysaccharide and chitosan) as carriers and calcium chloride as an initiator for coagulation. Based on central composite design-response surface methodology, comprehensive evaluation of appearance quality for composite sponges and water absorbency were used as evaluation indices to identify the optimized preparation conditions and further evaluate the performance of the squid ink polysaccharide-chitosan sponge (SIP-CS). The optimized formulation of SIP-CS was as follows: chitosan concentration, 2.29%; squid ink polysaccharide concentration, 0.55%; and calcium chloride concentration, 2.82%, at a volume ratio of 15:5:2. SIP-CS was conducive to sticking on the wound, characterized by the spongy property, strong absorptivity, and tackiness. Rabbit ear arterial, hepatic, and femoral artery hemorrhage experiments indicated that, compared with chitosan dressings and absorbable gelatin, the hemostatic times were shorter and the bleeding volume was smaller. Furthermore, SIP-CS absorbed a large amount of hemocytes, leading to rapid hemostasis. The healing areas and wound pathological sections in scalded New Zealand rabbits indicated that SIP-CS promoted wound healing more rapidly than chitosan and better than commercially available burn cream. Thus, SIP-CS is a good wound healing agent for rapid hemostasis, promoting burn/scalded skin healing, and protecting from wound infection. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Partial-thickness burn wounds healing by topical treatment

    Science.gov (United States)

    Saeidinia, Amin; Keihanian, Faeze; Lashkari, Ardalan Pasdaran; Lahiji, Hossein Ghavvami; Mobayyen, Mohammadreza; Heidarzade, Abtin; Golchai, Javad

    2017-01-01

    Abstract Background: Burns are common event and associated with a high incidence of death, disability, and high costs. Centella asiatica (L.) is a medicinal herb, commonly growing in humid areas in several tropical countries that improve wound healing. On the basis of previous studies, we compared the efficacy of Centiderm versus silver sulfadiazine (SSD) in partial thickness burning patients. Methods: Study population comprised burn victims referred to Velayat Burning Hospital at Rasht, Iran. The intervention group received Centiderm and control group SSD cream. Burn wounds were treated once daily at home. All of the wounds were evaluated till complete healing occurred and at the admission, days 3, 7, 14 objective signs; visual acuity score (VAS) and subjective signs were recorded. Re-epithelialization time and complete healing days were recorded. We used random fixed block for randomization. The randomization sequence was created using the computer. Patients and burning specialist physician were blinded. Results: Seventy-five patients randomized into 2 groups; (40 patients: Centiderm group; 35 patients: SSD group). The mean age of them was 30.67 ± 9.91 years and 19 of them were male (31.7%). Thirty patients in Centiderm and 30 patients in SSD group were analyzed. All of objective and subjective signs and mean of re-epithelialization and complete healing were significantly better in Centiderm group rather than SSD group (P < 0.05). There was no infection in Centiderm group. Conclusions: We showed that use of Centiderm ointment not only improved the objective and subjective signs in less than 3 days, but also the re-epithelialization and complete healing rather than SSD without any infection in the subjects. PMID:28248871

  6. Healing the healer: poetry in palliative care.

    Science.gov (United States)

    Coulehan, Jack; Clary, Patrick

    2005-04-01

    Poetry plays an age-old role in the art of healing. Although medicine today seems distant from the world of poetic expression, there are surprising commonalities between the two. In this essay we reflect on three aspects of healing that are fostered by poetry. Practicing medicine with too many facts and not enough poetry leads to dissatisfaction, disappointment, and impaired healing, especially in the care of the terminally ill. Likewise, poetry deficiency cuts off an important avenue for physician self-awareness and reflectivity. Alternatively, three aspects of healing are fostered by poetry: the power of the word to heal (and also harm); the skill of "negative capability" that enhances physician effectiveness; and empathic connection, or compassionate presence, a relationship that heals without words. Reading and writing poetry can help physicians, especially those who care for dying patients, become more reflective, creative, and compassionate practitioners.

  7. A Practice-Based Theory of Healing Through Therapeutic Touch: Advancing Holistic Nursing Practice.

    Science.gov (United States)

    Hanley, Mary Anne; Coppa, Denise; Shields, Deborah

    2017-08-01

    For nearly 50 years, Therapeutic Touch (TT) has contributed to advancing holistic nursing practice and has been recognized as a uniquely human approach to healing. This narrative explores the development of a practice-based theory of healing through TT, which occurred between 2010 and 2016. Through the in-depth self-inquiry of participatory reflective dialogue in concert with constant narrative analysis, TT practitioners revealed the meaning of healing within the context of their TT practice. As the community of TT experts participated in an iterative process of small group and community dialogues with analysis and synthesis of emerging themes, the assumptions and concepts central to a theory of healing emerged, were clarified and verified. Exemplars of practice illustrate the concepts. A model of the theory of healing illuminates the movement and relationship among concepts and evolved over time. Feedback from nursing and inter-professional practitioners indicate that the theory of healing, while situated within the context of TT, may be useful in advancing holistic nursing practice, informing healing and caring approaches, stimulating research and education, and contributing to future transformations in health care.

  8. Fibronectin binding modulates CXCL11 activity and facilitates wound healing.

    Directory of Open Access Journals (Sweden)

    Federico Tortelli

    Full Text Available Engineered biomatrices offer the potential to recapitulate the regenerative microenvironment, with important implications in tissue repair. In this context, investigation of the molecular interactions occurring between growth factors, cytokines and extracellular matrix (ECM has gained increasing interest. Here, we sought to investigate the possible interactions between the ECM proteins fibronectin (FN and fibrinogen (Fg with the CXCR3 ligands CXCL9, CXCL10 and CXCL11, which are expressed during wound healing. New binding interactions were observed and characterized. Heparin-binding domains within Fg (residues 15-66 of the β chain, Fg β15-66 and FN (FNI1-5, but not FNIII12-14 were involved in binding to CXCL10 and CXCL11 but not CXCL9. To investigate a possible influence of FN and Fg interactions with CXCL11 in mediating its role during re-epithelialization, we investigated human keratinocyte migration in vitro and wound healing in vivo in diabetic db/db mice. A synergistic effect on CXCL11-induced keratinocyte migration was observed when cells were treated with CXCL11 in combination with FN in a transmigration assay. Moreover, wound healing was enhanced in full thickness excisional wounds treated with fibrin matrices functionalized with FN and containing CXCL11. These findings highlight the importance of the interactions occurring between cytokines and ECM and point to design concepts to develop functional matrices for regenerative medicine.

  9. Acrylate-endcapped polymer precursors: effect of chemical composition on the healing efficiency of active concrete cracks

    Science.gov (United States)

    Araújo, Maria; Van Tittelboom, Kim; Dubruel, Peter; Van Vlierberghe, Sandra; De Belie, Nele

    2017-05-01

    The repair of cracks in concrete is an unavoidable practice since these cracks endanger the durability of the structure. Inspired by nature, the self-healing concept has been widely investigated in concrete as a promising solution to solve the limitations of manual repair. This self-healing functionality may be realized by the incorporation of encapsulated healing agents in concrete. Depending on the nature of the cracks, different healing agents can be used. For structures subjected to repeated loads, elastic materials should be considered to cope with the crack opening and closing movement. In this study, various acrylate-endcapped polymer precursors were investigated for their suitability to heal active cracks. The strain capacity of the polymers was assessed by means of visual observation together with water flow tests after widening of the healed cracks in a stepwise manner. A strain of at least 50% could be sustained by epoxy- and siloxane-based healing agents. For polyester- and urethane/poly(propylene glycol)-based precursors, failure occurred at 50% elongation due to detachment of the polymer from the crack walls. However, for urethane/poly(propylene glycol)-based healing agent, debonding was limited to some local spots. The resistance of the polymerized healing agents against degradation in the strong alkaline environment characteristic for concrete has also been evaluated, with the urethane/poly(propylene glycol)-based precursor showing the best performance to withstand degradation.

  10. Corneal wound healing after excimer laser keratectomy.

    Science.gov (United States)

    Kaji, Yuichi; Yamashita, Hidetoshi; Oshika, Tetsuro

    2003-03-01

    Excimer laser keratectomy is widely used to correct refractive errors. Several complications of excimer laser keratectomy are reported including corneal infection, regression, corneal haze formation, glare and halo. Most of the complications are closely related to the corneal stromal wound healing process. In order to perform the excimer laser keratectomy with minimum complications, we should understand the mechanism of the corneal stroma wound healing process. In addition, such knowledge will help us to regulate the corneal stromal wound healing process in the future. In the present article, we discuss the molecular mechanism of the corneal stromal wound healing process after excimer laser keratectomy and its regulation by anti-inflammatory agents.

  11. Mucosal healing in ulcerative colitis

    DEFF Research Database (Denmark)

    Seidelin, Jakob Benedict; Coskun, Mehmet; Nielsen, Ole Haagen

    2013-01-01

    Ulcerative colitis (UC) is a colonic inflammatory condition with a substantial impact on the quality of life of affected persons. The disease carries a cumulative risk of need of colectomy of 20-30% and an estimated cumulative risk of colorectal cancer of 18% after 30 years of disease duration...... epithelial cells and other cells of the mucosa are discussed. The biochemistry of wound healing in UC provides the basis for the subsequent description of how these pathways are affected by the current medications, and what can be learnt on how to design future treatment regimens for UC based on targeting...

  12. The importance of wetting in healing of bitumen

    NARCIS (Netherlands)

    Leegwater, G.A.

    2016-01-01

    Asphalt concrete has the advantageous ability to heal autonomously, however the mechanisms behind this are not fully understood. To increase insight in the healing mecha-nism, the healing model used in polymer science is adopted. It interprets healing as the sum of wetting and intrinsic healing. The

  13. The importance of wetting in healing of bitumen

    NARCIS (Netherlands)

    Leegwater, G.A.; Scarpas, Athanasios; Erkens, Sandra; Erkens, S.; Liu, X.; Anupam, K.; Yiqiu, T

    2016-01-01

    Asphalt concrete has the advantageous ability to heal autonomously, however the mechanisms behind this are not fully understood. To increase insight in the healing mechanism, the healing model used in polymer science is adopted. It interprets healing as the sum of wetting and intrinsic healing.

  14. RELATIONAL GROUP PSYCHOTHERAPY: THE HEALING OF STRESS, NEGLECT AND TRAUMA

    Directory of Open Access Journals (Sweden)

    Richard G. Erskine

    2010-01-01

    Full Text Available This article is the Keynote Address given at the 4th International Integrative Psychotherapy Association Conference, April 17, 2009. In speaking to the conference theme of “Acute Trauma, Cumulative Neglect, and Chronic Stress” the article describes some of the principles of Relational Group Psychotherapy. The theory of methods is based on the concept that the healing of trauma, neglect and stress occurs through a contactful therapeutic relationship. Relational group psychotherapy draws from several developments in group therapy, particularly the cybernetic feedback and other-centered models. It emphasizes the healing power of relationships between group members and the importance of phenomenological inquiry, affective attunement, identification, and relational-needs. The leader’s tasks are to stimulate the flow of contactful dialogue and to teach about human needs and healthy relationships.

  15. Impact of Disturbed Wound Healing after Surgery on the Prognosis of Marjolin's Ulcer

    Directory of Open Access Journals (Sweden)

    Jae Yeon Choi

    2013-05-01

    Full Text Available BackgroundMarjolin's ulcer is known to present a high proportion of recurrence and poor prognosis compared to other kinds of skin cancer. Based on our experience, Marjolin's ulcer patients who have received reconstructive surgery present a higher proportion of recurrence when there was disturbed wound healing after surgery. The impact of disturbed wound healing after surgery on the prognosis was examined in this study.MethodsA retrospective study was carried out on 26 patients who were diagnosed with Marjolin's ulcer and received surgery in this hospital from 1996 to 2011. Histologic grading, lymph node metastasis at diagnosis, and the wound healing process were evaluated and chi-squared analysis applied in order to determine the correlation with recurrence.ResultsThe proportion of recurrence increases in patients with a low histologic grade or lymph node metastasis at diagnosis. The proportion of recurrence is even higher when the problem occurs during the wound healing process after surgery.ConclusionsDisturbed wound healing after surgery could be used as a sign to quickly identify the recurrence of carcinoma. Therefore, in the event a problem occurs in the wound healing process after surgery, one should keep in mind that this could be a sign of the possibility of recurrence and proceed with careful observation and active diagnosis through additional physical examinations, general X-ray tests, computed tomographys, magnetic resonance imagings, and so on, to obtain an early diagnosis of recurrence.

  16. Microcapsule-Type Self-Healing Protective Coating for Cementitious Composites with Secondary Crack Preventing Ability

    Directory of Open Access Journals (Sweden)

    Dong-Min Kim

    2017-01-01

    Full Text Available A microcapsule-type self-healing protective coating with secondary crack preventing capability has been developed using a silanol-terminated polydimethylsiloxane (STP/dibutyltin dilaurate (DD healing agent. STP undergoes condensation reaction in the presence of DD to give a viscoelastic substance. STP- and DD-containing microcapsules were prepared by in-situ polymerization and interfacial polymerization methods, respectively. The microcapsules were characterized by Fourier-transform infrared (FT-IR spectroscopy, optical microscopy, and scanning electron microscopy (SEM. The microcapsules were integrated into commercial enamel paint or epoxy coating formulations, which were applied on silicon wafers, steel panels, and mortar specimens to make dual-capsule self-healing protective coatings. When the STP/DD-based coating was scratched, self-healing of the damaged region occurred, which was demonstrated by SEM, electrochemical test, and water permeability test. It was also confirmed that secondary crack did not occur in the healed region upon application of vigorous vibration to the self-healing coating.

  17. CCL20, (gamma)(delta) T cells, and IL-22 in corneal epithelial healing

    Science.gov (United States)

    After corneal epithelial abrasion, leukocytes and platelets rapidly enter the corneal stroma, and CCR6 (+) IL-17(+) gamma delta T cells migrate into the epithelium. Gamma delta T-cell-deficient (TCRd(-/-)) mice have significantly reduced inflammation and epithelial wound healing. Epithelial CCL20 mR...

  18. Bioconcrete: next generation of self-healing concrete.

    Science.gov (United States)

    Seifan, Mostafa; Samani, Ali Khajeh; Berenjian, Aydin

    2016-03-01

    Concrete is one of the most widely used construction materials and has a high tendency to form cracks. These cracks lead to significant reduction in concrete service life and high replacement costs. Although it is not possible to prevent crack formation, various types of techniques are in place to heal the cracks. It has been shown that some of the current concrete treatment methods such as the application of chemicals and polymers are a source of health and environmental risks, and more importantly, they are effective only in the short term. Thus, treatment methods that are environmentally friendly and long-lasting are in high demand. A microbial self-healing approach is distinguished by its potential for long-lasting, rapid and active crack repair, while also being environmentally friendly. Furthermore, the microbial self-healing approach prevails the other treatment techniques due to the efficient bonding capacity and compatibility with concrete compositions. This study provides an overview of the microbial approaches to produce calcium carbonate (CaCO3). Prospective challenges in microbial crack treatment are discussed, and recommendations are also given for areas of future research.

  19. Bioinspired porous membranes containing polymer nanoparticles for wound healing.

    Science.gov (United States)

    Ferreira, Ana M; Mattu, Clara; Ranzato, Elia; Ciardelli, Gianluca

    2014-12-01

    Skin damages covering a surface larger than 4 cm(2) require a regenerative strategy based on the use of appropriate wound dressing supports to facilitate the rapid tissue replacement and efficient self-healing of the lost or damaged tissue. In the present work, A novel biomimetic approach is proposed for the design of a therapeutic porous construct made of poly(L-lactic acid) (PLLA) fabricated by thermally induced phase separation (TIPS). Biomimicry of ECM was achieved by immobilization of type I collagen through a two-step plasma treatment for wound healing. Anti-inflammatory (indomethacin)-containing polymeric nanoparticles (nps) were loaded within the porous membranes in order to minimize undesired cell response caused by post-operative inflammation. The biological response to the scaffold was analyzed by using human keratinocytes cell cultures. In this work, a promising biomimetic construct for wound healing and soft tissue regeneration with drug-release properties was fabricated since it shows (i) proper porosity, pore size, and mechanical properties, (ii) biomimicry of ECM, and (iii) therapeutic potential. © 2014 Wiley Periodicals, Inc.

  20. Mechanism of Action of Topical Garlic on Wound Healing.

    Science.gov (United States)

    Alhashim, Minhal; Lombardo, Jamie

    2017-10-26

    Allicin, the active component of garlic, has been shown to have antimicrobial and anti-inflammatory properties. Garlic has also been used historically by many cultures to heal wounds. Several animal studies have shown that garlic extracts increase the rate of wound healing and decrease the rate of infection. Fibroblasts play a key role in wound healing. Here we hypothesize that fibroblasts are being activated by allicin, leading to more organized and rapid wound repair. Six rats were each given 2 surgical wounds. One side was treated with a 30% garlic ointment while the other was treated with Vaseline for two weeks. A biopsy was taken from each scar site and histopathology with Immunohistochemistry was performed to quantify the number of fibroblasts and proliferating fibroblasts in each site. The wound biopsies had more proliferating fibroblasts in the scars treated with the 30% garlic ointment than in the scars treated with Vaseline with a p-value of 0.0175 at two weeks post op and 0.081 at 6 week post op. This data tells us that allicin is acting on fibroblasts as there were more proliferating fibroblasts in the garlic treated sites than in the other sites.

  1. Development of self-healing coatings for corrosion protection on metallic structures

    Science.gov (United States)

    Stankiewicz, Alicja; Barker, Michael B.

    2016-08-01

    Inspired by biological systems, artificial self-healing materials are designed for repairing local damage caused by external factors. The rapidly expanding field of self-healing systems contains, among others, materials with well-defined surface properties. Undoubtedly, enhancing surface functionalisation, by applying smart coatings, enjoys an extensive interest. The self-healing ability is particularly essential property for corrosion protection strategies, especially when the use of one of the most effective corrosion systems, based on chromium(VI) compounds, is now banned by the current registration, evaluation, authorisation and restriction of chemicals legislation. Self-healing protective coatings are produced using macromolecular compounds, ceramics, metals and composites. Considering the wide range of available materials, the number of potential combinations seems to be unlimited. The self-healing action of such coatings is activated by appropriate stimuli: temperature changes, radiation, pH changes, pressure changes and mechanical action. In this paper, the research and practical implications of the various approaches to achieving self-healing functionality of protective coatings, as well as potential developments in this area, are explored.

  2. Accelerated oral wound healing using a pre-vascularized mucosal cell sheet.

    Science.gov (United States)

    Lee, Jaewang; Kim, Eun Hye; Shin, Daiha; Roh, Jong-Lyel

    2017-09-06

    Cell sheets with pre-vascularization have recently been developed but remain relatively untested in oral wound healing. Therefore, we examined the potential utility of our newly developed pre-vascularized mucosal cell sheets in oral wound healing. Mucosal keratinocytes, fibroblasts, and endothelial progenitor cells were primarily cultured for in vitro cell expansion from mucosa and blood of Sprague-Dawley rats. Mucosal cell sheets were generated using cultured keratinocytes and plasma fibrin (K sheet) or keratinocytes and a mixture of fibrin, fibroblasts, and endothelial cells (PV sheet). Autologous sheets were transplanted on deep wounds in the buccal region of rats. The gross and histological characteristics of wound healing were compared among control wound, K sheet, and PV sheet groups. We successfully cultured and expanded keratinocytes, fibroblasts, and endothelial progenitor cells in vitro for generating mucosal cell sheets with or without pre-vascularization. In the in vivo oral wound model, compared with the control wound, the PV sheet group exhibited rapid wound closure more prominently than the K sheet group. The histological healing in the PV sheet group was similar to that in rat normal buccal mucosa without fibrosis. The pre-vascularized mucosal cell sheet exhibited in vivo efficacy in oral wound healing by promoting accelerated healing.

  3. IL-20 promotes epithelial healing of the injured mouse cornea

    Science.gov (United States)

    After corneal epithelial injury, the ensuing inflammatory response is necessary for efficient wound healing. While beneficial healing effects are attributed to recruited neutrophils and platelets, dysregulated inflammation (too little or too much) is associated with impaired wound healing. The purpo...

  4. Tissue memory in healing tendons: short loading episodes stimulate healing.

    Science.gov (United States)

    Andersson, Therese; Eliasson, Pernilla; Aspenberg, Per

    2009-08-01

    Intact tendons adapt slowly to changes in mechanical loading, whereas in healing tendons the effect of mechanical loading or its absence is dramatic. The longevity of the response to a single loading episode is, however, unknown. We hypothesized that the tissue has a "memory" of loading episodes and that therefore short loadings are sufficient to elicit improved healing. The Achilles tendon of 70 female rats was transected and unloaded by tail suspension for 12 days (suspension started on day 2 after surgery). Each day, the rats were let down from suspension for short daily training episodes according to different regimes: 15 min of cage activity or treadmill running for 15, 30, 60, or 2x15 min. Rats with transected Achilles tendons and full-time cage activity served as controls. The results demonstrated that full-time cage activity increased the peak force over three times compared with unloading. Short daily loading episodes (treadmill running) increased the peak force about half as much as full-time activity. Prolongation of treadmill running above 15 min or dividing the daily training in two separate episodes had minimal further effect. This mechanical stimulation increased the cross-sectional area but had no effect on the mechanical properties of the repair tissue. The findings indicate that once the tissue had received information from a certain loading type and level, this is "memorized" and leads to a response lasting many hours. This suggests that patients might be allowed early short loading episodes following, e.g., an Achilles tendon rupture for a better outcome.

  5. Fibromodulin Enhances Angiogenesis during Cutaneous Wound Healing

    Directory of Open Access Journals (Sweden)

    Zhong Zheng, PhD

    2014-12-01

    Conclusions: Altogether, we demonstrated that in addition to reducing scar formation, FMOD also promotes angiogenesis. As blood vessels organize and regulate wound healing, its potent angiogenic properties will further expand the clinical application of FMOD for cutaneous healing of poorly vascularized wounds.

  6. Antimicrobial, Wound Healing And Antioxidant Activities Of ...

    African Journals Online (AJOL)

    claims of the plant in skin diseases, wound healing activity was studied, besides antioxidant activity to understand the mechanism of wound healing. The alchoholic and aqueous extract of this plant showed significant antibacterial and antifungal activity against almost all the organisms: Micrococcus luteus, Bacillus subtilis, ...

  7. Recent advances on self healing of concrete

    NARCIS (Netherlands)

    Schlangen, H.E.J.G.; Jonkers, H.M.; Qian, S.; Garcia, A.

    2010-01-01

    In this paper an overview is given of new developments obtained in research on self healing of cracks in cement based materials and asphalt concrete. At Delft University various projects are running to study self healing mechanisms. The first project that is discussed is Bacterial Concrete, in which

  8. Numerical Modelling of Self Healing Mechanisms

    Science.gov (United States)

    Remmers, Joris J. C.; de Borst, René

    A number of self healing mechanisms for composite materials have been presented in the previous chapters of this book. These methods vary from the classical concept of micro-encapsulating of healing agents in polymer systems to the autonomous healing of concrete. The key feature of these self healing mechanisms is the transport of material to the damaged zone in order to establish the healing process. Generally, this material is a fluid and its motion is driven by capillary action which enables transportation over relatively large distances requiring little or no work. In the microencapsulated polymers as developed by White et al. [1], this liquid material is a healing agent, which is enclosed in the material by micro-encapsulation. When the capsule is ruptured by a crack, the healing agent will flow into the crack, driven by capillary action. Polymerisation of this healing agent is triggered by contact with catalysts which are inserted in the material and whose position is fixed. The new polymerised material will rebond the crack surfaces.

  9. Self-healing composites and applications thereof

    Science.gov (United States)

    Tee, Chee Keong; Wang, Chao; Cui, Yi; Bao, Zhenan

    2016-11-08

    A battery electrode includes an electrochemically active material and a binder covering the electrochemically active material. The binder includes a self-healing polymer and conductive additives dispersed in the self-healing polymer to provide an electrical pathway across at least a portion of the binder.

  10. Recent advances on self healing of concrete

    NARCIS (Netherlands)

    Schlangen, H.E.J.G.; Jonkers, H.M.; Qian, S.; Garcia, A.

    In this paper an overview is given of new developments obtained in research on self healing of cracks in cement based materials and asphalt concrete. At Delft University various projects are running to study self healing mechanisms. The first project that is discussed is Bacterial Concrete, in which

  11. Biomechanics and Wound Healing in the Cornea

    OpenAIRE

    Dupps, William J.; Wilson, Steven E.

    2006-01-01

    The biomechanical and wound healing properties of the cornea undermine the predictability and stability of refractive surgery and contribute to discrepancies between attempted and achieved visual outcomes after LASIK, surface ablation and other keratorefractive procedures. Furthermore, patients predisposed to biomechanical failure or abnormal wound healing can experience serious complications such as keratectasia or clinically significant corneal haze, and more effective means for the identif...

  12. Use of Oxygen Therapies in Wound Healing

    DEFF Research Database (Denmark)

    Gottrup, Finn; Dissemond, Joachim; Baines, Carol

    2017-01-01

    Among other things wound healing requires restoration of macro-And microcirculation as essential conditions for healing.1,2 One of the most 'immediate' requirements is oxygen, which is critically important for reconstruction of new vessels and connective tissue and to enable competent resistance...

  13. STRESS PROLONGS WOUND HEALING POST CESAREAN SECTION

    Directory of Open Access Journals (Sweden)

    Ah. Yusuf

    2017-07-01

    Full Text Available Introduction: Decision for cesarean section may lead to the stress for women in delivery. Stress response requires longer recovery time in post cesarean section patients. Most of patients who experience stress before and after surgical is associated with wound healing delay. When this condition continues, the wound will have a higher risk of infection. The objective of this study was to analyze correlation between stress and wound healing phase in post cesarean section patients. Method: A cross sectional design was used in this study. The population were women with cesarean section, both elective or emergency, in Delivery Room I RSU Dr. Soetomo Surabaya. Samples were recruited by using purposive sampling, with 28 samples who met to the inclusion criterias. The observed variables were stress and wound healing phase in post cesarean section patient. Stress data were collected by interview and wound healing measurement done by observation on the 3rd day post cesarean section. Result: The result showed that women with stress experience wound healing delay. The characteristic of wound healing delay was prolonged on inflammation phase, nevertheless there was presence of granulation tissue. Spearman’s rho correlation showed that correlation value r=0.675 with p=0.000. Discussion: It can be concluded that there was strong significant correlation between stress and wound healing phase in post cesarean section patients. It is important to give this information to the patients with cesarean section in order to prevent stress and delay in wound healing phase.

  14. Wound Healing and Infection in Surgery

    DEFF Research Database (Denmark)

    Sørensen, Lars Tue

    2012-01-01

    To clarify the evidence on smoking and postoperative healing complications across surgical specialties and to determine the impact of perioperative smoking cessation intervention.......To clarify the evidence on smoking and postoperative healing complications across surgical specialties and to determine the impact of perioperative smoking cessation intervention....

  15. Self-healing cable for extreme environments

    Science.gov (United States)

    Huston, Dryver R. (Inventor); Tolmie, Bernard R. (Inventor)

    2009-01-01

    Self-healing cable apparatus and methods disclosed. The self-healing cable has a central core surrounded by an adaptive cover that can extend over the entire length of the self-healing cable or just one or more portions of the self-healing cable. The adaptive cover includes an axially and/or radially compressible-expandable (C/E) foam layer that maintains its properties over a wide range of environmental conditions. A tape layer surrounds the C/E layer and is applied so that it surrounds and axially and/or radially compresses the C/E layer. When the self-healing cable is subjected to a damaging force that causes a breach in the outer jacket and the tape layer, the corresponding localized axially and/or radially compressed portion of the C/E foam layer expands into the breach to form a corresponding localized self-healed region. The self-healing cable is manufacturable with present-day commercial self-healing cable manufacturing tools.

  16. Energy Healing for Cancer: A Critical Review

    DEFF Research Database (Denmark)

    Agdal, Rita; von Bornemann Hjelmborg, Jacob; Johannessen, Helle

    2011-01-01

    of energy healing are reiki, therapeutic touch and healing touch. Material and Methods: PubMed, AMED, JStor, Social Science Citation Index and PsycInfo databases were searched, and articles were rated according to the SIGN (Scottish Intercollegiate Guidelines Network) quality scale. Six quantitative and two...

  17. Wound healing and infection in surgery

    DEFF Research Database (Denmark)

    Sørensen, Lars Tue

    2012-01-01

    : The aim was to clarify how smoking and nicotine affects wound healing processes and to establish if smoking cessation and nicotine replacement therapy reverse the mechanisms involved.......: The aim was to clarify how smoking and nicotine affects wound healing processes and to establish if smoking cessation and nicotine replacement therapy reverse the mechanisms involved....

  18. Carbon Dots as Fillers Inducing Healing/Self-Healing and Anticorrosion Properties in Polymers.

    Science.gov (United States)

    Zhu, Cheng; Fu, Yijun; Liu, Changan; Liu, Yang; Hu, Lulu; Liu, Juan; Bello, Igor; Li, Hao; Liu, Naiyun; Guo, Sijie; Huang, Hui; Lifshitz, Yeshayahu; Lee, Shuit-Tong; Kang, Zhenhui

    2017-08-01

    Self-healing is the way by which nature repairs damage and prolongs the life of bio entities. A variety of practical applications require self-healing materials in general and self-healing polymers in particular. Different (complex) methods provide the rebonding of broken bonds, suppressing crack, or local damage propagation. Here, a simple, versatile, and cost-effective methodology is reported for initiating healing in bulk polymers and self-healing and anticorrosion properties in polymer coatings: introduction of carbon dots (CDs), 5 nm sized carbon nanocrystallites, into the polymer matrix forming a composite. The CDs are blended into polymethacrylate, polyurethane, and other common polymers. The healing/self-healing process is initiated by interfacial bonding (covalent, hydrogen, and van der Waals bonding) between the CDs and the polymer matrix and can be optimized by modifying the functional groups which terminate the CDs. The healing properties of the bulk polymer-CD composites are evaluated by comparing the tensile strength of pristine (bulk and coatings) composites to those of fractured composites that are healed and by following the self-healing of scratches intentionally introduced to polymer-CD composite coatings. The composite coatings not only possess self-healing properties but also have superior anticorrosion properties compared to those of the pure polymer coatings. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Why Cancer Patients Seek Islamic Healing.

    Science.gov (United States)

    Suhami, Norhasmilia; Muhamad, Mazanah Bt; Krauss, Steven Eric

    2016-10-01

    Islamic healing is frequently referred to as the treatment of choice by many Muslim cancer patients in Malaysia. Despite its widespread use, there is limited information relating to patients' healing preferences. With rising cancer rates in the country, this issue has become a concern to public health policy makers. The purpose of this study was to understand why cancer patients seek Islamic healing. This qualitative study utilized in-depth interviews with 18 cancer patients. The findings indicate three main reasons: (1) recommendations from family, friends and doctors; (2) belief in Islamic healing and (3) the perceived ineffectiveness and dissatisfaction with conventional treatments. Islamic healing will likely continue to be popular complementary cancer treatment in Malaysia as it is grounded in strong cultural and religious beliefs.

  20. Treatment of chronic non-healing ulcers using autologous platelet rich plasma: a case series.

    Science.gov (United States)

    Suthar, Manish; Gupta, Saniya; Bukhari, Suhail; Ponemone, Venkatesh

    2017-02-27

    Non-healing ulcers are a major health problem worldwide and have great impact at personal, professional and social levels, with high cost in terms of human and material resources. Recalcitrant non-healing ulcers are inevitable and detrimental to the lower limb and are a major cause of non-traumatic lower limb amputations. Application of autologous Platelet Rich Plasma (PRP) has been a major breakthrough for the treatment of non-healing and diabetic foot ulcers, as it is an easy and cost-effective method, and provides the necessary growth factors that enhance tissue healing. PRP is a conglomeration of thrombocytes, cytokines and various growth factors which are secreted by α-granules of platelets that augment the rate of natural healing process with decrease in time. The purpose of this case series was to evaluate the safety and efficacy of autologous platelet rich plasma for the treatment of chronic non-healing ulcers on the lower extremity. Autologous PRP was prepared from whole blood utilizing a rapid, intraoperative point-of-care system that works on the principle of density gradient centrifugation. Twenty Four (24) patients with non-healing ulcers of different etiologies, who met the inclusion criteria, were treated with single dose of subcutaneous PRP injections along with topical application of PRP gel under compassionate use. The mean age of the treated patients was 62.5 ± 13.53 years and they were followed-up for a period of 24 weeks. All the patients showed signs of wound healing with reduction in wound size, and the mean time duration to ulcer healing was 8.2 weeks. Also, an average five fold increase in the platelet concentrate was observed in the final PRP product obtained using the rapid point-of-care device, and the average platelet dose administered to the patients was 70.10 × 10(8). This case series has demonstrated the potential safety and efficacy of autologous platelet rich plasma for the treatment of chronic non-healing ulcers. NCT

  1. Unraveling beam self-healing.

    Science.gov (United States)

    Aiello, Andrea; Agarwal, Girish S; Paúr, Martin; Stoklasa, Bohumil; Hradil, Zdeněk; Řeháček, Jaroslav; de la Hoz, Pablo; Leuchs, Gerd; Sánchez-Soto, Luis L

    2017-08-07

    We show that, contrary to popular belief, diffraction-free beams may not only reconstruct themselves after hitting an opaque obstacle but also, for example, Gaussian beams. We unravel the mathematics and the physics underlying the self-reconstruction mechanism and we provide for a novel definition for the minimum reconstruction distance beyond geometric optics, which is in principle applicable to any optical beam that admits an angular spectrum representation. Moreover, we propose to quantify the self-reconstruction ability of a beam via a newly established degree of self-healing. This is defined via a comparison between the amplitudes, as opposite to intensities, of the original beam and the obstructed one. Such comparison is experimentally accomplished by tailoring an innovative experimental technique based upon Shack-Hartmann wave front reconstruction. We believe that these results can open new avenues in this field.

  2. Why the Healing Gods Are Twins

    Science.gov (United States)

    Hankoff, Leon D.

    1977-01-01

    The association of twins with health-giving powers is widespread in mythology, folklore, and religion. The Ashvins of the Rig-Veda, the classical Dioscuri, and the early Christian saints Cosmos and Damian are among the many examples of twins divinely empowered in the area of health and fertility. A characteristic set of attributes of twins recurs in different mythologies of wide distribution. In addition to healing, divine twins are often empowered with the ability to revive the dead, increase the fertility of man, animals, and crops, influence the weather, predict the future, and insure victory in battle. In some traditional societies these special attributes are thought to extend to all of the twins and their parents in the tribe. Ancient and primitive societies supposed that the birth of twins was associated with divine influence, the mother having been visited or otherwise affected by supernatural powers. A frequent explanation was that twins were the result of superfetation, a divine impregnation occurring along with that by the lawful husband. The specific powers of divine twins appear to be a reflection of the particular form of origin of twins through divine interference with the fertilization process. The twins thus share some of the powers of the divine parent, particularly those pertaining to fertility. Their dual paternity and its inherent competition is related to their martial interests as well as their ability to resolve ambivalent or ambiguous situations and predict outcomes. PMID:560764

  3. Inhibition of CaMKK2 Enhances Fracture Healing by Stimulating Indian Hedgehog Signaling and Accelerating Endochondral Ossification.

    Science.gov (United States)

    Williams, Justin N; Kambrath, Anuradha Valiya; Patel, Roshni B; Kang, Kyung Shin; Mével, Elsa; Li, Yong; Cheng, Ying-Hua; Pucylowski, Austin J; Hassert, Mariah A; Voor, Michael J; Kacena, Melissa A; Thompson, William R; Warden, Stuart J; Burr, David B; Allen, Matthew R; Robling, Alexander G; Sankar, Uma

    2018-01-03

    Approximately ten percent of all bone fractures do not heal, resulting in patient morbidity and healthcare costs. However, no pharmacological treatments are currently available to promote efficient bone healing. Inhibition of Ca2+ /calmodulin (CaM)-dependent protein kinase kinase 2 (CaMKK2) reverses age-associated loss of trabecular and cortical bone volume and strength in mice. In the current study, we investigated the role of CaMKK2 in bone fracture healing and show that its pharmacological inhibition using STO-609 accelerates early cellular and molecular events associated with endochondral ossification, resulting in a more rapid and efficient healing of the fracture. Within 7 days post-fracture, treatment with STO-609 resulted in enhanced Indian hedgehog signaling, paired-related homeobox (PRX1)-positive mesenchymal stem cell recruitment, chondrocyte differentiation and hypertrophy, along with elevated expression of osterix, vascular endothelial growth factor and type 1 collagen at the fracture callus. Early deposition of primary bone by osteoblasts resulted in STO-609 treated mice possessing significantly higher callus bone volume by 14 days following fracture. Subsequent rapid maturation of the bone matrix bestowed fractured bones in STO-609 treated animals with significantly higher torsional strength and stiffness by 28 days post-injury, indicating accelerated healing of the fracture. Previous studies indicate that fixed and closed femoral fractures in the mice take 35 days to fully heal without treatment. Therefore, our data suggest that STO-609 potentiates a 20% acceleration of the bone healing process. Moreover, inhibiting CaMKK2 also imparted higher mechanical strength and stiffness at the contralateral cortical bone within 4 weeks of treatment. Taken together, the data presented here underscore the therapeutic potential of targeting CaMKK2 to promote efficacious and rapid healing of bone fractures and as a mechanism to strengthen normal bones. This

  4. Rapid Prototyping

    Science.gov (United States)

    1999-01-01

    Javelin, a Lone Peak Engineering Inc. Company has introduced the SteamRoller(TM) System as a commercial product. The system was designed by Javelin during a Phase II NASA funded small commercial product. The purpose of the invention was to allow automated-feed of flexible ceramic tapes to the Laminated Object Manufacturing rapid prototyping equipment. The ceramic material that Javelin was working with during the Phase II project is silicon nitride. This engineered ceramic material is of interest for space-based component.

  5. Coating of Tungsten Wire with Ni/Al Multilayers for Self-Healing Applications

    Directory of Open Access Journals (Sweden)

    Ana Sofia Ramos

    2017-12-01

    Full Text Available Self-healing materials are able to partially or completely reverse the damage inflicted on them. The possibility of self-healing mechanical and chemical failures that occur during service will improve the lifetime and reliability of structural materials. For this purpose, two main steps must be considered: (i detection, and (ii repairing (healing of cracks. The exothermic character of reactive multilayers has potential for self-healing applications, namely in the healing step. In this context, Ni(V/Al multilayer thin films were deposited onto tungsten wires by magnetron sputtering from two targets. A detailed microstructural characterization was carried out by scanning and transmission electron microscopy after deposition, as well as after ignition by applying an electrical discharge. The as-deposited films presented an irregular layered structure with local defects not observed for flat substrates, although Ni- and Al-rich nanolayers could be distinguished. The as-reacted films were constituted by Al3Ni2 grains with Al3V phase at the grain boundaries. In order to use reactive multilayers for self-healing purposes, the heat released must be maximised by improving the microstructure of the nanolayered films. Nevertheless, after ignition, the Ni(V/Al multilayer films deposited onto W wire underwent a self-sustained reaction, releasing heat.

  6. Aloe vera and Vitis vinifera improve wound healing in an in vivo rat burn wound model.

    Science.gov (United States)

    Lin, Li-Xin; Wang, Peng; Wang, Yu-Ting; Huang, Yong; Jiang, Lei; Wang, Xue-Ming

    2016-02-01

    Aloe vera and Vitis vinifera have been traditionally used as wound healing agents. The present study aimed to investigate the effects of aloe emodin and resveratrol in the burn wound healing procedure. Burn wounds are common in developed and developing countries, however, in developing countries, the incidence of severe complications is higher and financial resources are limited. The results of the present study demonstrated that neither aloe emodin or resveratrol were cytotoxic to THP-1 macrophages at concentrations of 1, 100 and 500 ng/ml. A significant increase in wound-healing activity was observed in mice treated with the aloe emodin and resveratrol, compared with those which received control treatments. The levels of IL-1β in the exudates of the burn wound area of the treated mice increased in a time-dependent manner over 7 days following burn wound injury. At 10 days post-injury, steady and progressive wound healing was observed in the control animals. The present study confirmed that increased wound healing occurs following treatment with aloe emodin,, compared with resveratrol, providing support for the use of Aloe vera plants to improve burn wound healing.

  7. Exosome production and its regulation of EGFR during wound healing in renal tubular cells.

    Science.gov (United States)

    Zhou, Xiangjun; Zhang, Wei; Yao, Qisheng; Zhang, Hao; Dong, Guie; Zhang, Ming; Liu, Yutao; Chen, Jian-Kang; Dong, Zheng

    2017-06-01

    Kidney repair following injury involves the reconstitution of a structurally and functionally intact tubular epithelium. Growth factors and their receptors, such as EGFR, are important in the repair of renal tubules. Exosomes are cell-produced small (~100 nm in diameter) vesicles that contain and transfer proteins, lipids, RNAs, and DNAs between cells. In this study, we examined the relationship between exosome production and EGFR activation and the potential role of exosome in wound healing. EGFR activation occurred shortly after scratch wounding in renal tubular cells. Wound repair after scratching was significantly promoted by EGF and suppressed by EGFR inhibitor gefitinib. Interestingly, scratch wounding induced a significant increase of exosome production. The exosome production was decreased by EGF and increased by gefitinib, suggesting a suppressive role of EGFR signaling in exosome production. Conversely, inhibition of exosome release by GW4869 and manumycin A markedly increased EGFR activation and promoted wound healing. Moreover, exosomes derived from scratch-wounding cells could inhibit wound healing. Collectively, the results indicate that wound healing in renal tubular cells is associated with EGFR activation and exosome production. Although EGFR activation promotes wound healing, released exosomes may antagonize EGFR activation and wound healing. Copyright © 2017 the American Physiological Society.

  8. [The healing process of tympanic membrane perforations in rats].

    Science.gov (United States)

    Zajączkiewicz, Hanna; Hassmann-Poznańska, Elżbieta; Skotnicka, Bożena; Chyczewski, Lech; Reszeć, Joanna; Winnicka, Maria Małgorzata

    2014-01-01

    Tympanic membrane (TM) perforations are commonly seen in clinical practice as a result of trauma or in the course of otitis media. The TM is a unique structure suspended in air which makes its healing processes different than in the skin wounds. The aim of the study was otoscopical and histological evaluation of the rat's TM healing process. 56 male Wistar rats were used for the study. Fifty of them had TMs perforated bilaterally using CO2 laser, additional 6 served as a controls. The animals were sacrificed on either day 1, 2, 3, 6 and 10 post injury. Process of healing was assessed otoscopicaly, subsequently TM were dissected and processed for histological evaluation. At day 6 after perforation half and on day 10 all of TM were healed. On the first day, in histological evaluation, focal thickening of the epithelial layer was observed at some distance from the edge of perforation, on the side of annulus. On the following day proliferation of epithelium covering outer surface of TM on the side of the malleus handle and annulus was clearly visible. An eosinophilic mass containing macrophages and granulocytes was seen in front of the migrating epithelium. On day 3-6 migrating epithelium reached the edge of perforation. Proliferation of the connective tissue layer followed the epithelium. The present results indicate that the squamous epithelium covering the outer surface of TM constitutes the first layer which restores continuity of TM. The proliferation of the connective tissue occurs in the direct vicinity of the proliferating and migrating epithelium. Copyright © 2014 Polish Otorhinolaryngology - Head and Neck Surgery Society. Published by Elsevier Urban & Partner Sp. z.o.o. All rights reserved.

  9. Peri-implant versus periodontal wound healing.

    Science.gov (United States)

    Emecen-Huja, Pinar; Eubank, Tim D; Shapiro, Vladimir; Yildiz, Vedat; Tatakis, Dimitris N; Leblebicioglu, Binnaz

    2013-08-01

    Peri-implant gingival healing following one-stage implant placement was investigated and compared to periodontal healing. Healing at surgical sites [implant (I) and adjacent teeth (T+)] was compared to non-operated tooth (T-) in non-smokers receiving one-stage implant. Periodontal Indices (PI, GI) were recorded at surgery and up to 12 weeks post-operatively. Peri-implant (PICF) and gingival crevicular fluids (GCF) were analysed for cytokines, collagenases and inhibitors. Data were analysed by linear mixed model regression analysis and repeated measures anova. Forty patients (22 females; 21-74 years old) completed the study. Surgical site GI, increased at week 1, decreased significantly during early healing (weeks 1-3; p = 0.0003) and continually decreased during late healing (weeks 6-12) for I (p healing, as determined by crevicular fluid molecular composition, differs from periodontal healing. The observed differences suggest that peri-implant tissues, compared to periodontal tissues, represent a higher pro-inflammatory state. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  10. Factors affecting healing and survival after finger amputations in patients with digital artery occlusive disease.

    Science.gov (United States)

    Landry, Gregory J; McClary, Ashley; Liem, Timothy K; Mitchell, Erica L; Azarbal, Amir F; Moneta, Gregory L

    2013-05-01

    Finger amputations are typically performed as distal as possible to preserve maximum finger length. Failure of primary amputation leads to additional procedures, which could potentially be avoided if a more proximal amputation was initially performed. The effect of single versus multiple procedures on morbidity and mortality is not known. We evaluated factors that predicted primary healing and the effects of secondary procedures on survival. Patients undergoing finger amputations from 1995 to 2011 were evaluated for survival with uni- and multivariate analysis of demographic data and preoperative vascular laboratory studies to assess factors influencing primary healing. Seventy-six patients underwent 175 finger amputations (range 1 to 6 fingers per patient). Forty-one percent had diabetes, 33% had nonatherosclerotic digital artery disease, and 29% were on dialysis. Sex distribution was equal. Primary healing occurred in 78.9%, with the remainder requiring revisions. By logistic regression analysis, nonatherosclerotic digital artery disease was associated with failure of primary healing (odds ratio = 7.5; 95% confidence interval, 1.03 to 54; P = .047). Digital photoplethysmography did not predict primary healing. The overall healing of primary and secondary finger amputations was 96.0%. The mean survival after the initial finger amputation was 34.3 months and did not differ between patients undergoing single (35.6 months) versus multiple procedures (33.6 months). Dialysis dependence was associated with decreased survival (hazard ratio = 2.9; 95% confidence interval, 1.13 to 7.25; P = .026). Failure of primary healing is associated with the presence of nonatherosclerotic digital artery disease and is not predicted by digital photoplethysmographic studies. Dialysis dependence is associated with decreased survival in patients with finger amputations, but failure of primary healing does not adversely affect survival. A strategy of aggressive preservation of finger

  11. Wound healing and all-cause mortality in 958 wound patients treated in home care.

    Science.gov (United States)

    Zarchi, Kian; Martinussen, Torben; Jemec, Gregor B E

    2015-09-01

    Skin wounds are associated with significant morbidity and mortality. Data are, however, not readily available for benchmarking, to allow prognostic evaluation, and to suggest when involvement of wound-healing experts is indicated. We, therefore, conducted an observational cohort study to investigate wound healing and all-cause mortality associated with different types of skin wounds. Consecutive skin wound patients who received wound care by home-care nurses from January 2010 to December 2011 in a district in Eastern Denmark were included in this study. Patients were followed until wound healing, death, or the end of follow-up on December 2012. In total, 958 consecutive patients received wound care by home-care nurses, corresponding to a 1-year prevalence of 1.2% of the total population in the district. During the study, wound healing was achieved in 511 (53.3%), whereas 90 (9.4%) died. During the first 3 weeks of therapy, healing was most likely to occur in surgical wounds (surgical vs. other wounds: adjusted hazard ratio [AHR] 2.21, 95% confidence interval 1.50-3.23), while from 3 weeks to 3 months of therapy, cancer wounds, and pressure ulcers were least likely to heal (cancer vs. other wounds: AHR 0.12, 0.03-0.50; pressure vs. other wounds: AHR 0.44, 0.27-0.74). Cancer wounds and pressure ulcers were further associated with a three times increased probability of mortality compared with other wounds (cancer vs. other wounds: AHR 3.19, 1.35-7.50; pressure vs. other wounds: AHR 2.91, 1.56-5.42). In summary, the wound type was found to be a significant predictor of healing and mortality with cancer wounds and pressure ulcers being associated with poor prognosis. © 2015 by the Wound Healing Society.

  12. Vital tooth with periapical lesion: spontaneous healing after conservative treatment

    Directory of Open Access Journals (Sweden)

    Hyun-Joo Kim

    2012-05-01

    Full Text Available It is often presumed that apical periodontitis follows total pulp necrosis, and consequently root canal treatment is commonly performed. Periapical lesion development is usually caused by bacteria and its byproduct which irritate pulp, develop pulpitis, and result in necrosis through an irreversible process. Afterwards, apical periodontitis occurs. This phenomenon is observed as an apical radiolucency in radiographic view. However, this unusual case presents a spontaneous healing of periapical lesion, which has developed without pulp necrosis in a vital tooth, through conservative treatment.

  13. Extensive keloidal healing of pemphigus vulgaris

    Directory of Open Access Journals (Sweden)

    Khanna Neena

    1997-01-01

    Full Text Available Bullae of pemphigus vulgaris heal without scarring. We here report a patient of pemphigus vulgaris whose lesions healed with a one-month history of extensive flaccid bullae and uninfected erosions on the trunk and extremities along with superficial erosions in the oral mucosa. The clinical suspicion of pemphigus vulgaris was confirmed by histopathological and immunohistological examination. Pulse therapy with monthly parenteral dexamethasone and cyclophosphamide pulse was instituted. The cutaneous lesions on healing formed extensive keloidal scars despite high dose of monthly corticosteroid therapy.

  14. The Huichol offering: a shamanic healing journey.

    Science.gov (United States)

    Hammerschlag, Carl Allen

    2009-06-01

    An American transcultural psychiatrist, and a Mexican engineer deeply involved with the Huichol Indians, build a team that heals a decade-long epidemic caused by sorcery. Huichol children in boarding schools became possessed by demonic witchcraft that transformed them into aggressive animals. Many local shaman had been called in to treat the illness but had been unsuccessful. The team found a way to incorporate traditional belief and ritual, with modern psychological principles to weave a healing story. This article represents the ultimate integration of mind/body/spirit medicine to heal across cultures.

  15. Wound Healing in Mac-1 Deficient Mice

    Science.gov (United States)

    2017-05-01

    other studies have demonstrated that the treatment of wounds with M2 macrophages does not benefit wound healing. 15 Given the importance of... Wound healing in Mac-1 deficient mice Lin Chen, MD, PhD 1 ; Sridevi Nagaraja, PhD 2 ; Jian Zhou, BS 1 ; Yan Zhao, BS 1 ; David Fine, BS 1...Alexander Y. Mitrophanov, PhD 2 ; Jaques Reifman, PhD 2 ; Luisa A. DiPietro, DDS, PhD 1 1 Center for Wound Healing and Tissue Regeneration, College of

  16. Nanostructured Self-Healing Polymers and Composites

    Science.gov (United States)

    2010-10-31

    performance fibers for interfacial healing studies (Section 3). 1.3 Two Part Amine-Epoxy Based Healing Microencapsulation of a reactive amine represents a...Sottos, N.R. and White, S.R. In situ poly(urea-formaldehyde) microencapsulation of dicyclopentadiene. J. Microencapsulation , 20, 719-730 (2003). 3...Blaiszik, B.J., Caruso, M.M., White, S.R., Moore, J.S., Sottos, N.R. Microencapsulation of a Reactive Liquid-Phase Amine for Self-Healing Epoxy

  17. Biomimetics in materials science self-healing, self-lubricating, and self-cleaning materials

    CERN Document Server

    Nosonovsky, Michael

    2012-01-01

    Biomimetics in Materials Science provides a comprehensive theoretical and practical review of biomimetic materials with self-healing, self-lubricating and self-cleaning properties. These three topics are closely related and constitute rapidly developing areas of study. The field of self-healing materials requires a new conceptual understanding of this biomimetic technology, which is in contrast to traditional  engineering processes such as wear and fatigue.  Biomimetics in Materials Science is the first monograph to be devoted to these materials. A new theoretical framework for these processes is presented based on the concept of multi-scale structure of entropy and non-equilibrium thermodynamics, together with a detailed review of the available technology. The latter includes experimental, modeling, and simulation results obtained on self-healing/lubricating/cleaning materials since their emergence in the past decade. Describes smart, biomimetic materials in the context of nanotechnology, biotechnology, an...

  18. Factors That Influence Perforator Thrombosis and Predict Healing Perforator Sclerotherapy for Venous Ulceration Without Axial Reflux

    Science.gov (United States)

    Kiguchi, Misaki M.; Hager, Eric S.; Winger, Daniel G.; Hirsch, Stanley A.; Chaer, Rabih A.; Dillavou, Ellen D.

    2014-01-01

    OBJECTIVES Refluxing perforators contribute to venous ulceration. We sought to describe patient characteristics and procedural factors that (1) impact rates of incompetent perforator vein (IPV) thrombosis with ultrasound-guided sclerotherapy (UGS) and (2) impact the healing of venous ulcers (CEAP 6) without axial reflux. METHODS Retrospective review of UGS of IPV injections from 1/2010–11/2012 identified 73 treated venous ulcers in 62 patients. Patients had no other superficial/axial reflux and were treated with standard wound care and compression. Ultrasound was used to screen for refluxing perforators near ulcer(s), and these were injected with sodium tetradecyl sulfate or polidocanol foam and assessed for thrombosis at 2 weeks. Demographic data, comorbidities, treatment details and outcomes were analyzed. Univariate and multivariable modeling was performed to determine covariates predicting IPV thrombosis and ulcer healing. RESULTS 62 patients with active ulcers for an average of 28 months with compression therapy prior to perforator treatment had an average age of 57.1 years, were 55% male, 36% had a history of DVT and 30% had deep venous reflux. 32 patients (52%) healed ulcers, while 30 patients (48%) had non-healed ulcer(s) in mean follow-up of 30.2 months. Ulcers were treated with 189 injections, with average thrombosis rate of 54%. Of 73 ulcers, 43 ulcers healed (59%), and 30 ulcers did not heal (41%). Patients that healed ulcers had an IPV thrombosis rate of 69 % vs. 38% in patients who did not heal (Pulcer healing found complete IPV thrombosis was a positive predictor (P=.02), while large initial ulcer area was a negative predictor (P=.08). Increased age was associated with fewer ulcer recurrences (P=.05). Hypertension and increased follow-up time predicted increased ulcer recurrences (P=.04, P=.02). Calf vein thrombosis occurred after 3% (6/189) of injections. CONCLUSIONS Thrombosis of IPVs with UGS increases venous ulcer healing in a difficult patient

  19. Evaluation of burns healing effects of natural honey, Dermazine ...

    African Journals Online (AJOL)

    The healing effect of natural honey was evaluated in vivo using the excision wound healing model.Unpurified honey was used to treat burns inflictedon the experimental rats. The healing effects othe honey were compared to that of dermazine, honey-dermazine mixture, and methylaed spirit. The burns healing agents all ...

  20. Diabetic foot disease: impact of ulcer location on ulcer healing

    DEFF Research Database (Denmark)

    Pickwell, KM; Siersma, Volkert Dirk; Kars, M

    2013-01-01

    Healing of heel ulcers in patients with diabetes is considered to be poor, but there is relatively little information on the influence of ulcer location on ulcer healing.......Healing of heel ulcers in patients with diabetes is considered to be poor, but there is relatively little information on the influence of ulcer location on ulcer healing....

  1. Hemodynamic study for the healing process of ruptured achilles tendon by dynamic MRI

    Energy Technology Data Exchange (ETDEWEB)

    Mizuno, Toshiyuki [Hyogo Rehabilitation Center (Japan); Hamanishi, Hiroji; Nishikawa, Tetsuo; Mizuno, Kosaku

    2000-12-01

    Dynamic MR imaging with a combination of fast MR imaging technique and intravenous bolus administration of Gd-DTPA is a useful method to evaluate the vascularity of the soft tissue. By using this technique, we evaluated the healing processes of ruptured Achilles tendon. Eighteen patients who underwent percutaneous suture of the ruptured Achilles tendon were examined monthly by dynamic MRI in their course of healing. We evaluated time intensity curve obtained from each data of dynamic MRI. Time intensity curve showed slow fill in-slow wash out pattern 4 weeks after operation. Eight weeks after operation, the time course of the fill in-wash out changed to be shorter. Rapid fill in-rapid wash out pattern was observed about 12 weeks after surgery. After that period, time intensity curve tended to change into non-fitting pattern. (normal pattern) Eight functional parameters were obtained from time-intensity curve. We analyzed which parameters are useful for evaluation of tendon healing. In addition, we studied the healing processes of rabbit Achilles tendon following surgical incision. Twelve rabbits underwent tenotomy of Achilles tendon. The tendons excised at 1, 2, 4, 6, 8, 10, 12 weeks after operation were examined using microangiography and a light microscope. Four weeks after tenotomy, many capillary vessels filled with Gd-DTPA were observed in the ruptured area. About 10 weeks after operation, the capillary vessels decreased and collageneous fibers were arranged along the long axis of the tendon. This term would be thought to correspond to the condition about 12-14 weeks after surgery in clinical cases. From this study, dynamic MRI is thought to be useful method to know the hemodynamic conditions of the healing tendons. Especially, four parameters-Mean Transit Time, Corrected Transit Time, Time to Peak, Inflection Width, -seemed to have absolute value and be useful for the quantitative evaluation of the healing processes in human Achilles tendon. (author)

  2. Thrombomodulin promotes corneal epithelial wound healing

    National Research Council Canada - National Science Library

    Huang, Yi-Hsun; I, Ching-Chang; Kuo, Cheng-Hsiang; Hsu, Yun-Yan; Lee, Fang-Tzu; Shi, Guey-Yueh; Tseng, Sung-Huei; Wu, Hua-Lin

    2015-01-01

    To determine the role of thrombomodulin (TM) in corneal epithelial wound healing, and to investigate whether recombinant TM epidermal growth factor-like domain plus serine/threonine-rich domain (rTMD23...

  3. Ballistic Puncture Self-Healing Polymeric Materials

    Science.gov (United States)

    Gordon, Keith L.; Siochi, Emilie J.; Yost, William T.; Bogert, Phil B.; Howell, Patricia A.; Cramer, K. Elliott; Burke, Eric R.

    2017-01-01

    Space exploration launch costs on the order of $10,000 per pound provide an incentive to seek ways to reduce structural mass while maintaining structural function to assure safety and reliability. Damage-tolerant structural systems provide a route to avoiding weight penalty while enhancing vehicle safety and reliability. Self-healing polymers capable of spontaneous puncture repair show promise to mitigate potentially catastrophic damage from events such as micrometeoroid penetration. Effective self-repair requires these materials to quickly heal following projectile penetration while retaining some structural function during the healing processes. Although there are materials known to possess this capability, they are typically not considered for structural applications. Current efforts use inexpensive experimental methods to inflict damage, after which analytical procedures are identified to verify that function is restored. Two candidate self-healing polymer materials for structural engineering systems are used to test these experimental methods.

  4. Self-healing at the nanoscale

    Science.gov (United States)

    Amendola, Vincenzo; Meneghetti, Moreno

    2009-09-01

    The design of self-healing materials is a very important but challenging topic in nanotechnology. Self-healing strategies, also inspired by natural processes, allow the fabrication of auto-repairing systems, and in recent years, materials engineering at the nanoscale has allowed further advances in this emerging field. In this mini review, we recall some interesting self-healing systems found in natural processes and others created by man-made activity with special emphasis on the role played in this field by nanostructures. Finally, the self-healing of gold nanoparticles during laser irradiation is considered in more detail since it is a rare example of a functional nanomaterial with self-repairing properties.

  5. Blacktip reef sharks (Carcharhinus melanopterus) show high capacity for wound healing and recovery following injury

    Science.gov (United States)

    Chin, Andrew; Mourier, Johann; Rummer, Jodie L.

    2015-01-01

    Wound healing is important for sharks from the earliest life stages, for example, as the ‘umbilical scar’ in viviparous species heals, and throughout adulthood, when sharks can incur a range of external injuries from natural and anthropogenic sources. Despite anecdotal accounts of rapid healing in elasmobranchs, data regarding recovery and survival of individuals from different wound or injury types has not been systematically collected. The present study documented: (i) ‘umbilical scar’ healing in wild-caught, neonatal blacktip reef sharks while being reared for 30 days in flow-through laboratory aquaria in French Polynesia; (ii) survival and recovery of free-swimming blacktip reef sharks in Australia and French Polynesia following a range of injuries; and (iii) long-term survival following suspected shark-finning activities. Laboratory monitoring, tag-recapture records, telemetry data and photo-identification records suggest that blacktip reef sharks have a high capacity to survive and recover from small or even large and severe wounds. Healing rates, recovery and survival are important factors to consider when assessing impacts of habitat degradation and fishing stress on shark populations. The present study suggests that individual survival may depend more on handling practices and physiological stress rather than the extent of physical injury. These observations also contribute to discussions regarding the ethics of tagging practices used in elasmobranch research and provide baseline healing rates that may increase the accuracy in estimating reproductive timing inferred from mating scars and birth dates for neonatal sharks based on umbilical scar healing status. PMID:27293741

  6. Knockdown of Heme Oxygenase-2 Impairs Corneal Epithelial Cell Wound Healing

    Science.gov (United States)

    Halilovic, Adna; Patil, Kiran A.; Bellner, Lars; Marrazzo, Giuseppina; Castellano, Kirkland; Cullaro, Giuseppe; Dunn, Michael W.; Schwartzman, Michal Laniado

    2010-01-01

    Heme oxygenase (HO) represents an intrinsic cytoprotective system based on its anti-oxidative and anti-inflammatory properties mediated via its products biliverdin/bilirubin and carbon monoxide (CO). We showed that deletion of HO-2 results in impaired corneal wound healing with associated chronic inflammatory complications. This study was undertaken to examine the role of HO activity and the contribution of HO-1 and HO-2 to corneal wound healing in an in vitro epithelial scratch injury model. A scratch wound model was established using human corneal epithelial (HCE) cells. These cells expressed both HO-1 and HO-2 proteins. Injury elicited a rapid and transient increase in HO-1 and HO activity; HO-2 expression was unchanged. Treatment with biliverdin or CORM-A1, a CO donor, accelerated wound closure by 10% at 24 h. Inhibition of HO activity impaired wound closure by more than 50%. However, addition of biliverdin or CORM-A1 reversed the effect of HO inhibition on wound healing. Moreover, knockdown of HO-2 expression, but not HO-1, significantly impaired wound healing. These results indicate that HO activity is required for corneal epithelial cell migration. Inhibition of HO activity impairs wound healing while amplification of its activity restores and accelerates healing. Importantly, HO-2, which is highly expressed in the corneal epithelium, appears to be critical for the wound healing process in the cornea. The mechanisms by which it contributes to cell migration in response to injury may reside in the cytoprotective properties of CO and biliverdin. PMID:21506105

  7. Self Healing in Concrete Materials

    Science.gov (United States)

    Li, Victor C.; Yang, En-Hua

    The phenomenon of self healing in concrete has been known for many years. It has been observed that some cracks in old concrete structures are lined with white crystalline material suggesting the ability of concrete to self-seal the cracks with chemical products by itself, perhaps with the aid of rainwater and carbon dioxide in air. Later, a number of researchers [1, 2] in the study of water flow through cracked concrete under a hydraulic gradient, noted a gradual reduction of permeability over time, again suggesting the ability of the cracked concrete to self-seal itself and slow the rate of water flow. The main cause of self-sealing was attributed to the formation of calcium carbonate, a result of reaction between unhydrated cement and carbon dioxide dissolved in water [1]. Thus, under limited conditions, the phenomenon of self-sealing in concrete is well established. Self-sealing is important to watertight structures and to prolonging service life of infrastructure.

  8. Methods to study differences in cell mobility during skin wound healing in vitro

    NARCIS (Netherlands)

    Monsuur, H.N.; Boink, M.A.; Weijers, E.M.; Roffel, S.; Breetveld, M.; Gefen, A.; van den Broek, L.J.; Gibbs, S.

    2016-01-01

    Wound healing events which occur in humans are difficult to study in animals due to differences in skin physiology. Furthermore there are increasing restrictions in Europe for using animals for testing the therapeutic properties of new compounds. Therefore, in line with the 3Rs (reduction,

  9. Early secondary suture versus healing by second intention of incisional abscesses

    DEFF Research Database (Denmark)

    Hermann, G G; Bagi, P; Christoffersen, I

    1988-01-01

    A controlled trial was set up to compare the treatment of wound abscesses, occurring after laparotomy, with either early secondary suture combined with cefuroxime and metronidazole given intravenously or by healing by second intention. The secondary suture was performed two days after wound...

  10. New trends in healing chronic wounds

    OpenAIRE

    KREJSKOVÁ, Kamila

    2013-01-01

    Basic theoretical bases As a chronic wound is called a secondarily healing wound which despite adequate therapy does not tend to heal for a period of 6-9 weeks. The cause of the chronic wound occurrence and its transformation into an acute wound can be infection, influence of associated diseases, skin top layer microtraumatization or skin necrosis cavity. Among the most frequent types of chronic wounds there are aligned venous ulcerations, arterial rodent ulcers, decubitus ulcers and neuropat...

  11. Induction Healing of Porous Asphalt Concrete

    OpenAIRE

    Liu, Q.

    2012-01-01

    Porous asphalt shows excellent performance in both noise reduction and water drainage. Although porous asphalt has these great qualities, its service life is much shorter (sometimes only half) compared to dense graded asphalt roads. Ravelling, which is the loss of aggregate particles from the surface layer, is the main damage mechanism of porous asphalt surface wearing courses. In this research, an induction healing approach (namely, activating the healing process of asphalt concrete through ...

  12. Wound healing properties of Artocarpus heterophyllus Lam.

    Science.gov (United States)

    Gupta, Nilesh; Jain, U K; Pathak, A K

    2009-04-01

    The studies on excision wound healing model reveals significant wound healing activity of the methanolic leaf extract (simple ointment 5%) of "Artocarpus heterophyllus" ham which is comparable with standard (Betadine). In the excision model, the period of epithelization, of the extract treated group was found to be higher than the controlgroup and slightly lesser than standard treated group of animals on the up to 16(th) post wounding day.

  13. Towards electrically conductive, self-healing materials

    OpenAIRE

    Williams, Kyle A; Boydston, Andrew J; Bielawski, Christopher W

    2007-01-01

    A novel class of organometallic polymers comprising N-heterocyclic carbenes and transition metals was shown to have potential as an electrically conductive, self-healing material. These polymers were found to exhibit conductivities of the order of 10−3 S cm−1 and showed structurally dynamic characteristics in the solid-state. Thin films of these materials were cast onto silicon wafers, then scored and imaged using a scanning electron microscopy (SEM). The scored films were subsequently healed...

  14. A current affair: electrotherapy in wound healing

    OpenAIRE

    Hunckler,Jerome; de Mel,Achala

    2017-01-01

    Jerome Hunckler, Achala de Mel UCL Division of Surgery and Interventional Sciences, Faculty of Medical Sciences, University College London, London, UK Abstract: New developments in accelerating wound healing can have immense beneficial socioeconomic impact. The wound healing process is a highly orchestrated series of mechanisms where a multitude of cells and biological cascades are involved. The skin battery and current of injury mechanisms have become topics of interest for their in...

  15. Mammalian cell models to advance our understanding of wound healing: a review.

    Science.gov (United States)

    Vidmar, Jerneja; Chingwaru, Constance; Chingwaru, Walter

    2017-04-01

    Rapid and efficient healing of damaged tissue is critical for the restoration of tissue function and avoidance of tissue defects. Many in vitro cell models have been described for wound healing studies; however, the mechanisms that underlie the process, especially in chronic or complicated wounds, are not fully understood. The identification of cell culture systems that closely simulate the physiology of damaged tissue in vivo is necessary. We describe the cell culture models that have enhanced our understanding, this far, of the wound healing process or have been used in drug discovery. Cell cultures derived from the epithelium, including corneal, renal, intestinal (IEC-8 cells and IEC-6), skin epithelial cells (keratinocytes, fibroblasts, and multipotent mesenchymal stem cells), and the endothelium (human umbilical vein endothelial cells, primary mouse endothelial cells, endodermal stem cells, human mesenchymal stem cells, and corneal endothelial cells) have played a pivotal role toward our understanding of the mechanisms of wound healing. More studies are necessary to develop co-culture cell models which closely simulate the environment of a wound in vivo. Cell culture models are invaluable tools to promote our understanding of the mechanisms that regulate the wound healing process and provide a platform for drug discovery. Copyright © 2016 Elsevier Inc. All rights reserved.

  16. Low level diode laser accelerates wound healing.

    Science.gov (United States)

    Dawood, Munqith S; Salman, Saif Dawood

    2013-05-01

    The effect of wound illumination time by pulsed diode laser on the wound healing process was studied in this paper. For this purpose, the original electronic drive circuit of a 650-nm wavelength CW diode laser was reconstructed to give pulsed output laser of 50 % duty cycle and 1 MHz pulse repetition frequency. Twenty male mice, 3 months old were used to follow up the laser photobiostimulation effect on the wound healing progress. They were subdivided into two groups and then the wounds were made on the bilateral back sides of each mouse. Two sessions of pulsed laser therapy were carried along 15 days. Each mice group wounds were illuminated by this pulsed laser for 12 or 18 min per session during these 12 days. The results of this study were compared with the results of our previous wound healing therapy study by using the same type of laser. The mice wounds in that study received only 5 min of illumination time therapy in the first and second days of healing process. In this study, we found that the wounds, which were illuminated for 12 min/session healed in about 3 days earlier than those which were illuminated for 18 min/session. Both of them were healed earlier in about 10-11 days than the control group did.

  17. Bioimpedance measurement based evaluation of wound healing.

    Science.gov (United States)

    Kekonen, Atte; Bergelin, Mikael; Eriksson, Jan-Erik; Vaalasti, Annikki; Ylänen, Heimo; Viik, Jari

    2017-06-22

    Our group has developed a bipolar bioimpedance measurement-based method for determining the state of wound healing. The objective of this study was to assess the capability of the method. To assess the performance of the method, we arranged a follow-up study of four acute wounds. The wounds were measured using the method and photographed throughout the healing process. Initially the bioimpedance of the wounds was significantly lower than the impedance of the undamaged skin, used as a baseline. Gradually, as healing progressed, the wound impedance increased and finally reached the impedance of the undamaged skin. The clinical appearance of the wounds examined in this study corresponded well with the parameters derived from the bioimpedance data. Hard-to-heal wounds are a significant and growing socioeconomic burden, especially in the developed countries, due to aging populations and to the increasing prevalence of various lifestyle related diseases. The assessment and the monitoring of chronic wounds are mainly based on visual inspection by medical professionals. The dressings covering the wound must be removed before assessment; this may disturb the wound healing process and significantly increases the work effort of the medical staff. There is a need for an objective and quantitative method for determining the status of a wound without removing the wound dressings. This study provided evidence of the capability of the bioimpedance based method for assessing the wound status. In the future measurements with the method should be extended to concern hard-to-heal wounds.

  18. Hope for healing: the mobilization of interest in three types of religious healing in the Netherlands since 1850

    NARCIS (Netherlands)

    Vellenga, S.J.

    2008-01-01

    The author examines the development of the popularity of religious healing in the Netherlands since 1850 and the factors that contribute to its continuation. He focuses upon three traditions: devotional healing in Roman Catholicism, charismatic healing in Pentecostalism and paranormal healing in

  19. The effect of healing in the medial collateral ligament of human knee joint: A three-dimensional finite element analysis.

    Science.gov (United States)

    Wan, Chao; Hao, Zhixiu; Wen, Shizhu

    2016-06-30

    The medial collateral ligament (MCL) is one of the main ligaments that provide knee joint with major restraints against valgus, internal, and external torque loads. The MCL injury most frequently occurs near its femoral attachment but can be healed spontaneously. Hence, the usual clinical treatment for MCL injury is conservative therapy with early controlled rehabilitation motion. However, the effect of the variations in the healing conditions of the MCL portion (i.e. near the femoral insertion) is still unclear. In this study, finite element tibiofemoral joint models with three different MCL healing conditions were analyzed under six kinds of joint loads, such as 10 and 20 N·m valgus tibial torques, 5 and 10 N·m internal tibial torques, and 5 and 10 N·m external tibial torques. The three healing conditions corresponded to the early, medium, and final (i.e. healthy) stages of the healing period, respectively. It was found that different MCL healing conditions greatly affected the main joint kinematics under valgus tibial torques, but neither the reaction force nor stress results of the MCL. The peak strain values in the MCL healing portion changed greatly under all the six loads. Moreover, all the joint kinematics, strain results, and reaction force of the MCL at the medium stage were similar to those in the healthy joint, that is, at the final healing stage. These imply that the partially healed MCL might be enough for providing the restraints for knee joints and would not lead to some high strains occurring in the MCL. © IMechE 2016.

  20. Chinese Food and Cancer Healing

    Directory of Open Access Journals (Sweden)

    Hong Xu

    2006-01-01

    Full Text Available In cancer treatment, apart from studying the effectiveness of chemo or radiotherapy in killing cancer cells, studies should examine ways of reducing drug side effects on patients and ways of enhancing the bodies’ immune system at the same time. Our defence system not only includes immune response, there are also detoxifying enzymes, antioxidant mechanisms, the ability for DNA damage repair and regulation of the hormone metabolism. Harmful environmental oestrogens that enter the human body can cause an increase of 16-α-hydroxyestrone as a harmful estradiol metabolite, the ratio between 16-α-hydroxyestrone and 2-hydroxyestrone relates to the risk of breast cancer. It is suggested that choosing nutritional products (that decrease the amount of 16-α-hydroxyestrone to regulate the hormone metabolism can help with prevention of breast cancer. Increasing the ratio of monounsaturated fatty acid omega-3 (Ω-3 benefits health. Unsaturated fatty acid omega-6 (Ω-6 appears to be easily oxidised which can lead to DNA damage and increase the occurrence of cancer. The most important aspect to this approach is to reduce the ratio between saturated fatty acid and polyunsaturated fatty acid Ω-6, which is harmful to health. Olive oil has a high content of Ω-3 that benefits health. Ω-3 fatty acid can also be obtained from some fish, green vegetables and nuts. Linoleic acid is the most important source of Ω-6 fatty acid. Linolenic acid is the most important source of Ω-3 fatty acid. Natural foods e.g., purslane, is rich in Ω-3; the mustard family vegetables can increase the activity of detoxifying enzymes. Chinese Kiwi fruit drink reduces the side effects of the chemotherapy drug cyclophosphamide, which is also a DNA damaging agent. Soybean, job’s tears, garlic, mushroom varieties and tea have anti-cancer effects. Properly used nutritional products may assist treatment and recovery. Good balanced nutrition is essential for cancer healing.

  1. Lap shear strength and healing capability of self-healing adhesive containing epoxy/mercaptan microcapsules

    Science.gov (United States)

    Ghazali, Habibah; Ye, Lin; Zhang, Ming-Qiu

    2016-03-01

    The aim of this work is to develop a self-healing polymeric adhesive formulation with epoxy/mercaptan microcapsules. Epoxy/mercaptan microcapsules were dispersed into a commercialize two-part epoxy adhesive for developing self-healing epoxy adhesive. The influence of different content of microcapsules on the shear strength and healing capability of epoxy adhesive were investigated using single-lap-joints with average thickness of adhesive layer of about 180 µm. This self-healing adhesive was used in bonding of 5000 series aluminum alloys adherents after mechanical and alkaline cleaning surface treatment. The adhesion strength was measured and presented as function of microcapsules loading. The results indicated that the virgin lap shear strength was increased by about 26% with addition of 3 wt% of self-healing microcapsules. 12% to 28% recovery of the shear strength is achieved after self-healing depending on the microcapsules content. Scanning electron microscopy was used to study fracture surface of the joints. The self-healing adhesives exhibit recovery of both cohesion and adhesion properties with room temperature healing.

  2. Lap shear strength and healing capability of self-healing adhesive containing epoxy/mercaptan microcapsules

    Energy Technology Data Exchange (ETDEWEB)

    Ghazali, Habibah; Ye, Lin [Centre for Advanced Materials Technology (CAMT), School of Aerospace, Mechanical and Mechatronic Engineering, The University of Sydney, NSW 2006 (Australia); Zhang, Ming-Qiu [Key Laboratory of Polymeric Composite and Functional Materials of Ministry of Education, Zhongshan University, Guangzhou 510275 (China)

    2016-03-09

    The aim of this work is to develop a self-healing polymeric adhesive formulation with epoxy/mercaptan microcapsules. Epoxy/mercaptan microcapsules were dispersed into a commercialize two-part epoxy adhesive for developing self-healing epoxy adhesive. The influence of different content of microcapsules on the shear strength and healing capability of epoxy adhesive were investigated using single-lap-joints with average thickness of adhesive layer of about 180 µm. This self-healing adhesive was used in bonding of 5000 series aluminum alloys adherents after mechanical and alkaline cleaning surface treatment. The adhesion strength was measured and presented as function of microcapsules loading. The results indicated that the virgin lap shear strength was increased by about 26% with addition of 3 wt% of self-healing microcapsules. 12% to 28% recovery of the shear strength is achieved after self-healing depending on the microcapsules content. Scanning electron microscopy was used to study fracture surface of the joints. The self-healing adhesives exhibit recovery of both cohesion and adhesion properties with room temperature healing.

  3. Time to wound closure in trauma patients with disorders in wound healing is shortened by supplements containing antioxidant micronutrients and glutamine: a PRCT.

    Science.gov (United States)

    Blass, Sandra C; Goost, Hans; Tolba, René H; Stoffel-Wagner, Birgit; Kabir, Koroush; Burger, Christof; Stehle, Peter; Ellinger, Sabine

    2012-08-01

    : We hypothesize that wound closure in trauma patients with disorders in wound healing is accelerated by supplementation of antioxidant micronutrients and glutamine. In a randomized, double-blind, placebo-controlled trial, 20 trauma patients with disorders in wound healing were orally supplemented with antioxidant micronutrients (ascorbic acid, α-tocopherol, β-carotene, zinc, selenium) and glutamine (verum) or they received isoenergetic amounts of maltodextrine (placebo) for 14 days. Plasma/serum levels of micronutrients, glutamine, and vascular endothelial growth factor-A (VEGF-A) were determined before and after supplementation. In the wound, several parameters of microcirculation were measured. Time from study entry to wound closure was recorded. Micronutrients in plasma/serum did not change except for selenium which increased in the verum group (1.1 ± 0.2 vs. 1.4 ± 0.2 μmol/l; P = 0.009). Glutamine decreased only in the placebo group (562 ± 68 vs. 526 ± 55 μmol/l; P = 0.047). The prevalence of hypovitaminoses and the concentration of VEGF-A did not change. Considering microcirculation, only O(2)-saturation decreased in the placebo group (56.7 ± 23.4 vs. 44.0 ± 24.0 [arbitrary units]; P = 0.043). Wound closure occurred more rapidly in the verum than in the placebo group (35 ± 22 vs. 70 ± 35 d; P = 0.01). Time to wound closure can be shortened by oral antioxidant and glutamine containing supplements in trauma patients with disorders in wound healing. Copyright © 2012 Elsevier Ltd and European Society for Clinical Nutrition and Metabolism. All rights reserved.

  4. Ultrasonic Monitoring of the Interaction between Cement Matrix and Alkaline Silicate Solution in Self-Healing Systems

    Directory of Open Access Journals (Sweden)

    Mohand Ait Ouarabi

    2017-01-01

    Full Text Available Alkaline solutions, such as sodium, potassium or lithium silicates, appear to be very promising as healing agents for the development of encapsulated self-healing concretes. However, the evolution of their mechanical and acoustic properties in time has not yet been completely clarified, especially regarding their behavior and related kinetics when they are used in the form of a thin layer in contact with a hardened cement matrix. This study aims to monitor, using linear and nonlinear ultrasonic methods, the evolution of a sodium silicate solution interacting with a cement matrix in the presence of localized cracks. The ultrasonic inspection via linear methods revealed that an almost complete recovery of the elastic and acoustic properties occurred within a few days of healing. The nonlinear ultrasonic measurements contributed to provide further insight into the kinetics of the recovery due to the presence of the healing agent. A good regain of mechanical performance was ascertained through flexural tests at the end of the healing process, confirming the suitability of sodium silicate as a healing agent for self-healing cementitious systems.

  5. Ultrasonic Monitoring of the Interaction between Cement Matrix and Alkaline Silicate Solution in Self-Healing Systems.

    Science.gov (United States)

    Ait Ouarabi, Mohand; Antonaci, Paola; Boubenider, Fouad; Gliozzi, Antonio S; Scalerandi, Marco

    2017-01-07

    Alkaline solutions, such as sodium, potassium or lithium silicates, appear to be very promising as healing agents for the development of encapsulated self-healing concretes. However, the evolution of their mechanical and acoustic properties in time has not yet been completely clarified, especially regarding their behavior and related kinetics when they are used in the form of a thin layer in contact with a hardened cement matrix. This study aims to monitor, using linear and nonlinear ultrasonic methods, the evolution of a sodium silicate solution interacting with a cement matrix in the presence of localized cracks. The ultrasonic inspection via linear methods revealed that an almost complete recovery of the elastic and acoustic properties occurred within a few days of healing. The nonlinear ultrasonic measurements contributed to provide further insight into the kinetics of the recovery due to the presence of the healing agent. A good regain of mechanical performance was ascertained through flexural tests at the end of the healing process, confirming the suitability of sodium silicate as a healing agent for self-healing cementitious systems.

  6. The enhancement of neuronal cells wound healing with non-contact electric field stimulation by graphene electrodes

    Science.gov (United States)

    Lee, Sohee; Heo, Chaejeong; Lee, Si Young; Lee, Young Hee; Suh, Minah

    2013-05-01

    Electrical stimulation affects cellular behaviors including division, migration and wound healing [1-3]. Cellular injury often occurs due to the imbalance of the endogenous electric field [3]. In order to recover from the injury, wound healing process requires various cellular changes such as regeneration, migration, and the enhancement of cytoskeletal proteins and growth factors. In previous reports, a weak non-contact electric field stimulation (nEFS) accelerates the cell migration as well as cell-to-cell coupling between neuronal cell junction which are accompanied by increasing of cytoskeletal proteins [4, 5]. In this paper, we further investigated the wound healing effect of the nEFS in the neuronal cells (SHSY5Y cells) with live cell optical imaging. Cells were cultured over the optically transparent graphenen EF stimulator. Cellular behavioral changes upon nEFS were recorded with live optical imaging during stimulation of 120 minutes. The ability of wound healing was significantly enhanced with the nEFS. In particular, nEFS significantly shorten the duration of wound healing process. Moreover, after treating cells with cytochalasin D, a block polymerization of the actin filaments, the nEFS significantly enhanced wound healing process of cytochalasin D treated neural cells as compared to the control neural cells. This study suggests that nEFS may provide an effective way to control neural cells repairing process from cellular injury. Further mechanism study about the effect of nEFS on the wound healing may shed new light on cellular behavior.

  7. Novel Diels-Alder based self-healing epoxies for aerospace composites

    Science.gov (United States)

    Coope, T. S.; Turkenburg, D. H.; Fischer, H. R.; Luterbacher, R.; van Bracht, H.; Bond, I. P.

    2016-08-01

    Epoxy resins containing Diels-Alder (DA) furan and maleimide moieties are presented with the capability to self-heal after exposure to an external heat source. A conventional epoxy amine system has been combined with furfuryl and maleimide functional groups in a two-step process, to avoid major side-reactions, and the concentration of a thermo-reversibly binding cross-linker was considered to balance thermoset and thermoplastic behaviours, and the subsequent self-healing performance. In the context of self-repair technologies an inbuilt ‘intrinsic’ self-healing system is deemed favourable as the healing agent can be placed in known ‘hot spot’ regions (i.e. skin-stringer run outs, ply drops and around drilled holes) where operational damage predominately occurs in load bearing aerospace structures. In this study, the mechanical and self-healing performance of furan functionalised epoxy resins containing varying amounts (10, 20, 30 or 40 pph) of bismaleimide were investigated using a bulk epoxy polymer tapered double cantilever beam test specimen geometry. Two forms, a thin film and a bulk material, were evaluated to account for future integration methods into fibre reinforced polymer (FRP) composites. The highest healing efficiency, with respect to the obtained initial load value, was observed from the 20 pph bulk material derivative. The polymers were successful in achieving consistent multiple (three) healing cycles when heated at 150 °C for 5 min. This novel investigated DA material exhibits favourable processing characteristics for FRP composites as preliminary studies have shown successful coextrution with reinforcing fibres to form free standing films and dry fibre impregnation.

  8. American Muslim perceptions of healing: key agents in healing, and their roles.

    Science.gov (United States)

    Padela, Aasim I; Killawi, Amal; Forman, Jane; DeMonner, Sonya; Heisler, Michele

    2012-06-01

    American Muslims represent a growing and diverse community. Efforts at promoting cultural competence, enhancing cross-cultural communication skills, and improving community health must account for the religio-cultural frame through which American Muslims view healing. Using a community-based participatory research model, we conducted 13 focus groups at area mosques in southeast Michigan to explore American Muslim views on healing and to identify the primary agents, and their roles, within the healing process. Participants shared a God-centric view of healing. Healing was accessed through direct means such as supplication and recitation of the Qur'an, or indirectly through human agents including imams, health care practitioners, family, friends, and community. Human agents served integral roles, influencing spiritual, psychological, and physical health. Additional research into how religiosity, health care systems, and community factors influence health-care-seeking behaviors is warranted.

  9. Relationships that Heal: Beyond the Patient-Healer Dyad in Mayan Therapy.

    Science.gov (United States)

    Berger-González, Mónica; Vides-Porras, Ana; Strauss, Sarah; Heinrich, Michael; Taquirá, Simeón; Krütli, Pius

    2016-01-01

    Biomedicine fosters particular styles of interaction and behaviors, with the therapeutic relationship seen as occurring between a doctor and patient. In contrast, where alternative modalities of healing are practiced, relationships go beyond a dyadic interaction and include wider social networks. In this article, we propose the existence of a 'therapeutic unit' in Maya healing practices in Guatemala that binds healer, wellness seeker, family, and community members, along with the spiritual and natural realms, into a coherent system requiring all of these elements to achieve success. Drawing on interviews with 67 Maya healers, we describe healers' understanding of raxnaq'il nuk'aslemal (well-being), and show how these interactions activate wider networks that play crucial roles during treatments. We highlight how holism is expressed in relationships typical of indigenous healing systems, and how an appreciation of this is important for developing culturally appropriate health care provision systems.

  10. The Healing Species: Animal-Assisted Character Education for Improving Student Behavior

    Directory of Open Access Journals (Sweden)

    Wanda J. Pearson

    2011-03-01

    Full Text Available The Healing Species program aims to reduce disruptive behaviors at school by increasing students’ abilities to avoid conflict when possible and to resolve conflicts peaceably when they occur. The program’s 11 lessons incorporate elements of behavior theory that postulate behavior follows belief. This study hypothesized that 5th and 6th grade students who completed the Healing Species curriculum would show fewer normative beliefs favoring aggression, greater empathy, and fewer disciplinary infractions, than a comparable group of students who did not receive the Healing Species program. Lessons included the participation of rescued dogs to emphasize compassion, empathy, responsibility, and forgiveness. Study results offered evidence of improved overall behavior and specific reductions in violence and aggression.

  11. Pressurized vascular systems for self-healing materials.

    Science.gov (United States)

    Hamilton, A R; Sottos, N R; White, S R

    2012-05-07

    An emerging strategy for creating self-healing materials relies on embedded vascular networks of microchannels to transport reactive fluids to regions of damage. Here we investigate the use of active pumping for the pressurized delivery of a two-part healing system, allowing a small vascular system to deliver large volumes of healing agent. Different pumping strategies are explored to improve the mixing and subsequent polymerization of healing agents in the damage zone. Significant improvements in the number of healing cycles and in the overall healing efficiency are achieved compared with prior passive schemes that use only capillary forces for the delivery of healing agents. At the same time, the volume of the vascular system required to achieve this superior healing performance is significantly reduced. In the best case, nearly full recovery of fracture toughness is attained throughout 15 cycles of damage and healing, with a vascular network constituting just 0.1 vol% of the specimen.

  12. The rhetoric of transformation in ritual healing.

    Science.gov (United States)

    Csordas, T J

    1983-12-01

    The problem of reconciling accounts of religious healing from the points of view of comparative religion and medicine suggests the necessity of an interpretive or hermeneutic approach to the analysis of therapeutic process. This paper, in the context of examining psychotherapeutic ritual among Catholic Pentecostals, formulates an interpretive approach in which healing is conceived as a form of discourse that is both religious and psychiatric. This discourse embodies a cultural rhetoric capable of performing three essential persuasive tasks: to create a predisposition to be healed, to create the experience of spiritual empowerment, and to create the concrete perception of personal transformation. It is shown that this threefold process activates and controls healing processes endogenous to the supplicant in healing, and either redirects the supplicant's attention toward new aspects of his actions and experiences, or alters the manner in which he attends to accustomed aspects of those actions and experiences. The result is the creation of both a new phenomenological world, and new self-meaning for the supplicant as a whole and holy person.

  13. Physics of Wound Healing I: Energy Considerations

    CERN Document Server

    Apell, S Peter; Papazoglou, Elisabeth S; Pizziconi, Vincent

    2012-01-01

    Wound healing is a complex process with many components and interrelated processes on a microscopic level. This paper addresses a macroscopic view on wound healing based on an energy conservation argument coupled with a general scaling of the metabolic rate with body mass M as M^{\\gamma} where 0 <{\\gamma}<1. Our three main findings are 1) the wound healing rate peaks at a value determined by {\\gamma} alone, suggesting a concept of wound acceleration to monitor the status of a wound. 2) We find that the time-scale for wound healing is a factor 1/(1 -{\\gamma}) longer than the average internal timescale for producing new material filling the wound cavity in corresondence with that it usually takes weeks rather than days to heal a wound. 3) The model gives a prediction for the maximum wound mass which can be generated in terms of measurable quantities related to wound status. We compare our model predictions to experimental results for a range of different wound conditions (healthy, lean, diabetic and obses...

  14. Non-healing wounds: the geriatric approach.

    Science.gov (United States)

    Jaul, Efraim

    2009-01-01

    The most common types of non-healing wounds are four types: pressure ulcers, diabetic ulcers, ischemic ulcers and venous ulcers. Many of those wounds develop among the elderly, becoming non-healing to the extent that the patient may live with them all of his life, or even die because of them. Not enough attention is paid to the underlying contributing problems specific to the elderly patient. Those factors are physiologic (aging skin, immune state and atherosclerosis) and pathologic situation (diabetic disease, ischemia of leg). Therefore, the geriatric approach to a non-healing wound is comprehensive and multidisciplinary. Those including: patient's co-morbidities, functional state as measured by the activities of daily living (ADL) scale, nutritional status, social support, ethical beliefs and quality of life and not only the wound itself. Each discipline (the nursing staff, physician, dietitian, occupational, physical therapists and social worker) has its own task in preventing and treating such wounds. The ultimate goal therefore has been altered from healing of the wounds to symptom control, prevention of complications and to contribute to the patient's overall wellbeing. This review discusses all those items in a geriatric point of view, and how to deal with the non-healing wounds as a geriatric syndrome.

  15. Mechanoregulation of Wound Healing and Skin Homeostasis

    Directory of Open Access Journals (Sweden)

    Joanna Rosińczuk

    2016-01-01

    Full Text Available Basic and clinical studies on mechanobiology of cells and tissues point to the importance of mechanical forces in the process of skin regeneration and wound healing. These studies result in the development of new therapies that use mechanical force which supports effective healing. A better understanding of mechanobiology will make it possible to develop biomaterials with appropriate physical and chemical properties used to treat poorly healing wounds. In addition, it will make it possible to design devices precisely controlling wound mechanics and to individualize a therapy depending on the type, size, and anatomical location of the wound in specific patients, which will increase the clinical efficiency of the therapy. Linking mechanobiology with the science of biomaterials and nanotechnology will enable in the near future precise interference in abnormal cell signaling responsible for the proliferation, differentiation, cell death, and restoration of the biological balance. The objective of this study is to point to the importance of mechanobiology in regeneration of skin damage and wound healing. The study describes the influence of rigidity of extracellular matrix and special restrictions on cell physiology. The study also defines how and what mechanical changes influence tissue regeneration and wound healing. The influence of mechanical signals in the process of proliferation, differentiation, and skin regeneration is tagged in the study.

  16. Influence of different energy densities of laser phototherapy on oral wound healing

    Science.gov (United States)

    Wagner, Vivian Petersen; Meurer, Luise; Martins, Marco Antonio Trevizani; Danilevicz, Chris Krebs; Magnusson, Alessandra Selinger; Marques, Márcia Martins; Filho, Manoel Sant'Ana; Squarize, Cristiane Helena; Martins, Manoela Domingues

    2013-12-01

    The aim of the present prospective study was to evaluate the impact of laser phototherapy (LPT) on the healing of oral ulcers. Different power densities were used on oral wounds in Wistar rats (n=72) randomly divided into three groups: control (0 J/cm2), 4 J/cm2 laser, and 20 J/cm2 laser. Ulcers (3 mm in diameter) were made on the dorsum of the tongue with a punch. Irradiation with an indium-gallium-aluminum-phosphide laser (660 nm output power: 40 mW spot size: 0.04 cm) was performed once a day in close contact with the ulcer for 14 consecutive days. A statistically significant acceleration in healing time was found with wounds treated with 4 J/cm2 LPT. Moreover, striking differences were found in the ulcer area, healing percentage, degree of reepithelialization, and collagen deposition. The most significant changes occurred after 5 days of irradiation. Based on the conditions employed in the present study, LPT is capable of accelerating the oral mucosa wound-healing process. Moreover, faster and more organized reepithelialization and tissue healing of the oral mucosa were achieved with an energy density of 4 J/cm2 in comparison to 20 J/cm2.

  17. A novel rodent excision model for ischemia-impaired wound healing.

    Science.gov (United States)

    Hofmann, Anna Theresa; Neumann, Sabine; Ferguson, James Crawford; Redl, Heinz; Mittermayr, Rainer

    2017-10-05

    Delayed wound healing and the potentially resulting chronic wounds are a challenging clinical problem. Available therapeutic strategies are limited in both number and efficacy. For developing and establishing novel treatment approaches appropriate clinical relevant animal models are essential. The aim of the study was to establish a reliable and reproducible delayed wound healing model which simulates the clinical scenario of compromised vascular tissue perfusion (hypoxia/ischemia). Therefore a standard rodent ischemic flap model was modified by challenging the tissue with ascending degrees of ischemia using different surgical approaches (minimal, mild, moderate and severe ischemic invasive approach). Then a full-thickness circular wound was excised in both the non-/hypoperfused flap area and in the normally perfused contralateral region serving as an internal control. Wound healing progress was compared. Superficial tissue perfusion was measured by Laser Doppler imaging technique, which showed persistent ischemia in the moderate and severe invasive surgical approaches 7 days after wounding. Wound closure assessed by planimetric analysis occurred significantly slower in the ischemic wounds as compared to the contralateral non-ischemic wounds. Histologic evaluations showed signs of tissue necrosis and impaired angiogenesis in the ischemic wounds. Therefore, it can be concluded that this clinically relevant animal model is suitable to study mechanism in ischemia-impaired wound healing. Furthermore, it allows evaluating the efficacy of therapeutic strategies for impaired wound healing and comparing the results with an internal control wound.

  18. Monitoring wound healing by multiphoton tomography/endoscopy

    Science.gov (United States)

    König, Karsten; Weinigel, Martin; Bückle, Rainer; Kaatz, Martin; Hipler, Christina; Zens, Katharina; Schneider, Stefan W.; Huck, Volker

    2015-02-01

    Certified clinical multiphoton tomographs are employed to perform rapid label-free high-resolution in vivo histology. Novel tomographs include a flexible 360° scan head attached to a mechano-optical arm for autofluorescence and SHG imaging as well as rigid two-photon GRIN microendoscope. Mitochondrial fluorescent NAD(P)H, fluorescent elastin, keratin, and melanin as well as SHG-active collagen can be imaged with submicron resolution in human skin. The system was employed to study the healing of chronic wounds (venous leg ulcer) and acute wounds (curettage of actinic or seborrheic keratosis) on a subcellular level. Furthermore, a flexible sterile foil as interface between wound and focusing optic was tested.

  19. A randomized, comparative study of three doses of AZD0865 and esomeprazole for healing of reflux esophagitis

    DEFF Research Database (Denmark)

    Kahrilas, Peter J; Dent, John; Lauritsen, Karsten

    2007-01-01

    BACKGROUND & AIMS: AZD0865 belongs to a new class of acid-suppressing agents with rapid onset of action and potent acid inhibition. We evaluated its effectiveness for healing reflux esophagitis. METHODS: One thousand five hundred twenty-one patients with Los Angeles A-D esophagitis and heartburn ...

  20. Multiple self-healing squamous epithelioma is caused by a disease-specific spectrum of mutations in TGFBR1

    DEFF Research Database (Denmark)

    Goudie, David R; D'Alessandro, Mariella; Merriman, Barry

    2011-01-01

    Multiple self-healing squamous epithelioma (MSSE), also known as Ferguson-Smith disease (FSD), is an autosomal-dominant skin cancer condition characterized by multiple squamous-carcinoma-like locally invasive skin tumors that grow rapidly for a few weeks before spontaneously regressing, leaving s...

  1. An Analytical Model for the Probability Characteristics of a Crack Hitting an Encapsulated Self-healing Agent in Concrete

    Science.gov (United States)

    Zemskov, Serguey V.; Jonkers, Henk M.; Vermolen, Fred J.

    The present study is performed in the framework of the investigation of the potential of bacteria to act as a catalyst of the self-healing process in concrete, i.e. their ability to repair occurring cracks autonomously. Spherical clay capsules containing the healing agent (calcium lactate) are embedded in the concrete structure. Water entering a freshly formed crack releases the healing agent and activates the bacteria which will seal the crack through the process of metabolically mediated calcium carbonate precipitation. In the paper, an analytic formalism is developed for the computation of the probability that a crack hits an encapsulated particle, i.e. the probability that the self-healing process starts. Most computations are performed in closed algebraic form in the computer algebra system Mathematica which allows to perform the last step of calculations numerically with a higher accuracy.

  2. Dietary strategies to optimize wound healing after periodontal and dental implant surgery: an evidence-based review.

    Science.gov (United States)

    Lau, Beatrice Y; Johnston, Bryan D; Fritz, Peter C; Ward, Wendy E

    2013-01-01

    Methods to optimize healing through dietary strategies present an attractive option for patients, such that healing from delicate oral surgeries occurs as optimally as possible with minimal patient-meditated complications through improper food choices. This review discusses findings from studies that have investigated the role of diet, either whole foods or individual dietary components, on periodontal health and their potential role in wound healing after periodontal surgery. To date, research in this area has largely focused on foods or individual dietary components that may attenuate inflammation or oxidant stress, or foster de novo bone formation. These studies suggest that a wide variety of dietary components, including macronutrients and micronutrients, are integral for optimal periodontal health and have the potential to accelerate oral wound healing after periodontal procedures. Moreover, this review provides guidance regarding dietary considerations that may help a patient achieve the best possible outcome after a periodontal procedure.

  3. Healing of cysteamine-induced duodenal ulcers in the rat

    DEFF Research Database (Denmark)

    Poulsen, Steen Seier

    1985-01-01

    by formation of new mucosa from the epithelium of the remaining parts of the crypts of Lieberkühn. The mucosa became completely normal within 15 days. Ulcers healed primarily by a contraction of the circular layer of the external muscle coat, thereby approaching the ulcer edges and reestablishing a complete...... of these therefore determined the healing of the ulcer. Only a few of these ulcers had healed after 50 days. After 100 and 150 days, approximately 50% had healed, and after 200 days still only 64% had healed. Thus the cysteamine ulcer with destroyed muscle coat has a very prolonged healing and thereby represents...

  4. Evaluation healing of jejunal anastomosis in preoperative dexamethasone treated dogs

    Directory of Open Access Journals (Sweden)

    A.S. Al-Qadhi

    2015-06-01

    Full Text Available The objective of this study is to evaluate the healing process of jejunal anastomosis by the aid of histopathology and measurement of bursting pressure of anastomosis site in thirty two adult preoperatively with dexamethasone. The animals were randomly divided into 2 equal groups: Group 1: consists of 16 dogs underwent apposition end-to-end jejunal anastomosis using simple interrupted suture technique which in turn divided into 2 subgroups: subgroup A: consists of 8 dogs treated preoperatively for 15 days with dexamethasone at a dose of (0.2mg/kg given I/M. Subgroup B: control group consists of 8 dogs not treated with dexamethasone. Group 2: consists of 16 dogs underwent inverted end-to-end jejunal anastomosis using continuous Lembert suture pattern that also divided into 2 subgroups: subgroup A: consists of 8 dogs treated preoperatively for 15 days with dexamethasone at a dose of (0.2mg/kg given I/M. subgroup B: control group consists of 8 dogs not treated with dexamethasone. The result of bursting pressure measurement showed higher tensile strength in the control groups (445±9.6 in comparison with the steroidal groups (255±25.3 for both techniques. The histopathological study showed that the healing was good in all groups but the rupture that occur due to shedding the pressure lead to non discrimination between which is better in terms of healing. Massonʼs trichrome showed that collagen content of subgroups taking dexamethasone was lower than that of subgroups not treated with dexamethasone.

  5. Self-healing flexible photonic composites for light sources

    Science.gov (United States)

    Mikhael, Michael; Yializis, Angelo; Jabbour, Ghassan E.; Johnson, Steve G.; Kerr, John B.

    2003-03-01

    Besides display application, organic light emitting diodes (OLED) have great potential for the application of thin film light sources. The new device is designed to have a self-healing mechanism against electrical shorts. The entire device can be prepared in a vacuum chamber equipped with plasma treater, monomer evaporators, radiation curing units and inorganic deposition stations. A blend of small electron-donor organic molecules and radiation polymerizable monomers is flash evaporated to provide a molecular-level vapor-phase mixture, which is then condensed and cured on a flexible ITO coated substrate. The procedure is repeated with an electron-acceptor organic substance, which is deposited over the electron-donor layer. A metallic cathode is then deposited over the electron-acceptor layer and the composite OLED product is packaged. The flash evaporation vacuum deposition technique with in-line radiation cross-linking allows the mixing of small OLED molecules with monomers or oligomers at any ratio. Using this technique, a heterogeneous blend can be flash evaporated and molecularly mixed in the vapor phase, re-condensed as a homogeneous film, and then quickly cross-linked before any phase separation occurs. This creates a unique polymer chemistry that is not possible by conventional coating techniques. The electrical characteristics and the thickness of the metallic cathode and the composition of the polymer layers are selected to produce a self-healing mechanism via gasification of elemental carbon generated by dielectric breakdowns and the oxidation of any exposed cathodic surface, thereby providing a self-healing mechanism to prevent propagation of the damage caused by electrical shorts.

  6. UV-Triggered Self-Healing of a Single Robust SiO2 Microcapsule Based on Cationic Polymerization for Potential Application in Aerospace Coatings.

    Science.gov (United States)

    Guo, Wanchun; Jia, Yin; Tian, Kesong; Xu, Zhaopeng; Jiao, Jiao; Li, Ruifei; Wu, Yuehao; Cao, Ling; Wang, Haiyan

    2016-08-17

    UV-triggered self-healing of single microcapsules has been a good candidate to enhance the life of polymer-based aerospace coatings because of its rapid healing process and healing chemistry based on an accurate stoichiometric ratio. However, free radical photoinitiators used in single microcapsules commonly suffer from possible deactivation due to the presence of oxygen in the space environment. Moreover, entrapment of polymeric microcapsules into coatings often involves elevated temperature or a strong solvent, probably leading to swelling or degradation of polymer shell, and ultimately the loss of active healing species into the host matrix. We herein describe the first single robust SiO2 microcapsule self-healing system based on UV-triggered cationic polymerization for potential application in aerospace coatings. On the basis of the similarity of solubility parameters of the active healing species and the SiO2 precursor, the epoxy resin and cationic photoinitiator are successfully encapsulated into a single SiO2 microcapsule via a combined interfacial/in situ polymerization. The single SiO2 microcapsule shows solvent resistance and thermal stability, especially a strong resistance for thermal cycling in a simulated space environment. In addition, the up to 89% curing efficiency of the epoxy resin in 30 min, and the obvious filling of scratches in the epoxy matrix demonstrate the excellent UV-induced healing performance of SiO2 microcapsules, attributed to a high load of healing species within the capsule (up to 87 wt %) and healing chemistry based on an accurate stoichiometric ratio of the photoinitiator and epoxy resin at 9/100. More importantly, healing chemistry based on a UV-triggered cationic polymerization mechanism is not sensitive to oxygen, extremely facilitating future embedment of this single SiO2 microcapsule in spacecraft coatings to achieve self-healing in a space environment with abundant UV radiation and oxygen.

  7. Bioactive thermoresponsive polyblend nanofiber formulations for wound healing

    Energy Technology Data Exchange (ETDEWEB)

    Pawar, Mahesh D. [Polymer Science and Engineering, National Chemical Laboratory, Homi Bhabha Road, Pashan, Pune 411008 (India); MAEER' s Maharashtra Institute of Pharmacy S. No. 124, MIT Campus Paud Road, Kothrud, Pune 411 038 (India); Rathna, G.V.N., E-mail: rv.gundloori@ncl.res.in [Polymer Science and Engineering, National Chemical Laboratory, Homi Bhabha Road, Pashan, Pune 411008 (India); Agrawal, Shubhang [Polymer Science and Engineering, National Chemical Laboratory, Homi Bhabha Road, Pashan, Pune 411008 (India); Kuchekar, Bhanudas S. [MAEER' s Maharashtra Institute of Pharmacy S. No. 124, MIT Campus Paud Road, Kothrud, Pune 411 038 (India)

    2015-03-01

    The rationale of this work is to develop new bioactive thermoresponsive polyblend nanofiber formulations for wound healing (topical). Various polymer compositions of thermoresponsive, poly(N-isopropylacrylamide), egg albumen and poly(ε-caprolactone) blend solutions with and without a drug [gatifloxacin hydrochloride, Gati] were prepared. Non-woven nanofibers of various compositions were fabricated using an electrospinning technique. The morphology of the nanofibers was analyzed by an environmental scanning electron microscope. The morphology was influenced by the concentration of polymer, drug, and polymer blend composition. Fourier transform infrared spectroscopy analysis showed the shift in bands due to hydrogen ion interactions between polymers and drug. Thermogram of PNIPAM/PCL/EA with Gati recorded a shift in lower critical solution temperature (LCST) and glass transition temperature (T{sub g}) of PNIPAM. Similarly T{sub g} and melting temperature (T{sub m}) of PCL were shifted. X-ray diffraction patterns recorded a decrease in the crystalline state of PCL nanofibers and transformed crystalline drug to an amorphous state. In vitro release study of nanofibers with Gati showed initial rapid release up to 10 h, followed by slow and controlled release for 696 h (29 days). Nanofiber mats with Gati exhibited antibacterial properties to Staphylococcus aureus, supported suitable controlled drug release with in vitro cell viability and in vivo wound healing. - Highlights: • Thermoresponsive and bioactive nanofiber blends of PNIPAM/EA/PCL were fabricated. • Nanofiber blends favored initial rapid release, followed by controlled release. • In vitro cell viability of pure polymers and nanofiber blends was least toxic. • In vivo studies of drug loaded nanofiber mats recorded faster tissue regeneration.

  8. Towards electrically conductive, self-healing materials.

    Science.gov (United States)

    Williams, Kyle A; Boydston, Andrew J; Bielawski, Christopher W

    2007-04-22

    A novel class of organometallic polymers comprising N-heterocyclic carbenes and transition metals was shown to have potential as an electrically conductive, self-healing material. These polymers were found to exhibit conductivities of the order of 10(-3) S cm-1 and showed structurally dynamic characteristics in the solid-state. Thin films of these materials were cast onto silicon wafers, then scored and imaged using a scanning electron microscopy (SEM). The scored films were subsequently healed via thermal treatment, which enabled the material to flow via a unique depolymerization process, as determined by SEM and surface profilometry. A method for incorporating these features into a device that exhibits electrically driven, self-healing functions is proposed.

  9. Dynamics of bone graft healing around implants

    Directory of Open Access Journals (Sweden)

    Narayan Venkataraman

    2015-01-01

    A few questions arise pertaining to the use of bone grafts along with implants are whether these are successful in approximation with implant. Do they accelerate bone regeneration? Are all defects ultimately regenerated with new viable bone? Is the bone graft completely resorbed or integrated in new bone? Does the implant surface characteristic positively affect osseointegration when used with a bone graft? What type of graft and implant surface can be used that will have a positive effect on the healing type and time? Finally, what are the dynamics of bone graft healing around an implant? This review discusses the cellular and molecular mechanisms of bone graft healing in general and in vicinity of another foreign, avascular body, namely the implant surface, and further, the role of bone grafts in osseointegration and/or clinical success of the implants.

  10. Regulation of regenerative periodontal healing by NAMPT.

    Science.gov (United States)

    Nokhbehsaim, Marjan; Keser, Sema; Jäger, Andreas; Jepsen, Søren; Deschner, James

    2013-01-01

    Periodontitis is an inflammatory disease characterized by destruction of the tooth-supporting tissues. Obese individuals have an increased risk of periodontitis, and elevated circulating levels of nicotinamide phosphoribosyltransferase (NAMPT) may be a pathomechanistic link between both diseases. Recently, increased levels of NAMPT have also been found in patients with periodontitis, irrespective of the presence of obesity. This in vitro study sought to examine the effects of NAMPT on the regenerative capacity of human periodontal ligament (PDL) cells and, thereby, periodontal healing. PDL cells treated with enamel matrix derivative (EMD), which was used to mimic regenerative healing conditions in vitro, were grown in the presence and absence of NAMPT for up to 14 d. EMD stimulated significantly (P periodontal regeneration are counteracted by NAMPT. Enhanced levels of NAMPT, as found in obesity and periodontal inflammation, may compromise the regenerative capacity of PDL cells and, thereby, periodontal healing in the presence of EMD.

  11. SUFI HEALING: TERAPI DALAM LITERATUR TASAWUF

    Directory of Open Access Journals (Sweden)

    Muhammad Amin Syukur

    2012-12-01

    Kajian ini mengungkap tentang sufi healing, yaitu terapi di dalam literatur tentang sifisme. Kajian ini memfokuskan pada perilaku yang berasosiasi dengan sufi healing atau pencegahan penyakit, baik secara fisik maupun mental, dan kemudian menentukan aspek-aspek yang mendukung sistem terapi rasional dan empirik. Hasil yang diperoleh dari kajian ini adalah penemuan treatment alternatif atau preventif terhadap penyakit secara tepat yang sesuai dengan tuntutan masyarakat saat ini. Ditemukan bahwa sufi healing merupakan bentuk terapi alternatif yang dilakukan dengan menggunakan nilai-nilai sufisme se­bagai cara treatment atau pencegahan. Model ini telah dikenal dalam ma­syarakat sejak Islam dan sufisme berkembang. Rujukan ilmiah dari mengenai sistem kerja peng­obatan­nya dapat ditemukan dalam berbagai teori psikologi transpersonal, di mana kesadaran menjadi fokus kajian. Secara medis, pengobatan ini juga disebut psycho-neurons-endocrine-immunology, yang kesimpulannya adalah adanya hubungan antara fikiran dan tubuh dalam kesehatan manusia,

  12. Multiple Primary Cancers: Simultaneously Occurring Prostate ...

    African Journals Online (AJOL)

    2016-05-20

    May 20, 2016 ... occurring prostate cancer and other primary tumors-our experience and ... tweak, and build upon the work non-commercially, as long as the author is credited ..... Seretis C, Seretis F, Liakos N. Multidisciplinary approach to.

  13. Enhanced Cutaneous Wound Healing In Vivo by Standardized Crude Extract of Poincianella pluviosa.

    Directory of Open Access Journals (Sweden)

    Fernanda Giacomini Bueno

    Full Text Available Wound healing is a complex process that involves several biological events, and a delay in this process may cause economic and social problems for the patient. The search continues for new alternative treatments to aid healing, including the use of herbal medicines. Members of the genus Caesalpinia are used in traditional medicine to treat wounds. The related species Poincianella pluviosa (DC. L.P. Queiroz increases the cell viability of keratinocytes and fibroblasts and stimulates the proliferation of keratinocytes in vitro. The crude extract (CE from bark of P. pluviosa was evaluated in the wound-healing process in vivo, to validate the traditional use and the in vitro activity. Standardized CE was incorporated into a gel and applied on cutaneous wounds (TCEG and compared with the formulation without CE (Control for 4, 7, 10, or 14 days of treatment. The effects of the CE on wound re-epithelialization; cell proliferation; permeation, using photoacoustic spectroscopy (PAS; and proteins, including vascular endothelial growth factor (VEGF, superoxide dismutase 2 (SOD-2 and cyclooxygenase 2 (COX-2 were evaluated. The TCEG stimulated the migration of keratinocytes at day 4 and proliferation on the following days, with a high concentration of cells in metaphase at 7 days. Type I collagen formed more rapidly in the TCEG. PAS showed that the CE had permeated through the skin. TCEG stimulated VEGF at day 4 and SOD-2 and COX-2 at day 7. The results suggest that the CE promoted the regulation of proteins and helped to accelerate the processes involved in healing, promoting early angiogenesis. This led to an increase in the re-epithelialized surface, with significant mitotic activity. Maturation of collagen fibers was also enhanced, which may affect the resistance of the extracellular matrix. PAS indicated a correlation between the rate of diffusion and biological events during the healing process. The CE from P. pluviosa appears promising as an aid in

  14. Promotion of oral surgical wound healing using autologous mucosal cell sheets.

    Science.gov (United States)

    Roh, Jong-Lyel; Jang, Hyejin; Lee, Jaewang; Kim, Eun Hye; Shin, Daiha

    2017-06-01

    Severe oral mucosal and tissue defects can lead to pain, infection, and later undesirable healing of scarring and adhesion, resulting in a poor quality of life. In vitro-engineered oral mucosal equivalents for covering such defects are an alternative to avoiding the donor site morbidity of conventional skin or tissue grafts. We examined the efficacy of our newly developed three-dimensional mucosal cell sheets in an in vivo tongue wound model mimicking the surgical extirpation of tongue cancer. Small oral mucosal and autologous fibrin samples were obtained from surgical patients and Sprague-Dawley rats. The fibrin was mixed with fibroblasts and seeded with keratinocytes that had been primarily cultured for in vitro cell expansion. The three-dimensional autologous cell sheets, cultured in air-lift interface inserts, were transplanted into deep wounds of the rat ventral tongue. Gross and microscopic findings of the postsurgical wounds were compared between wound control and cell sheet groups. The cell sheets were flexible, expandable, and easy to transfer, and had histological characteristics similar to that of the normal oral mucosa, with high p63 positivity. They promoted oral wound healing with earlier re-epithelialization and less fibrosis than that in the wound control. The cell sheet-healed tongue had similar histology to that of a normal tongue. Our engineered cell sheets have potential applicability for the rapid healing of oral mucosal and soft tissue defects, without scarring, adhesion, and functional deficits. The efficacy of in vitro-engineered mucosal equivalents, using completely autologous mucosa and plasma, was examined. Transplantation of the autologous cell sheets into deep wounds of the rat ventral tongue promoted oral wound healing with earlier re-epithelialization and less fibrosis than that in controls. Healed and normal tongues showed similar histology. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Exploring Inpatients' Experiences of Healing and Healing Spaces: A Mixed Methods Study.

    Science.gov (United States)

    MacAllister, Lorissa; Bellanti, Dawn; Sakallaris, Bonnie R

    2016-12-01

    In order to understand a patient's healing experience it is essential to understand the elements that they, the patient, believes contributed to their healing. Previous research has focused on symptom reducers or contributors through environment such as stress. A person's experience of healing happens over time not instantaneous. Therefore, in this study, the interviews with patients happened after forty-eight hours of hospitalization. This mixed methods study describes the experiences of seventeen inpatients from two healthcare systems using a phenomenological approach combined with evidence based design evaluation methods to document the setting. The qualitative data was analyzed first for reoccurring themes then further explored and defined through quantitative environmental observations. The seventeen patients defined healing as "getting better/well." Seventy three statements were recorded about contributors and detractors to healing in the physical environment. Three primary themes emerged from the data as positive influencers of a healing experience: being cared for, being comfortable and experiencing something familiar or like home. These results demonstrate that patients perceive their inpatient healing experience through a supported environment.

  16. Esomeprazole Versus Pantoprazole for Healing Erosive Oesophagitis

    OpenAIRE

    Včev, Aleksandar; Begić, Ivana; Ostojić, Rajko; Jurčić, Dragan; Božić, Dubravko; Soldo, Ivan; Gmajnić, Rudika; Kondža, Goran; Khaznadar, Eyad; Mićunović, Nikola

    2006-01-01

    The aim of this study was to compare the efficacy of esomeprazole and pantoprazole with regard to healing and relief from gastroesophageal reflux disease-related symptoms. I this multicentre, randomized, single-blind study 180 patients (ITT population) diagnosed with endoscopically proven GERD grade A,B,C received esomeprazole (40 mg once daily (o.d.), n=90) or pantoprazole (40 mg o.d., n=90). Healing and relief from GERD-related symptoms were assessed at first and final visit (af...

  17. Periodontal wound healing following GTR therapy of dehiscence-type defects in the monkey: short-, medium- and long-term healing.

    Science.gov (United States)

    Graziani, Filippo; Laurell, Lars; Tonetti, Maurizio; Gottlow, Jan; Berglundh, Tord

    2005-08-01

    To describe periodontal wound healing in dehiscence-type defects following guided tissue re-generation (GTR) therapy. Ten adult Macaca fascicularis monkeys were used. Buccal dehiscence-type defects were created at the maxillary second pre-molars and second molars. After 3 months, GTR surgery was performed. The animals were euthanized at 6 weeks, 6 months and 2 years after surgery. Block biopsies were harvested, and prepared for histological analysis. A new attachment apparatus was structured already after 6 weeks of healing. A 10-20 microm thin layer of acellular extrinsic fibre cementum (AEFC) had formed along the instrumented root surface. At 6 months, the thickness of the supracrestal cementum was comparable with that at 6 weeks, while the thickness of the subcrestal cementum had increased to 40-60 microm. In this zone, the cementum consisted of an inner layer of AEFC attached to the circum-pulpal dentin and an outer layer of cellular mixed fibre cementum (CMFC). The numerical extrinsic fibre density was twice that at 6 weeks. At 2 years, the periodontal tissues resembled the pristine periodontium. Periodontal healing following GTR therapy of recession-type defects will result in a restitutio ad integrum, i.e. healing by re-generation. A continuous maturation process occurs over at least 2 years.

  18. Fatigue life extension of epoxy materials using ultrafast epoxy-SbF5 healing system introduced by manual infiltration

    Directory of Open Access Journals (Sweden)

    X. J. Ye

    2015-03-01

    Full Text Available The present paper is devoted to the verification of the capability of epoxy-SbF5 system as a healing chemistry for rapidly retarding and/or arresting fatigue cracks in epoxy materials at room temperature. Owing to the very fast curing speed of epoxy catalyzed by SbF5, epoxy monomer and the hardener (ethanol solution of SbF5–ethanol complex are successively infiltrated into the fracture plane under cyclic loading during the tension-tension fatigue test. As a result, the mechanisms including hydrodynamic pressure crack tip shielding, polymeric wedge and adhesive bonding of the healing agent are revealed. It is found that the healing agent forms solidified wedge at the crack tip within 20 s after start of polymerization of the epoxy monomer, so that the highest healing effect is offered at the moment. The epoxy-SbF5 system proves to be effective in rapidly obstructing fatigue crack propagation (despite that its cured version has lower fracture toughness than the matrix, and satisfies the requirement of constructing fast self-healing polymeric materials.

  19. Reorganizational healing: a paradigm for the advancement of wellness, behavior change, holistic practice, and healing.

    Science.gov (United States)

    Epstein, Donald M; Senzon, Simon A; Lemberger, Daniel

    2009-05-01

    Reorganizational Healing, (ROH), is an emerging wellness, growth and behavioral change paradigm. Through its three central elements (the Four Seasons of Wellbeing, the Triad of Change, and the Five Energetic Intelligences) Reorganizational Healing takes an approach to help create a map for individuals to self-assess and draw on strengths to create sustainable change. Reorganizational Healing gives individuals concrete tools to explore and use the meanings of their symptoms, problems, and life-stressors as catalysts to taking new and sustained action to create a more fulfilling and resilient life.

  20. Modeled Microgravity Affects Fibroblast Functions Related to Wound Healing

    Science.gov (United States)

    Cialdai, Francesca; Vignali, Leonardo; Morbidelli, Lucia; Colciago, Alessandra; Celotti, Fabio; Santi, Alice; Caselli, Anna; Cirri, Paolo; Monici, Monica

    2017-02-01

    Wound healing is crucial for the survival of an organism. Therefore, in the perspective of space exploration missions, it is important to understand if and how microgravity conditions affect the behavior of the cell populations involved in wound healing and the evolution of the process. Since fibroblasts are the major players in tissue repair, this study was focused on the behavior of fibroblasts in microgravity conditions, modeled by a RCCS. Cell cytoskeleton was studied by immunofluorescence microscopy, the ability to migrate was assessed by microchemotaxis and scratch assay, and the expression of markers of fibroblast activation, angiogenesis, and inflammation was assessed by western blot. Results revealed that after cell exposure to modeled microgravity conditions, a thorough rearrangement of microtubules occurred and α-SMA bundles were replaced by a tight network of faulty and disorganized filaments. Exposure to modeled microgravity induced a decrease in α-SMA and E-CAD expressions. Also, the expression of the pro-angiogenic protein VEGF decreased, while that of the inflammatory signal COX-2 increased. Fibroblast ability to adhere, migrate, and respond to chemoattractants (PRP), closely related to cytoskeleton integrity and membrane junctions, was significantly impaired. Nevertheless, PRP was able to partially restore fibroblast migration.

  1. Development of self-healing polymer composites and photoinduced ring-opening metathesis polymerization

    Science.gov (United States)

    Sriram, Suresh Ranganathan

    The design and development of "smart-materials" which are capable of assessing their internal damage and perform self-healing is described. Failure of a material occurs by the induction of cracks. Often cracks are formed deep within the structure where detection is difficult and repair is virtually impossible. Once cracks have formed within polymeric materials, the integrity of the structure is compromised. A composite material can be repaired and its lifetime enhanced by relieving stress concentrations surrounding the crack tip. This thesis reports the novel development of a structural polymeric material with the ability to self-heal cracks by the application of ring opening metathesis polymerization. Self-healing is accomplished by incorporating a microencapsulated healing agent and a catalytic chemical trigger within an epoxy matrix. When the material is damaged, the microcapsules rupture and release the healing agent into the damaged region through capillary action. As the healing agent contacts the catalyst, polymerization is initiated and the damage is repaired. Ring opening metathesis polymerization (ROMP) has been applied towards the development of a self-healing polymer composite. Grubbs' catalyst is embedded in the matrix as a solid and dicyclopentadiene is employed as the healing agent within the microcapsules. Chemical and micromechanical experiments have been performed that illustrate the ROMP based self-healing concept. Experiments on fracture specimens have yielded as much as 75% recovery of virgin toughness. In addition, the development and utility of these easily accessible ruthenium precatalyst, [(p-cymene)RuCl2]2 and tricyclohexylphosphine in performing Photoinduced Ring Opening Metathesis Polymerization (PROMP) is demonstrated. Polymerization of norbornene and dicyclopentadiene has been performed, showing the simplicity and ease of this procedure. The resulting poly(norbornene) shows high trans content (85%) of the ring opened double bonds

  2. Clinical investigation into the observation that silicon carbide coating on cobalt chromium stents leads to early differentiating functional endothelial layer, increased safety and DES-like recurrent stenosis rates: results of the PRO-Heal Registry (PRO-Kinetic enhancing rapid in-stent endothelialisation).

    Science.gov (United States)

    Dahm, Johannes B; Willems, Tine; Wolpers, Hans Georg; Nordbeck, Hans; Becker, Jürgen; Ruppert, Jörg

    2009-01-01

    Recurrent stenosis and stent thrombosis are still major concerns after drug eluting stent placement which inhibits not only the restenostic process but endothelialisation as well. In contrast, through accelerating rapid endothelialisation and development of an earlier functional endothelial layer, passive coatings have shown encouraging results. The objective of the present study was to investigate the clinical outcome and rate of recurrent stenosis of silicon carbide passive coated cobalt chromium stents (PROKinetic Coronary Stent with PROBIO coating, Biotronik AG, Switzerland) on restenosis after percutaneous coronary intervention. Percutaneous coronary stent deployment was carried out in 161 lesions in 145 consecutive patients. The primary combined endpoint was the rate of target-lesion revascularisation (TLR) and late lumen loss; the secondary endpoints were the procedural success and the major adverse cardiac events at 6-months follow-up. Out of 145 patients, 141 were successfully amenable to a silicon carbide coated stent (PRO-Kinetic, Biotronik AG, Switzerland) implantation (97.2% procedural success). At follow-up, the late loss was 0.75 +/- 0.71 mm. (in-stent) respectively 0.79 +/- 0.72 mm (in-segment), TLR was 4.9% and MACE was 5.6%. By augmenting rapid endothelialisation and development of an earlier functional endothelial layer, silicon carbide (PROBIO) as a passive coating on cobalt chromium stents has shown encouraging results relative to success rates, clinical outcome, TLR and late-loss in a cohort of patients with extended coronary artery disease.

  3. Gene expression profiling of cutaneous wound healing

    Directory of Open Access Journals (Sweden)

    Wang Ena

    2007-02-01

    Full Text Available Abstract Background Although the sequence of events leading to wound repair has been described at the cellular and, to a limited extent, at the protein level this process has yet to be fully elucidated. Genome wide transcriptional analysis tools promise to further define the global picture of this complex progression of events. Study Design This study was part of a placebo-controlled double-blind clinical trial in which basal cell carcinomas were treated topically with an immunomodifier – toll-like receptor 7 agonist: imiquimod. The fourteen patients with basal cell carcinoma in the placebo arm of the trial received placebo treatment consisting solely of vehicle cream. A skin punch biopsy was obtained immediately before treatment and at the end of the placebo treatment (after 2, 4 or 8 days. 17.5K cDNA microarrays were utilized to profile the biopsy material. Results Four gene signatures whose expression changed relative to baseline (before wound induction by the pre-treatment biopsy were identified. The largest group was comprised predominantly of inflammatory genes whose expression was increased throughout the study. Two additional signatures were observed which included preferentially pro-inflammatory genes in the early post-treatment biopsies (2 days after pre-treatment biopsies and repair and angiogenesis genes in the later (4 to 8 days biopsies. The fourth and smallest set of genes was down-regulated throughout the study. Early in wound healing the expression of markers of both M1 and M2 macrophages were increased, but later M2 markers predominated. Conclusion The initial response to a cutaneous wound induces powerful transcriptional activation of pro-inflammatory stimuli which may alert the host defense. Subsequently and in the absence of infection, inflammation subsides and it is replaced by angiogenesis and remodeling. Understanding this transition which may be driven by a change from a mixed macrophage population to predominately M2

  4. Mechanism of prion propagation: amyloid growth occurs by monomer addition.

    Directory of Open Access Journals (Sweden)

    Sean R Collins

    2004-10-01

    Full Text Available Abundant nonfibrillar oligomeric intermediates are a common feature of amyloid formation, and these oligomers, rather than the final fibers, have been suggested to be the toxic species in some amyloid diseases. Whether such oligomers are critical intermediates for fiber assembly or form in an alternate, potentially separable pathway, however, remains unclear. Here we study the polymerization of the amyloidogenic yeast prion protein Sup35. Rapid polymerization occurs in the absence of observable intermediates, and both targeted kinetic and direct single-molecule fluorescence measurements indicate that fibers grow by monomer addition. A three-step model (nucleation, monomer addition, and fiber fragmentation accurately accounts for the distinctive kinetic features of amyloid formation, including weak concentration dependence, acceleration by agitation, and sigmoidal shape of the polymerization time course. Thus, amyloid growth can occur by monomer addition in a reaction distinct from and competitive with formation of potentially toxic oligomeric intermediates.

  5. Wire Insulation Incorporating Self-Healing Polymers (WIISP) Project

    Data.gov (United States)

    National Aeronautics and Space Administration — NextGen and Virginia Tech are developing a self-healing material for wire insulation using a class of ionomeric polymers. These ionomers exhibit self-healing...

  6. Chronic Wound Healing: A Review of Current Management and Treatments.

    Science.gov (United States)

    Han, George; Ceilley, Roger

    2017-03-01

    Wound healing is a complex, highly regulated process that is critical in maintaining the barrier function of skin. With numerous disease processes, the cascade of events involved in wound healing can be affected, resulting in chronic, non-healing wounds that subject the patient to significant discomfort and distress while draining the medical system of an enormous amount of resources. The healing of a superficial wound requires many factors to work in concert, and wound dressings and treatments have evolved considerably to address possible barriers to wound healing, ranging from infection to hypoxia. Even optimally, wound tissue never reaches its pre-injured strength and multiple aberrant healing states can result in chronic non-healing wounds. This article will review wound healing physiology and discuss current approaches for treating a wound.

  7. Multiphase design of autonomic self-healing thermoplastic elastomers

    Science.gov (United States)

    Chen, Yulin; Kushner, Aaron M.; Williams, Gregory A.; Guan, Zhibin

    2012-06-01

    The development of polymers that can spontaneously repair themselves after mechanical damage would significantly improve the safety, lifetime, energy efficiency and environmental impact of man-made materials. Most approaches to self-healing materials require the input of external energy, healing agents, solvent or plasticizer. Despite intense research in this area, the synthesis of a stiff material with intrinsic self-healing ability remains a key challenge. Here, we show a design of multiphase supramolecular thermoplastic elastomers that combine high modulus and toughness with spontaneous healing capability. The designed hydrogen-bonding brush polymers self-assemble into a hard-soft microphase-separated system, combining the enhanced stiffness and toughness of nanocomposites with the self-healing capability of dynamic supramolecular assemblies. In contrast to previous self-healing polymers, this new system spontaneously self-heals as a single-component solid material at ambient conditions, without the need for any external stimulus, healing agent, plasticizer or solvent.

  8. Mucopolysaccharides from psyllium involved in wound healing

    NARCIS (Netherlands)

    Westerhof, W.; Das, P. K.; Middelkoop, E.; Verschoor, J.; Storey, L.; Regnier, C.

    2001-01-01

    Mucopolysaccharides derived from the husk of psyllium (Plantago ovata) have properties beneficial for wound cleansing and wound healing. Recent studies indicate that these mucopolysaccharides also limit scar formation. Our in vitro and in vivo studies aimed to investigate the mechanisms involved,

  9. Mechanophores for Self-Healing Applications

    Science.gov (United States)

    2013-09-09

    Healing Applications active species in ROMP. Organometallics, 31 (6), 2476–2481. 59 Tennyson , A.G., Wiggins, K.M., and Bielawski, C.W. (2010) Mechanical... Tennyson , A.G., and Bielawski, C.W. (2011) Selective scission of pyridine-boronium complexes: mechanical generation of brønsted bases and

  10. Practices in Wound Healing Studies of Plants

    Directory of Open Access Journals (Sweden)

    Rupesh Thakur

    2011-01-01

    Full Text Available Wounds are the result of injuries to the skin that disrupt the other soft tissue. Healing of a wound is a complex and protracted process of tissue repair and remodeling in response to injury. Various plant products have been used in treatment of wounds over the years. Wound healing herbal extracts promote blood clotting, fight infection, and accelerate the healing of wounds. Phytoconstituents derived from plants need to be identified and screened for antimicrobial activity for management of wounds. The in vitro assays are useful, quick, and relatively inexpensive. Small animals provide a multitude of model choices for various human wound conditions. The study must be conducted after obtaining approval of the Ethics Committee and according to the guidelines for care and use of animals. The prepared formulations of herbal extract can be evaluated by various physicopharmaceutical parameters. The wound healing efficacies of various herbal extracts have been evaluated in excision, incision, dead space, and burn wound models. In vitro and in vivo assays are stepping stones to well-controlled clinical trials of herbal extracts.

  11. Biomechanics and wound healing in the cornea.

    Science.gov (United States)

    Dupps, William J; Wilson, Steven E

    2006-10-01

    The biomechanical and wound healing properties of the cornea undermine the predictability and stability of refractive surgery and contribute to discrepancies between attempted and achieved visual outcomes after LASIK, surface ablation and other keratorefractive procedures. Furthermore, patients predisposed to biomechanical failure or abnormal wound healing can experience serious complications such as keratectasia or clinically significant corneal haze, and more effective means for the identification of such patients prior to surgery are needed. In this review, we describe the cornea as a complex structural composite material with pronounced anisotropy and heterogeneity, summarize current understanding of major biomechanical and reparative pathways that contribute to the corneal response to laser vision correction, and review the role of these processes in ectasia, intraocular pressure measurement artifact, diffuse lamellar keratitis (DLK) and corneal haze. The current understanding of differences in the corneal response after photorefractive keratectomy (PRK), LASIK and femtosecond-assisted LASIK are reviewed. Surgical and disease models that integrate corneal geometric data, substructural anatomy, elastic and viscoelastic material properties and wound healing behavior have the potential to improve clinical outcomes and minimize complications but depend on the identification of preoperative predictors of biomechanical and wound healing responses in individual patients.

  12. Inhibition of Midkine Augments Osteoporotic Fracture Healing.

    Directory of Open Access Journals (Sweden)

    Melanie Haffner-Luntzer

    Full Text Available The heparin-binding growth and differentiation factor midkine (Mdk is proposed to negatively regulate osteoblast activity and bone formation in the adult skeleton. As Mdk-deficient mice were protected from ovariectomy (OVX-induced bone loss, this factor may also play a role in the pathogenesis of postmenopausal osteoporosis. We have previously demonstrated that Mdk negatively influences bone regeneration during fracture healing. Here, we investigated whether the inhibition of Mdk using an Mdk-antibody (Mdk-Ab improves compromised bone healing in osteoporotic OVX-mice. Using a standardized femur osteotomy model, we demonstrated that Mdk serum levels were significantly enhanced after fracture in both non-OVX and OVX-mice, however, the increase was considerably greater in osteoporotic mice. Systemic treatment with the Mdk-Ab significantly improved bone healing in osteoporotic mice by increasing bone formation in the fracture callus. On the molecular level, we demonstrated that the OVX-induced reduction of the osteoanabolic beta-catenin signaling in the bony callus was abolished by Mdk-Ab treatment. Furthermore, the injection of the Mdk-Ab increased trabecular bone mass in the skeleton of the osteoporotic mice. These results implicate that antagonizing Mdk may be useful for the therapy of osteoporosis and osteoporotic fracture-healing complications.

  13. Angiogenesis in wound healing and tumor metastasis

    NARCIS (Netherlands)

    Ruiter, D. J.; Schlingemann, R. O.; Westphal, J. R.; Denijn, M.; Rietveld, F. J.; de Waal, R. M.

    1993-01-01

    Formation of new blood vessels is essential for several physiological and pathological events, e.g. embryogenesis, wound healing and tumor growth and metastasis. In order to increase the insight into the mechanisms of angiogenesis we have visualized the different components of the microvasculature

  14. Healing of experimentally created defects: a review

    DEFF Research Database (Denmark)

    Aaboe, M; Pinholt, E M; Hjørting-Hansen, E

    1995-01-01

    Within cranio-maxillofacial surgery and orthopedic surgery a bone graft or a bone substitute is required to recontour or assist bony healing in repair of osseous congenital deformities, or in repair of deformity due to trauma or to surgical excision after elimination of osseous disease processes...

  15. Healing the Hidden Wounds of Racial Trauma

    Science.gov (United States)

    Hardy, Kenneth V.

    2013-01-01

    This article examines racial trauma and highlights strategies for healing and transformation to support the disproportionate number of children and youth of color who fail in school and become trapped in the pipelines of treatment, social service, and justice systems. The difficulty in meeting the needs of these children and youth is failing to…

  16. Faith Healing and Womenn's Reproductive Health | Sackey ...

    African Journals Online (AJOL)

    This paper is based on several years of field research on African religious movements, particularly those led by women. It employs in-depth interviews, participant observation, collection of testimonies and case studies. It looks at how faith healing is patronised especially by women as a health delivery option. It suggests that ...

  17. Shock wave therapy in wound healing.

    Science.gov (United States)

    Qureshi, Ali A; Ross, Kimberly M; Ogawa, Rei; Orgill, Dennis P

    2011-12-01

    Recently, shock wave therapy has been investigated as an adjuvant therapy in the treatment of acute and chronic wounds. There are several devices with focused and unfocused shock waves that have been administered to a heterogenous group of wounds. Encouraging preclinical and clinical studies suggest that shock wave therapy may promote wound healing with little or no adverse events, prompting investigations into the mechanism of action and additional clinical trials. The peer-reviewed literature within the past 10 years was studied using an evidence-based approach. Preclinical studies demonstrate that shock wave therapy affects cellular function and leads to the expression of several genes and elaboration of growth factors known to promote wound healing. Limited clinical trials are encouraging for the use of shock wave therapy in the treatment of acute and chronic wounds. Serious complications, including wound infections, bleeding, hematomas, seromas, and petechiae, have not been reported in the largest of these studies. Shock wave therapy is an intriguing physical modality that may play an important role as an adjuvant therapy in wound healing. To date, there is no consensus on which wounds are most likely to benefit from shock wave therapy and what the optimal power, degree of focus, and frequency or number of cycles should be. Well-designed preclinical and clinical studies are necessary to better understand shock wave therapy in wound healing.

  18. The Oneness of Humankind: Healing Racism Today

    Science.gov (United States)

    Davis, Sharon E.

    2010-01-01

    The guiding principle behind the healing of racism is the Oneness of Humankind. This is not an old concept warmed over. It is knowledge about our collective capacity to reach deep into the human spirit and solve the most complex challenges of our time. The compound problem of race and other issues such as poverty only can be resolved with the…

  19. Growing Healing One Garden at a Time.

    Science.gov (United States)

    Ashman, Julann

    2016-01-01

    Evidence exists regarding the effect of horticultural therapy on improving human well-being, including promotion of overall health and quality of life, physical strength, and cardiac function. This article shares how a nurse created a healing garden at Lourdes Hospital, where she works. Resource information about therapeutic gardens is included.

  20. Health Enterprise Architecture Laboratory (HEAL) | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2010-06-03

    Journal articles. Position paper : researching and developing open architectures for national health information systems in developing African countries. Download PDF. Reports. Workshop narrative report : IDRC eHealth Enterprise Architecture Workshop, June 3, 2010. Download PDF. Studies. HEAL: Establishing a Health ...

  1. Histomorphological evaluation of wound healing - Comparison ...

    African Journals Online (AJOL)

    Vernonia amygdalina leaf juice, similar to honey, enhanced fibroblasts recruitment, epithelia cells migration, neovascularization and reduced polymorphonuclear leukocytes (PMNL) infiltration as compared to the NC at the early phase of wound healing (days 3 and 5). Vernonia amygdalina might enhance cutaneous wound ...

  2. Biomechanics and Wound Healing in the Cornea

    Science.gov (United States)

    Dupps, William J.; Wilson, Steven E.

    2009-01-01

    The biomechanical and wound healing properties of the cornea undermine the predictability and stability of refractive surgery and contribute to discrepancies between attempted and achieved visual outcomes after LASIK, surface ablation and other keratorefractive procedures. Furthermore, patients predisposed to biomechanical failure or abnormal wound healing can experience serious complications such as keratectasia or clinically significant corneal haze, and more effective means for the identification of such patients prior to surgery are needed. In this review, we describe the cornea as a complex structural composite material with pronounced anisotropy and heterogeneity, summarize current understanding of major biomechanical and reparative pathways that contribute to the corneal response to laser vision correction, and review the role of these processes in ectasia, intraocular pressure measurement artifact, diffuse lamellar keratitis (DLK) and corneal haze. The current understanding of differences in the corneal response after photorefractive keratectomy (PRK), LASIK and femtosecond-assisted LASIK are reviewed. Surgical and disease models that integrate corneal geometric data, substructural anatomy, elastic and viscoelastic material properties and wound healing behavior have the potential to improve clinical outcomes and minimize complications but depend on the identification of preoperative predictors of biomechanical and wound healing responses in individual patients. PMID:16720023

  3. Anti-inflammatory and Wound- Healing Activities

    African Journals Online (AJOL)

    Erah

    Linn (Apocynaceae) 2: Anti-inflammatory and Wound-. Healing Activities. Indranil Chanda1*, Usha Sarma2, Sanat K Basu3, Mangala Lahkar4 and. Sadhan K Dutta5. 1Girijananda Chowdhury Institute of Pharmaceutical Science, Guwahati, Assam-781017, 2Department of Pathology,. Gauhati Medical College and Hospital, ...

  4. Herbal remedies for mandibular fracture healing.

    Science.gov (United States)

    Mohammad, Shadab; Pal, U S; Pradhan, R; Singh, Nimisha

    2014-01-01

    When a bone is fractured it is usually necessary to employ a mechanical means to reduce and maintain the fragments in position. However, healing of the fracture is governed by biological principles, with which the mechanical measures must be coordinated to the end, such that a satisfactory bony union and restoration of form and function are obtained. We have studied the effect of Cissus quadrangularis (Harjor) and Ocimum sanctum (Tulsi), in the healing of mandibular fractures. A total of 29 cases having a fracture in the body of the mandible were included in the study and divided into three groups. Groups A and B were treated with Ocimum sanctum and Cissus quadrangularis, respectively, and fracture healing was assessed with biochemical markers and the bite force. Group C was the control group. The period of immobilization was the lowest in the Group A followed by Group B. A significant increase in alkaline phosphatase and serum calcium was seen in Group B. The tensile strength in terms of the biting force was the maximum in cases of Group B. We conclude that Cissus quadrangularis and Ocimum sanctum help in fracture healing, and use of such traditional drugs will be a breakthrough in the management and early mobilization of facial fractures.

  5. 'divine healing' in the 'faith movement'

    African Journals Online (AJOL)

    2009-12-10

    Dec 10, 2009 ... more than a 'mind-over-matter' approach, leading people into ... study as well as personal experience through years of active ... Conditions of the body or mind that cause pain, dysfunction or ... with bodily defects visible on their hands, arms, spinal cord, feet .... Healings took place in the Old Testament.

  6. Pastoral counseling as spiritual healing: a credo.

    Science.gov (United States)

    Hopkins, P E

    1999-01-01

    Notes that pastoral counseling is an ancient ministry which brings rich resources to the contemporary efforts to develop wholistic healing. Provides a historical background summary, a sketch of Judeo-Christian tradition, and clinical examples to illustrate ways in which modern explorations in mind/body wellness can be enhanced by including the pastoral counseling project.

  7. A Novel Design of Autonomously Healed Concrete: Towards a Vascular Healing Network

    Directory of Open Access Journals (Sweden)

    Pieter Minnebo

    2017-01-01

    Full Text Available Concrete is prone to crack formation in the tensile zone, which is why steel reinforcement is introduced in these zones. However, small cracks could still arise, which give liquids and gasses access to the reinforcement causing it to corrode. Self-healing concrete repairs and seals these small (300 µm cracks, preventing the development of corrosion. In this study, a vascular system, carrying the healing agent, is developed. It consists of tubes connected to a 3D printed distribution piece. This distribution piece has four outlets that are connected to the tubes and has one inlet, which is accessible from outside. Several materials were considered for the tubes, i.e., polymethylmethacrylate, starch, inorganic phosphate cement and alumina. Three-point-bending and four-point-bending tests proved that self-healing and multiple self-healing is possible with this developed vascular system.

  8. A Novel Design of Autonomously Healed Concrete: Towards a Vascular Healing Network.

    Science.gov (United States)

    Minnebo, Pieter; Thierens, Glenn; De Valck, Glenn; Van Tittelboom, Kim; De Belie, Nele; Van Hemelrijck, Danny; Tsangouri, Eleni

    2017-01-08

    Concrete is prone to crack formation in the tensile zone, which is why steel reinforcement is introduced in these zones. However, small cracks could still arise, which give liquids and gasses access to the reinforcement causing it to corrode. Self-healing concrete repairs and seals these small (300 µm) cracks, preventing the development of corrosion. In this study, a vascular system, carrying the healing agent, is developed. It consists of tubes connected to a 3D printed distribution piece. This distribution piece has four outlets that are connected to the tubes and has one inlet, which is accessible from outside. Several materials were considered for the tubes, i.e., polymethylmethacrylate, starch, inorganic phosphate cement and alumina. Three-point-bending and four-point-bending tests proved that self-healing and multiple self-healing is possible with this developed vascular system.

  9. A Novel Design of Autonomously Healed Concrete: Towards a Vascular Healing Network

    Science.gov (United States)

    Minnebo, Pieter; Thierens, Glenn; De Valck, Glenn; Van Tittelboom, Kim; De Belie, Nele; Van Hemelrijck, Danny; Tsangouri, Eleni

    2017-01-01

    Concrete is prone to crack formation in the tensile zone, which is why steel reinforcement is introduced in these zones. However, small cracks could still arise, which give liquids and gasses access to the reinforcement causing it to corrode. Self-healing concrete repairs and seals these small (300 µm) cracks, preventing the development of corrosion. In this study, a vascular system, carrying the healing agent, is developed. It consists of tubes connected to a 3D printed distribution piece. This distribution piece has four outlets that are connected to the tubes and has one inlet, which is accessible from outside. Several materials were considered for the tubes, i.e., polymethylmethacrylate, starch, inorganic phosphate cement and alumina. Three-point-bending and four-point-bending tests proved that self-healing and multiple self-healing is possible with this developed vascular system. PMID:28772409

  10. Pharmacological Evaluation of Chrozophora tinctoria as Wound Healing Potential in Diabetic Rat’s Model

    Directory of Open Access Journals (Sweden)

    Harikesh Maurya

    2016-01-01

    Full Text Available Objective. The study was designed to evaluate pharmacological potential of hydroalcoholic leaves extract of Chrozophora tinctoria intended for wound healing in diabetic rats’ model. Methods. The method used to evaluate the pharmacological potential of hydroalcoholic leave extract was physical incision rat model. In this model, cutting of the skin and/or other tissues with a sharp blade has been made and the rapid disruption of tissue integrity with minimal collateral damage was observed shortly. Animals used in the study were divided into four groups that consist of six animals in each group. Group I serves as normal control, Group II serves as disease control, Group III was used as standard treatment (Povidone iodine 50 mg/kg b.w., and Group IV was used for test drug (C. tinctoria 50 mg/kg b.w.. Result. The hydroalcoholic leave extract of Chrozophora tinctoria has been significantly observed to heal the wound (98% in diabetic rats within 21 days, while standard drug (Povidone iodine healed the wound about 95% in the same condition. The oral dose (50 mg/kg b.w. of Chrozophora tinctoria was also found to improve the elevated blood glucose level in comparison to disease control group, which increased after the oral administration of Streptozotocin. Conclusion. The Chrozophora tinctoria has significant wound healing potential in the animal having physically damaged tissue in diabetic condition.

  11. Percieved functions of naturally occurring autobiographical memories

    DEFF Research Database (Denmark)

    Treebak, L. S.; Henriksen, J. R.; Lundhus, S.

    2005-01-01

    The main empirical reference on functions of autobiographical memories is still Hyman & Faries (1992) who used the cue-word-method and retrospective judgements. We used diaries to sample naturally occurring autobiographical memories and participants? perceived use of these. Results partly replicate...... a pattern found by Hyman and Faries, suggest self-related functions to be primary, and indicate possible gender differences...

  12. Down Syndrome: Co-Occuring Conditions

    Science.gov (United States)

    ... cells for various reasons. Dental Issues & Down Syndrome Dental care is important for everybody, but people with Down syndrome can have a number of differences that can require special attention. Dual Diagnosis of Down Syndrome & Autism Autism spectrum disorder occurs more frequently in individuals ...

  13. Can reinforcement occur with a learned trait?

    Science.gov (United States)

    Olofsson, Helen; Frame, Alicia M; Servedio, Maria R

    2011-07-01

    We use birdsong as a case study to ask whether reinforcement can occur via the spread of a genetically determined female preference for a socially inherited (learned) male trait. We envision secondary contact between two neighboring populations with different song dialects. An individual's ability to learn song is confined by a genetic predisposition: if predispositions are strong, there will be no phenotypic overlap in song between populations, whereas weak predispositions allow phenotypic overlap, or "mixed" song. To determine if reinforcement has occurred, we consider if an allele for within-population female mating preference, based on song, can spread, and whether population specific songs can concurrently be maintained at equilibrium. We model several scenarios, including costs to mating preferences, mating preferences in hybrids, and hybrids having the ability to learn pure songs. We find that when weak predispositions are fixed within a population reinforcement based on song cannot occur. However, when some individuals have strong predispositions, restricting phenotypic overlap between populations in the trait, reinforcement is only slightly inhibited from a purely genetic model. Generalizing beyond the example of song, we conclude that socially learned signals will tend to prohibit reinforcement, but it may still occur if some individuals acquire trait phenotypes genetically. © 2011 The Author(s). Evolution© 2011 The Society for the Study of Evolution.

  14. Chemical and Biological Significance of Naturally Occurring ...

    African Journals Online (AJOL)

    PROF HORSFALL

    and www.bioline.org.br/j a. Chemical and Biological Significance of Naturally Occurring Additives on. African Black Soap and its Performance. IKOTUN, A. ADEBOMI; OGUNDELE, O. FISAYO; KAYODE, O. MOBOLAJI;. *AJAELU, C. JOHN. Department of Chemistry and Industrial Chemistry, Bowen Univeristy, Iwo, Nigeria.

  15. Photographic essay: healing by secondary intention in oculoplastics.

    Science.gov (United States)

    Lam, Lewis; Weatherhead, Robert

    2015-05-01

    This short report is written to demonstrate the usefulness of healing by secondary intention in oculoplastics. It shows photo strips of our patient outcomes, reflecting the excellent healing capacity of the face. The main point is to challenge misconceptions that healing by secondary intention is prone to infection and scarring, but instead, to show it is a safe and practical approach to our patients.

  16. Beneficial Therapeutic Effects of Sildenafil on Bone Healing in ...

    African Journals Online (AJOL)

    2018-02-22

    6 days ago ... However, it has been reported that they might have the potential to improve fracture healing. In previous studies, ZA was generally applied for fracture repair perioperatively or postoperatively with the aim of improving bone healing.[15,16] In cases wherein ZA was administered preoperatively, the healing ...

  17. Self-Healing Corrosion Protective Sol-Gel Coatings

    NARCIS (Netherlands)

    Abdolah Zadeh, M.

    2016-01-01

    Inspired by the state of the art and the recent advances in the field of self-healing corrosion protective coatings, the thesis entitled “Self-healing corrosion protective sol-gel coatings” addresses novel routes to self-healing corrosion protective sol-gel coatings via extrinsic and intrinsic

  18. The Healing Land : Research Methods in Kalahari Communities ...

    African Journals Online (AJOL)

    The Healing Land (Isaacson, 2001a) is a vivid, experiential account of Rupert Isaacson's journey towards personal and community healing among the Khomani Bushmen of the Kalahari Desert in South Africa. This paper provides a detailed analysis of The Healing Land in relation to Isaacson's research methodology and ...

  19. The consequences of not healing: Evidence from the Gukurahundi ...

    African Journals Online (AJOL)

    This article reports part of a larger research project which investigated whether the survivors of Gukurahundi could heal themselves via participation over time in a group action research project directed at their healing. The present article focuses on the consequences of failing to heal, based on the experiences and attitudes ...

  20. Holistic Healing Through Herbs: Effectiveness of Aloe Vera on Post Extraction Socket Healing.

    Science.gov (United States)

    Nimma, Vijaya Lakshmi; Talla, Harsha Vardhan; Bairi, Jaya Krishna; Gopaldas, Madhulatha; Bathula, Haritha; Vangdoth, Sandeep

    2017-03-01

    Advances in the field of alternative medicine has encouraged the use of various natural products for multiple uses in the field of dentistry for treatment of various oral diseases. A natural herbal product is Aloe vera, which has number of benefits with no reported side effects and gaining considerable importance in clinical research. The aim of this cross-sectional randomized interventional study was to evaluate the effectiveness of Aloe vera in the healing of post extraction sockets. A sample size of 40 patients undergoing atraumatic extraction was divided into two groups. Group A-patients were prescribed only analgesics and followed for seven consecutive days and socket healing assessment was done. Group B-Patients were given Aloe vera soaked gel foams, followed up to the third and seventh day by two observers and the socket healing was assessed using the standardized index by Landry, Turnbull and Howley. In addition to healing the common complaint associated with extraction wound, the pain was assessed using numerical rating scale. Data obtained was statistically analysed using Mann-whitney U test, Wilcoxon Signed ranks test and Spearman's rank correlation method. Control group on the third and the seventh day showed healing of 60% and 70% respectively and the Aloe vera group showed a better result having a healing potential of 70% on the third day and 90% on the seventh day which was statistically significant with a (p-valueAloe vera group showed a significant decrease in pain after two hours on the day of extraction followed by second, third and seventh day which was statistically significant (p-valueAloe vera has been proved to have a unique property that is implicated in better healing than other group without any side effects. Aloe vera is economical, effective, powerful nutritional supplement and antioxidant that protects and promotes wound healing.

  1. Self-Healing Characteristics of Damaged Rock Salt under Different Healing Conditions

    OpenAIRE

    Lin Li; Chunhe Yang; Deyi Jiang; Song Ren; Jie Chen

    2013-01-01

    Salt deposits are commonly regarded as ideal hosts for geologic energy reservoirs. Underground cavern construction-induced damage in salt is reduced by self-healing. Thus, studying the influencing factors on such healing processes is important. This research uses ultrasonic technology to monitor the longitudinal wave velocity variations of stress-damaged rock salts during self-recovery experiments under different recovery conditions. The influences of stress-induced initial damage, temperatur...

  2. Self-healing phenomena in cement-based materials state-of-the-art report of RILEM Technical Committee 221-SHC Self-Healing Phenomena in Cement-Based Materials

    CERN Document Server

    Tittelboom, Kim; Belie, Nele; Schlangen, Erik

    2013-01-01

    Self-healing materials are man-made materials which have the built-in capability to repair damage. Failure in materials is often caused by the occurrence of small microcracks throughout the material. In self-healing materials phenomena are triggered to counteract these microcracks. These processes are ideally triggered by the occurrence of damage itself. Thus far, the self-healing capacity of cement-based materials has been considered as something "extra". This could be called passive self-healing, since it was not a designed feature of the material, but an inherent property of it. Centuries-old buildings have been said to have survived these centuries because of the inherent self-healing capacity of the binders used for cementing building blocks together. In this State-of-the-Art Report a closer look is taken at self-healing phenomena in cement-based materials. It is shown what options are available to design for this effect rather than have it occur as a "coincidental extra".

  3. Effective Crack Control of Concrete by Self-Healing of Cementitious Composites Using Synthetic Fiber.

    Science.gov (United States)

    Choi, Heesup; Inoue, Masumi; Kwon, Sukmin; Choi, Hyeonggil; Lim, Myungkwan

    2016-03-30

    Although concrete is one of the most widely used construction materials, it is characterized by substantially low tensile strength in comparison to its compression strength, and the occurrence of cracks is unavoidable. In addition, cracks progress due to environmental conditions including damage by freezing, neutralization, and salt, etc. Moreover, detrimental damage can occur in concrete structures due to the permeation of deteriorating elements such as Cl(-) and CO₂. Meanwhile, under an environment in which moisture is being supplied and if the width of the crack is small, a phenomenon of self-healing, in which a portion of the crack is filled in due to the rehydration of the cement particles and precipitation of CaCO₃, is been confirmed. In this study, cracks in cementitious composite materials are effectively dispersed using synthetic fibers, and for cracks with a width of more than 0.1 mm, a review of the optimal self-healing conditions is conducted along with the review of a diverse range of self-healing performance factors. As a result, it was confirmed that the effective restoration of watertightness through the production of the majority of self-healing products was achieved by CaCO₃ and the use of synthetic fibers with polarity, along with the effect of inducing a multiple number of hairline cracks. In addition, it was confirmed that the self-healing conditions of saturated Ca(OH)₂ solution, which supplied CO₂ micro-bubbles, displayed the most effective self-healing performance in the surface and internal sections of the cracks.

  4. Creating rigidly stabilized fractures for assessing intramembranous ossification, distraction osteogenesis, or healing of critical sized defects.

    Science.gov (United States)

    Yu, Yan-yiu; Bahney, Chelsea; Hu, Diane; Marcucio, Ralph S; Miclau, Theodore

    2012-04-11

    Assessing modes of skeletal repair is essential for developing therapies to be used clinically to treat fractures. Mechanical stability plays a large role in healing of bone injuries. In the worst-case scenario mechanical instability can lead to delayed or non-union in humans. However, motion can also stimulate the healing process. In fractures that have motion cartilage forms to stabilize the fracture bone ends, and this cartilage is gradually replaced by bone through recapitulation of the developmental process of endochondral ossification. In contrast, if a bone fracture is rigidly stabilized bone forms directly via intramembranous ossification. Clinically, both endochondral and intramembranous ossification occur simultaneously. To effectively replicate this process investigators insert a pin into the medullary canal of the fractured bone as described by Bonnarens. This experimental method provides excellent lateral stability while allowing rotational instability to persist. However, our understanding of the mechanisms that regulate these two distinct processes can also be enhanced by experimentally isolating each of these processes. We have developed a stabilization protocol that provides rotational and lateral stabilization. In this model, intramembranous ossification is the only mode of healing that is observed, and healing parameters can be compared among different strains of genetically modified mice, after application of bioactive molecules, after altering physiological parameters of healing, after modifying the amount or time of stabilization, after distraction osteogenesis, after creation of a non-union, or after creation of a critical sized defect. Here, we illustrate how to apply the modified Ilizarov fixators for studying tibial fracture healing and distraction osteogenesis in mice.

  5. Anti-inflammatory and wound healing potential of citrus auraptene.

    Science.gov (United States)

    La, Vu Dang; Zhao, Lei; Epifano, Francesco; Genovese, Salvatore; Grenier, Daniel

    2013-10-01

    Auraptene is the most abundant naturally occurring geranyloxycoumarin. It is primarily isolated from plants in the Rutaceae family, many of which, like citrus fruits, are used as food in many countries. Auraptene is a biologically active secondary metabolite with valuable properties. The aim of our study was to identify novel properties of auraptene with potential for managing periodontal diseases, an inflammatory disease of bacterial origin affecting the tissues surrounding and supporting the teeth. In vitro assays showed that auraptene decreased, in a dose-dependent manner, the secretion of matrix metalloproteinase 2 as well as key inflammatory mediators, including interleukin-6 (IL-6), IL-8, and chemokine (C-C motif) ligand-5 secreted by Aggregatibacter actinomycetemcomitans lipopolysaccharide-stimulated oral epithelial cells. Using gingival fibroblasts, auraptene showed a significant (Phealing effect by its capacity to increase cell migration. In conclusion, auraptene shows promise for promoting wound healing and controlling periodontal diseases through its capacity to interfere with inflammatory mediator secretion.

  6. Analysis of traumatic ulcer healing time under the treatment of the Mauli banana (Musa acuminata 25% stem extract gel

    Directory of Open Access Journals (Sweden)

    Dewi Puspitasari

    2017-03-01

    Full Text Available ABSTRACT Introduction: Traumatic ulcer is one of oral disorders that often occur. The prevalence is quite high, between 3-24% of population. Therapy of traumatic ulcer is symptomatic. People usually use Aloe vera extract gel. Previous research showed that the Aloe vera gel is equivalent with ethanol extract of 25% Mauli banana (Musa acuminata stem in accelerating wound healing based on the number of macrophages and neovascular. The objective of the study is to find out the time difference of traumatic ulcer healing using 25% Musa acuminata stem extract gel compared to a gel containing Aloe vera extract. Methods: The research was post test design. Subjects were patients of Oral Medicine Installation in Gusti Hasan Aman Dental Hospital Banjarmasin with diagnosis of traumatic ulcer using completely random sampling method. Eight patients as samples were determined by the formula of Lemeshow. Results: there was no significant difference with p=0,724 (p>0,05 between healing time using Aloe vera gel and 25% Musa acuminata stem extract. Conclusion: At the concentration of 25% Musa acuminata stem extract gel concentration has the same healing time with Aloe vera gel, therefore can be recommended as a topical use for traumatic ulcer healing. Keywords: Musa acuminata stem, Healing time, Traumatic ulcer

  7. Histological and ultrastructural evaluation of the early healing of the lateral collateral ligament epiligament tissue in a rat knee model

    Directory of Open Access Journals (Sweden)

    Kinov Plamen S

    2010-06-01

    Full Text Available Abstract Background In this study, we evaluated the changes which occurred in the epiligament, an enveloping tissue of the ligament, during the ligament healing. We assessed the association of epiligament elements that could be involved in ligament healing. Methods Thirty-two 8-month old male Wistar rats were used in this study. In twenty-four of them the lateral collateral ligament of the knee joint was surgically transected and was allowed to heal spontaneously. The evaluation of the epiligament healing included light microscopy and transmission electron microscopy. Results At the eight, sixteenth and thirtieth day after injury, the animals were sacrificed and the ligaments were examined. Our results revealed that on the eight and sixteenth day post-injury the epiligament tissue is not completely regenerated. Till the thirtieth day after injury the epiligament is similar to normal, but not fully restored. Conclusion Our study offered a more complete description of the epiligament healing process and defined its important role in ligament healing. Thus, we provided a base for new strategies in ligament treatment.

  8. Histological and ultrastructural evaluation of the early healing of the lateral collateral ligament epiligament tissue in a rat knee model.

    Science.gov (United States)

    Georgiev, Georgi P; Vidinov, Nikolai K; Kinov, Plamen S

    2010-06-13

    In this study, we evaluated the changes which occurred in the epiligament, an enveloping tissue of the ligament, during the ligament healing. We assessed the association of epiligament elements that could be involved in ligament healing. Thirty-two 8-month old male Wistar rats were used in this study. In twenty-four of them the lateral collateral ligament of the knee joint was surgically transected and was allowed to heal spontaneously. The evaluation of the epiligament healing included light microscopy and transmission electron microscopy. At the eight, sixteenth and thirtieth day after injury, the animals were sacrificed and the ligaments were examined. Our results revealed that on the eight and sixteenth day post-injury the epiligament tissue is not completely regenerated. Till the thirtieth day after injury the epiligament is similar to normal, but not fully restored. Our study offered a more complete description of the epiligament healing process and defined its important role in ligament healing. Thus, we provided a base for new strategies in ligament treatment.

  9. Initial Characterization of the Pig Skin Bacteriome and Its Effect on In Vitro Models of Wound Healing.

    Directory of Open Access Journals (Sweden)

    Matthew K McIntyre

    Full Text Available Elucidating the roles and composition of the human skin microbiome has revealed a delicate interplay between resident microbes and wound healing. Evolutionarily speaking, normal cutaneous flora likely has been selected for because it potentiates or, at minimum, does not impede wound healing. While pigs are the gold standard model for wound healing studies, the porcine skin microbiome has not been studied in detail. Herein, we performed 16S rDNA sequencing to characterize the pig skin bacteriome at several anatomical locations. Additionally, we used bacterial conditioned-media with in vitro techniques to examine the paracrine effects of bacterial-derived proteins on human keratinocytes (NHEK and fibroblasts (NHDF. We found that at the phyla level, the pig skin bacteriome is similar to that of humans and largely consists of Firmicutes (55.6%, Bacteroidetes (20.8%, Actinobacteria (13.3%, and Proteobacteria (5.1% however species-level differences between anatomical locations exist. Studies of bacterial supernatant revealed location-dependent effects on NHDF migration and NHEK apoptosis and growth factor release. These results expand the limited knowledge of the cutaneous bacteriome of healthy swine, and suggest that naturally occurring bacterial flora affects wound healing differentially depending on anatomical location. Ultimately, the pig might be considered the best surrogate for not only wound healing studies but also the cutaneous microbiome. This would not only facilitate investigations into the microbiome's role in recovery from injury, but also provide microbial targets for enhancing or accelerating wound healing.

  10. Use of composite materials, health monitoring and self-healing concepts to refurbish our civil and military infrastructure.

    Energy Technology Data Exchange (ETDEWEB)

    Roach, Dennis Patrick; Delong, Waylon Anthony; White, Scott (University of Illinois, Urbana, Illinois); Yepez, Esteban; Rackow, Kirk A.; Reedy, Earl David, Jr.

    2007-09-01

    An unavoidable by-product of a metallic structure's use is the appearance of crack, corrosion, erosion and other flaws. Economic barriers to the replacement of these structures have created an aging civil and military infrastructure and placed even greater demands on efficient and safe repair and inspection methods. As a result of Homeland Security issues and these aging infrastructure concerns, increased attention has been focused on the rapid repair and preemptive reinforcement of structures such as buildings and bridges. This Laboratory Directed Research and Development (LDRD) program established the viability of using bonded composite patches to repair metallic structures. High modulus fiber-reinforced polymer (FRP) material may be used in lieu of mechanically fastened metallic patches or welds to reinforce or repair damaged structures. Their use produces a wide array of engineering and economic advantages. Current techniques for strengthening steel structures have several drawbacks including requiring heavy equipment for installation, poor fatigue performance, and the need for ongoing maintenance due to continued corrosion attack or crack growth. The use of bonded composite doublers has the potential to correct the difficulties associated with current repair techniques and the ability to be applied where there are currently no rehabilitation options. Applications include such diverse structures as: buildings, bridges, railroad cars, trucks and other heavy machinery, steel power and communication towers, pipelines, factories, mining equipment, ships, tanks and other military vehicles. This LDRD also proved the concept of a living infrastructure by developing custom sensors and self-healing chemistry and linking this technology with the application of advanced composite materials. Structural Health Monitoring (SHM) systems and mountable, miniature sensors were designed to continuously or periodically assess structural integrity. Such systems are able to

  11. Ethical issues occurring within nursing education.

    Science.gov (United States)

    Fowler, Marsha D; Davis, Anne J

    2013-03-01

    The large body of literature labeled "ethics in nursing education" is entirely devoted to curricular matters of ethics education in nursing schools, that is, to what ought to be the ethics content that is taught and what theory or issues ought to be included in all nursing curricula. Where the nursing literature actually focuses on particular ethical issues, it addresses only single topics. Absent from the literature, however, is any systematic analysis and explication of ethical issues or dilemmas that occur within the context of nursing education. The objective of this article is to identify the spectrum of ethical issues in nursing education to the end of prompting a systematic and thorough study of such issues, and to lay the groundwork for research by identifying and provisionally typologizing the ethical issues that occur within the context of academic nursing.

  12. Clinical Characteristics of Stroke Occurring while Bathing.

    Science.gov (United States)

    Inamasu, Joji; Nakatsukasa, Masashi; Oshima, Takeo; Tomiyasu, Kazuhiro; Mayanagi, Keita; Imai, Akira

    2017-07-01

    Stroke can occur during any human activity. Although cardiac arrests or drowning accidents while bathing have been studied extensively, there are few studies focusing on stroke occurring while bathing. The objectives of this study were to evaluate the clinical characteristics of stroke occurring while bathing and the association between stroke and drowning accidents. Clinical data prospectively acquired between January 2011 and December 2015 on 1939 patients with stroke (1224 cerebral infarctions [CIs], 505 intracerebral hemorrhages [ICHs], and 210 subarachnoid hemorrhages [SAHs]) were reviewed to identify patients who sustained a stroke while bathing. The ratio of bathing-related strokes to strokes occurring during other activities was evaluated. Moreover, the demographics of these 2 groups were compared in each stroke type. Among the 1939 patients, 78 (CI, 32; ICH, 28; and SAH, 18) sustained a stroke while bathing. The ratio of bathing to other activities in the SAH group was the highest (8.6%), followed by the ICH group (5.5%), whereas that in the CI group was the lowest (2.6%). Regardless of stroke type, only a minority of patients were found to have collapsed inside the bathtub. The higher ratio of bathing in hemorrhagic strokes may indicate that there is a small risk of hemorrhagic stroke while bathing in vulnerable subjects. This retrospective study did not establish a causal relationship between bathing and stroke nor identify risk factors, which means that future prospective studies are warranted. The finding that the great majority of bathing-related stroke patients were found to have collapsed outside the bathtub suggests that the involvement of stroke in drowning accidents in the bathtub may be small. Copyright © 2017 National Stroke Association. Published by Elsevier Inc. All rights reserved.

  13. Jerky Periods: Myoclonus Occurring Solely During Menses

    OpenAIRE

    Buijink, Arthur W.G.; Gelauff, Jeannette M.; van der Salm, Sandra M. A.; Marina A.J. Tijssen; van Rootselaar, Anne-Fleur

    2013-01-01

    Background In this case report, we describe an unusual case of a patient with myoclonus only occurring during menses. Case Report A 41-year-old female, known to have neurological sequelae after a car accident 1 year earlier, presented with myoclonic movements of the right arm and hand only during menses. Brain magnetic resonance imaging is compatible with head trauma. Electromyography shows brief irregular bursts with a duration of about 20?ms. Discussion This appears to be the first descript...

  14. Diverticulitis occurs early after lung transplantation.

    Science.gov (United States)

    Larson, Eric S; Khalil, Hassan A; Lin, Anne Y; Russell, Marcia; Ardehali, Abbas; Ross, David; Yoo, James

    2014-08-01

    Lung transplantation recipients are at an increased risk for developing diverticulitis. However, the incidence and natural history of diverticulitis have not been well characterized. Our objective was to identify patient and transplant-related factors that may be associated with an increased risk of developing diverticulitis in this patient population. This is a retrospective single institution study. All patients who received a lung transplant between May 2008 and July 2013 were evaluated using an existing lung transplantation database. Patient-related factors, the incidence and timing of diverticulitis, and outcomes of medical and surgical management were measured. Of the 314 patients who received a lung transplant, 14 patients (4.5%) developed diverticulitis. All episodes (100%) of diverticulitis occurred within the first 2 y after transplantation. Eight patients (57%) required surgery with a mortality rate of 12.5%. Six patients (43%) were managed medically and did not require surgery with a mean follow-up period of 442 d. Diverticulitis is common after lung transplantation and occurs with a higher incidence compared with the general population. Diverticulitis occurs early in the posttransplant period, and the majority of patients require surgery. Patients who respond promptly to medical treatment may not require elective resection. A greater awareness of the risk of diverticulitis in the early posttransplant period may allow for earlier diagnosis and treatment. Copyright © 2014 Elsevier Inc. All rights reserved.

  15. Composites by rapid prototyping technology

    CSIR Research Space (South Africa)

    Kumar, S

    2010-02-01

    Full Text Available powder is a fiber, problems of manufacturing occur. The method has also been used to make Metal Matrix Composite (MMC), e.g Fe and graphite [17], WC-Co [18,19], WC-Co and Cu [20,21], Fe, Ni and TiC [22] etc and Ceramic Matrix Composite (CMC) e.g. Si... of various materials used. Key words: : Rapid Prototyping (RP), Laser, Composites 1 Introduction Rapid Prototyping (RP) initially focussed on polymers. These were later re- placed/supplemented by ceramics, metals and composites. Composites are used in RP...

  16. Laboratory investigation of crushed salt consolidation and fracture healing

    Energy Technology Data Exchange (ETDEWEB)

    1987-01-01

    A laboratory test program was conducted to investigate the consolidation behavior of crushed salt and fracture healing in natural and artificial salt. Crushed salt is proposed for use as backfill in a nuclear waste repository in salt. Artificial block salt is proposed for use in sealing a repository. Four consolidation tests were conducted in a hydrostatic pressure vessel at a maximum pressure of 2500 psi (17.2 MPa) and at room temperature. Three 1-month tests were conducted on salt obtained from the Waste Isolation Pilot Plant and one 2-month test was conducted on salt from Avery Island. Permeability was obtained using argon and either a steady-state or transient method. Initial porosities ranged from 0.26 to 0.36 and initial permeabilities from 2000 to 50,000 md. Final porosities and permeabilities ranged from 0.05 to 0.19 and from <10/sup -5/ md to 110 md, respectively. The lowest final porosity (0.05) and permeability (<10/sup -5/ md) were obtained in a 1-month test in which 2.3% moisture was added to the salt at the beginning of the test. The consolidation rate was much more rapid than in any of the dry salt tests. The fracture healing program included 20 permeability tests conducted on fractured and unfractured samples. The tests were conducted in a Hoek cell at hydrostatic pressures up to 3000 psi (20.6 MPa) with durations up to 8 days. For the natural rock salt tested, permeability was strongly dependent on confining pressure and time. The effect of confining pressure was much weaker in the artificial salt. In most cases the combined effects of time and pressure were to reduce the permeability of fractured samples to the same order of magnitude (or less) as the permeability measured prior to fracturing.

  17. Pentadecapeptide BPC 157 and the esophagocutaneous fistula healing therapy.

    Science.gov (United States)

    Cesarec, Vedran; Becejac, Tomislav; Misic, Marija; Djakovic, Zeljko; Olujic, Danijela; Drmic, Domagoj; Brcic, Luka; Rokotov, Dinko Stancic; Seiwerth, Sven; Sikiric, Predrag

    2013-02-15

    Esophagocutaneous fistulas are a failure of the NO-system, due to NO-synthase blockage by the NOS-blocker L-NAME consequently counteracted by l-arginine and gastric pentadecapeptide BPC 157 (l-arginine BPC 157), precipitating a therapeutic benefit. Previously, there was an established BPC 157-NO-system interaction. BPC 157 GEPPPGKPADDAGLV, MW 1419 (LD1 not achieved), is a safe and stable anti-ulcer peptide, successful in inflammatory bowel disease trials, counteracting esophagitis, sphincter failure, gastrointestinal and skin ulcers, gastrocutaneous or colocutaneous fistulas. We treated rats with established cervical esophagocutaneous fistulas throughout four days (both open skin and esophageal defects, with significant leakage) with BPC 157 (parenterally and perorally) and L-NAME (blocking NO genesis) and l-arginine (NO-substrate) alone or in combination. RT-PCR investigated eNOS, iNOS, COX-2 mRNA levels in the fistulas. We evidenced a closely inter-related process of unhealed skin, esophageal defects, unhealed fistulas (up regulated eNOS, iNOS and COX2 mRNA levels), usually lethal, particularly NO-system related and therapy dependent. Generally, the course of fistula healing was accelerated either to a greater extent (with BPC 157 (in particular, less eNOS gene expression) completely counteracting L-NAME effects, in L-NAME+BPC 157 and L-NAME+l-arginine+BPC 157 groups), or to a lesser extent (with l-arginine). Conversely, the process was aggravated, rapidly and prominently (with L-NAME). In particular, BPC 157 was effective either given per-orally/intraperitoneally, in μg- and ng-regimens. Shortly, defects started to heal, with less fistula leakage and no mortality at day 4. Failure of pyloric and lower esophageal sphincter pressure was restored, with practically no esophagitis. Copyright © 2012 Elsevier B.V. All rights reserved.

  18. Carcinogenesis and diabetic wound healing: evidences of parallelism.

    Science.gov (United States)

    Singh, Kanhaiya; Singh, Kiran

    2015-01-01

    There is a close association of chronic tissue damage, inflammation and cancer. A chronic injury may contribute to sustained healing response leading to fibrosis, organ failure and carcinogenesis. Wounds created due to mechanical or patho-physiological insults, generally follow a sophisticated series of mutually coherent steps leading to the re-establishment of the affected tissue or organ. The process of wound healing resembles fundamental processes like embryogenesis and tissue regeneration. All the stages in the wound healing process are tightly regulated and any sort of imbalance may lead to either non healing chronic ulcers or excessively healed hypertrophic scars. Diabetic wounds are also very tough to heal and in many cases they do not heal, ultimately resulting in the amputation of that body part. The non-healing property of diabetic wounds may be due to combined effect of intrinsic and extrinsic factors. In this review, we aimed to explore the steps involved in diabetic wound healing and compare it with the process of carcinogenesis. This review demonstrates that both carcinogenesis and the diabetic wound healing follow a similar path of latent healing in an abnormal exaggerated manner.

  19. Ultrafast self-healing of polymer toward strength restoration.

    Science.gov (United States)

    Ye, Xiao Ji; Zhang, Ji-Long; Zhu, Yong; Rong, Min Zhi; Zhang, Ming Qiu; Song, Yi Xi; Zhang, Hong-Xing

    2014-03-12

    Self-healing materials should take effect immediately following crack generation in principle, but the speed of autonomic recovery of mechanical properties through either extrinsic or intrinsic healing strategy reported so far is not that fast. Mostly, a couple of hours are taken for reaching steady state or maximum healing. To accelerate the healing process, the authors of this work make use of antimony pentafluoride as instant hardener of epoxy and successfully encapsulate the highly active antimony pentafluoride-ethanol complex in terms of hollow silica spheres. Accordingly, self-healing agent based on microencapsulated antimony pentafluoride-ethanol complex and epoxy monomer is developed. Epoxy material with the embedded healant capsules can thus be healed within a few seconds, as demonstrated by impact and fatigue tests. It is believed that the outcome presented here might help to move the self-healing technique closer to practical application, especially when the engineering significance of epoxy material is concerned.

  20. Symbolic, ritual and social dynamics of spiritual healing.

    Science.gov (United States)

    Glik, D C

    1988-01-01

    Participant observation among white, middle class spiritual healing groups in the Baltimore area (1981-1983) revealed distinct sociocultural and interpersonal patterns of action and influence among two types of groups found. Types of groups were (1) Christian, Pentecostal, neo-Pentecostal or 'charismatic' healing groups and (2) 'New Age', or 'metaphysical' healing groups. Qualitative findings highlight similarities and differences between these two types of groups through examination of organizational characteristics, leadership patterns, ideological systems, and ritual processes. Illness and social characteristics of participants are also compared. Analysis of characteristics of groups and participants shows how the incorporation of explanatory models, social roles, myths, and symbols into the social, ideational, and ritual context of spiritual healing is essential to its therapeutic effect, and that spiritual healing exemplifies a symbolic healing system. Finally, a substantive theoretical model for healing research is suggested.

  1. Fatigue crack arrest in a self-healing polymer composite

    Energy Technology Data Exchange (ETDEWEB)

    Brown, E. N. (Eric N.); White, S. R. (Scott R.); Sottos, Nancy R.

    2004-01-01

    A comprehensive experimental program is performed to assess the in situ fatigue behavior of a self-healing polymer. A fatigue-life-extension protocol is established for characterizing healing efficiency of the self-healing epoxy under cyclic loading. At moderate {Delta}K{sub I} and at high {Delta}K{sub I}, when a rest period is employed, in situ healing extends fatigue life though temporary crack arrest and retardation. In situ self-healing permanently arrests crack growth at low {delta}K{sub I} and at moderate {Delta}K{sub I}, when a rest period is employed. Fatigue crack retardation and arrest result from two primary crack-tip shielding mechanisms: hydrodynamic pressure in the viscous healing agent and artificial crack closure. Application of self-healing functionality to fatigue slows the crack growth rate and increases the fatigue threshold.

  2. Are healing ceremonies useful for enhancing quality of life?

    Science.gov (United States)

    Hewson, Paul; Rowold, Jens; Sichler, Conrad; Walter, Wiltrud

    2014-09-01

    In line with the growing interest in integrated health care approaches, both nonindigenous (e.g., Western) and indigenous people are participating in healing ceremonies. However, little is known about the potential health-related benefit of healing ceremonies. Thus, the current study sought to close this gap in the literature by exploring the effect of healing ceremonies on participant's self-rated quality of life. Data were gathered at three time points (T1: 4 weeks before ceremony; T2: 2 days before ceremony; T3: 4 weeks after ceremony). 25 persons with various diseases participated in the healing ceremony. A 6-hour healing ceremony was conducted. Mental, physical, emotional, and spiritual quality of life were assessed. Participation in a healing ceremony increased mental, physical, emotional, and spiritual quality of life. As part of integrative health care, healing ceremonies are potentially useful for fostering participants' quality of life.

  3. Cosmos caudatus enhances fracture healing in ovariectomised rats: A preliminary biomechanical evaluation

    OpenAIRE

    Pamela Godspower Rufus; Norazlina Mohamed; Ahmad Nazrun Shuid

    2015-01-01

    Summary. Osteoporotic fractures occur in osteoporotic states and affect patients’ quality of life. Cosmos caudatus (ulam raja) is a local plant known for its high calcium content and anti-oxidant properties. The present study aimed to investigate the fracture healing properties of C. caudatus water extract in ovariectomised rats by studying the biomechanical properties of tibia. Twenty-four female Sprague-Dawley rats were divided into 4 groups: (i) sham operated (ii) ovariectomised control (i...

  4. Mucinous carcinoma occurring in the male breast

    OpenAIRE

    Ishida, Mitsuaki; UMEDA, TOMOKO; KAWAI, YUKI; MORI, Tsuyoshi; Kubota, Yoshihiro; ABE, Hajime; Iwai, Muneo; Yoshida, Keiko; Kagotani, Akiko; Tani, Tohru; Okabe, Hidetoshi

    2013-01-01

    Male breast carcinoma is an uncommon neoplasm, accounting for 0.6% of all breast carcinomas. Invasive ductal carcinoma of no special type is the most common type of male breast carcinoma, and mucinous carcinoma occurring in the male breast is extremely rare. In the present study, we report a case of mucinous carcinoma of the male breast and discuss the clinicopathological features of this type of tumor. A 63-year-old Japanese male presented with a gradually enlarged nodule in the right breast...

  5. Jerky Periods - Myoclonus Occurring Solely During Menses

    Directory of Open Access Journals (Sweden)

    Arthur W. Buijink

    2013-05-01

    Full Text Available Background: In this case report, we describe an unusual case of a patient with myoclonus only occurring during menses. Case Report: A 41-year-old female, known to have neurological sequelae after a car accident 1 year earlier, presented with myoclonic movements of the right arm and hand only during menses. Brain magnetic resonance imaging is compatible with head trauma. Electromyography shows brief irregular bursts with a duration of about 20 ms. Discussion: This appears to be the first description of myoclonus appearing only during menses. We suggest a cortical origin for myoclonus.

  6. Jerky Periods: Myoclonus Occurring Solely During Menses

    Science.gov (United States)

    Buijink, Arthur W. G.; Gelauff, Jeannette M.; van der Salm, Sandra M. A.; Tijssen, Marina A. J.; van Rootselaar, Anne-Fleur

    2013-01-01

    Background In this case report, we describe an unusual case of a patient with myoclonus only occurring during menses. Case Report A 41-year-old female, known to have neurological sequelae after a car accident 1 year earlier, presented with myoclonic movements of the right arm and hand only during menses. Brain magnetic resonance imaging is compatible with head trauma. Electromyography shows brief irregular bursts with a duration of about 20 ms. Discussion This appears to be the first description of myoclonus appearing only during menses. We suggest a cortical origin for myoclonus. PMID:23724361

  7. Hepatitis B Virus Capsid Completion Occurs through Error Correction.

    Science.gov (United States)

    Lutomski, Corinne A; Lyktey, Nicholas A; Zhao, Zhongchao; Pierson, Elizabeth E; Zlotnick, Adam; Jarrold, Martin F

    2017-11-22

    Understanding capsid assembly is important because of its role in virus lifecycles and in applications to drug discovery and nanomaterial development. Many virus capsids are icosahedral, and assembly is thought to occur by the sequential addition of capsid protein subunits to a nucleus, with the final step completing the icosahedron. Almost nothing is known about the final (completion) step because the techniques usually used to study capsid assembly lack the resolution. In this work, charge detection mass spectrometry (CDMS) has been used to track the assembly of the T = 4 hepatitis B virus (HBV) capsid in real time. The initial assembly reaction occurs rapidly, on the time scale expected from low resolution measurements. However, CDMS shows that many of the particles generated in this process are defective and overgrown, containing more than the 120 capsid protein dimers needed to form a perfect T = 4 icosahedron. The defective and overgrown capsids self-correct over time to the mass expected for a perfect T = 4 capsid. Thus, completion is a distinct phase in the assembly reaction. Capsid completion does not necessarily occur by inserting the last building block into an incomplete, but otherwise perfect icosahedron. The initial assembly reaction can be predominently imperfect, and completion involves the slow correction of the accumulated errors.

  8. Medicine and the Task of Healing

    Directory of Open Access Journals (Sweden)

    Paul A. Komesaroff

    2013-01-01

    Full Text Available To understand the traditional description of medicine as a practice of healing, it is necessary to examine its relationships with both science and ethics. The “scientific” component of medicine includes an acknowledgment of the influence of social, cultural and environmental factors on the functioning of the organism. The “ethical” component is often presented as merely supplementary but actually provides the conditions of possibility of knowledge. “Healing” then appears as what joins the two together: the site where science is applied in the service of ethics and where ethics encounters science. This perspective allows us to reconsider medicine as a project to healing complex wounds that manifest themselves at the physical, psychological, emotional and cultural levels.

  9. Quantum healing of spacetime singularities: A review

    Science.gov (United States)

    Konkowski, D. A.; Helliwell, T. M.

    2018-02-01

    Singularities are commonplace in general relativistic spacetimes. It is natural to hope that they might be “healed” (or resolved) by the inclusion of quantum mechanics, either in the theory itself (quantum gravity) or, more modestly, in the description of the spacetime geodesic paths used to define them. We focus here on the latter, mainly using a procedure proposed by Horowitz and Marolf to test whether singularities in broad classes of spacetimes can be resolved by replacing geodesic paths with quantum wave packets. We list the spacetime singularities that various authors have studied in this context, and distinguish those which are healed quantum mechanically (QM) from those which remain singular. Finally, we mention some alternative approaches to healing singularities.

  10. The Healing Potential of Architectural Design

    DEFF Research Database (Denmark)

    Frandsen, Anne Kathrine; Ryhl, Camilla

    2010-01-01

    . Drawing upon phenomenological architectural theory a categorical model was developed that facilitated sorting and communicating the research findings. The project concluded that the research findings can be used to inform the decision-making in the briefing and design process. Especially well documented...... facilities replacing the facilities designed and built in the sixties and seventies, this research is especially relevant currently. The research project 'Healing architecture' compiled and reviewed research that links the physical environment on hospitals with patient and staff outcomes. The project...... addressed the question whether architectural design has a healing potential. The objective was to develop a tool that could give an overview of this research for the building clients and decision-makers responsible for the huge investments in future hospitals and healthcare facilities in the coming decade...

  11. Skin wound healing and phytomedicine: a review.

    Science.gov (United States)

    Pazyar, Nader; Yaghoobi, Reza; Rafiee, Esmail; Mehrabian, Abolfath; Feily, Amir

    2014-01-01

    Skin integrity is restored by a physiological process aimed at repairing the damaged tissues. The healing process proceeds in four phases: hemostasis, inflammation, proliferation and remodeling. Phytomedicine presents remedies, which possess significant pharmacological effects. It is popular amongst the general population in regions all over the world. Phytotherapeutic agents have been largely used for cutaneous wound healing. These include Aloe vera, mimosa, grape vine, Echinacea, chamomile, ginseng, green tea, jojoba, tea tree oil, rosemary, lemon, soybean, comfrey, papaya, oat, garlic, ginkgo, olive oil and ocimum. Phytotherapy may open new avenues for therapeutic intervention on cutaneous wounds. This article provides a review of the common beneficial medicinal plants in the management of skin wounds with an attempt to explain their mechanisms. © 2014 S. Karger AG, Basel.

  12. HIV/AIDS: impact on healing.

    Science.gov (United States)

    Burns, J; Pieper, B

    2000-03-01

    Human immunodeficiency virus and acquired immune deficiency syndrome (HIV/AIDS) are leading chronic illnesses in many major cities worldwide. Frequently, people with HIV infection require surgery or develop chronic wounds. This paper summarizes the impact of HIV infection on body organs and systems and the effect of antiretroviral therapy as a basis for potential complications with wound care and healing. The authors also present research on wound healing in HIV-positive people undergoing operative procedures. Besides the physical effect of HIV infection on the person, clinicians must also realize psychosocial and economic effects of the disease when considering wound care. This paper also addresses care considerations for patients with HIV/AIDS in the inpatient, outpatient, and home care settings.

  13. Impact of Disturbed Wound Healing after Surgery on the Prognosis of Marjolin’s Ulcer

    Directory of Open Access Journals (Sweden)

    Jae Yeon Choi

    2013-05-01

    Full Text Available Background  Marjolin’s ulcer is known to present a high proportion of recurrence and poorprognosis compared to other kinds of skin cancer. Based on our experience, Marjolin’s ulcerpatients who have received reconstructive surgery present a higher proportion of recurrencewhen therewas disturbedwound healing aftersurgery. The impact of disturbedwound healingaftersurgery on the prognosiswas examined in thisstudy.Methods  A retrospective study was carried out on 26 patients who were diagnosed withMarjolin’s ulcer and received surgery in this hospital from 1996 to 2011. Histologic grading,lymph node metastasis at diagnosis, and thewound healing processwere evaluated and chisquared analysis applied in orderto determine the correlationwith recurrence.Results  The proportion of recurrence increases in patients with a low histologic grade orlymph node metastasis at diagnosis. The proportion of recurrence is even higher when theproblemoccurs during thewound healing process aftersurgery.Conclusions  Disturbedwound healing aftersurgery could be used as a sign to quickly identifythe recurrence of carcinoma. Therefore, in the event a problem occurs in the wound healingprocess after surgery, one should keep in mind that this could be a sign of the possibility ofrecurrence and proceed with careful observation and active diagnosis through additionalphysical examinations, general X-ray tests, computed tomographys,magnetic resonance imagings, and so on,to obtain an early diagnosis ofrecurrence.

  14. The effect of red, green and blue lasers on healing of oral wounds in diabetic rats.

    Science.gov (United States)

    Fekrazad, Reza; Mirmoezzi, Amir; Kalhori, Katayoun Am; Arany, Praveen

    2015-07-01

    Many studies have demonstrated that low-level laser therapy (LLLT) can improve wound healing in non-diabetic and diabetic animals. We compared the effects of red, green, and blue lasers in terms of accelerating oral wound healing in diabetic rats. Diabetes was successfully induced in 32 male Wistar rats using intraperitoneal injection of Streptozotocin (150 mg/kg). After intraperitoneal injection of the anesthetic agent, a full-thickness oral wound (10 mm × 2 mm) was created aseptically with a scalpel on hard palate of the diabetic rats. The study was performed using red (630 nm), green (532 nm), and blue (425 nm) lasers and a control group. We used an energy density of 2J/cm2 and a treatment schedule of 3 times/week for 10 days. The area of wounds was measured and recorded on a chart for all rats. On the 10th day, the samples were then sacrificed and a full-thickness sample of wound area was prepared for pathological study. We observed a significant difference (plaser and two other lasers - blue and green (plaser and green laser (p=0.777). The results of the present study provide evidence that wound healing is slower in control rats compared to the treatment groups. Moreover, the findings suggest that wound healing occurs faster with red laser compared to blue and green lasers. Copyright © 2015 Elsevier B.V. All rights reserved.

  15. Biotechnological Management of Skin Burn Injuries: Challenges and Perspectives in Wound Healing and Sensory Recovery.

    Science.gov (United States)

    Girard, Dorothée; Laverdet, Betty; Buhé, Virginie; Trouillas, Marina; Ghazi, Kamélia; Alexaline, Maïa M; Egles, Christophe; Misery, Laurent; Coulomb, Bernard; Lataillade, Jean-Jacques; Berthod, François; Desmoulière, Alexis

    2017-02-01

    Many wound management protocols have been developed to improve wound healing after burn with the primordial aim to restore the barrier function of the skin and also provide a better esthetic outcome. Autologous skin grafts remain the gold standard in the treatment of skin burn, but this treatment has its limitation especially for patients presenting limited donor sites due to extensive burn areas. Deep burn injuries also alter the integrity of skin-sensitive innervation and have an impact on patient's quality of life by compromising perceptions of touch, temperature, and pain. Thus, patients can suffer from long-term disabilities ranging from cutaneous sensibility loss to chronic pain. The cellular mechanisms involved in skin reinnervation following injury are not elucidated yet. Depending on the depth of the burn, nerve sprouting can occur from the wound bed or the surrounding healthy tissue, but somehow this process fails to provide correct reinnervation of the wound during scarring. In addition, several clinical observations indicate that damage to the peripheral nervous system influences wound healing, resulting in delayed wound healing or chronic wounds, underlining the role of innervation and neuromediators for normal cutaneous tissue repair development. Promising tissue engineering strategies, including the use of biomaterials, skin substitutes, and stem cells, could provide novel alternative treatments in wound healing and help in improving patient's sensory recovery.

  16. Spontaneous healing of the tympanic membrane after traumatic perforation in rats.

    Science.gov (United States)

    Araújo, Marcos Miranda de; Murashima, Adriana Andrade Batista; Alves, Vani Maria; Jamur, Maria Celia; Hyppolito, Miguel Angelo

    2014-01-01

    The most common etiologies of tympanic membrane perforation are infections and trauma. The objective of the present study was to assess the healing of traumatic tympanic membrane perforation in rats. The tympanic membrane from male Wistar rats was perforated in the anterior and posterior portions to the handle of the malleus. Five tympanic membranes were evaluated 3 days after tympanic perforation; 5 after 5 days; 5 after 7 days; 3 after 10 days; and 4 after 14 days. The tympanic membranes were submitted to histopathological evaluation after hematoxylin-eosin staining. Tympanic membrane closure occurred at about 7-10 days after injury and the healing process was complete by day 14. The proliferative activity of the outer epithelial layer was present close to the handle of the malleus and to the tympanic annulus. The spontaneous healing process of the tympanic membrane starts from the outer epithelial layer, with later healing of the lamina propria and the mucosal layer. Copyright © 2014 Associação Brasileira de Otorrinolaringologia e Cirurgia Cérvico-Facial. Published by Elsevier Editora Ltda. All rights reserved.

  17. Pharmacological interventions for improved colonic anastomotic healing

    DEFF Research Database (Denmark)

    Oines, Mari Nanna; Krarup, Peter-Martin; Jorgensen, Lars Nannestad

    2014-01-01

    with the primary purpose of promoting healing of anastomoses made in the colon or rectum under uncomplicated conditions. We excluded studies on adverse events from interventions, nutritional interventions or in situ physical supporting biomaterials. The primary outcome was biomechanical strength or AL. We...... performed meta-analyses on therapeutic agents investigated by three or more independent research groups using the same outcome. The DerSimonian-Laird method for random effects was applied with P analysis...

  18. INTRAPSYCHIC CONFLICT, TRANSFERENCE, AND A HEALING RELATIONSHIP

    Directory of Open Access Journals (Sweden)

    Richard G. Erskine

    2013-10-01

    Full Text Available In this rejoinder to “Responses to Relational Healing of Early Affect-Confusion: Part 3 of a Case Study Trilogy”, the author defines an Integrative Psychotherapy perspective of transference and addresses the significance of working within a transference-countertransference milieu. Descriptions of how to understand and therapeutically use client’s “idealization” are provided. The concept of avoidant and disorganized attachment is related to a clinical case.

  19. Muscle-bone Interactions During Fracture Healing

    Science.gov (United States)

    2015-03-01

    interactions on bone health105. Disuse atrophy via denervation or immobilization has been shown to decrease bone integrity in animal models106-108. Fur...significantly impaired fracture heal- ing. The rate of delayed union or non-union in tibial fractures with associated compartment syndrome was 55...X. Adaptation of non-growing former epiphysis and metaphyseal tra- becular bones to aging and immobilization in rat. Bone 1995;17:207S-12S. 107

  20. Regenerative healing following foetal myocardial infarction.

    Science.gov (United States)

    Herdrich, Benjamin J; Danzer, Enrico; Davey, Marcus G; Allukian, Myron; Englefield, Virginia; Gorman, Joseph H; Gorman, Robert C; Liechty, Kenneth W

    2010-12-01

    The adult response to myocardial infarction results in inflammation, scar formation, left ventricular dilatation, and loss of regional and global function. Regenerative scarless healing has been demonstrated in foetal dermis and tendon and is associated with diminished inflammation. We hypothesised that following foetal myocardial infarction, there would be minimal inflammation, regenerative healing, and preservation of function. Anteroapical myocardial infarction encompassing 20% of the left ventricle was created in adult or early gestation foetal sheep. Myocardial function was serially assessed using quantitative echocardiography. Infarct architecture was examined histologically for evidence of scar formation. Cellular inflammation, cellular proliferation, and apoptosis were assessed using immunohistochemistry. In the adult sheep 4 weeks following myocardial infarction, there was a significant decline in ejection fraction (EF) (41±7.4% to 26±7.4%, p<0.05), and the akinetic myocardial segment increased in size (6.9±0.8 cm to 7.9±1.1 cm, p<0.05). By contrast, there was no decline in the foetal EF (53±8.1% to 55±8.8%) and no akinetic foetal myocardial segment 4 weeks post-infarction. The foetal infarcts lacked an inflammatory cell infiltrate and healed with minimal fibrosis, compared with the adults. Foetal infarcts also demonstrated 5-bromo-2'-deoxyuridine (BrdU)+ proliferating cells, including cardiomyocytes, within the infarct. These data demonstrate that the foetal response to myocardial infarction is dramatically different from the adult and is characterised by minimal inflammation, lack of fibrosis, myocardial proliferation and restoration of cardiac function. Diminished inflammation is associated with foetal regenerative cardiac healing following injury. Understanding the mechanisms involved in foetal myocardial regeneration may lead to applications to alter the adult response following myocardial infarction. Copyright © 2010 European Association for

  1. Regenerative healing following fetal myocardial infarction

    Science.gov (United States)

    Herdrich, Benjamin J.; Danzer, Enrico; Davey, Marcus G.; Allukian, Myron; Englefield, Virginia; Gorman, Joseph H.; Gorman, Robert C.; Liechty, Kenneth W.

    2010-01-01

    Objectives The adult response to myocardial infarction results in inflammation, scar formation, left ventricular dilatation, and loss of regional and global function. Regenerative scarless healing has been demonstrated in fetal dermis and tendon and is associated with diminished inflammation. We hypothesized that following fetal myocardial infarction there would be minimal inflammation, regenerative healing, and preservation of function. Methods Anteroapical myocardial infarction encompassing 20% of the left ventricle were created in adult or early gestation fetal sheep. Myocardial function was serially assessed using quantitative echocardiography. Infarct architecture was examined histologically for evidence of scar formation. Cellular inflammation, cellular proliferation, and apoptosis were assessed using immunohistochemistry. Results In the adult sheep 4 weeks following myocardial infarction, there was a significant decline in ejection fraction (41±7.4% to 26±7.4%, p<0.05), and the akinetic myocardial segment increased in size (6.9±0.8 cm to 7.9±1.1 cm, p<0.05). In contrast, there was no decline in the fetal ejection fraction (53±8.1% to 55±8.8%) and no akinetic fetal myocardial segment 4 weeks post-infarction. The fetal infarcts lacked an inflammatory cell infiltrate and healed with minimal fibrosis, compared to the adults. Fetal infarcts also demonstrated BrdU+ proliferating cells, including cardiomyocytes, within the infarct. Conclusions These data demonstrate that the fetal response to myocardial infarction is dramatically different than the adult and is characterized by minimal inflammation, lack of fibrosis, myocardial proliferation, and restoration of cardiac function. Diminished inflammation is associated with fetal regenerative cardiac healing following injury. Understanding the mechanisms involved in fetal myocardial regeneration may lead to applications to alter the adult response following myocardial infarction. PMID:20452780

  2. Self-Healing, Inflatable, Rigidizable Shelter

    Science.gov (United States)

    Haight, Andrea; Gosau, Jan-Michael; Dixit, Anshu; Gleeson, Dan

    2012-01-01

    An inflatable, rigidizable shelter system was developed based on Rigi dization on Command (ROC) technology incorporating not only the requ ired low-stowage volume and lightweight character achieved from an i nflatable/rigidizable system, but also a self-healing foam system inc orporated between the rigidizable layers of the final structure to m inimize the damage caused by any punctures to the structure.

  3. Rapidly separating microneedles for transdermal drug delivery.

    Science.gov (United States)

    Zhu, Dan Dan; Wang, Qi Lei; Liu, Xu Bo; Guo, Xin Dong

    2016-09-01

    The applications of polymer microneedles (MNs) into human skin emerged as an alternative of the conventional hypodermic needles. However, dissolving MNs require many minutes to be dissolved in the skin and typically have difficulty being fully inserted into the skin, which may lead to the low drug delivery efficiency. To address these issues, we introduce rapidly separating MNs that can rapidly deliver drugs into the skin in a minimally invasive way. For the rapidly separating MNs, drug loaded dissolving MNs are mounted on the top of solid MNs, which are made of biodegradable polylactic acid which eliminate the biohazardous waste. These MNs have sufficient mechanical strength to be inserted into the skin with the drug loaded tips fully embedded for subsequent dissolution. Compared with the traditional MNs, rapidly separating MNs achieve over 90% of drug delivery efficiency in 30s while the traditional MNs needs 2min to achieve the same efficiency. With the in vivo test in mice, the micro-holes caused by rapidly separating MNs can heal in 1h, indicating that the rapidly separating MNs are safe for future applications. These results indicate that the design of rapidly separating dissolvable MNs can offer a quick, high efficient, convenient, safe and potentially self-administered method of drug delivery. Polymer microneedles offer an attractive, painless and minimally invasive approach for transdermal drug delivery. However, dissolving microneedles require many minutes to be dissolved in the skin and typically have difficulty being fully inserted into the skin due to the skin deformation, which may lead to the low drug delivery efficiency. In this work we proposed rapidly separating microneedles which can deliver over 90% of drug into the skin in 30s. The in vitro and in vivo results indicate that the new design of these microneedles can offer a quick, high efficient, convenient and safe method for transdermal drug delivery. Copyright © 2016 Acta Materialia Inc

  4. Histological demonstration of healing in experimental aneurysms.

    Science.gov (United States)

    Killer, M; Plenk, H; Minnich, B; Al-Schameri, R; Lametschwantner, A; Richling, B

    2009-08-01

    Recanalisation of aneurysms after interventional therapy is still an unsolved problem. The aim of this study is to demonstrate the angiographic and histological evidence of healing after endovascular embolisation of experimental aneurysms. We evaluated the healing reaction in experimental aneurysms treated with HydroCoils and platinum coils. After microsurgical construction of aneurysms in 24 rabbits, embolisation was performed. Four animals were sacrificed immediately after embolisation and 5 after 1 month, 3 months and 6 months, respectively, the remaining served as control group. Serial plastic-embedded ground sections of the parent arteries-aneurysm complexes were evaluated by light microscopy. Thrombus organisation in the aneurysms resulted in fibrovascular tissue formation between bare platinum and HydroCoils from the walls of the aneurysms towards the centre of the sac over time. In the clefts between HydroCoils only thin strands of granulation tissue were observed. From one month on, there was a neointimal layer covering the coil mass at the aneurysm orifice. Progressive occlusion by the expanding hydrogel polymers on the coils seemed to result in a durable healing reaction in the aneurismal sac in a short-term follow-up period. Georg Thieme Verlag KG Stuttgart * New York.

  5. In vitro wound healing activity of luteolin

    Directory of Open Access Journals (Sweden)

    Z. Bayrami

    2017-11-01

    Full Text Available Background and objectives: Luteolin (3′,4′,5,7-tetrahydroxy flavone is one of the most common flavones, which is naturally found in several edible plants and traditional medicine. It is known as a non-toxic compound with anti-inflammatory, antinociceptive, anticarcinogenic, antimutagenic, and antiangiogenic properties. Luteolin has antiproliferative activity against different human hormone dependent cancer cells e.g. breast, prostate, and thyroid. Due to its bacteriostatic properties  and strong antioxidant potential, luteolin is valuable in the management of diverse diseases including peptic ulcers. There are some evidences on wound healing effect of luteolin on diabetic rats and in this work, an in vitro model of wound healing was used to study the wound healing effect of luteolin. Methods: Different concentrations of luteolin were applied in MTT and scratch assay on 3T3 fibroblast cells. FBS-free medium was used as the negative control. Cell proliferation and migration during scratch contraction was calculated. Annexin V and cell cycle analyses were performed to study the effect of luteolin on cell proliferation. Result: The results showed that, scratch contraction was observed significantly (p

  6. Hyperbaric hyperoxia accelerates fracture healing in mice.

    Directory of Open Access Journals (Sweden)

    Shigeo Kawada

    Full Text Available Increased oxygen tension influences bone metabolism. This study comprised two main experiments: one aimed to determine the bone mineral apposition and bone formation rates in vivo under hyperbaric hyperoxia (HBO, and the other aimed to evaluate the effects of exposure to HBO on fracture healing. In experiment 1, male mice were exposed to HBO [90 min/day at 90% O₂ at 2 atmospheres absolute (ATA for 5 days]. In experiment 2, an open femur fracture model was created in mice, followed by exposure to HBO 5 times/week (90 min/day at 90% O₂ at 2 ATA for 6 weeks after surgery. In experiment 1, HBO treatment significantly increased the mineral apposition and bone formation rates in the lumbar vertebra and femur and type 1 collagen alpha 1 and alkaline phosphatase mRNA expression in the lumbar vertebra. In experiment 2, at 2 weeks after fracture, the fracture callus was significantly larger in the HBO group than in the non-HBO group. Furthermore, at 4 and 6 weeks after fracture, radiographic findings showed accelerated fracture healing in the HBO group. At 6 weeks after fracture, femur stiffness and maximum load were significantly higher in the HBO group than in the non-HBO group. Urinary 8-hydroxy-2'-deoxyguanosine and plasma calcium concentrations were not significantly different between groups. These results suggest that exposure to HBO enhances bone anabolism and accelerates fracture healing without causing oxidative DNA damage or disruption of plasma calcium homeostasis.

  7. Fracture healing in HIV-positive populations.

    Science.gov (United States)

    Richardson, J; Hill, A M; Johnston, C J C; McGregor, A; Norrish, A R; Eastwood, D; Lavy, C B D

    2008-08-01

    Highly active anti-retroviral therapy has transformed HIV into a chronic disease with a long-term asymptomatic phase. As a result, emphasis is shifting to other effects of the virus, aside from immunosuppression and mortality. We have reviewed the current evidence for an association between HIV infection and poor fracture healing. The increased prevalence of osteoporosis and fragility fractures in HIV patients is well recognised. The suggestion that this may be purely as a result of highly active anti-retroviral therapy has been largely rejected. Apart from directly impeding cellular function in bone remodelling, HIV infection is known to cause derangement in the levels of those cytokines involved in fracture healing (particularly tumour necrosis factor-alpha) and appears to impair the blood supply of bone. Many other factors complicate this issue, including a reduced body mass index, suboptimal nutrition, the effects of anti-retroviral drugs and the avoidance of operative intervention because of high rates of wound infection. However, there are sound molecular and biochemical hypotheses for a direct relationship between HIV infection and impaired fracture healing, and the rewards for further knowledge in this area are extensive in terms of optimised fracture management, reduced patient morbidity and educated resource allocation. Further investigation in this area is overdue.

  8. Influence of suturing material on wound healing: Experimental study in dogs

    Directory of Open Access Journals (Sweden)

    Gazivoda Dragan

    2015-01-01

    Full Text Available Background/Aim. The most common materials implanted in the human organism are suture materials that are classified on the basis of several criteria, usually the origin, structure, and properties. The properties of suture materials are related to its absorbability and non-absorbability. When using resorbable materials it is of great importance to determine whether its absorbability and tensile strength help wound healing in function of time. Sutures themselves can become a source of inflammation, that may reduce or compromise the potential of reparation and regeneration. The aim of this experimental study on dogs was to ascertain whether the absorption rate and the degree of local tissue reactions differ from information provided by the manufacturers, whether there are differences between the applied suture materials and which of the used suture materials have better effect on wound healing. Methods. Experimental testing of the selected suture materials basic characteristics was performed on 6 German Shepherd dogs, which, after induction of general anesthesia, were made 3 identical incisions each in all 4 quadrants (left and right side of the upper and lower jaws, so that 12 horizontal incisions were formed, 10 mm long, 20-25 mm distant from one another, on each animal. Randomly, incisions were stitched up in the following order, starting from back to front: catgut, Dexon®, Vicryl-Rapid®. The experiment was terminated by histopathological examination of tissue samples, taken on postoperative day 3, 7, 14 and 21 in order to identify the effect of healing and the degree of local reaction. Results. The obtained results suggest that catgut has the highest absorption rate, while Dexon® the lowest. Vicryl-Rapid® causes the lowest level of local reactions, while Dexon® the highest. Conclusion. There is no ideal suture material because various patient factors also influence the wound healing process.

  9. Nuclear expression of IL-33 in epidermal keratinocytes promotes wound healing in mice.

    Science.gov (United States)

    Oshio, Tomoyuki; Komine, Mayumi; Tsuda, Hidetoshi; Tominaga, Shin-Ichi; Saito, Hirohisa; Nakae, Susumu; Ohtsuki, Mamitaro

    2017-02-01

    Skin is the outermost tissue of the human body, and works as a mechanical, chemical, and biological barrier. The epidermis is the uppermost layer of the skin, and keratinocytes constitute the majority of epidermal cells. Wounds are disruptions of skin integrity, and cause tremendous disadvantages to humans; accordingly, rapid wound healing is very important. Interleukin (IL)-33 is expressed in barrier tissue cells, such as epithelial and endothelial cells. Upon injury, IL-33 is released to stimulate immune cells, functioning as an "alarmin." ST2 is a receptor for IL-33; its soluble form (s)ST2 acts as a decoy receptor and competes for IL-33 binding. We aimed to clarify the role of IL-33 in wound healing. Wild-type (WT), IL-33 knockout (IL33 KO) mice, and sST2 transgenic (Tg) mice were wounded with a 4-mm punch, and the wound healing process was compared. Immunohistochemical analyses were performed to detect macrophages, neutrophils, and mast cells. Total RNA was extracted from the skin samples and real-time PCR was performed. An in vitro scratch wound assay was performed. Wound healing was delayed in IL33 KO mice compared to WT mice, while wound healing in sST2 Tg mice was comparable to that of WT mice. A histological examination showed delayed elongation of the epidermal tongue in IL-33 KO mice. An immunohistochemical study revealed prolonged neutrophilic infiltration at a later stage in IL-33 KO mice. IL-6, IL-1β, and CXCL1 transcripts were more abundant in the wounds of IL-33 KO mice than WT mice. Intraperitoneal administration of an NFκB inhibitor to IL-33 KO mice normalized the delayed wound healing and the enhanced expression of IL-6 in IL-33 KO mice. Epidermal keratinocytes from IL-33 KO mice showed delayed wound closure compared to those from WT mice. Our results indicate that nuclear IL-33, but not IL-33 as a cytokine, has beneficial effects on wound healing in mice, probably by suppressing NFκB to inhibit excessive inflammation and by maintaining

  10. Naturally occurring Tyzzer's disease in a calf.

    Science.gov (United States)

    Ikegami, T; Shirota, K; Une, Y; Nomura, Y; Wada, Y; Goto, K; Takakura, A; Itoh, T; Fujiwara, K

    1999-05-01

    Naturally occurring Clostridium piliforme infection (Tyzzer's disease) was found in a calf. Light microscopic examination revealed multifocal coagulative necrosis in the liver, catarrhal gastroenteritis, tracheitis and pneumonia, and thymic atrophy. Warthin-Starry staining clearly showed large filamentous bacilli in bundles or criss-cross patterns within the hepatocytes and epithelium and smooth muscle cells of the ileum and cecum. Immunohistochemistry using anti-C. piliforme RT and MSK strain antisera showed positive reaction against the bacilli. Electron microscopic examination revealed bacilli within the hepatocytes that demonstrated a characteristic vegetative form, with peritrichous flagella, and spores. The polymerase chain reaction (PCR) study using the paraffin-embedded liver sections, the 196-bp DNA fragment specific to 16S ribosomal RNA of C. piliforme was amplified. The characteristics of these bacilli are consistent with those of of C. piliforme. The PCR technique using paraffin-embedded sections should be useful for confirming C. piliforme infection in spontaneous cases.

  11. Does dietary learning occur outside awareness?

    Science.gov (United States)

    Brunstrom, Jeffrey M

    2004-09-01

    Several forms of dietary learning have been identified in humans. These include flavor-flavor learning, flavor-postingestive learning (including flavor-caffeine learning), and learned satiety. Generally, learning is thought to occur in the absence of contingency (CS-US) or demand awareness. However, a review of the literature suggests that this conclusion may be premature because measures of awareness lack the rigor that is found in studies of other kinds of human learning. If associations do configure outside awareness then this should be regarded as a rare instance of automatic learning. Conversely, if awareness is important, then successful learning may be governed by an individual's beliefs and predilection to attend to stimulus relationships. For researchers of dietary learning this could be critical because it might explain why learning paradigms have a reputation for being unreliable. Since most food preferences are learned, asking questions about awareness can also tell us something fundamental about everyday dietary control.

  12. Pilomyxoid Astrocytoma Occurring in the Third Ventricle

    Directory of Open Access Journals (Sweden)

    Sanghyeon Kim

    2015-01-01

    Full Text Available Pilomyxoid astrocytoma (PMA is a rare central nervous system tumor that has been included in the 2007 World Health Organization Classification of Tumors of the Central Nervous System. Due to its more aggressive behavior, PMA is classified as Grade II neoplasm by the World Health Organization. PMA predominantly affects the hypothalamic/chiasmatic region and occurs in children (mean age of occurrence = 10 months. We report a case of a 24-year-old man who presented with headache, nausea, and vomiting. Brain CT and MRI revealed a mass occupying only the third ventricle. We performed partial resection. Histological findings, including monophasic growth with a myxoid background, and absence of Rosenthal fibers or eosinophilic granular bodies, as well as the strong positivity for glial fibrillary acidic protein were consistent with PMA.

  13. Covariate Balancing through Naturally Occurring Strata.

    Science.gov (United States)

    Alemi, Farrokh; ElRafey, Amr; Avramovic, Ivan

    2016-12-14

    To provide an alternative to propensity scoring (PS) for the common situation where there are interacting covariates. We used 1.3 million assessments of residents of the United States Veterans Affairs nursing homes, collected from January 1, 2000, through October 9, 2012. In stratified covariate balancing (SCB), data are divided into naturally occurring strata, where each stratum is an observed combination of the covariates. Within each stratum, cases with, and controls without, the target event are counted; controls are weighted to be as frequent as cases. This weighting procedure guarantees that covariates, or combination of covariates, are balanced, meaning they occur at the same rate among cases and controls. Finally, impact of the target event is calculated in the weighted data. We compare the performance of SCB, logistic regression (LR), and propensity scoring (PS) in simulated and real data. We examined the calibration of SCB and PS in predicting 6-month mortality from inability to eat, controlling for age, gender, and nine other disabilities for 296,051 residents in Veterans Affairs nursing homes. We also performed a simulation study, where outcomes were randomly generated from treatment, 10 covariates, and increasing number of covariate interactions. The accuracy of SCB, PS, and LR in recovering the simulated treatment effect was reported. In simulated environment, as the number of interactions among the covariates increased, SCB and properly specified LR remained accurate but pairwise LR and pairwise PS, the most common applications of these tools, performed poorly. In real data, application of SCB was practical. SCB was better calibrated than linear PS, the most common method of PS. In environments where covariates interact, SCB is practical and more accurate than common methods of applying LR and PS. © Health Research and Educational Trust.

  14. Identifying, managing and preventing skin maceration: a rapid review of the clinical evidence.

    Science.gov (United States)

    Whitehead, F; Giampieri, S; Graham, T; Grocott, P

    2017-04-02

    To identify the clinical empirical evidence for identifying, managing and preventing skin maceration in human subjects. A rapid review of the current literature was undertaken between 5 September and 19 September 2016 using the electronic databases CINAHL, MEDLINE, PUBMED and Cochrane, with the key words: skin macerat*, wound macerat*, moisture associated skin damage, wound exudate and hyper-hydration of skin, Results: Of 526 papers found using an electronic database search, four were identified as fitting the search parameters, and a further two were retrieved from a manual search of reference lists. There were three themes that emerged: how to identify and measure maceration, how to manage and reduce maceration once it has already occurred, and how to prevent skin maceration. Hyper-hydration can reach greater skin depths than previously thought, thus engendering more extensive damage potential, which in turn can impact on treatments and healing time. Realistically, the deeper the hyper-hydration issue, the more extensive the damage and it will take longer to recover-a problem compounded if the hyper-hydration is due to incontinence and skin is also exposed to urine and/or faeces. In relation to wound management, the authors advocate the removal of moisture away from the wound or skin, either through superabsorbent dressings, or by allowing the excess moisture to evaporate through semi-permeable dressings to reduce maceration, enhance patient comfort and encourage healing. However, we found no evidence regarding the limits of hydration of the dermis and epidermis and thereby the optimal conditions for managing exuding wounds and promoting skin health. Each of the six papers in this review calls for further research to help identify, treat and prevent maceration. Maceration causes patients' discomfort and pain as well as prolonging healing time and deserves more focused research. This rapid review highlights how limited the clinical empirical research is on

  15. A review on self-healing in reinforced concrete structures in view of serving conditions.

    OpenAIRE

    Huang, H.; Ye, G.

    2014-01-01

    In this paper, different mechanisms of self-healing, i.e. self-healing based on adhesive agents, self-healing based on bacteria, self-healing based on autogenous self-healing were described. Their required conditions were summarized. The previous investigations showed that all mechanisms of self-healing are effective to some extend under particular conditions. In this paper, concrete structures were categorized according to serving conditions. Potential self-healing mechanisms are pointed out...

  16. Wound Healing Angiogenesis: Innovations and Challenges in Acute and Chronic Wound Healing

    Science.gov (United States)

    Demidova-Rice, Tatiana N.; Durham, Jennifer T.; Herman, Ira M.

    2012-01-01

    Background Formation of new blood vessels, by either angiogenesis or vasculogenesis, is critical for normal wound healing. Major processes in neovascularization include (i) growth-promoting or survival factors, (ii) proteolytic enzymes, (iii) activators of multiple differentiated and progenitor cell types, and (iv) permissible microenvironments. A central aim of wound healing research is to “convert” chronic, disease-impaired wounds into those that will heal. The problem Reduced ability to re-establish a blood supply to the injury site can ultimately lead to wound chronicity. Basic/Clinical Science Advances (1) Human fetal endothelial progenitor cells can stimulate wound revascularization and repair following injury, as demonstrated in a novel mouse model of diabetic ischemic healing. (2) Advances in bioengineering reveal exciting alternatives by which wound repair may be facilitated via the creation of vascularized microfluidic networks within organ constructs created ex vivo for wound implantation. (3) A “personalized” approach to regenerative medicine may be enabled by the identification of protein components present within individual wound beds, both chronic and acute. Clinical Care Relevance Despite the development of numerous therapies, impaired angiogenesis and wound chronicity remain significant healthcare problems. As such, innovations in enhancing wound revascularization would lead to significant advances in wound healing therapeutics and patient care. Conclusion Insights into endothelial progenitor cell biology together with developments in the field of tissue engineering and molecular diagnostics should not only further advance our understanding of the molecular mechanisms regulating wound repair but also offer innovative solutions to promote the healing of chronic and acute wounds in vivo. PMID:24527273

  17. Introduction to naturally occurring radioactive material

    Energy Technology Data Exchange (ETDEWEB)

    Egidi, P.

    1997-08-01

    Naturally occurring radioactive material (NORM) is everywhere; we are exposed to it every day. It is found in our bodies, the food we eat, the places where we live and work, and in products we use. We are also bathed in a sea of natural radiation coming from the sun and deep space. Living systems have adapted to these levels of radiation and radioactivity. But some industrial practices involving natural resources concentrate these radionuclides to a degree that they may pose risk to humans and the environment if they are not controlled. Other activities, such as flying at high altitudes, expose us to elevated levels of NORM. This session will concentrate on diffuse sources of technologically-enhanced (TE) NORM, which are generally large-volume, low-activity waste streams produced by industries such as mineral mining, ore benefication, production of phosphate Fertilizers, water treatment and purification, and oil and gas production. The majority of radionuclides in TENORM are found in the uranium and thorium decay chains. Radium and its subsequent decay products (radon) are the principal radionuclides used in characterizing the redistribution of TENORM in the environment by human activity. We will briefly review other radionuclides occurring in nature (potassium and rubidium) that contribute primarily to background doses. TENORM is found in many waste streams; for example, scrap metal, sludges, slags, fluids, and is being discovered in industries traditionally not thought of as affected by radionuclide contamination. Not only the forms and volumes, but the levels of radioactivity in TENORM vary. Current discussions about the validity of the linear no dose threshold theory are central to the TENORM issue. TENORM is not regulated by the Atomic Energy Act or other Federal regulations. Control and regulation of TENORM is not consistent from industry to industry nor from state to state. Proposed regulations are moving from concentration-based standards to dose

  18. Medicinal significance of naturally occurring cyclotetrapeptides.

    Science.gov (United States)

    Abdalla, Muna Ali

    2016-10-01

    Bioactive natural products are serendipitous drug candidates, which stimulate synthetic approaches for improving and supporting drug discovery and development. Therefore, the search for bioactive metabolites from different natural sources continues to play an important role in fashioning new medicinal agents. Several cyclic peptides were produced by organisms, such as β-defensins, gramicidin S, and tyrocidine A, and exhibited a wide range of bioactivities, such as antiviral activity against HIV-1, influenza A viruses, or antibacterial activity. Cyclic tetrapeptides are a class of natural products that were found to have a broad range of biological activities, promising pharmacokinetic properties, as well as interesting conformational dynamics and ability of slow inter-conversion to several different structures. Cyclooligopeptides, particularly medium ring-sized peptides, were obtained from marine microorganisms and exhibited a wide range of pharmacological properties, including antimicrobial and anti-dinoflagellate activities, cytotoxicity, and inhibitory activity against enzyme sortase B. Most of the naturally occurring cyclotetrapeptides are obtained from fungi. Some natural cyclic tetrapeptides were found to inhibit histone deacetylase (HDAC), which regulate the expression of genes. These compounds are very useful as cancer therapeutics. Various analogues of the natural cyclotetrapeptides were successfully synthesized to find novel lead compounds for pharmacological and biotechnological applications. Therefore, in this review, previously reported novel natural cyclotetrapeptides are briefly discussed, along with their important biological activities as drug candidates, together with their promising therapeutic properties. Moreover, their future perspective in drug discovery as potential therapeutic agents will be determined.

  19. A comparative study on long term stability of self-healing epoxy coating with different inorganic nanotubes as healing agent reservoirs

    Directory of Open Access Journals (Sweden)

    P. P. Vijayan

    2017-11-01

    Full Text Available Self-healing epoxy coatings were prepared with different nanotubes as reservoirs for epoxy monomer (healing agent. The nanotubes selected for the current study were TiO2 nanotubes with two different tube diameter (TNT1 and TNT2 and naturally occurring hallyosite nanotubes (HNT. These self-healing coatings were subjected to accelerated weathering exposure. The weathering stability of the coatings were observed. The surface morphology, chemical changes and surface roughness were studied as a function of weathering exposure period. These studies confirmed that the long term stability of the coatings highly depend on the nanotube parameters such as nature, surface area and diameter. It was found that the photocatalytic degradation of epoxy matrix with TiO2 nanotubes was prominent in TNT1 filled coating compared with their TNT2 variant. The higher possibility of exposure of epoxy monomer encapsulated inside both HNT and TNT2 facilitated the cure reaction with UV light to create new chains during weathering.

  20. Boric Acid Reduces the Formation of DNA Double Strand Breaks and Accelerates Wound Healing Process.

    Science.gov (United States)

    Tepedelen, Burcu Erbaykent; Soya, Elif; Korkmaz, Mehmet

    2016-12-01

    Boron is absorbed by the digestive and respiratory system, and it was considered that it is converted to boric acid (BA), which was distributed to all tissues above 90 %. The biochemical essentiality of boron element is caused by boric acid because it affects the activity of several enzymes involved in the metabolism. DNA damage repair mechanisms and oxidative stress regulation is quite important in the transition stage from normal to cancerous cells; thus, this study was conducted to investigate the protective effect of boric acid on DNA damage and wound healing in human epithelial cell line. For this purpose, the amount of DNA damage occurred with irinotecan (CPT-11), etoposide (ETP), doxorubicin (Doxo), and H2O2 was determined by immunofluorescence through phosphorylation of H2AX((Ser139)) and pATM((Ser1981)) in the absence and presence of BA. Moreover, the effect of BA on wound healing has been investigated in epithelial cells treated with these agents. Our results demonstrated that H2AX((Ser139)) foci numbers were significantly decreased in the presence of BA while wound healing was accelerated by BA compared to that in the control and only drug-treated cells. Eventually, the results indicate that BA reduced the formation of DNA double strand breaks caused by agents as well as improving the wound healing process. Therefore, we suggest that boric acid has important therapeutical effectiveness and may be used in the treatment of inflammatory diseases where oxidative stress and wound healing process plays an important role.

  1. The cultural diversity of healing: meaning, metaphor and mechanism.

    Science.gov (United States)

    Kirmayer, Laurence J

    2004-01-01

    This chapter reviews the great diversity of healing practices found around the world and represented in most urban centres. A general model of healing is presented that includes both the physiological processes central to biomedical theory and practice and the symbolic aspects of healing that have physiological, psychological and social effects. Work on the theory of metaphor in cognitive science provides a way to understand the transformation of experience across levels of sensory, affective and conceptual meaning. Healing rituals and other symbolic action can thus have effects on physiology, experience, interpersonal interaction and social positioning. Complementary medicine and traditional forms of healing are attractive to many individuals both because of the limitations of biomedicine and their metaphoric logic of transformation, which promises wholeness, balance and well-being. Participation in specific healing traditions may also contribute to individual and collective identity.

  2. The Effect of Oral Medication on Wound Healing.

    Science.gov (United States)

    Levine, Jeffrey M

    2017-03-01

    The purpose of this learning activity is to provide information about the effects of oral medications on wound healing. This continuing education activity is intended for physicians, physician assistants, nurse practitioners, and nurses with an interest in skin and wound care. After participating in this educational activity, the participant should be better able to:1. Identify oral medications that aid in wound healing.2. Recognize oral medications that interfere with wound healing. Given the accelerated medical discoveries of recent decades, there is a surprising lack of oral medications that directly improve wound healing. Of the oral medications available, most target ancillary aspects of wound care such as pain management, infection mitigation, and nutrition. This article describes oral pharmacologic agents intended to build new tissue and aid in wound healing, as well as an introduction to oral medications that interfere with wound healing. This review will not discuss the pharmacology of pain management or treatment of infection, nor will it address nutritional supplements.

  3. Healing of the bone with anti-fracture drugs.

    Science.gov (United States)

    Vannucci, Letizia; Brandi, Maria Luisa

    2016-12-01

    Fracture healing is a complex physiological process. As impaired fracture healing is more frequent in osteoporotic subjects, anti-osteoporotic drugs could have some impact on this process. Areas covered: We reviewed the current literature to evaluate the effects of these drugs on fracture healing and their potential role in supporting this process, especially when impaired. A PubMed/Medline search was undertaken combining the terms 'fracture healing', 'anti-resorptive drugs', 'anabolic agents', 'anti-osteoporotic drugs'. Expert opinion: As clinical evidence on the role of anti-osteoporotic drugs in the process of fracture healing consists mainly of case reports or studies with a relatively small number of patients, large randomized clinical trials are needed in order to extend to the human setting the promising results on these agents as inductors or co-adjuvants of bone healing derived from animal studies.

  4. Impaired cutaneous wound healing in mice lacking tetranectin

    DEFF Research Database (Denmark)

    Iba, Kousuke; Hatakeyama, Naoko; Kojima, Takashi

    2009-01-01

    . However, those of tetranectin-null mice never showed complete reepithelialization at 14 days. At 21 days after the injury, the wound healed and was covered with an epidermis. These results supported the fact that tetranectin may play a role in the wound healing process....... disruption of the tetranectin gene to elucidate the biological function of tetranectin. In this study, we showed that wound healing was markedly delayed in tetranectin-null mice compared with wild-type mice. A single full-thickness incision was made in the dorsal skin. By 14 days after the incision......, the wounds fully healed in all wild-type mice based on the macroscopic closure; in contrast, the progress of wound healing in the tetranectin null mice appeared to be impaired. In histological analysis, wounds of wild-type mice showed complete reepithelialization and healed by 14 days after the incision...

  5. Complements and the Wound Healing Cascade: An Updated Review

    Directory of Open Access Journals (Sweden)

    Hani Sinno

    2013-01-01

    Full Text Available Wound healing is a complex pathway of regulated reactions and cellular infiltrates. The mechanisms at play have been thoroughly studied but there is much still to learn. The health care system in the USA alone spends on average 9 billion dollars annually on treating of wounds. To help reduce patient morbidity and mortality related to abnormal or prolonged skin healing, an updated review and understanding of wound healing is essential. Recent works have helped shape the multistep process in wound healing and introduced various growth factors that can augment this process. The complement cascade has been shown to have a role in inflammation and has only recently been shown to augment wound healing. In this review, we have outlined the biology of wound healing and discussed the use of growth factors and the role of complements in this intricate pathway.

  6. A self-healing polymer composite for extended fatigue life

    Energy Technology Data Exchange (ETDEWEB)

    Brown, E. N. (Eric N.); Jones, A. S. (Alan S.); White, S. R. (Scott R.); Sottos, Nancy R.

    2004-01-01

    A novel approach is explored for improving the fatigue life of thermosetting polymers through the addition of self-healing functionality. Thermosetting polymers are used in a wide variety of applications, but are susceptible to the initiation and propagation of small cracks deep within the structure where detection is difficult and repair is virtually impossible. The material under investigation is an epoxy matrix composite, which utilizes embedded microcapsules to store a healing agent and an embedded catalyst. A propagating crack exposes particles of catalyst and ruptures the microcapsules, which release healing agent into the crack plane. Polymerization of the healing agent is triggered by contact with the catalyst. Fatigue crack retardation and arrest from self-healing functionality result from crack-tip shielding mechanisms, such as hydrodynamic pressure and artificial-crack closure. In situ healing is observed to significantly extended fatigue life or permanently arrested fatigue crack growth over a wide range of loading conditions.

  7. Tibial tuberosity advancement in small-breed dogs using TTA Rapid implants: complications and outcome.

    Science.gov (United States)

    Dyall, B; Schmökel, H

    2017-06-01

    To assess the perioperative complications and the outcome when treating small-breed dogs with cranial cruciate ligament insufficiency with tibial tuberosity advancement using the TTA Rapid implant. 40 dogs (48 stifles) with cranial cruciate ligament insufficiency and body weight of 15 kg or less. Diagnosis was confirmed by arthroscopy or arthrotomy, followed by tibial tuberosity advancement surgery. Six weeks after surgery, the dogs were re-evaluated with clinical examination and radiography. Mid- to long-term outcome was assessed using client questionnaire. Intraoperative complications consisted of four osteotomy-related fissures through the cranial cortex; two complete fissures were stabilised with a screw, the others healed without intervention. After surgery there were two tibial fractures and two incisional complications. Six weeks postoperatively, limb function was good to excellent in 43 dogs (94%). Two late meniscal injuries occurred. The overall major complication rate was 7/48 14·6%). Mid- to long-term follow-up information was available for 43 stifles: 34 stifles (79%) were free of lameness at a median of 72 weeks postoperatively. The outcome was rated excellent by 88% of the clients and good by 7%. The use of TTA Rapid implants is an alternative for treatment of cranial cruciate ligament insufficiency in small-breed dogs, with complication rates comparable to those recorded in larger breeds and to other techniques, and with a high degree of owner satisfaction. © 2017 British Small Animal Veterinary Association.

  8. Wound healing and hyper-hydration - a counter intuitive model

    OpenAIRE

    Ousey, Karen; Cutting, Keith

    2016-01-01

    Winters seminal work in the 1960s relating to providing an optimal level of moisture to aid wound healing (granulation and re-epithelialisation) has been the single most effective advance in wound care over many decades. As such the development of advanced wound dressings that manage the fluidic wound environment have provided significant benefits in terms of healing to both patient and clinician. Although moist wound healing provides the guiding management principle confusion may arise betwe...

  9. Wound Healing Activity of a New Formulation from Platelet Lysate

    OpenAIRE

    Akram Jamshidzadeh; Omid Koohi Hosseinabadi; Reza Heidari; Soliman Mohammadi-Samani; Sara Rajabzadeh; Seyed Mojtaba Seyed Raoufi; Alireza Ahmadi Vadeghani

    2016-01-01

    Platelet-rich plasma (PRP) is an attractive preparation in regenerative medicine due to its potential role in the healing process in different experimental models. This study was designed to investigate the wound healing activity of a new formulation of PRP. Different gel-based formulations of PRP were prepared. Open excision wounds were made on the back of male Sprague-Dawley rats, and PRP gel was administered topically once daily until the wounds healed completely (12 days). The results rev...

  10. A Multiple-Action Self-Healing Coating

    OpenAIRE

    Alexander eLutz; Alexander eLutz; Otto evan den Berg; Jan eWielant; Iris eDe Graeve; Herman eTerryn

    2016-01-01

    This paper describes a self-healing coating for corrosion protection of metals which combines two different types of self-healing mechanisms in one coating with multiple-healing functionality. 2-Mercaptobenzothiazole (MBT) was loaded into layered double hydroxide (LDH) carriers which were mixed into an acrylated polycaprolactone polyurethane based shape recovery coating and applied on Hot Dip Galvanized steel (HDG). The effect of triggered release of MBT on the protection of HDG became visibl...

  11. A Multiple-Action Self-Healing Coating

    OpenAIRE

    Lutz, Alexander; van den Berg, Otto; Wielant, Jan; De Graeve, Iris; Terryn, Herman

    2016-01-01

    This article describes a self-healing coating for corrosion protection of metals, which combines two different types of self-healing mechanisms in one coating with multiple-healing functionality. 2-Mercaptobenzothiazole (MBT) was loaded into layered double hydroxide (LDH) carriers that were mixed into an acrylated polycaprolactone polyurethane-based shape-recovery coating and applied on hot-dip galvanized steel (HDG). The effect of triggered release of MBT on the protection of HDG became visi...

  12. The healing of damage after the plastic deformation of metals

    Directory of Open Access Journals (Sweden)

    S.V. Smirnov

    2013-04-01

    Full Text Available The general regularities of damage healing during the annealing after cold deformation of metal materials are presented in this paper. In categories of damage mechanics the kinetic equations of damage healing during recovery and recrystallization are formulated. Diagrams of damage healing for some metal alloys are presented. The example of use of investigation results for optimization of industrial technology of pipes drawing is presented.

  13. Healing through differentiation: a pastoral care and counseling perspective.

    Science.gov (United States)

    VanKatwyk, P L

    1997-01-01

    Focuses on the function of healing as central to the cure-of-souls tradition of pastoral care and counseling and describes two prominent but contrary styles of healing in ministry. Proposes an interactional model of pastoral care which integrates the two healing styles of compassion and competence through the principle of differentiation, drawing from the perspective of constructivism as practiced in narrative therapy and the theory of natural systems as applied to the role of the pastor.

  14. Chronic kidney disease is associated with high abdominal incisional hernia rates and wound healing disturbances.

    Science.gov (United States)

    Heller, Andreas; Westphal, Saskia E; Bartsch, Peter; Haase, Michael; Mertens, Peter R

    2014-06-01

    Incisional hernias are among the most frequent complications following abdominal surgery with impact on morbidity and mortality rates. Elevated uremia toxins may inhibit granulation tissue formation and impair wound healing, thereby promoting incisional hernia development. Here, we quantified the hazard ratio for incisional hernia prevalence in patients at risk undergoing abdominal reoperations with interrelationship to kidney function. In the same cohort, incidence rates for de novo wound healing disturbances within a4-month follow-up period were determined. Upon hospitalization for elective abdominal surgery in a university hospital (tertiary medical center), past medical histories were recorded in 251 patients and incisional hernia prevalence rates were calculated. Known modifiers for hernia formation as well as laboratory values for estimated glomerular filtration rate (eGFR) were recorded. The status of wound healing was assessed by a blinded investigator 4 months postoperatively. Chronic kidney disease(CKD) was defined as eGFR healing disorder, multivariate regression analyses were performed. The incisional hernia prevalence was 24.3 % in the overall cohort. Patients with CKD (32/251; 12.8 %)were more likely to suffer from incisional hernias with an odds ratio (OR) of 2.8 ([95 % CI 1.2-6.1]; p = 0.014) than patients with eGFR >60 ml/min (219/251; 88.2 %). In multivariate analyses, CKD proved to be an independent risk factor for incisional hernia development with an OR similar to obesity (BMI>25; OR 2.6 [95 % CI 1.3-5.1];p = 0.007). In the prospective analysis, disturbed wound healing occurred in 32 of 251 (12.8 %) patients undergoing abdominal operations. Frequency of wound healing was increased when CKD was present (8/32; 25 %; OR 2.3[95 % CI 1.1–6.7]; p = 0.026) compared to patients with eGFR>60 ml/min (24/219; 11 %). Chronic kidney disease is associated with impaired wound healing and constitutes an independent risk factor for incisional hernia

  15. Sundew adhesive: a naturally occurring hydrogel.

    Science.gov (United States)

    Huang, Yujian; Wang, Yongzhong; Sun, Leming; Agrawal, Richa; Zhang, Mingjun

    2015-06-06

    Bioadhesives have drawn increasing interest in recent years, owing to their eco-friendly, biocompatible and biodegradable nature. As a typical bioadhesive, sticky exudate observed on the stalked glands of sundew plants aids in the capture of insects and this viscoelastic adhesive has triggered extensive interests in revealing the implied adhesion mechanisms. Despite the significant progress that has been made, the structural traits of the sundew adhesive, especially the morphological characteristics in nanoscale, which may give rise to the viscous and elastic properties of this mucilage, remain unclear. Here, we show that the sundew adhesive is a naturally occurring hydrogel, consisting of nano-network architectures assembled with polysaccharides. The assembly process of the polysaccharides in this hydrogel is proposed to be driven by electrostatic interactions mediated with divalent cations. Negatively charged nanoparticles, with an average diameter of 231.9 ± 14.8 nm, are also obtained from this hydrogel and these nanoparticles are presumed to exert vital roles in the assembly of the nano-networks. Further characterization via atomic force microscopy indicates that the stretching deformation of the sundew adhesive is associated with the flexibility of its fibrous architectures. It is also observed that the adhesion strength of the sundew adhesive is susceptible to low temperatures. Both elasticity and adhesion strength of the sundew adhesive reduce in response to lowering the ambient temperature. The feasibility of applying sundew adhesive for tissue engineering is subsequently explored in this study. Results show that the fibrous scaffolds obtained from sundew adhesive are capable of increasing the adhesion of multiple types of cells, including fibroblast cells and smooth muscle cells, a property that results from the enhanced adsorption of serum proteins. In addition, in light of the weak cytotoxic activity exhibited by these scaffolds towards a variety of

  16. Information Needs While A Disaster Is Occurring

    Science.gov (United States)

    Perry, S. C.

    2010-12-01

    that rainfall intensity at their homes might be less than the intensity up in the mountains where the debris flows would start. Nor did they know that debris flows travel too quickly to be outrun. These and many other examples indicate need for social and natural scientists to increase awareness of what to expect when the disaster strikes. This information must be solidly understood before the event occurs - while a disaster is unfolding there are no teachable moments. Case studies indicate that even those who come into a disaster well educated about the phenomenon can struggle to apply what they know when the real situation is at hand. In addition, psychological studies confirm diminished ability to comprehend information at times of stress.

  17. Tibia Fracture Healing Prediction Using First-Order Mathematical Model

    OpenAIRE

    M Sridevi; Prakasam, P.; Kumaravel, S.; Madhava Sarma, P.

    2015-01-01

    The prediction of healing period of a tibia fracture in humans across limb using first-order mathematical model is demonstrated. At present, fracture healing is diagnosed using X-rays. Recent studies have demonstrated electric stimulation as a diagnostic tool in fracture healing. A DC electric voltage of 0.7 V was applied across the fracture and stabilized with Teflon coated carbon rings and the data was recorded at different time intervals until the fracture heals. The experimental data fitt...

  18. Wound healing activity of Elaeis guineensis leaf extract ointment.

    Science.gov (United States)

    Sasidharan, Sreenivasan; Logeswaran, Selvarasoo; Latha, Lachimanan Yoga

    2012-01-01

    Elaeis guineensis of the Arecaceae family is widely used in the traditional medicine of societies in West Africa for treating various ailments. To validate the ethnotherapeutic claims of the plant in skin diseases, wound healing activity was studied. The results showed that E. guineensis leaf extract had potent wound healing capacity as evident from the better wound closure (P guineensis in the treatment of the wound. E. guineensis accelerated wound healing in rats, thus supporting its traditional use. The result of this study suggested that, used efficiently, oil palm leaf extract is a renewable resource with wound healing properties.

  19. Chemokine Involvement in Fetal and Adult Wound Healing

    Science.gov (United States)

    Balaji, Swathi; Watson, Carey L.; Ranjan, Rajeev; King, Alice; Bollyky, Paul L.; Keswani, Sundeep G.

    2015-01-01

    Significance: Fetal wounds heal with a regenerative phenotype that is indistinguishable from surrounding skin with restored skin integrity. Compared to this benchmark, all postnatal wound healing is impaired and characterized by scar formation. The biologic basis of the fetal regenerative phenotype can serve as a roadmap to recapitulating regenerative repair in adult wounds. Reduced leukocyte infiltration, likely mediated, in part, through changes in the chemokine milieu, is a fundamental feature of fetal wound healing. Recent Advances: The contributions of chemokines to wound healing are a topic of active investigation. Recent discoveries have opened the possibility of targeting chemokines therapeutically to treat disease processes and improve healing capability, including the possibility of achieving a scarless phenotype in postnatal wounds. Critical Issues: Successful wound healing is a complex process, in which there is a significant interplay between multiple cell types, signaling molecules, growth factors, and extracellular matrix. Chemokines play a crucial role in this interplay and have been shown to have different effects in various stages of the healing process. Understanding how these chemokines are locally produced and regulated during wound healing and how the chemokine milieu differs in fetal versus postnatal wounds may help us identify ways in which we can target chemokine pathways. Future Directions: Further studies on the role of chemokines and their role in the healing process will greatly advance the potential for using these molecules as therapeutic targets. PMID:26543680

  20. Cultural Comparisons for Healing and Exorcism Narratives in Matthew's Gospel

    National Research Council Canada - National Science Library

    Keener, Craig S

    2010-01-01

    ...: stories of unusual cures and exorcisms of hostile spirits. Rather than simply allegorising these narratives, many Majority World readers treat them as models for experiencing healing and deliverance...

  1. A potential wound-healing-promoting peptide from salamander skin.

    Science.gov (United States)

    Mu, Lixian; Tang, Jing; Liu, Han; Shen, Chuanbin; Rong, Mingqiang; Zhang, Zhiye; Lai, Ren

    2014-09-01

    Although it is well known that wound healing proceeds incredibly quickly in urodele amphibians, such as newts and salamanders, little is known about skin-wound healing, and no bioactive/effector substance that contributes to wound healing has been identified from these animals. As a step toward understanding salamander wound healing and skin regeneration, a potential wound-healing-promoting peptide (tylotoin; KCVRQNNKRVCK) was identified from salamander skin of Tylototriton verrucosus. It shows comparable wound-healing-promoting ability (EC50=11.14 μg/ml) with epidermal growth factor (EGF; NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR) in a murine model of full-thickness dermal wound. Tylotoin directly enhances the motility and proliferation of keratinocytes, vascular endothelial cells, and fibroblasts, resulting in accelerated reepithelialization and granulation tissue formation in the wound site. Tylotoin also promotes the release of transforming growth factor β1 (TGF-β1) and interleukin 6 (IL-6), which are essential in the wound healing response. Gene-encoded tylotoin secreted in salamander skin is possibly an effector molecule for skin wound healing. This study may facilitate understanding of the cellular and molecular events that underlie quick wound healing in salamanders. © FASEB.

  2. Chemical reactions occurring during direct solar reduction of CO2.

    Science.gov (United States)

    Lyma, J L; Jensen, R J

    2001-09-28

    At high temperatures carbon dioxide may absorb solar radiation and react to form carbon monoxide and molecular oxygen. The CO, so produced, may be converted by well-established means to a combustible fuel, such as methanol. We intend to make a future demonstration of the solar reduction of CO2 based on these processes. This paper, however, addresses only the problem of preserving, or even enhancing, the initial photolytic CO by quenching the hot gas with colder H2O or CO2. We present model calculations with a reaction mechanism used extensively in other calculations. If a CO2 gas stream is heated and photolyzed by intense solar radiation and then allowed to cool slowly, it will react back to the initial CO2 by a series of elementary chemical reactions. The back reaction to CO2 can be terminated with the rapid addition of CO2, water, or a mixture. Calculations show that a three-fold quench with pure CO2 will stop the reactions and preserve over 90% of the initial photolytic CO. We find that water has one of two effects. It can either increase the CO level, or it can catalyze the recombination of O and CO to CO2. The gas temperature is the determining factor. If the quench gas is not sufficient to keep the temperature below approximately 1100 K, a chain-branching reaction dominates and the reaction to CO2 occurs. If the temperature stays below that level a chain terminating reaction dominates and the CO is increased. The former case occurs below approximately a fourfold quench with a water/CO2 mixture. The later case occurs when the quench is greater than fourfold. We conclude that CO2, H2O, or a mixture may quench the hot gas stream photolyzed by solar radiation and preserve the photolytic CO.

  3. Ekaterina Boldyreva, Healing and Upbringing Children

    OpenAIRE

    Churyumova, Elvira; Churyumov, Anton

    2017-01-01

    Ekaterina cures sick children. She says that she first heard about her curing abilities from an old woman called Bosya who lived in the village of Dzhalykovo. Being a teacher herself, Ekaterina did not believe what the old woman said. Bosya gave Ekaterina a coin with which she was supposed to massage sick children and said that Ekaterina’s healing gift came from her mother. She also asked Ekaterina to sew a pink robe. Ekaterina did what she was asked to do and came back to see the old woman. ...

  4. A review on self-healing in reinforced concrete structures in view of serving conditions.

    NARCIS (Netherlands)

    Huang, H.; Ye, G.

    2014-01-01

    In this paper, different mechanisms of self-healing, i.e. self-healing based on adhesive agents, self-healing based on bacteria, self-healing based on autogenous self-healing were described. Their required conditions were summarized. The previous investigations showed that all mechanisms of

  5. Local electrochemical evaluation of a self-healing coating based on encapsulated healing-agent

    NARCIS (Netherlands)

    González-García, Y.; García, S.J.; Fischer, H.R.; Hughes, A.E.; Mol, J.M.C.

    2011-01-01

    In this work local electrochemical techniques are introduced as powerful and complementary techniques for the in-situ evaluation of self-healing systems applied for the protection of metals against corrosion. Scanning vibrating electrode technique (SVET) and scanning electrochemical microscopy

  6. Early Periimplant Tissue Healing on 1-Piece Implants With a Concave Transmucosal Design: A Histomorphometric Study in Dogs.

    Science.gov (United States)

    Bolle, Caroline; Gustin, Marie-Paule; Fau, Didier; Exbrayat, Patrick; Boivin, Georges; Grosgogeat, Brigitte

    2015-10-01

    The purpose of our study was to investigate the early healing phase of marginal bone and soft tissues around unloaded 1-piece implants with a concave transmucosal design, in a dog model. Twenty-four 1-piece implants with a concave transmucosal neck were inserted 1 mm subcrestally in the mandibular ridge of 8 beagle dogs. Four animals were sacrificed after 3 and 12 weeks of healing. Histomorphometric analysis was performed to measure the height of the periimplant tissues. The overall height of the periimplant mucosa was, respectively, 2.67 and 2.52 mm, after 3 and 12 weeks. In the connective tissue, a soft tissue O-ring seal was observed in the healing area provided by the transmucosal concavity, after 12 weeks. The location of the first bone-to-implant contact facing the implant shoulder was 0.00 and +0.18 mm, respectively, after 3 and 12 weeks of healing. Some bone apposition occurred on the implant shoulder during the healing. Within the limits of the present study, a concave transmucosal design in 1-piece implants was associated with a short vertical value of biological width and promoted a mechanical interlocking of the implant body at the connective tissue and marginal bone levels.

  7. An in vivo comparison of commonly used topical antimicrobials on skin graft healing after full-thickness burn injury.

    Science.gov (United States)

    Abbas, Ozan L; Borman, Huseyin; Bahar, Taner; Ertaş, Nilgün M; Haberal, Mehmet

    2015-01-01

    Topical antimicrobials are frequently used for local control of infections in burn patients. It has been postulated that these agents retard wound healing. There are limited data about the effects of topical antimicrobial agents on skin graft healing. In this study, we aimed to evaluate the effects of nitrofurazone, 1% silver sulfadiazine, and povidone-iodine on skin graft healing. Forty male rats were used in this study. A meshed skin graft, placed on an excised burn wound, was used as a model to compare topical agents with a control group. Skin graft survival rates, closure of meshed graft interstices (based on physical parameters, namely epithelialization and wound contraction), and histological changes were analyzed. Graft take was more than 85% in all groups. There was no difference between the mean values of the percent graft survival for each group (P > .05). Epithelialization occurred significantly earlier in animals in the nitrofurazone group (P .05). There was no histological difference between the biopsy specimens of skin grafts. In specimens obtained from the interstices of the meshed graft, no significant differences were found among the groups regarding the wound healing parameters (P > .05). We found that nitrofurazone, silver sulfadiazine, and povidone-iodine had no negative effect on graft healing and take in noncontaminated burn wounds.

  8. Comparative Evaluation of Silver-Containing Antimicrobial Dressings on In Vitro and In Vivo Processes of Wound Healing

    Science.gov (United States)

    Hiro, Matthew E.; Pierpont, Yvonne N.; Ko, Francis; Wright, Terry E; Robson, Martin C.; Payne, Wyatt G.

    2012-01-01

    Objectives: To compare the in vitro and in vivo effects of silver products on wound healing. Methods: Eight silver products were compared to determine: fibroblast function using fibroblast-populated collagen lattices (FPCLs), fibroblast viability using the Trypan Blue exclusion test, and fibroblast mitochondrial activity using the MTT [yellow tetrazolium salt; 3-(4,5-Dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide] assay. In vivo effects of 9 silver products were evaluated utilizing a rat model of contaminated wounds. Serial quantitative bacteriology was performed on tissue biopsies over a 10-day period and serial wound areas were obtained over 12 days. Results: Fibroblast cytotoxicity occurred for all of the silver products evaluated. Remaining viable fibroblasts were insufficient to allow FPCL contraction. Mitochondrial activity of the fibroblasts allowed a separation of the various silver compounds. Actisorb Silver and Silvercel had the greatest viable fibroblast activity, but less than the control. Despite in vitro cytotoxicity, all of the silver products except Contreet Foam and Acticoat Moisture Control accelerated wound healing. Conclusions: Silver-containing dressings appeared to benefit healing of the wounds. Just as in vitro bacterial analyses do not fully predict the effect of an antimicrobial in the in vivo setting, in vitro cytotoxicity tests do not fully predict the effect of an agent on wound healing trajectories. Because of the varied antimicrobial and wound healing responses among products, a careful consideration of the particular effects of individual silver-containing dressings or drugs is warranted. PMID:23150745

  9. Monitoring combat wound healing by IR hyperspectral imaging

    Science.gov (United States)

    Howle, Chris R.; Spear, Abigail M.; Gazi, Ehsan; Crane, Nicole J.

    2016-03-01

    In recent conflicts, battlefield injuries consist largely of extensive soft injuries from blasts and high energy projectiles, including gunshot wounds. Repair of these large, traumatic wounds requires aggressive surgical treatment, including multiple surgical debridements to remove devitalised tissue and to reduce bacterial load. Identifying those patients with wound complications, such as infection and impaired healing, could greatly assist health care teams in providing the most appropriate and personalised care for combat casualties. Candidate technologies to enable this benefit include the fusion of imaging and optical spectroscopy to enable rapid identification of key markers. Hence, a novel system based on IR negative contrast imaging (NCI) is presented that employs an optical parametric oscillator (OPO) source comprising a periodically-poled LiNbO3 (PPLN) crystal. The crystal operates in the shortwave and midwave IR spectral regions (ca. 1.5 - 1.9 μm and 2.4 - 3.8 μm, respectively). Wavelength tuning is achieved by translating the crystal within the pump beam. System size and complexity are minimised by the use of single element detectors and the intracavity OPO design. Images are composed by raster scanning the monochromatic beam over the scene of interest; the reflection and/or absorption of the incident radiation by target materials and their surrounding environment provide a method for spatial location. Initial results using the NCI system to characterise wound biopsies are presented here.

  10. Effects of ketanserin on hypergranulation tissue formation, infection, and healing of equine lower limb wounds.

    Science.gov (United States)

    Engelen, Marc; Besche, Béatrice; Lefay, Marie-Paul; Hare, Jonathan; Vlaminck, Kathleen

    2004-02-01

    The objective of this multicentre, randomized, controlled field study was to determine the efficacy of ketanserin gel in preventing exuberant granulation tissue formation (hypergranulation) and infection in equine lower limb wounds. Horses and ponies (n = 481) with naturally occurring wounds were randomized to either topical treatment with ketanserin gel (n = 242) or a positive control (Belgium, Germany: ethacridin lactate solution, n = 120; France, United Kingdom: malic, benzoic, and salicylic acid [MBS] cream, n = 119). Treatment continued until the wound healed (success), formed hypergranulation tissue (failure), or became infected (failure). Treatment was terminated after 6 months in all remaining animals. Ketanserin was successful in 88% of cases. Wounds treated with ketanserin were 2 and 5 times more likely to heal successfully than were those treated with MBS or ethacridin lactate, respectively. Ketanserin gel is thus more effective than these standard treatments in preventing hypergranulation tissue and infection of equine lower limb wounds.

  11. Multiple self-healing squamous epithelioma is caused by a disease-specific spectrum of mutations in TGFBR1

    DEFF Research Database (Denmark)

    Goudie, David R; D'Alessandro, Mariella; Merriman, Barry

    2011-01-01

    Multiple self-healing squamous epithelioma (MSSE), also known as Ferguson-Smith disease (FSD), is an autosomal-dominant skin cancer condition characterized by multiple squamous-carcinoma-like locally invasive skin tumors that grow rapidly for a few weeks before spontaneously regressing, leaving......-of-function TGFBR1 mutations and MSSE. This distinguishes MSSE from the Marfan syndrome-related disorders in which missense mutations in TGFBR1 lead to developmental defects with vascular involvement but no reported predisposition to cancer....

  12. Self-healing efficiency of cementitious materials containing microcapsules filled with healing adhesive: mechanical restoration and healing process monitored by water absorption.

    Science.gov (United States)

    Li, Wenting; Jiang, Zhengwu; Yang, Zhenghong; Zhao, Nan; Yuan, Weizhong

    2013-01-01

    Autonomous crack healing of cementitious composite, a construction material that is susceptible to cracking, is of great significance to improve the serviceability and to prolong the longevity of concrete structures. In this study, the St-DVB microcapsules enclosing epoxy resins as the adhesive agent were embedded in cement paste to achieve self-healing capability. The self-healing efficiency was firstly assessed by mechanical restoration of the damaging specimens after being matured. The flexural and compressive configurations were both used to stimulate the localized and distributed cracks respectively. The effects of some factors, including the content of microcapsules, the curing conditions and the degree of damage on the healing efficiency were investigated. Water absorption was innovatively proposed to monitor and characterize the evolution of crack networks during the healing process. The healing cracks were observed by SEM-EDS following. The results demonstrated that the capsule-containing cement paste can achieve the various mechanical restorations depending on the curing condition and the degree of damage. But the voids generated by the surfactants compromised the strength. Though no noticeable improved stiffness obtained, the increasing fracture energy was seen particularly for the specimen acquiring 60% pre-damage. The sorptivity and amount of water decreased with cracks healing by the adhesive, which contributed to cut off and block ingress of water. The micrographs by SEM-EDS also validated that the cracks were bridged by the hardened epoxy as the dominated elements of C and O accounted for 95% by mass in the nearby cracks.

  13. Stimulating Fracture Healing in Ischemic Environments: Does Oxygen Direct Stem Cell Fate during Fracture Healing?

    Science.gov (United States)

    Miclau, Katherine R.; Brazina, Sloane A.; Bahney, Chelsea S.; Hankenson, Kurt D.; Hunt, Thomas K.; Marcucio, Ralph S.; Miclau, Theodore

    2017-01-01

    Bone fractures represent an enormous societal and economic burden as one of the most prevalent causes of disability worldwide. Each year, nearly 15 million people are affected by fractures in the United States alone. Data indicate that the blood supply is critical for fracture healing; as data indicate that concomitant bone and vascular injury are major risk factors for non-union. However, the various role(s) that the vasculature plays remains speculative. Fracture stabilization dictates stem cell fate choices during repair. In stabilized fractures stem cells differentiate directly into osteoblasts and heal the injury by intramembranous ossification. In contrast, in non-stable fractures stem cells differentiate into chondrocytes and the bone heals through endochondral ossification, where a cartilage template transforms into bone as the chondrocytes transform into osteoblasts. One suggested role of the vasculature has been to participate in the stem cell fate decisions due to delivery of oxygen. In stable fractures, the blood vessels are thought to remain intact and promote osteogenesis, while in non-stable fractures, continual disruption of the vasculature creates hypoxia that favors formation of cartilage, which is avascular. However, recent data suggests that non-stable fractures are more vascularized than stable fractures, that oxygen does not appear associated with differentiation of stem cells into chondrocytes and osteoblasts, that cartilage is not hypoxic, and that oxygen, not sustained hypoxia, is required for angiogenesis. These unexpected results, which contrast other published studies, are indicative of the need to better understand the complex, spatio-temporal regulation of vascularization and oxygenation in fracture healing. This work has also revealed that oxygen, along with the promotion of angiogenesis, may be novel adjuvants that can stimulate healing in select patient populations. PMID:28523266

  14. Evaluation of healing wound and genotoxicity potentials from extracts hydroalcoholic of Plantago major and Siparuna guianensis.

    Science.gov (United States)

    Thomé, Ralph Gruppi; dos Santos, Hélio Batista; dos Santos, Fábio Vieira; da Silva Oliveira, Renato José; de Camargos, Luis Fernando; Pereira, Mariana Nunes; Longatti, Tamara Ribeiro; Souto, Cássio Martins; Franco, Carlaile Soares; de Oliveira Aquino Schüffner, Raissa; Ribeiro, Rosy Iara Maciel Azambuja

    2012-12-01

    Despite the large use of the Plantago major and Siparuna guianensis in traditional medicine, there are no studies demonstrating the effectiveness from extracts of these plants in the healing process by the present methodology. This study reported the effects and toxicity of the P. major and S. guianensis extracts in the wound healing compared with a commercial product used in Brazil by macroscopic and microscopic analysis. Following injury in cervical dorsal area of the mice, the extract from P. major and S. guianensis and ointment was applied after an injury in cervical dorsal area of the mice. Wound healing rates were calculated at 4, 9, 15 and 21 d after the wounding, and tissues were obtained on the ninth day for histological analysis. Moreover, mutagenic assay of extracts was performed. Mutagenicity studies carried out with plant extracts showed not mutagenic with or without metabolic activations. Reduction of the wound area occurred earlier in mice treated with P. major and control treatment. On the 15th day, the complete wound closure occurred in P. major-treated wounds. Throughout ointment and S. guianensis treatment it was not observed the wound closured. Microscopic analyses of the wound, on the ninth day, showed the more efficient formation of the neoepithelium and skin appendages in animals treated with S. guianensis and P. major, while ointment treatment presented no re-epithelialization and absent skin appendages in wound. Thus, P. major extract showed good effects on wound healing processes rendering it a promising candidate for the treatment of wounds what also justified its traditional usage in wound treatment.

  15. Effect of Royal Jelly on Sterile Wound Healing in Balb/C Mice

    Directory of Open Access Journals (Sweden)

    H Shirzad

    2010-04-01

    Full Text Available Introduction & Objective: Wound healing is the process of repairing following injury to the skin and other soft tissues. Following injury, inflammatory response occurs and the cells below the dermis begin to increase collagen production, later on, the epithelial tissue is regenerated. Royal jelly (RJ is a bee product. There are many reports on pharmacological activity of RJ on experimented animals. The purpose of this study was to investigate the effect of RJ on the induction of wound healing of sterile incision in Balb/C mice. Materials & Methods: In this experimental study which was conducted at Shahr-e-kord University of Medical Sciences in 60 female Balb/C mice (8 weeks old were selected. The mice were anesthetized with ether. The dorsal fur of the animals was shaved and sterilized with alcohol, and then a longitudinal para vertebral full thickness incision of 10mm long was made. The animals were then divided into six equal groups. In group one (negative control, nothing was applied to the wound. Group 2 (positive control was treated with nitrofurazon ointment, group 3 was treated with RJ 200 mg/kg daily, group 4 was treated with RJ 200 mg/kg every two days, group 5 was treated with RJ 300 mg/kg daily, group 6 treated with RJ 300 mg/kg every two days. Royal jelly was topically used on the wounds. The wound length was measured with vernier capilar every two days until the complete healing was occurred. The data were analyzed with SPSS version 11.5 using Kruscal Walis tests. Results: There was a significant difference between groups 1, 2 with the other groups (p0.015. Conclusion: The results of this study indicated that daily application of RJ possesses betters wound healing effects than nitrofurazon.

  16. The arresting phase determines the total healing time of

    Directory of Open Access Journals (Sweden)

    LI Ping

    2012-04-01

    Full Text Available 【Abstract】Objective: Radiation is an important cause of delayed wound healing, and there still exist many questions regarding the patterns and mechanisms of wound healing. This study investigated the characteristics of wound healing after varying doses of local radiation and explored possible causes of the delay in healing caused by radiation. Methods: A full-thickness dorsal longitudinal skin tissue, 2 cm in diameter, was excised after local irradiation on one side of the back of swine, and the other side was wounded as a control. The size of the wound area was re-corded every two days after injury. Pathological changes, proliferating cell nuclear antigen (PCNA, immunohisto-chemistry and apoptosis levels (TUNEL assay were mea-sured at different time points after wounding. Results: The course of wound healing can be divided into four phases, namely: the arresting phase, the healing priming phase, the fast healing phase, and the healed phase. Although the total wound healing time was closely corre-lated to the dose of irradiation (R 2 = 0.9758, it was more dependent on the length of the arresting phase (R 2 =0.9903 because once the arresting phase ended, the wound healed at a similar speed regardless of radiation doses. Pathologi-cal analysis showed that compared with the control side there were more necrotic tissues, slower epithelial crawling, as well as fewer blood vessels and cellular components in the irradiated side at the arresting phase, while other phases revealed no significant difference concerning these measurements. Immunohistochemistry showed that the ir-radiated wounds had significantly less PCNA-positive and more TUNEL-positive labeling of cells in the arresting phase than in other phases. Moreover, the changes were posi-tively related to the radiation doses, but there was no obvi-ous difference in cell proliferation or apoptosis among the healing priming phase, fast healing phase or healed phase, whether on the control side

  17. Walking with Madhu: healing ped/agogy

    Science.gov (United States)

    Watson, T. Francene

    2015-03-01

    In this essay, the author responds to Madhu Prakash's piece on friendship gardens and healing our "Mother" through Prakash's central question, How to birth a world in which many worlds flourish and complement each other in their wild, divine diversity; all equally enjoying Ahimsa flourishing and happiness? Coming from the standpoint of schooling, education, and teacher preparation, the author works to reground the descriptors of "pre-service" and "in-service" from a technical discourse to an ecological one, where the notion of service becomes expansive and pedagogical. Illustrated is how people in community are building gardens and working with soil in a way that is restorative for more-than human relationships, illuminating the deep ways gardens heal and nourish. This is especially important as we emerge from the wake of Cold War numbness, where gardens enable and empower continued societal growth from ideological mindset of "against" to an increasing ability to look at the discord inside of our own communities/selves and move to growing "with." Working with soil not only opens us to relationship and hospitality with one another, but also inspires peace with the earth.

  18. Self-Healing Materials for Ecotribology

    Directory of Open Access Journals (Sweden)

    Shih-Chen Shi

    2017-01-01

    Full Text Available Hydroxypropyl methylcellulose (HPMC is a biopolymer that is biodegradable, environmentally friendly, and bio-friendly. Owing to its unique chemical structure, HPMC can reduce the coefficient of friction (COF and frictional wear and thus possesses excellent lubrication properties. HPMC has good dissolvability in specific solvents. The present research focuses on the reversible dissolution reaction subsequent to the film formation of HPMC, with a view to the healing and lubrication properties of thin films. Raman spectroscopy was used to test the film-forming properties of HPMC and the dissolution characteristics of various solvents. In this study, the solvents were water, methanol, ethanol, and acetone. The results showed that the HPMC film had the highest dissolvability in water. The ball-on-disk wear test was used to analyze the lubrication properties of HPMC, and the results showed that HPMC had the same COF and lubrication properties as the original film after being subjected to the water healing treatment. The HPMC film can be reused, recycled, and refilled, making it an ideal lubricant for next-generation ecotribology.

  19. Self-Healing Materials for Ecotribology.

    Science.gov (United States)

    Shi, Shih-Chen; Huang, Teng-Feng

    2017-01-22

    Hydroxypropyl methylcellulose (HPMC) is a biopolymer that is biodegradable, environmentally friendly, and bio-friendly. Owing to its unique chemical structure, HPMC can reduce the coefficient of friction (COF) and frictional wear and thus possesses excellent lubrication properties. HPMC has good dissolvability in specific solvents. The present research focuses on the reversible dissolution reaction subsequent to the film formation of HPMC, with a view to the healing and lubrication properties of thin films. Raman spectroscopy was used to test the film-forming properties of HPMC and the dissolution characteristics of various solvents. In this study, the solvents were water, methanol, ethanol, and acetone. The results showed that the HPMC film had the highest dissolvability in water. The ball-on-disk wear test was used to analyze the lubrication properties of HPMC, and the results showed that HPMC had the same COF and lubrication properties as the original film after being subjected to the water healing treatment. The HPMC film can be reused, recycled, and refilled, making it an ideal lubricant for next-generation ecotribology.

  20. Come and play with HEAL in Microcosm!

    CERN Multimedia

    Stefania Pandolfi

    2016-01-01

    A new interactive game in Microcosm informs about hadron therapy – come and test it!   HEAL is a new interactive game currently under evaluation at Microcosm to inform visitors about hadron therapy, one aspect of the CERN-related contributions to the medical field. Microcosm is continuously evolving and new content is installed regularly. One of the most recent exhibits is called HEAL - an interactive game with the aim of informing visitors about the hadron therapy to treat cancer. It has been developed by Jenny Rompa, a PhD student at CERN, within the activities of MediaLab.  The application is controlled through body movements and the player is asked to set the right energy and the right angle of the hadron beam to make the (brain) cancer disappear. As part of her doctoral thesis, Jenny also built a questionnaire to hand out to visitors in order to examine their user experience. The goal of the study is to evaluate the effectiveness of using inter...

  1. Grand challenge in Biomaterials-wound healing

    Science.gov (United States)

    Salamone, Joseph C.; Salamone, Ann Beal; Swindle-Reilly, Katelyn; Leung, Kelly Xiaoyu-Chen; McMahon, Rebecca E.

    2016-01-01

    Providing improved health care for wound, burn and surgical patients is a major goal for enhancing patient well-being, in addition to reducing the high cost of current health care treatment. The introduction of new and novel biomaterials and biomedical devices is anticipated to have a profound effect on the future improvement of many deleterious health issues. This publication will discuss the development of novel non-stinging liquid adhesive bandages in healthcare applications developed by Rochal Industries. The scientists/engineers at Rochal have participated in commercializing products in the field of ophthalmology, including rigid gas permeable contact lenses, soft hydrogel contact lenses, silicone hydrogel contact lenses, contact lens care solutions and cleaners, intraocular lens materials, intraocular controlled drug delivery, topical/intraocular anesthesia, and in the field of wound care, as non-stinging, spray-on liquid bandages to protect skin from moisture and body fluids and medical adhesive-related skin injuries. Current areas of entrepreneurial activity at Rochal Industries pertain to the development of new classes of biomaterials for wound healing, primarily in regard to microbial infection, chronic wound care, burn injuries and surgical procedures, with emphasis on innovation in product creation, which include cell-compatible substrates/scaffolds for wound healing, antimicrobial materials for opportunistic pathogens and biofilm reduction, necrotic wound debridement, scar remediation, treatment of diabetic ulcers, amelioration of pressure ulcers, amelioration of neuropathic pain and adjuvants for skin tissue substitutes. PMID:27047680

  2. Influence of suturing on wound healing.

    Science.gov (United States)

    Burkhardt, Rino; Lang, Niklaus P

    2015-06-01

    The present article describes the significance of suturing and appropriate suture materials in current periodontal and implant surgery. Synthetic, nonresorbable, monofilament threads appear to be advantageous. The physical and biological properties of such threads remain unchanged with use and, when used in small diameters (i.e. with lower breaking resistance), seem to promote passive wound closure. Wound healing at hard, nonshedding surfaces is conceptually a more complex process than is wound healing in most other sites of the oral cavity. Firm adaptation and stabilization of the flaps by optimal suturing ensures adhesion of the delicate fibrin clot to the nonshedding surface. The early formation and mechanical stability of the blood clot between the mucosal or mucoperiosteal flap and the wound bed are of paramount importance and hence suturing techniques must be considered as a key prerequisite to ensure optimal surgical outcomes. With the sophisticated surgical procedures now applied, there is a greater need for knowledge with regard to the various types of suturing techniques and materials available in order to achieve the above-mentioned goals. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  3. Johrei Family Healing: A Pilot Study

    Directory of Open Access Journals (Sweden)

    P. H. Canter

    2006-01-01

    Full Text Available Johrei is a form of spiritual healing comprising “energy channelling” and light massage given either by a trained healer or, after some basic training, by anyone. This pilot trial aimed to identify any potential benefits of family-based Johrei practice in childhood eczema and for general health and to establish the feasibility of a subsequent randomised controlled trial. Volunteer families of 3-5 individuals, including at least one child with eczema were recruited to an uncontrolled pilot trial lasting 12 months. Parents were trained in Johrei healing and then practised at home with their family. Participants kept diaries and provided questionnaire data at baseline, 3,6 and 12 months. Eczema symptoms were scored at the same intervals. Scepticism about Johrei is presently an obstacle to recruitment and retention of a representative sample in a clinical trial, and to its potential use in general practice. The frequency and quality of practise at home by families may be insufficient to bring about the putative health benefits. Initial improvements in eczema symptoms and diary recorded illness, could not be separated from seasonal factors and other potential confounders. There were no improvements on other outcomes measuring general health and psychological wellbeing of family members.

  4. Stimulation Of Wound Healing By Lasers

    Science.gov (United States)

    Lyons, Richard F.; Abergel, R. Patrick; Lam, Thomas s.; White, Rodney A.; Dwyer, Richard M.; Uitto, Jouni

    1986-08-01

    Clinical observations have suggested that low energy lasers might stimulate wound healing. To understand the mechanism of the biostimulation, we have previously examined the effects of low energy lasers on collagen production by human skin fibroblasts and reported an increase of collagen synthesis in vitro (J. Am. Acad. Derm. 11:1142-1150, 1980. To examine the effects of low energy lasers in vivo, hairless mice were experimentally wounded, sutured and subjected to laser irradiation by He-Ne laser with a power output of 1.56 mW, and an energy fluence of 1.22 J/cm2. Experimental wounds were subjected to laser treatment every other day, for a total duration of 2 months; control wounds remained untreated. Specimens from the wounds were then examined for histology, tensile strength and total collagen content. Results demonstrated a considerable improvement of the tensile strength of the laser-irradiated wounds at 1 and 2 weeks. Furthermore, the total collagen content was significantly increased at 2 months when compared to control wounds. These results suggest a beneficial effect of He-Ne laser on wound healing in vivo.

  5. Healing of small circular model wounds

    Science.gov (United States)

    Cochet, Olivier; Marcq, Philippe; Ranft, Jonas; Reffay, Myriam; Buguin, Axel; Silberzan, Pascal

    2012-02-01

    We develop a new method to produce numerous circular wounds in an epithelial tissue of MDCK cells in a non-traumatic fashion. The reproducibility of the wounds allows for a quantitative study of the dynamics of healing and for a better understanding of the key processes involved in those collective morphogenetic movements. First, we show different mechanisms of closing depending on the initial size of the wound. We then focus on the healing of the smallest wounds from an experimental and theoretical point of view. At the onset of closure, an actomyosin ring is formed around the wound and small protrusions appear and invade the free surface. Using inhibition and laser ablation experiments, we show the relative contribution of both processes to the dynamics of closing. Finally, we develop a theoretical model of the tissue as a whole, combined with the observed forces, in order to better understand the underlying mechanics of this process. We hope that this qualitative and quantitative description will prove useful in the future for the study of epithelial architecture, collective mechanisms in migrating tissues and, on a broader context, cellular invasion in cancerous tissues.

  6. Healing X-ray scattering images.

    Science.gov (United States)

    Liu, Jiliang; Lhermitte, Julien; Tian, Ye; Zhang, Zheng; Yu, Dantong; Yager, Kevin G

    2017-07-01

    X-ray scattering images contain numerous gaps and defects arising from detector limitations and experimental configuration. We present a method to heal X-ray scattering images, filling gaps in the data and removing defects in a physically meaningful manner. Unlike generic inpainting methods, this method is closely tuned to the expected structure of reciprocal-space data. In particular, we exploit statistical tests and symmetry analysis to identify the structure of an image; we then copy, average and interpolate measured data into gaps in a way that respects the identified structure and symmetry. Importantly, the underlying analysis methods provide useful characterization of structures present in the image, including the identification of diffuse versus sharp features, anisotropy and symmetry. The presented method leverages known characteristics of reciprocal space, enabling physically reasonable reconstruction even with large image gaps. The method will correspondingly fail for images that violate these underlying assumptions. The method assumes point symmetry and is thus applicable to small-angle X-ray scattering (SAXS) data, but only to a subset of wide-angle data. Our method succeeds in filling gaps and healing defects in experimental images, including extending data beyond the original detector borders.

  7. Healing X-ray scattering images

    Directory of Open Access Journals (Sweden)

    Jiliang Liu

    2017-07-01

    Full Text Available X-ray scattering images contain numerous gaps and defects arising from detector limitations and experimental configuration. We present a method to heal X-ray scattering images, filling gaps in the data and removing defects in a physically meaningful manner. Unlike generic inpainting methods, this method is closely tuned to the expected structure of reciprocal-space data. In particular, we exploit statistical tests and symmetry analysis to identify the structure of an image; we then copy, average and interpolate measured data into gaps in a way that respects the identified structure and symmetry. Importantly, the underlying analysis methods provide useful characterization of structures present in the image, including the identification of diffuse versus sharp features, anisotropy and symmetry. The presented method leverages known characteristics of reciprocal space, enabling physically reasonable reconstruction even with large image gaps. The method will correspondingly fail for images that violate these underlying assumptions. The method assumes point symmetry and is thus applicable to small-angle X-ray scattering (SAXS data, but only to a subset of wide-angle data. Our method succeeds in filling gaps and healing defects in experimental images, including extending data beyond the original detector borders.

  8. Analyzing the influence of gastric intestinal metaplasia on gastric ulcer healing in Helicobacter pylori-infected patients without atrophic gastritis.

    Science.gov (United States)

    Chen, Li-Wei; Chang, Liang-Che; Hua, Chung-Ching; Hsieh, Bor-Jen; Chen, Shuo-Wei; Chien, Rong-Nan

    2017-01-03

    Gastric epithelial hyper-proliferation was reported in patients with Helicobacter pylori (H. pylori)-infected gastric mucosa with intestinal metaplasia (IM) changes. In patients with gastric ulcer (GU) and IM, the GU may have a different healing rate in comparison to patients without IM. This study aimed to compare the difference in GU healing between H. pylori-infected patients with IM and those without IM. We retrospectively analyzed patients at the Keelung Chung Gung Memorial Hospital during the period from March 2005 to January 2011. The inclusion criteria were: 1) endoscopic findings of GU and biopsy histological examination plus rapid urease test indicating H. pylori infection; 2) gastric IM adjacent to a GU but with no atrophic gastritis changes; 3) patients receiving H. pylori eradication triple therapy and 8 weeks of maintenance therapy with a proton pump inhibitor; and 4) patients receiving follow-up endoscopy within the 3(rd) and the 4(th) months after treatment. In total, 327 patients with GU and H. pylori infection (136 with IM and 191 without IM) were included. Patients with IM had a higher GU healing rate than those without IM (91.9% vs. 84.3%, P = 0.040). Multivariate logistical regression analysis revealed that failure of H. pylori eradication (Odds = 4.013, 95% CI: 1.840-8.951, P gastric IM (Odds = 0.369, 95% CI: 0.168-0.812, P = 0.013) were the predictors of non-healing GU following treatment. Patient with gastric IM change may have a higher GU healing rate than those without gastric IM. However, successful H. pylori eradication is a more important factor for GU healing than gastric IM.

  9. Raman spectroscopy enables noninvasive biochemical identification of the collagen regeneration in cutaneous wound healing of diabetic mice treated with MSCs.

    Science.gov (United States)

    Yan, Wenxia; Liu, Hanping; Deng, Xiaoyuan; Jin, Ying; Sun, Huimin; Li, Caiyun; Wang, Ning; Chu, Jing

    2017-07-01

    Mesenchymal stem cells (MSCs) had been reported as a novel therapeutic strategy for non-healing diabetic cutaneous wound mainly by promoting the formation of extracellular matrix (ECM) and neovasculature. Collagen regeneration is one of the key processes of ECM remodeling in wound healing. Accordingly, rapid assessment of the collagen content in a noninvasive manner can promptly provide objective evaluation for MSC therapy of cutaneous wound healing and strength evidence to adjust therapeutic regimen. In the present study, noninvasive Raman microspectroscopy was used for tracing the regeneration status of collagen during diabetic wound healing with MSCs. Wound tissues of normal mice, diabetic mice, and MSC-treated diabetic mice were subjected to Masson trichrome staining assay and submitted to spectroscopic analysis by Raman microspectroscopy after wounding 7, 14, and 21 days. Masson trichrome staining demonstrated that there was more collagen deposition in diabetic + MSCs group relative to diabetic group. The relative intensity of Raman collagen peak positions at 937, 1004, 1321, 1452, and 1662 cm-1 increased in MSC-treated diabetic group compared to diabetic group, although normal mice group had the highest relative intensity of collagen peak bands. Correlation analysis suggested that the spectral bands had a high positive correlation with the collagen intensity detected by Masson trichrome staining in wound tissues of three groups. Our results demonstrate that Raman microspectroscopy has potential application in rapidly and quantitatively assessing diabetic wound healing with MSCs by monitoring collagen variation, which may provide a novel method for the study of skin regeneration.

  10. Low-dose X-ray irradiation promotes osteoblast proliferation, differentiation and fracture healing.

    Directory of Open Access Journals (Sweden)

    Ming Chen

    Full Text Available Great controversy exists regarding the biologic responses of osteoblasts to X-ray irradiation, and the mechanisms are poorly understood. In this study, the biological effects of low-dose radiation on stimulating osteoblast proliferation, differentiation and fracture healing were identified using in vitro cell culture and in vivo animal studies. First, low-dose (0.5 Gy X-ray irradiation induced the cell viability and proliferation of MC3T3-E1 cells. However, high-dose (5 Gy X-ray irradiation inhibited the viability and proliferation of osteoblasts. In addition, dynamic variations in osteoblast differentiation markers, including type I collagen, alkaline phosphatase, Runx2, Osterix and osteocalcin, were observed after both low-dose and high-dose irradiation by Western blot analysis. Second, fracture healing was evaluated via histology and gene expression after single-dose X-ray irradiation, and low-dose X-ray irradiation accelerates fracture healing of closed femoral fractures in rats. In low-dose X-ray irradiated fractures, an increase in proliferating cell nuclear antigen (PCNA-positive cells, cartilage formation and fracture calluses was observed. In addition, we observed more rapid completion of endochondral and intramembranous ossification, which was accompanied by altered expression of genes involved in bone remodeling and fracture callus mineralization. Although the expression level of several osteoblast differentiation genes was increased in the fracture calluses of high-dose irradiated rats, the callus formation and fracture union were delayed compared with the control and low-dose irradiated fractures. These results reveal beneficial effects of low-dose irradiation, including the stimulation of osteoblast proliferation, differentiation and fracture healing, and highlight its potential translational application in novel therapies against bone-related diseases.

  11. Factors affecting healing after arthroscopic rotator cuff repair

    Science.gov (United States)

    Abtahi, Amir M; Granger, Erin K; Tashjian, Robert Z

    2015-01-01

    Rotator cuff repair has been shown to have good long-term results. Unfortunately, a significant proportion of repairs still fail to heal. Many factors, both patient and surgeon related, can influence healing after repair. Older age, larger tear size, worse muscle quality, greater muscle-tendon unit retraction, smoking, osteoporosis, diabetes and hypercholesterolemia have all shown to negatively influence tendon healing. Surgeon related factors that can influence healing include repair construct-single vs double row, rehabilitation, and biologics including platelet rich plasma and mesenchymal stem cells. Double-row repairs are biomechanically stronger and have better healing rates compared with single-row repairs although clinical outcomes are equivalent between both constructs. Slower, less aggressive rehabilitation programs have demonstrated improved healing with no negative effect on final range of motion and are therefore recommended after repair of most full thickness tears. Additionally no definitive evidence supports the use of platelet rich plasma or mesenchymal stem cells regarding improvement of healing rates and clinical outcomes. Further research is needed to identify effective biologically directed augmentations that will improve healing rates and clinical outcomes after rotator cuff repair. PMID:25793161

  12. Circadian rhythms accelerate wound healing in female Siberian hamsters.

    Science.gov (United States)

    Cable, Erin J; Onishi, Kenneth G; Prendergast, Brian J

    2017-03-15

    Circadian rhythms (CRs) provide temporal regulation and coordination of numerous physiological traits, including immune function. CRs in multiple aspects of immune function are impaired in rodents that have been rendered circadian-arrhythmic through various methods. In Siberian hamsters, circadian arrhythmia can be induced by disruptive light treatments (DPS). Here we examined CRs in wound healing, and the effects of circadian disruption on wound healing in DPS-arrhythmic hamsters. Circadian entrained/rhythmic (RHYTH) and behaviorally-arrhythmic (ARR) female hamsters were administered a cutaneous wound either 3h after light onset (ZT03) or 2h after dark onset (ZT18); wound size was quantified daily using image analyses. Among RHYTH hamsters, ZT03 wounds healed faster than ZT18 wounds, whereas in ARR hamsters, circadian phase did not affect wound healing. In addition, wounds healed slower in ARR hamsters. The results document a clear CR in wound healing, and indicate that the mere presence of organismal circadian organization enhances this aspect of immune function. Faster wound healing in CR-competent hamsters may be mediated by CR-driven coordination of the temporal order of mechanisms (inflammation, leukocyte trafficking, tissue remodeling) underlying cutaneous wound healing. Copyright © 2016 Elsevier Inc. All rights reserved.

  13. Indigenous African art and healing: forgotten memories, planting ...

    African Journals Online (AJOL)

    ... paper concludes by arguing that the privileging of rational intelligence (IQ) over emotional and spiritual intelligences (EQ and SQ) has deprived art of its principle role of healing at the societal, communal and individual levels. Keywords: African art, healing, rational intelligence, emotional intelligence, spiritual intelligence.

  14. Wound healing with honey - a randomised controlled trial

    African Journals Online (AJOL)

    tissues, creates a moist healing environment, is antibacterial and stimulates healing and epithelialisation.'1 Some of honey's antibacterial activity is due to the high osmolarity created by its sugar content, some is due to hydrogen peroxide released by exudate, and some is due to phytochemicals that come from the nectar of ...

  15. Honey improves healing of circumscribed excision injury to the ...

    African Journals Online (AJOL)

    Background: Honey promotes wound healing. Objective: In this study, we described the anatomical perspective of honey on wound healing in male rats. Methods: The twenty-four male rats used were randomly divided equally into treated Experimental (E) and Control (C) groups. Infliction of wound done under anaesthesia; ...

  16. HeartMath and Ubuntu integral healing approaches for social ...

    African Journals Online (AJOL)

    This research was motivated by many social health problems confronting planet earth. Its aim is to introduce HeartMath and Ubuntu as complimentary, integral healing approaches for promoting social consciousness, coherence and various forms of physical activity. Integral healing themes discussed include holism, ...

  17. Effects of anti-osteoporosis medications on fracture healing

    DEFF Research Database (Denmark)

    Jørgensen, Niklas R; Schwarz, Peter

    2011-01-01

    stimulate bone healing. Parathyroid hormone (PTH) is the first bone anabolic drug approved for the treatment of osteoporosis and, intriguingly, a number of animal studies prove the ability of PTH to induce fracture healing. PTH may therefore be a potential novel treatment option in humans with impaired...

  18. A self-healing PDMS polymer with solvatochromic properties.

    Science.gov (United States)

    Jia, Xiao-Yong; Mei, Jin-Feng; Lai, Jian-Cheng; Li, Cheng-Hui; You, Xiao-Zeng

    2015-05-28

    Coordination bonds are effective for constructing functional self-healing materials due to their tunable bond strength and metal-ion-induced functionalities. In this work, we incorporate a cobalt(II) triazole complex into a polydimethylsiloxane (PDMS) matrix. The resulting polymers show solvatochromic behaviour as well as self-healing properties.

  19. Self-healing concrete by use of microencapsulated bacterial spores

    Energy Technology Data Exchange (ETDEWEB)

    Wang, J.Y. [Magnel Laboratory for Concrete Research, Faculty of Engineering and Architecture, Ghent University, TechnologieparkZwijnaarde 904, B-9052 Ghent (Belgium); Laboratory of Microbial Ecology and Technology (LabMET), Faculty of Bioscience Engineering, Ghent University, Coupure Links 653, B-9000 Ghent (Belgium); Soens, H. [Devan Chemicals NV, Klein Frankrijk 18, 9600 Ronse (Belgium); Verstraete, W. [Laboratory of Microbial Ecology and Technology (LabMET), Faculty of Bioscience Engineering, Ghent University, Coupure Links 653, B-9000 Ghent (Belgium); De Belie, N., E-mail: nele.debelie@ugent.be [Magnel Laboratory for Concrete Research, Faculty of Engineering and Architecture, Ghent University, TechnologieparkZwijnaarde 904, B-9052 Ghent (Belgium)

    2014-02-15

    Microcapsules were applied to encapsulate bacterial spores for self-healing concrete. The viability of encapsulated spores and the influence of microcapsules on mortar specimens were investigated first. Breakage of the microcapsules upon cracking was verified by Scanning Electron Microscopy. Self-healing capacity was evaluated by crack healing ratio and the water permeability. The results indicated that the healing ratio in the specimens with bio-microcapsules was higher (48%–80%) than in those without bacteria (18%–50%). The maximum crack width healed in the specimens of the bacteria series was 970 μm, about 4 times that of the non-bacteria series (max 250 μm). The overall water permeability in the bacteria series was about 10 times lower than that in non-bacteria series. Wet–dry cycles were found to stimulate self-healing in mortar specimens with encapsulated bacteria. No self-healing was observed in all specimens stored at 95%RH, indicating that the presence of liquid water is an essential component for self-healing.

  20. Direct numerical simulation of noninvasive channel healing in electrical field

    KAUST Repository

    Wang, Yi

    2017-11-25

    Noninvasive channel healing is a new idea to repair the broken pipe wall, using external electric fields to drive iron particles to the destination. The repair can be done in the normal operation of the pipe flow without any shutdown of the pipeline so that this method can be a potentially efficient and safe technology of pipe healing. However, the real application needs full knowledge of healing details. Numerical simulation is an effective method. Thus, in this research, we first established a numerical model for noninvasive channel healing technology to represent fluid–particle interaction. The iron particles can be attached to a cracking area by external electrostatic forces or can also be detached by mechanical forces from the fluid. When enough particles are permanently attached on the cracking area, the pipe wall can be healed. The numerical criterion of the permanent attachment is discussed. A fully three-dimensional finite difference framework of direct numerical simulation is established and applied to different cases to simulate the full process of channel healing. The impact of Reynolds number and particle concentration on the healing process is discussed. This numerical investigation provides valuable reference and tools for further simulation of real pipe healing in engineering.

  1. Oxygen therapies and their effects on wound healing

    NARCIS (Netherlands)

    de Smet, Gijs H. J.; Kroese, Leonard F.; Menon, Anand G.; Jeekel, Johannes; van Pelt, Antoon W. J.; Kleinrensink, Gert-Jan; Lange, Johan F.

    Oxygen is an important factor for wound healing. Although several different therapies investigated the use of oxygen to aid wound healing, the results of these studies are not unequivocal. This systematic review summarizes the clinical and experimental studies regarding different oxygen therapies

  2. Evaluation of Healing Intervals of Incisional Skin Wounds of Goats ...

    African Journals Online (AJOL)

    The aim of this study was to compare the healing intervals among simple interrupted (SI), ford interlocking (FI) and subcuticular (SC) suture patterns in goats. We hypothesized that these common suture patterns used for closure of incisional skin wounds may have effect on the healing interval. To test this hypothesis, two ...

  3. Ethnobotanical survey of tree species used for wound healing in ...

    African Journals Online (AJOL)

    Ethnobotanical survey of tree species used for wound healing in Ibadan, southwest Nigeria. ... The most frequently mentioned family is Fabaceae, followed by Meliaceae and Annonaceae. Stem barks were predominant in the ... Keywords: Wound healing, ethnobotanical survey, tree species, medicinal uses, conservation ...

  4. Augmenting endogenous Wnt signaling improves skin wound healing

    National Research Council Canada - National Science Library

    Whyte, Jemima L; Smith, Andrew A; Liu, Bo; Manzano, Wilfred R; Evans, Nick D; Dhamdhere, Girija R; Fang, Mark Y; Chang, Howard Y; Oro, Anthony E; Helms, Jill A

    2013-01-01

    .... Utilizing a biochemical approach that mimics the amplified Wnt response of Axin2(LacZ/LacZ) mice, we show that topical application of liposomal Wnt3a to a non-healing wound enhances endogenous Wnt signaling, and results in better skin wound healing...

  5. INTRODUCTION OF CHRONICAL WOUNDS HEALING WITH LUCILIA SERICATALARVAE IN SLOVENIA

    Directory of Open Access Journals (Sweden)

    Domen Jaklič

    2008-03-01

    The method of healing chronic wounds with L. sericata larvae was successfully introducedinto Slovenia. Due to its simplicity and effectiveness biosurgery should be accepted as astandard method in Slovene clinical practice. With the help of biosurgical method chronicwounds heal faster, further inflammation and tissue decomposition are prevented andpatients can integrate faster into normal everyday life

  6. Evaluation of workshops on healing through multicultural counseling ...

    African Journals Online (AJOL)

    Training of psychologists in general and sport psychologists in particular takes place within a global village called planet earth, with all its multifaceted problems. Relevant integral healing approaches are needed in both general and sport psychological contexts. Healing through multicultural counselling workshops were ...

  7. Notch Regulates Macrophage-Mediated Inflammation in Diabetic Wound Healing

    Directory of Open Access Journals (Sweden)

    Andrew S. Kimball

    2017-06-01

    Full Text Available Macrophages are essential immune cells necessary for regulated inflammation during wound healing. Recent studies have identified that Notch plays a role in macrophage-mediated inflammation. Thus, we investigated the role of Notch signaling on wound macrophage phenotype and function during normal and diabetic wound healing. We found that Notch receptor and ligand expression are dynamic in wound macrophages during normal healing. Mice with a myeloid-specific Notch signaling defect (DNMAMLfloxedLyz2Cre+ demonstrated delayed early healing (days 1–3 and wound macrophages had decreased inflammatory gene expression. In our physiologic murine model of type 2 diabetes (T2D, Notch receptor expression was significantly increased in wound macrophages on day 6, following the initial inflammatory phase of wound healing, corresponding to increased inflammatory cytokine expression. This increase in Notch1 and Notch2 was also observed in human monocytes from patients with T2D. Further, in prediabetic mice with a genetic Notch signaling defect (DNMAMLfloxedLyz2Cre+ on a high-fat diet, improved wound healing was seen at late time points (days 6–7. These findings suggest that Notch is critical for the early inflammatory phase of wound healing and directs production of macrophage-dependent inflammatory mediators. These results identify that canonical Notch signaling is important in directing macrophage function in wound repair and define a translational target for the treatment of non-healing diabetic wounds.

  8. Healing and women healers in Yoruba religion and African Christianity

    African Journals Online (AJOL)

    Healing in African indigenous cultures is a corporate matter involving the totality of the person, family and community. Healing presupposes sickness; its practice is therefore interlocked with a people's conception of sickness and diseases. In Africa, sickness is an attestation to the fact that an individual is out of tune with ...

  9. Autogeneous healing and chloride ingress in cracked concrete

    NARCIS (Netherlands)

    Savija, B.; Schlangen, E.

    2016-01-01

    An experimental study of the influence of autogeneous healing on chloride ingress in cracked concrete is presented. In the study, two concrete mixtures (a Portland cement mix and a blast furnace slag mix), two healing regimes (submerged and fog room regime), two cracking ages (14 and 28 days), and

  10. Evaluating fracture healing using digital x-ray image analysis ...

    African Journals Online (AJOL)

    Evaluating fracture healing using digital x-ray image analysis: Fracture healing is not easily monitored using currently available techniques. SP Whiley. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online.

  11. Persistence of Features of Traditional Healing in the Churches in ...

    African Journals Online (AJOL)

    This article examines some features of traditional healing which are manifested in faith healing in the AICs. The persistence of these features pauses a challenge to mainline churches in Africa, forcing them to rethink their approach to life threatening issues such as witchcraft and barrenness that continue to preoccupy many ...

  12. Evaluation of Wound Healing Actions of Hoslundia opposita Vahl ...

    African Journals Online (AJOL)

    To validate the ethnotherapeutic claims of these plants in skin diseases, in vivo wound healing activity was studied, besides antioxidant activity to understand the mechanism of wound healing. Methanol extract of Hoslundia opposita showed significant antibacterial activity against all bacteria tested including some resistant ...

  13. Evaluation of effectiveness in a novel wound healing ointment ...

    African Journals Online (AJOL)

    Background: Crocodile oil and its products are used as ointments for burns and scalds in traditional medicines. A new ointment formulation - crocodile oil burn ointment (COBO) was developed to provide more efficient wound healing activity. The purpose of the study was to evaluate the burn healing efficacy of this new ...

  14. Direct tensile test to assess healing in asphalt

    NARCIS (Netherlands)

    Leegwater, G.A.; Scarpas, T.; Erkens, S.

    2016-01-01

    Asphalt concrete has the advantageous ability to heal. During rest periods, damage present in the material is restored to a certain extent. Healing of the material can be observed in its regaining of strength and stiffness after rest periods. In this paper, a new test method is presented. It was

  15. Studies on wound healing properties of Crateva religiosa leaf extract ...

    African Journals Online (AJOL)

    Alkaloids, carbohydrates, tannins, flavonoids, resins, proteins, oils, steroids and terpenoids were present. The extract had wound healing activity that was superior to that of penicillin. The faces of wound treated with the extract dried faster indicating that the extract had extrawound healing mechanism when compared to that ...

  16. Healing from Childhood Sexual Abuse: A Theoretical Model

    Science.gov (United States)

    Draucker, Claire Burke; Martsolf, Donna S.; Roller, Cynthia; Knapik, Gregory; Ross, Ratchneewan; Stidham, Andrea Warner

    2011-01-01

    Childhood sexual abuse is a prevalent social and health care problem. The processes by which individuals heal from childhood sexual abuse are not clearly understood. The purpose of this study was to develop a theoretical model to describe how adults heal from childhood sexual abuse. Community recruitment for an ongoing broader project on sexual…

  17. African Traditional And Religious Faith Healing Practices And The ...

    African Journals Online (AJOL)

    African Traditional And Religious Faith Healing Practices And The Provision Of Psychological Wellbeing Among Amaxhosa People. ... and religious faith healing ceremonies enhance the release of misdirected energies and, as such, should be considered as a proper part of mainstream forms of therapeutic intervention.

  18. Ethical quandaries in spiritual healing and herbal medicine: A ...

    African Journals Online (AJOL)

    raoul

    2011-09-21

    Sep 21, 2011 ... &Corresponding author: Munyaradzi Mawere, Department of Social Anthropology at the University of Cape Town, South Africa, Universidade. Pedagogica .... contentious. However Grayson (ibid) notes that the underlying principle of spiritual healing is that in the spiritual mind healing process, one does.

  19. Evaluation of the wound healing potential of Protea madiensis Oliv ...

    African Journals Online (AJOL)

    Protea madiensis Oliv. is a flowering shrub which grows in south eastern Nigeria. Liquids extracted from its leaves are applied on wounds to promote healing. To investigate the effect of P. madiensis on wound healing, its methanol extract was applied topically on excision wounds daily. During the experimental period, the ...

  20. Healing as transformation and restoration: A ritual-liturgical exploration

    African Journals Online (AJOL)

    Illness is a reality that affects all people, and healing is the main reason why people attend worship services in sub-Saharan Africa. According to the Ritual Studies scholar Ronald Grimes, illness is a social reality; it is socially imagined and constructed. Healing in the church is something that many believers experience, also ...

  1. Chromotographic and wound healing studies of Jatropha curcas ...

    African Journals Online (AJOL)

    The wound healing properties of the methanol extract of the leaves of Jatropha curcas were studied by incision and excision wound models in rats. The wound healing effect was compared to that of the standard antibiotic, Cicatrin R. The histopathological profile, phytochemistry and the acute toxicity were also studied.

  2. Studies on Wound Healing Properties of Quercus infectoria ...

    African Journals Online (AJOL)

    Purpose: The aim of the present study was to investigate the wound healing activity of the selected Indian medicinal plant Quercus infectoria. Method: Ethanol extract of the shade-dried leaves of Quercus infectoria was studied for its effect on wound healing in rats, using incision, excision and dead-space wound models, ...

  3. Experimental wound healing aspects of Jasminum grandiflorum Linn

    African Journals Online (AJOL)

    Experimental wound healing aspects of Jasminum grandiflorumLinn: a preclinical study. M Arun, S Satish, P Anima. Abstract. Background: Jasminum grandiflorum is an important shrub of family Oleaceae and ancient literature mentions its various medicinal uses especially its efficacy in wound healing. To substantiate its ...

  4. Biomaterials and Nanotherapeutics for Enhancing Skin Wound Healing

    Directory of Open Access Journals (Sweden)

    Subhamoy Das

    2016-10-01

    Full Text Available Wound healing is an intricate process that requires complex coordination between many cells and an appropriate extracellular microenvironment. Chronic wounds often suffer from high protease activity, persistent infection, excess inflammation, and hypoxia. While there has been intense investigation to find new methods to improve cutaneous wound care; the management of chronic wounds, burns, and skin wound infection remain challenging clinical problems. Ideally, advanced wound dressings can provide enhanced healing and bridge the gaps in the healing processes that prevent chronic wounds from healing. These technologies have great potential for improving outcomes in patients with poorly healing wounds but face significant barriers in addressing the heterogeneity and clinical complexity of chronic or severe wounds. Active wound dressings aim to enhance the natural healing process and work to counter many aspects that plague poorly healing wounds including excessive inflammation, ischemia, scarring and wound infection. This review paper discusses recent advances in the development of biomaterials and nanoparticle therapeutics to enhance wound healing. In particular, this review focuses on the novel cutaneous wound treatments that have undergone significant preclinical development or currently used in clinical practice.

  5. Effect of bone marrow and low power lasers on fracture healing with destruction of both periosteum and endosteum in rabbits

    Directory of Open Access Journals (Sweden)

    M. G. Thanoon

    2010-01-01

    Full Text Available Ten mature rabbits of local breed were used in this study; weighing between 1.5 to 1.75 kg and aged about 1–2 years. These animals were divided into two equal groups; in group A destruction of both periosteum and endosteum was done one centimeter from each side of mid-shaft femoral bone fracture, then sufficient amount of autogenously bone marrow was injected directly at the fracture site after immobilization by intramedullary pin. In group B a similar procedure was achieved as in group A, but in additional to that He-Ne infrared laser therapy was used for several sessions. The result of radiological findings indicated that, the fracture healing occurred within group B at fifteen weeks, whereas in group A the healing occurred at eighteen weeks after operation. The implantation of autologous bone marrow enhanced the fracture healing, whereas using of combinations of autologous bone marrow and He-Ne infrared laser therapy hastened the healing.

  6. Design and testing of tubular polymeric capsules for self-healing of concrete

    OpenAIRE

    Araújo, M.; van Tittelboom, K; Feiteira, J.; Gruyaert, Elke; Chatrabhuti, S.; Raquez, J. M.; Savija, B.; Alderete, N.; Schlangen, H.E.J.G.; de Belie, N

    2017-01-01

    Polymeric healing agents have proven their efficiency to heal cracks in concrete in an autonomous way. However, the bottleneck for valorisation of self-healing concrete with polymeric healing agents is their encapsulation. In the present work, the suitability of polymeric materials such as poly(methyl methacrylate) (PMMA), polystyrene (PS) and poly(lactic acid) (PLA) as carriers for healing agents in self-healing concrete has been evaluated. The durability of the polymeric capsules in differe...

  7. Wound healing potential of Pterocarpus santalinus linn: a pharmacological evaluation.

    Science.gov (United States)

    Biswas, Tuhin Kanti; Maity, Lakshmi Narayan; Mukherjee, Biswapati

    2004-09-01

    The need for new therapeutics for wound healing has encouraged the drive to examine the nature and value of plant products. Ayurveda, the Indian traditional system of medicine, mentions the values of medicinal plants for wound healing. One of these is Pterocarpus santalinus. This article describes a pharmacological study to evaluate its toxicity as well as wound-healing potential in animal studies. Powder made from the wood of the P. santalinus tree was used to make up an ointment in a petroleum jelly base. No toxic effects were observed in 72 hours. Studies were done on punch and burn wound models on normal and diabetic rats using the test ointment, untreated and vehicle controls, and standard therapy. Physical and biochemical measurements were made. The test ointment-treated wounds healed significantly faster. On healing, collagenesis and biochemical measurements yielded supportive data. These studies permit the conclusion that the P. santalinus ointment is safe and effective in treating acute wounds in animal models.

  8. Autonomic Healing of Epoxy Using Micro-Encapsulated Dicyclopentadiene

    Energy Technology Data Exchange (ETDEWEB)

    THOMA, STEVEN G.; GIUNTA, RACHEL K.; STAVIG, MARK E.; EMERSON, JOHN A.; MORALES, ALFREDO M.

    2003-05-01

    The autonomic healing ability of an epoxy adhesive containing micro-encapsulated dicyclopentadiene (DCPD) was evaluated. The epoxy resin used was Epon 828 cured with either Versamid 140 or diethylenetriamine (DETA). Variables included total weight percent of microcapsules (MCs) and catalyst, as well as the catalyst to DCPD ratio. The degree of healing was determined by the fracture toughness before and after ''healing'' using double-cantilever beam analysis. It was found that the degree of self-healing was most directly related to the contact area (i.e. crack width) during healing. Temperature also played a significant role. Observed differences between the results of this study and those in literature are discussed.

  9. Fibrin Glue Does Not Improve Healing of Gastrointestinal Anastomoses

    DEFF Research Database (Denmark)

    Nordentoft, Tyge; Pommergaard, Hans-Christian; Rosenberg, Jacob

    2015-01-01

    glue (FG), and the results in individual studies have been varying. The positive effect of anastomotic sealing with FG might be due to the mechanical/physical properties, the increased healing of the anastomoses or both. The aim of this systematic review was to evaluate the existing evidence...... on the healing effects of FG on gastrointestinal anastomoses. METHODS: PubMed, EMBASE and the Cochrane databases were searched for studies evaluating the healing process of gastrointestinal anastomoses after any kind of FG application. The search period was from 1953 to December 2013. RESULTS: Twenty......-eight studies were included in the qualitative synthesis. These studies were all experimental studies, since no human studies used histological or biochemical evaluation of healing. In 7 of the 28 studies, a positive effect of FG on healing was found, while 8 studies reported a negative effect and 11 studies...

  10. Self-healing epoxy composite with heat-resistant healant.

    Science.gov (United States)

    Yuan, Yan Chao; Ye, Xiao Ji; Rong, Min Zhi; Zhang, Ming Qiu; Yang, Gui Cheng; Zhao, Jian Qing

    2011-11-01

    To provide self-healing epoxy composite with adequate heat resistance for high-performance application, we developed a novel microencapsulated epoxy/mercaptan healing agent. The key measure lies in usage of diglycidyl ether of bisphenol A (EPON 828) as the polymerizable component and 2,4,6-tris(dimethylaminomethyl)phenol (DMP-30) as the catalyst. Because of the higher thermal stability of EPON 828 and lower volatility of DMP-30, the healing agent and the self-healing composite not only survive high-temperature curing and thermal exposure, but also offer satisfactory capability of autonomous properties restoration, as characterized by both fracture mechanics and fatigue tests. Especially when the operation temperature is not higher than 200 °C, the performance of the healing system is nearly independent of thermal history.

  11. An Experimental Animal Model for Abdominal Fascia Healing after Surgery

    DEFF Research Database (Denmark)

    Burcharth, J; Pommergaard, H-C; Klein, M

    2013-01-01

    Background: Incisional hernia (IH) is a well-known complication after abdominal surgical procedures. The exact etiology of IH is still unknown even though many risk factors have been suggested. The aim of this study was to create an animal model of a weakly healed abdominal fascia that could...... be used to evaluate the actively healing fascia. Such an animal model may promote future research in the prevention of IH. Methods: 86 male Sprague-Dawley rats were used to establish a model involving six experiments (experiments A-F). Mechanical testing of the breaking strength of the healed fascia...... was performed by testing tissue strips from the healed fascia versus the unincised control fascia 7 and 28 days postoperatively. Results: During the six experiments a healing model was created that produced significantly weaker coherent fascia when compared with the control tissue measured in terms...

  12. Mechanochemical triggers for self-healing polymers

    Science.gov (United States)

    Hickenboth, Charles Robert

    Including self-healing and self-toughening elements into structural polymer systems are one of several approaches for extending the lifetimes of materials and preventing catastrophic failure. As an alternative strategy to reduce the extent of damage necessary to initiate healing, a molecular-based approach is sought in which a chemical unit initiates toughening and healing before crack growth begins. We envision that this type of trigger would be coupled directly to the mechanical load stored within a failing polymer. Several mechanochemical triggers were designed and studied, including azo-based triggers, enediyne-based triggers and benzocyclobutene-based triggers. It was found that flow-induced mechanical forces, induced by ultrasound, were able to accelerate the homolytic extrusion of nitrogen from azo triggers by a factor of 105 at 9°C. The degradation leads to site-specific cleavage of polymers containing the trigger, resulting in one type of end group and degradation products of low polydispersity. Mechanochemical triggers based on enediynes were designed, computationally studied and synthesized. It was found computationally that the level of stress activation is highly sensitive the shape of the trigger, as well as the substituent pattern. These triggers were incorporated into PMMA polymer microspheres, and their reactivity under thermal and mechanical conditions was studied. No conclusions were able to be drawn on the stress-sensitivity of enediyne-based mechanochemical triggers, due to the absence of an efficient means of detecting reactivity. Mechanochemical triggers based on the electrocyclic ring opening of both trans and cis substituted benzocyclobutenes was studied. The products of mechanically-accelerated ring opening were studied by trapping experiments. Ultrasound induces ring opening at 10°C, whereas thermal activation only took place at temperatures over 105°C. It was found that the substitution pattern around the four-membered ring influenced

  13. Duodenocutaneous fistula in rats as a model for "wound healing-therapy" in ulcer healing: the effect of pentadecapeptide BPC 157, L-nitro-arginine methyl ester and L-arginine.

    Science.gov (United States)

    Skorjanec, S; Kokot, A; Drmic, D; Radic, B; Sever, M; Klicek, R; Kolenc, D; Zenko, A; Lovric Bencic, M; Belosic Halle, Z; Situm, A; Zivanovic Posilovic, G; Masnec, S; Suran, J; Aralica, G; Seiwerth, S; Sikiric, P

    2015-08-01

    While very rarely reported, duodenocutanenous fistula research might alter the duodenal ulcer disease background and therapy. Our research focused on rat duodenocutaneous fistulas, therapy, stable gastric pentadecapeptide BPC 157, an anti-ulcer peptide that healed other fistulas, nitric oxide synthase-substrate L-arginine, and nitric oxide synthase-inhibitor L-nitro-arginine methyl ester (L-NAME). The hypothesis was, duodenal ulcer-healing, like the skin ulcer, using the successful BPC 157, with nitric oxide-system involvement, the "wound healing-therapy", to heal the duodenal ulcer, the fistula-model that recently highlighted gastric and skin ulcer healing. Pressure in the lower esophageal and pyloric sphincters was simultaneously assessed. Duodenocutaneous fistula-rats received BPC 157 (10 μg/kg or 10 ng/kg, intraperitoneally or perorally (in drinking water)), L-NAME (5 mg/kg intraperitoneally), L-arginine (100 mg/kg intraperitoneally) alone and/or together, throughout 21 days. Duodenocutaneous fistula-rats maintained persistent defects, continuous fistula leakage, sphincter failure, mortality rate at 40% until the 4(th) day, all fully counteracted in all BPC 157-rats. The BPC 157-rats experienced rapidly improved complete presentation (maximal volume instilled already at 7(th) day). L-NAME further aggravated the duodenocutaneous fistula-course (mortality at 70% until the 4(th) day); L-arginine was beneficial (no mortality; however, maximal volume instilled not before 21(st) day). L-NAME-worsening was counteracted to the control level with the L-arginine effect, and vice versa, while BPC 157 annulled the L-NAME effects (L-NAME + L-arginine; L-NAME + BPC 157; L-NAME + L-arginine + BPC 157 brought below the level of the control). It is likely that duodenocutaneous fistulas, duodenal/skin defect simultaneous healing, reinstated sphincter function, are a new nitric oxide-system related phenomenon. In conclusion, resolving the duodenocutanenous fistulashealing

  14. Negative pressure wound therapy for skin grafts and surgical wounds healing by primary intention.

    Science.gov (United States)

    Webster, Joan; Scuffham, Paul; Stankiewicz, Monica; Chaboyer, Wendy P

    2014-10-07

    Indications for the use of negative pressure wound therapy (NPWT) are broadening with a range of systems now available on the market, including those designed for use on clean, closed incisions and skin grafts. Reviews have concluded that the evidence for the effectiveness of NPWT remains uncertain, however, it is a rapidly evolving therapy. Consequently, an updated systematic review of the evidence for the effects of NPWT on postoperative wounds expected to heal by primary intention is required. To assess the effects of NPWT on surgical wounds (primary closure, skin grafting or flap closure) that are expected to heal by primary intention. We searched the following electronic databases to identify reports of relevant randomised clinical trials: the Cochrane Wounds Group Specialised Register (searched 28 January 2014); the Cochrane Central Register of Controlled Trials (CENTRAL; 2013, issue 12); Database of Abstracts of Reviews of Effects (2013, issue 12); Ovid MEDLINE (2011 to January 2014); Ovid MEDLINE (In-Process & Other Non-Indexed Citations 24 January 2014); Ovid EMBASE (2011 to January 2014 Week 44); and EBSCO CINAHL (2011 to January 2014). We conducted a separate search to identify economic evaluations. We included trials if they allocated patients to treatment randomly and compared NPWT with any other type of wound dressing, or compared one type of NPWT with a different type of NPWT. We assessed trials for their appropriateness for inclusion and for their quality. This was done by three review authors working independently, using pre-determined inclusion and quality criteria. In this first update, we included an additional four trials, taking the total number of trials included to nine (785 participants). Three trials involved skin grafts, four included orthopaedic patients and two included general surgery and trauma surgery patients; all the included trials had unclear or high risk of bias for one or more of the quality indicators we assessed. Seven

  15. The contribution of interleukin-2 to effective wound healing.

    Science.gov (United States)

    Doersch, Karen M; DelloStritto, Daniel J; Newell-Rogers, M Karen

    2017-02-01

    Ineffective skin wound healing is a significant source of morbidity and mortality. Roughly 6.5 million Americans experience chronically open wounds and the cost of treating these wounds numbers in the billions of dollars annually. In contrast, robust wound healing can lead to the development of either hypertrophic scarring or keloidosis, both of which can cause discomfort and can be cosmetically undesirable. Appropriate wound healing requires the interplay of a variety of factors, including the skin, the local microenvironment, the immune system, and the external environment. When these interactions are perturbed, wounds can be a nidus for infection, which can cause them to remain open an extended period of time, or can scar excessively. Interleukin-2, a cytokine that directs T-cell expansion and phenotypic development, appears to play an important role in wound healing. The best-studied role for Interleukin-2 is in influencing T-cell development. However, other cell types, including fibroblasts, the skin cells responsible for closing wounds, express the Interleukin-2 receptor, and therefore may respond to Interleukin-2. Studies have shown that treatment with Interleukin-2 can improve the strength of healed skin, which implicates Interleukin-2 in the wound healing process. Furthermore, diseases that involve impaired wound healing, such as diabetes and systemic lupus erythematosus, have been linked to deficiencies in Interleukin-2 or defects Interleukin-2-receptor signaling. The focus of this review is to summarize the current understanding of the role of Interleukin-2 in wound healing, to highlight diseases in which Interleukin-2 and its receptor may contribute to impaired wound healing, and to assess Interleukin-2-modulating approaches as potential therapies to improve wound healing.

  16. Where are patients who have co-occurring mental and physical diseases located?

    DEFF Research Database (Denmark)

    Toftegaard, Kristian L; Gustafsson, Lea Nørgreen; Uwakwe, Richard

    2015-01-01

    ). METHODOLOGY: On admission to a psychiatric service, patients diagnosed with schizophrenia, schizotypal or delusional disorders (International Classification of Diseases-10 (ICD-10) group F2) or mood (affective) disorders (ICD-10 group F3) and a co-morbid physical condition (cardiovascular disease, diabetes......BACKGROUND: Patients with a psychiatric illness have a higher prevalence of physical diseases and thus a higher morbidity and mortality. AIM: The main aim was to investigate where patients with co-occurring physical diseases and mental disorders (psychotic spectrum or mood) in the health and social......, with a contact percentage of 46%-91%; in addition, general practice was a common contact, with a margin of 41%-93%. Similar tendencies are seen in Japan despite the small sample size. With regard to general practice, this is also the case with Nigerian patients. However, religious guidance or healing was rarely...

  17. Deep anterior lamellar keratoplasty for the management of iatrogenic keratectasia occurring after hexagonal keratotomy

    Directory of Open Access Journals (Sweden)

    Paras Mehta

    2012-01-01

    Full Text Available Iatrogenic keratectasia has been reported subsequent to refractive surgery or trauma. Hexagonal keratotomy (HK is a surgical incisional technique to correct hyperopia. A number of complications have been reported following this procedure, including irregular astigmatism, wound healing abnormalities and corneal ectasia. When visual acuity is poor because of ectasia or irregular astigmatism and contact lens fitting is not possible, penetrating or lamellar keratoplasty can be performed. Since incisions in refractive keratotomy are set at 90-95% depth of cornea, intraoperative microperforations are known to occur and lamellar keratoplasty may become difficult. We describe deep anterior lamellar keratoplasty (DALK used to successfully manage keratectasia after HK. Pre DALK vision was 20/400 and post DALK vision was 20/30 two months after surgery. This report aims to show improved visual outcome in corneal ectasia secondary to HK. DALK can be a procedure of choice with proper case selection.

  18. Rapid mixing kinetic techniques.

    Science.gov (United States)

    Martin, Stephen R; Schilstra, Maria J

    2013-01-01

    Almost all of the elementary steps in a biochemical reaction scheme are either unimolecular or bimolecular processes that frequently occur on sub-second, often sub-millisecond, time scales. The traditional approach in kinetic studies is to mix two or more reagents and monitor the changes in concentrations with time. Conventional spectrophotometers cannot generally be used to study reactions that are complete within less than about 20 s, as it takes that amount of time to manually mix the reagents and activate the instrument. Rapid mixing techniques, which generally achieve mixing in less than 2 ms, overcome this limitation. This chapter is concerned with the use of these techniques in the study of reactions which reach equilibrium; the application of these methods to the study of enzyme kinetics is described in several excellent texts (Cornish-Bowden, Fundamentals of enzyme kinetics. Portland Press, 1995; Gutfreund, Kinetics for the life sciences. Receptors, transmitters and catalysis. Cambridge University Press, 1995).There are various ways to monitor changes in concentration of reactants, intermediates and products after mixing, but the most common way is to use changes in optical signals (absorbance or fluorescence) which often accompany reactions. Although absorbance can sometimes be used, fluorescence is often preferred because of its greater sensitivity, particularly in monitoring conformational changes. Such methods are continuous with good time resolution but they seldom permit the direct determination of the concentrations of individual species. Alternatively, samples may be taken from the reaction volume, mixed with a chemical quenching agent to stop the reaction, and their contents assessed by techniques such as HPLC. These methods can directly determine the concentrations of different species, but are discontinuous and have a limited time resolution.

  19. Healing thyself: a Korean shaman's afflictions.

    Science.gov (United States)

    Kendall, L

    1988-01-01

    Accounts of shamans' lives have typically emphasized the shaman's experience of a divine 'calling' and subsequent initiation as the key incidents around which other biographical, psychological, and cultural information may be organized and appreciated. Scholars have thus emphasized those aspects of the shaman's experience which set the shaman apart from other members of her or his society and at the same time, render the shaman comparable to other shamans in other places far removed in time and space. This paper takes a different approach, describing a series of ordinary misfortunes that befell a Korean mansin several years after her initiation, the interpretations she and her colleagues placed upon these events, the advice she received, and the healing strategies she subsequently followed. This discussion reveals those aspects of the shaman's experience that render her more, rather than less, like those she treats and suggests a process whereby the shared reality of shaman and client is realized in lived experiences, rituals, and conversations.

  20. The external microenvironment of healing skin wounds

    DEFF Research Database (Denmark)

    Kruse, Carla R; Nuutila, Kristo; Lee, Cameron Cy

    2015-01-01

    The skin wound microenvironment can be divided into two main components that influence healing: the external wound microenvironment, which is outside the wound surface; and the internal wound microenvironment, underneath the surface, to which the cells within the wound are exposed. Treatment...... and carbon dioxide), pH, and anti-microbial treatment on the wound. These factors are well described in the literature and can be modified with treatment methods available in the clinic. Understanding the roles of these factors in wound pathophysiology is of central importance in wound treatment...... methods that directly alter the features of the external wound microenvironment indirectly affect the internal wound microenvironment due to the exchange between the two compartments. In this review, we focus on the effects of temperature, pressure (positive and negative), hydration, gases (oxygen...

  1. News in wound healing and management

    DEFF Research Database (Denmark)

    Gottrup, Finn; Jørgensen, Bo; Karlsmark, Tonny

    2009-01-01

    . In the treatment of wounds, the new trend in the wound device marked is to produce dressings containing compounds or drugs. This could be local antiseptics (silver, other antiseptics, honey) and pain relieving drugs such as ibuprofen and morphine. New treatments such as anti-tumor necrosis factor alfa (anti...... is still at an exploratory level. Organizing models for optimal wound management are constantly being developed and refined. SUMMARY: Recent knowledge on the importance of new dressing materials containing active substances, new treatments for atypical wounds, influencing factors on the healing process...... and organization in the wound area are increasingly been launched. This may in the coming years significantly improve the treatment outcome of problem wounds....

  2. The Power of Rhetoric: Two Healing Movements

    Science.gov (United States)

    Justman, Stewart

    2011-01-01

    Though we might suppose that our sensations are unaffected by the talk around us, the rhetoric surrounding a treatment can in fact color the experience of those having the treatment. So it is with both Eye Movement Desensitization and Reprocessing (EMDR) and the 18th-century therapy that has been cited as its predecessor: mesmerism. In both cases, rhetoric itself is conscripted into the service of therapeutic ends. Reports of cures are advertised and celebrated in a way that builds the expectation and feeds the experience of more of the same. Precisely because they are rooted in and speak to their time and place, however, the efficacy of these therapies may be limited. An investigation of the kinship between the two healing movements — and the driving force of a movement is nothing other than rhetoric — throws light on possibly social sources of therapeutic efficacy. PMID:21451780

  3. Self-healing effect of spallation damageability

    Science.gov (United States)

    Buravova, S. N.

    2017-10-01

    The self-healing effect has been found in a study of the microstructure of the bands of localized deformation. It has been shown that interstitial elements (O, C) and the particles of a doping phase migrate to the zone of growing spallation damageability from the matrix material. When considering the wave pattern of the process of localization, it has been ascertained that the formation of bands of localized deformation is accompanied by the process of reverberation which is characterized by the formation of periodically repeated compression-extension cycles. A weak attenuation of the reverberation has led to an increase in the duration of the deformation pulse of the sample by two to three orders of magnitude compared with the time of the initial compression pulse.

  4. The experiential foundations of shamanic healing.

    Science.gov (United States)

    McClenon, J

    1993-04-01

    An experience-centered approach reveals empirical foundations for shamanic healing. This article is based on data derived from surveys of Chinese, Japanese, Caucasian-American, and African-American populations and participant observation of over thirty Asian shamans. Respondents reported anomalous events such as apparitions, extrasensory perceptions, contact with the dead, precognitive dreams, clairvoyance, and out-of-body experiences. Based on folk reasoning, these episodes support belief in spirits, souls, and life after death. Shamanic healers have a far greater propensity to experience anomalous events than general populations and to use their beliefs arising from these episodes to produce ceremonies that change clients' perceptions of their illnesses. Although the foundations supporting shamanism differ from those sustaining Western medicine, both traditions provide experiences that convince clients that specific procedural methods alleviate illness.

  5. Applications of biomaterials in corneal wound healing.

    Science.gov (United States)

    Tsai, I-Lun; Hsu, Chih-Chien; Hung, Kuo-Hsuan; Chang, Chi-Wen; Cheng, Yung-Hsin

    2015-04-01

    Disease affecting the cornea is a common cause of blindness worldwide. To date, the amniotic membrane (AM) is the most widely used clinical method for cornea regeneration. However, donor-dependent differences in the AM may result in variable clinical outcomes. To overcome this issue, biomaterials are currently under investigation for corneal regeneration in vitro and in vivo. In this article, we highlight the recent advances in hydrogels, bioengineered prosthetic devices, contact lenses, and drug delivery systems for corneal regeneration. In clinical studies, the therapeutic effects of biomaterials, including fibrin and collagen-based hydrogels and silicone contact lenses, have been demonstrated in damaged cornea. The combination of cells and biomaterials may provide potential treatment in corneal wound healing in the future. Copyright © 2014. Published by Elsevier Taiwan.

  6. Applications of biomaterials in corneal wound healing

    Directory of Open Access Journals (Sweden)

    I-Lun Tsai

    2015-04-01

    Full Text Available Disease affecting the cornea is a common cause of blindness worldwide. To date, the amniotic membrane (AM is the most widely used clinical method for cornea regeneration. However, donor-dependent differences in the AM may result in variable clinical outcomes. To overcome this issue, biomaterials are currently under investigation for corneal regeneration in vitro and in vivo. In this article, we highlight the recent advances in hydrogels, bioengineered prosthetic devices, contact lenses, and drug delivery systems for corneal regeneration. In clinical studies, the therapeutic effects of biomaterials, including fibrin and collagen-based hydrogels and silicone contact lenses, have been demonstrated in damaged cornea. The combination of cells and biomaterials may provide potential treatment in corneal wound healing in the future.

  7. The effect of platelet-rich plasma on osseous healing in dogs undergoing high tibial osteotomy.

    Directory of Open Access Journals (Sweden)

    Samuel P Franklin

    Full Text Available The purpose of this study was to investigate whether platelet-rich plasma (PRP enhances osseous healing in conjunction with a high tibial osteotomy in dogs.Randomized controlled trial.Sixty-four client-owned pet dogs with naturally occurring rupture of the anterior cruciate ligament and that were to be treated with a high tibial osteotomy (tibial plateau leveling osteotomy were randomized into the treatment or control group. Dogs in the treatment group received autologous platelet-rich plasma activated with calcium chloride and bovine thrombin to produce a well-formed PRP gel that was placed into the osteotomy at the time of surgery. Dogs in the control group received saline lavage of the osteotomy. All dogs had the osteotomy stabilized with identical titanium alloy implants and all aspects of the surgical procedure and post-operative care were identical among dogs of the two groups. Bone healing was assessed at exactly 28, 49, and 70 days after surgery with radiography and ultrasonography and with MRI at day 28. The effect of PRP on bone healing was assessed using a repeated measures analysis of covariance with radiographic and ultrasonographic data and using a t-test with the MRI data.Sixty dogs completed the study. There were no significant differences in age, weight, or gender distribution between the treatment and control groups. Twenty-seven dogs were treated with PRP and 33 were in the control group. The average platelet concentration of the PRP was 1.37x106 platelets/μL (±489x103 with a leukocyte concentration of 5.45x103/μL (±3.5x103. All dogs demonstrated progressive healing over time and achieved clinically successful outcomes. Time since surgery and patient age were significant predictors of radiographic healing and time since surgery was a significant predictor of ultrasonographic assessment of healing. There was no significant effect of PRP treatment as assessed radiographically, ultrasonographically, or with MRI.The PRP used

  8. The effect of platelet-rich plasma on osseous healing in dogs undergoing high tibial osteotomy

    Science.gov (United States)

    Burke, Emily E.; Holmes, Shannon P.

    2017-01-01

    Objectives The purpose of this study was to investigate whether platelet-rich plasma (PRP) enhances osseous healing in conjunction with a high tibial osteotomy in dogs. Study design Randomized controlled trial. Methods Sixty-four client-owned pet dogs with naturally occurring rupture of the anterior cruciate ligament and that were to be treated with a high tibial osteotomy (tibial plateau leveling osteotomy) were randomized into the treatment or control group. Dogs in the treatment group received autologous platelet-rich plasma activated with calcium chloride and bovine thrombin to produce a well-formed PRP gel that was placed into the osteotomy at the time of surgery. Dogs in the control group received saline lavage of the osteotomy. All dogs had the osteotomy stabilized with identical titanium alloy implants and all aspects of the surgical procedure and post-operative care were identical among dogs of the two groups. Bone healing was assessed at exactly 28, 49, and 70 days after surgery with radiography and ultrasonography and with MRI at day 28. The effect of PRP on bone healing was assessed using a repeated measures analysis of covariance with radiographic and ultrasonographic data and using a t-test with the MRI data. Results Sixty dogs completed the study. There were no significant differences in age, weight, or gender distribution between the treatment and control groups. Twenty-seven dogs were treated with PRP and 33 were in the control group. The average platelet concentration of the PRP was 1.37x106 platelets/μL (±489x103) with a leukocyte concentration of 5.45x103/μL (±3.5x103). All dogs demonstrated progressive healing over time and achieved clinically successful outcomes. Time since surgery and patient age were significant predictors of radiographic healing and time since surgery was a significant predictor of ultrasonographic assessment of healing. There was no significant effect of PRP treatment as assessed radiographically, ultrasonographically

  9. Phototherapy improves healing of cutaneous wounds in nourished and undernourished Wistar rats.

    Science.gov (United States)

    Pinheiro, Antonio Luiz Barbosa; Meireles, Gyselle Cynthia Silva; de Barros Vieira, Alessandro Leonardo; Almeida, Darcy; Carvalho, Carolina Montagn; dos Santos, Jean Nunes

    2004-01-01

    A wound represents the interruption of the continuity of tissue that is followed by damage or cellular death. Wound healing occurs due to a competitive mechanism between the synthesis and lysis of collagen. Any factor that increases collagen lysis or reduces its synthesis may result in changes in the healing process, i.e., nutritional deficiencies. Phototherapies have been suggested as an effective method to improve wound healing. This study evaluated, histologically, the differences in the healing of cutaneous wounds in nourished and undernourished rats following laser therapy or illumination by polarized light. Fifty nourished or undernourished Wistar rats had a standardized wound created on the dorsum and were divided into 6 subgroups: Group 1--Control (Standard diet; n=5); Group 2--Control (DBR; n=5); Group 3--Standard diet + laser therapy (lambda635nm; 20J/cm2, n=5; or 40J/cm2, n=5); Group 4--Standard diet + Bioptron (lambda400-2000nm; 20J/cm2, n=5; or 40 J/cm2, n=5); Group 5--DBR + laser therapy (lambda635nm; 20J/cm2, n=5; or 40J/cm2, n=5); Group 6--DBR + Bioptron (lambda400-2000nm; 20J/cm2, n=5; or 40 J/cm2, n=5). The first application of the treatment was carried out immediately after surgery and repeated every 24 h during 7 days. Specimens were routinely processed (wax, cut and stained with H&E and Picrosirius stain) and analyzed under light microscopy. Analysis included re-epithelization, inflammatory infiltrate, and fibroblastic proliferation. Picrosirius stained slides were used to perform descriptive analysis of the collagen fibers. The results showed the best results for nourished and undernourished groups treated with polarized light at a dose of 20J/cm2 and the undernourished groups irradiated with the laser light. It is concluded that the nutritional status influenced the progression of the healing process as well as the quality of the healed tissue and that the use of both modalities of phototherapy resulted in a positive biomodulatory effect in

  10. [New directions of research related to chronic wound healing].

    Science.gov (United States)

    Rusak, Agnieszka; Rybak, Zbigniew

    2013-01-01

    Optimal nutrition, immunological state and psychological condition play an important role in the process of chronic wound healing. Infections caused by pathogens resistant to commonly used antibiotics additionally complicate and disturb regeneration of wounds. As part of the treatment, modern wound dressings are used, for example designed on the basis of alginates, dextranomers, hydrogels, hydrofiber, polyurethanes foams, hydrocolloids and liquids for wound debridement such us 0.9% NaCl, the PWE liquid, Ringer's liquid, octenidine. Owing to their features, treatment in accordance with TIME concept could be realized, because they provide moisture wound bed, protection against contamination, gas exchange, protection of wound edges and infection control. Repairing process in chronic wounds is dependent on blood flow in tissues, which may be insufficient. The result is a permanent hypoxia. Natural occurring antioxidants are becoming more crucial in chronic wound treatment. They decrease oxygen radical concentration, increase angiogenesis, reduce inflammatory response, stimulate fibroblasts and keratinocytes proliferation, possess antibacterial properties against chemotherapeutic resistant strains. There are a lot of antioxidants in honey, papaya fruit (Carrica papaia L.), transgenic flax (Linum usitatissimum), and in orange oil (Citrus sinensis), stem of acanthus (Acanthus ebracteatus), leafs of tea (Camellia sinensis). Application of biologically active, natural derived compounds is nowadays a direction of intense in vitro and in vivo research focused on the chronic wound treatment. Results suggest beneficial influence of antioxidant on wound repairing process. Clinical research are needed to state effective influence of natural compound in the chronic wound treatment.

  11. Beauty and healing: examining sociocultural expectations of the embodied goddess.

    Science.gov (United States)

    Yeh, Jin-Tsann; Lin, Chyong-Ling

    2013-03-01

    Studies indicate mental health improvement can occur via religious communities offering social support and other resources. Many people from many cultures regard medicine as a supernatural or magical treatment that can somehow lead to a better state of living. In medical advertising, female role portrayal involves the blending of beauty, ritual and attractiveness in combination with the best product image. A Chinese saying suggests that, "A girl will doll herself up for him who loves her." Female role attraction is a very important ethical subject in gender issues. Moving forward in time, female role visualization and consumption in medical advertising reveal depictions that encouraged women to do some self-searching and find, or develop, inner strength. This study is designed to examine female role portrayals in a restricted patriarchal society. The results indicate that the ideology of motherhood is an accepted social orientation that the public readily identifies with. Results further indicate that beautification through medical products incorporates an emotional element of religious healing and that the objectification of beauty in the media reveals a possible neglect of women's internal beauty.

  12. The importance of the apposition of the submucosal intestinal layers for primary wound healing of intestinal anastomosis.

    Science.gov (United States)

    Jansen, A; Becker, A E; Brummelkamp, W H; Keeman, J N; Klopper, P J

    1981-01-01

    This study was undertaken to examine the importance of the apposition of the submucosal layers in healing of the intestinal anastomosis. On 18 mongrel dogs, weighing between 8 and 15 kilograms, four anastomoses were performed on the small intestine. Two with a conventional anastomosis and two with rings of polyester-polyethyleneterephtalate, containing small Ticonal magnets. The force between the rings with the magnets varied from 0-3 newton between, respectively, 15 millimeters and zero millimeter distance. After three to four days, the rings cut through and disappeared from the anastomosis. Morphologic and microangiographic studies, undertaken at ten days, revealed that, in instances of good submucosal apposition, direct bridging of the defect in the submucosal layer was seen with rapid restoration of the villous epithelium and an undisturbed vascular pattern in the anastomotic area. This we called primary intestinal healing. In instances of bad submucosal apposition, we saw indirect bridging of the submucosal layer defect by smaller and longer strands of newly synthesized collagen tissue in the outer intestinal layers with a collateral circulation from the submucosal plexus to the arterial plexuses in these layers. In all instances, an epithelial defect still persisted at ten days. This type of wound healing we called secondary intestinal healing. The results showed that, with the magnetic rings, a significantly better apposition of the intestinal layers was achieved.

  13. Enhanced Healing of Diabetic Wounds by Subcutaneous Administration of Human Umbilical Cord Derived Stem Cells and Their Conditioned Media

    Directory of Open Access Journals (Sweden)

    Chandrama Shrestha

    2013-01-01

    Full Text Available Objective. Mesenchymal stem cells (MSCs isolated from the umbilical cord and their conditioned media (CM can be easily obtained and refined compared with stem cells from other sources. Here, we explore the possibility of the benefits of these cells in healing diabetic wounds. Methodology and Results. Delayed wound healing animal models were established by making a standard wound on the dorsum of eighteen db/db mice, which were divided into three groups with six mice in each: groups I, II, and III received PBS, UC-MSC, and CM, respectively. UC-MSC and their CM significantly accelerated wound closure compared to PBS-treated wounds, and it was most rapid in CM-injected wounds. In day-14 wounds, significant difference in capillary densities among the three groups was noted (n=6; P<0.05, and higher levels of VEGF, PDGF, and KGF expression in the CM- and UC-MSC-injected wounds compared to the PBS-treated wounds were seen. The expression levels of PDGF-β and KGF were higher in CM-treated wounds than those in UC-MSC-treated wounds. Conclusion. Both the transplantation of UC-MSC and their CM are beneficial to diabetic wound healing, and CM has been shown to be therapeutically better than UC-MSC, at least in the context of diabetic wound healing.

  14. [Healing and the Roman imperial culture].

    Science.gov (United States)

    Ziethen, G

    1994-01-01

    From the time of Augustus till Late Antiquity one of the important elements of Roman Imperial policy was the celebration of rituals honouring the Roman Emperor. Elements of Hellenistic ruler cult and traditions of the Roman Republican Age were connected with Roman administration, the economic life and military organisation. Thereby the Roman Emperor generally was considered not only as a powerful and legitimate political leader but also as a well-educated and informed princeps with some kind of ritual sphere. Continuing the traditions of kingship risen in the Oriental monarchies and traduced to the Hellenistic rulers, the Roman Emperor seemed--pictured as Asclepius or Sarapis--to be able to heal not only incurable persons by magic therapy, but also to give a cure to mishandled affairs of state. The hope of the people in the panacea founded on the Emperor's knowledge was explained differently on two intellectual levels: the belief in magical-medical practices against threatening demons and the sophisticated comparisons of the eras of the Roman Empire expressed as the progress of human life from the cradle of iuventus to the old age of senectus. With the image of the Roman State as a human being a tradition began which had been prepared by the parable of the body and the limbs since early Roman historiography. From paganism to the Christianisation of the Roman Empire the vocabulary of healing and therapy was used in papyrological, literary, juridical and theological texts expressing the expectation in impersonation and ceremony of the Roman and Byzantine Emperors till the godblessed monarchs in Christian Europe.

  15. Cat keratoplasty wound healing and corneal astigmatism.

    Science.gov (United States)

    Tripoli, N K; Cohen, K L; Proia, A D

    1992-01-01

    A major contributor to postkeratoplasty astigmatism may be donor/recipient disparity. Deficient or excess cornea at the wound is thought to influence the directions of the steep and flat meridians. Using an established model of penetrating keratoplasty in the cat, this study evaluated the morphometry of histopathologic wound features in the steep and flat meridians. Thirteen cats had successful penetrating keratoplasties after intentionally misshapen donor corneas were misaligned in misshapen recipient beds. At 9.50 +/- 0.32 (mean +/- 1 SEM) months after keratoplasty, photokeratography was performed and analyzed, corneas were sectioned along the steep and flat meridians, and four histologic sections were processed. Features of the wounds were measured using a Zeiss Videoplan. The relationships between the morphometry of each feature and every other feature, between the morphometry of each feature and eccentricity, and between the steep and flat section morphometry of each feature were statistically evaluated. Epithelial thickness, area of lamellar alteration, length of Descemet's membrane produced postoperatively, and the depth that preoperative Descemet's membrane was embedded in the stroma were correlated with eccentricity (corneal astigmatism). Stromal thickness and the presence or absence of folded and fragmented Descemet's membrane were not correlated with eccentricity. Wound morphometry at the steep meridians was neither correlated with nor significantly different from wound morphometry at the flat meridians. Differences between healing at the steep and flat meridians were not likely contributors to astigmatism. Disproportionate availability of tissue in wound regions may have affected healing throughout the entire wound over time. The absence of Bowman's layer in cats restricts application of our results to understanding the etiology of corneal astigmatism after penetrating keratoplasty in humans.

  16. Concept of healing of recurrent shoulder dislocation

    Directory of Open Access Journals (Sweden)

    Donato D'Angelo

    2014-08-01

    Full Text Available This paper presents the main surgical techniques applied in the treatment of anterior recurrent shoulder dislocation, aiming the achievement of the normality of articulate movements. This was obtained by combining distinct surgical procedures, which allowed the recovery of a complete functional capacity of the shoulder, without jeopardizing the normality of movement, something that has not been recorded in the case of the tense sutures of the surgical procedures of Putti-Platt, Bankart, Latarjet, Dickson-O'Dell and others.The careful review of the methods applied supports the conclusion that recurrent shoulder dislocation can be cured, since cure has been obtained in 97% of the treated cases. However, some degree of limitation in the shoulder movement has been observed in most of the treated cases.Our main goal was to achieve a complete shoulder functional recovery, by treating simultaneously all of the anatomical–pathological lesions, without considering the so-called essential lesions.The period of post-operatory immobilization only last for the healing of soft parts; this takes place in a position of neutral shoulder rotation, since the use of vascular bone graft eliminates the need for long time immobilization, due to the shoulder stabilization provided by rigid fixation of the coracoid at the glenoid edge, as in the Latarjet's technique.Our procedure, used since 1959, comprises the association of several techniques, which has permitted shoulder healing without movement limitation. That was because of the tension reduction in the sutures of the subescapularis, capsule, and coracobraquialis muscles.

  17. [Healing gardens: recommendations and criteria for design].

    Science.gov (United States)

    Rivasseau-Jonveaux, Thérèse; Pop, Alina; Fescharek, Reinhard; Chuzeville, Stanislas Bah; Jacob, Christel; Demarche, Laëtitia; Soulon, Laure; Malerba, Gabriel

    2012-09-01

    The French Alzheimer plan anticipates new specialized structures for cognitive rehabilitation and psycho-behavioural therapy of Alzheimer's patients: the cognitive-behavioural units as follow-care units, the units of reinforced hospitalization inside the long term care units and the adapted activities units. this plan indicates the need to make healing gardens integral parts of these units. The benefits of green space in urban environments has been demonstrated with regards to physical, psychological and sociological effects and similarly studies in hospitals have revealed objective and measurable improvements of patients well being. Although green spaces and gardens are available in many French care units, they are rarely specifically adapted to the needs of Alzheimer's patients. For the garden "art, memory and life" a specific concept guided by a neuropsychological approach was developed, complemented by an artistic vision based on cultural invariants. It is already used in the frame of non-pharmacological therapies to improve symptoms such as deambulation, sleep disorders, apathy and aggressive behaviors. Based on the literature, and our experience and research, recommendations for the design of such gardens dedicated to Alzheimer's patients can be proposed. Beyond taking into account obvious aspects relating to security, allowing for free access, a careful design of walk-ways and a conscious choice of plants is needed. A systematic analysis of the existing green spaces or garden must be conducted in order to pinpoint the weakness of the space and identify the potential for developing it into a real healing garden. Evaluation of adapted questionnaires for users and professionals allow to establish a list of requirements combining both user requests and therapeutic needs as basis for the design of the garden as well as to evaluate during the course of the project, whether the needs of the various stakeholders have been met or if adjustments are necessary.

  18. Rapid Prototyping Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The ARDEC Rapid Prototyping (RP) Laboratory was established in December 1992 to provide low cost RP capabilities to the ARDEC engineering community. The Stratasys,...

  19. Surface-initiated self-healing of polymers in aqueous media

    Science.gov (United States)

    Ahn, B. Kollbe; Lee, Dong Woog; Israelachvili, Jacob N.; Waite, J. Herbert

    2014-09-01

    Polymeric materials that intrinsically heal at damage sites under wet or moist conditions are urgently needed for biomedical and environmental applications. Although hydrogels with self-mending properties have been engineered by means of mussel-inspired metal-chelating catechol-functionalized polymer networks, biological self-healing in wet conditions, as occurs in self-assembled holdfast proteins in mussels and other marine organisms, is generally thought to involve more than reversible metal chelates. Here we demonstrate self-mending in metal-free water of synthetic polyacrylate and polymethacrylate materials that are surface-functionalized with mussel-inspired catechols. Wet self-mending of scission in these polymers is initiated and accelerated by hydrogen bonding between interfacial catechol moieties, and consolidated by the recruitment of other non-covalent interactions contributed by subsurface moieties. The repaired and pristine samples show similar mechanical properties, suggesting that the triggering of complete self-healing is enabled underwater by the formation of extensive catechol-mediated interfacial hydrogen bonds.

  20. Healing effect of sea buckthorn, olive oil, and their mixture on full-thickness burn wounds.

    Science.gov (United States)

    Edraki, Mitra; Akbarzadeh, Armin; Hosseinzadeh, Massood; Tanideh, Nader; Salehi, Alireza; Koohi-Hosseinabadi, Omid

    2014-07-01

    The purpose of this study is to evaluate the healing effect of silver sulfadiazine (SSD), sea buckthorn, olive oil, and 5% sea buckthorn and olive oil mixture on full-thickness burn wounds with respect to both gross and histopathologic features. Full-thickness burns were induced on 60 rats; the rats were then were divided into 5 groups and treated with sea buckthorn, olive oil, a 5% sea buckthorn/olive oil mixture, SSD, and normal saline (control). They were observed for 28 days, and the wounds' healing process was evaluated. Wound contraction occurred faster in sea buckthorn, olive oil, and the sea buckthorn/olive oil mixture groups compared with the SSD and control groups. The volume of the exudates was controlled more effectively in wounds treated with the sea buckthorn/olive oil mixture. Purulent exudates were observed in the control group, but the others did not show infection. The group treated with sea buckthorn/olive oil mixture revealed more developed re-epithelialization with continuous basement membrane with a mature granulation tissue, whereas the SSD-treated group showed ulceration, necrosis, and immature granulation. The results show that sea buckthorn and olive oil individually are proper dressing for burn wounds and that they also show a synergetic effect when they are used together. A sea buckthorn and olive oil mixture could be considered as an alternative dressing for full-thickness burns because of improved wound healing characteristics and antibacterial property.