Super ACO FEL oscillation at 300 nm
Nutarelli, D; Renault, E; Nahon, L; Couprie, Marie Emmanuelle
2000-01-01
Some recent improvements, involving both the optical cavity mirrors and the positron beam dynamics in the storage ring, have allowed us to achieve a laser oscillation at 300 nm on the Super ACO Storage Ring FEL. The Super ACO storage ring is operated at 800 MeV which is the nominal energy for the usual synchrotron radiation users, and the highest energy for a storage ring FEL. The lasing at 300 nm could be kept during 2 h per injection, with a stored current ranging between 30 and 60 mA. The FEL characteristics are presented here. The longitudinal stability and the FEL optics behaviour are also discussed.
Low-cost 420nm blue laser diode for tissue cutting and hemostasis
Linden, Kurt J.
2016-03-01
This paper describes the use of a 420 nm blue laser diode for possible surgery and hemostasis. The optical absorption of blood-containing tissue is strongly determined by the absorption characteristics of blood. Blood is primarily comprised of plasma (yellowish extracellular fluid that is approximately 95% water by volume) and formed elements: red blood cells (RBCs), white blood cells (WBCs) and platelets. The RBCs (hemoglobin) are the most numerous, and due to the spectral absorption characteristics of hemoglobin, the optical absorption of blood has a strong relative maximum value in the 420 nm blue region of the optical spectrum. Small, low-cost laser diodes emitting at 420 nm with tens of watts of continuous wave (CW) optical power are becoming commercially available. Experiments on the use of such laser diodes for tissue cutting with simultaneous hemostasis were carried out and are here described. It was found that 1 mm deep x 1 mm wide cuts can be achieved in red meat at a focused laser power level of 3 W moving at a velocity of ~ 1 mm/s. The peripheral necrosis and thermal damage zone extended over a width of approximately 0.5 mm adjacent to the cuts. Preliminary hemostasis experiments were carried out with fresh equine blood in Tygon tubing, where it was demonstrated that cauterization can occur in regions of intentional partial tubing puncture.
Energy Technology Data Exchange (ETDEWEB)
Karcı, Özgür [NanoMagnetics Instruments Ltd., Hacettepe - İvedik OSB Teknokent, 1368. Cad., No: 61/33, 06370, Yenimahalle, Ankara (Turkey); Department of Nanotechnology and Nanomedicine, Hacettepe University, Beytepe, 06800 Ankara (Turkey); Dede, Münir [NanoMagnetics Instruments Ltd., Hacettepe - İvedik OSB Teknokent, 1368. Cad., No: 61/33, 06370, Yenimahalle, Ankara (Turkey); Oral, Ahmet, E-mail: orahmet@metu.edu.tr [Department of Physics, Middle East Technical University, 06800 Ankara (Turkey)
2014-10-01
We describe the design of a wide temperature range (300 mK-300 K) atomic force microscope/magnetic force microscope with a self-aligned fibre-cantilever mechanism. An alignment chip with alignment groves and a special mechanical design are used to eliminate tedious and time consuming fibre-cantilever alignment procedure for the entire temperature range. A low noise, Michelson fibre interferometer was integrated into the system for measuring deflection of the cantilever. The spectral noise density of the system was measured to be ~12 fm/√Hz at 4.2 K at 3 mW incident optical power. Abrikosov vortices in BSCCO(2212) single crystal sample and a high density hard disk sample were imaged at 10 nm resolution to demonstrate the performance of the system.
International Nuclear Information System (INIS)
Karcı, Özgür; Dede, Münir; Oral, Ahmet
2014-01-01
We describe the design of a wide temperature range (300 mK-300 K) atomic force microscope/magnetic force microscope with a self-aligned fibre-cantilever mechanism. An alignment chip with alignment groves and a special mechanical design are used to eliminate tedious and time consuming fibre-cantilever alignment procedure for the entire temperature range. A low noise, Michelson fibre interferometer was integrated into the system for measuring deflection of the cantilever. The spectral noise density of the system was measured to be ∼12 fm/√Hz at 4.2 K at 3 mW incident optical power. Abrikosov vortices in BSCCO(2212) single crystal sample and a high density hard disk sample were imaged at 10 nm resolution to demonstrate the performance of the system
Absorption spectrum of DNA for wavelengths greater than 300 nm
International Nuclear Information System (INIS)
Sutherland, J.C.; Griffin, K.P.
1981-01-01
Although DNA absorption at wavelengths greater than 300 nm is much weaker than that at shorter wavelengths, this absorption seems to be responsible for much of the biological damage caused by solar radiation of wavelengths less than 320 nm. Accurate measurement of the absorption spectrum of DNA above 300 nm is complicated by turbidity characteristic of concentrated solutions of DNA. We have measured the absorption spectra of DNA from calf thymus, Clostridium perfringens, Escherichia coli, Micrococcus luteus, salmon testis, and human placenta using procedures which separate optical density due to true absorption from that due to turbidity. Above 300 nm, the relative absorption of DNA increases as a function of guanine-cytosine content, presumably because the absorption of guanine is much greater than the absorption of adenine at these wavelengths. This result suggests that the photophysical processes which follow absorption of a long-wavelength photon may, on the average, differ from those induced by shorter-wavelength photons. It may also explain the lower quantum yield for the killing of cells by wavelengths above 300 nm compared to that by shorter wavelengths
Energy Technology Data Exchange (ETDEWEB)
Get' man, V.A.; Gorbenko, V.G.; Grushin, V.F.; Derkach, A.Y.; Zhebrovskii, Y.V.; Karnaukhov, I.M.; Kolesnikov, L.Y.; Luchanin, A.A.; Rubashkin, A.L.; Sanin, V.M.; Sorokin, P.V.; Sporov, E.A.; Telegin, Y.N.; Shalatskii, S.V.
1980-10-01
A technique for measurement of the polarization observables ..sigma.., P, and T for the reaction ..gamma..p..-->..n..pi../sup +/ in a doubly polarized experiment (polarized proton target + linearly polarized photon beam) is described. Measurements of the angular distributions of these observables in the range of pion emission angles 30--150/sup 0/ are presented for four photon energies from 300 to 420 MeV. Inclusion of the new experimental data in an energy-independent multipole analysis of photoproduction from protons permits a more reliable selection of solutions to be made.
Optical gain and absorption of 420 nm InGaN-based laser diodes grown on m-plane GaN substrate
Shen, Chao
2014-01-01
Segmented contact method was utilized to measure the gain and absorption spectra at below and above threshold for 420nm m-plane InGaN/GaN laser diode with a comparatively higher peak modal gain of 29.2 cm-1.
ASPECTS OF THE MECHNANICAL BEHAVIOR OF STITCHED T300 MAT/URETHANE 420 IMR COMPOSITE
Energy Technology Data Exchange (ETDEWEB)
Deng, S.
2002-11-25
This report presents experimental and analytical results concerning the behavior of crossply and quasi-isotropic laminates manufactured of stitch-bonded T300 urethane 420 IMR polymeric composites. Based on extensive creep and recovery data at various levels of stress and temperature, as well as on strain-to-failure information, it was possible to arrive at empirical expressions relating deformation to the previous input as well as to input duration. These expressions were incorporated within the formalisms of viscoelasticity and laminate theory to illuminate some basic underlying mechanistic aspects of the material at hand, thereby enabling the prediction of anticipated response under more complex stress and temperature inputs.
The Role of NADPH Oxidase in the Inhibition of Trichophyton rubrum by 420-nm Intense Pulsed Light
Directory of Open Access Journals (Sweden)
Hao Huang
2018-01-01
Full Text Available Objectives: To evaluate the effect of intense pulsed light (IPL on Trichophyton rubrum and investigate its mechanism of action.Methods: The viability of fungi treated with IPL alone and with IPL combined with an NADPH oxidase inhibitor (DPI pretreatment was determined by MTT assays. The reactive oxygen species (ROS were quantified with a DCFH-DA fluorescent probe. Malondialdehyde (MDA content and superoxide dismutase (SOD and glutathione peroxidase (GSH-Px activities were determined by commercial kits. The transcription of the Nox gene was quantified using quantitative real-time PCR (qRT-PCR analysis, and micromorphology was observed using scanning electron microscopy (SEM. In addition, fungal keratinase activity was detected by measuring dye release from keratin azure.Results: The growth declined with statistical significance after 6 h of treatment (P < 0.001. The ROS and MDA content increased after IPL treatment, whereas the SOD and GSH-Px activity decreased. Nox gene expression was upregulated, and the micromorphology was damaged. Keratinase activity decreased. Fungi that received DPI pretreatment exhibited contrasting outcomes.Conclusion: We found that 420-nm IPL significantly inhibited the growth and pathogenicity of T. rubrum in vitro. A suggested mechanism involves Nox as a factor that mediates 420-nm IPL-induced oxidative damage of T. rubrum.
Socci, Luciano; Sorianello, Vito; Romagnoli, Marco
2015-07-27
Adiabatic polarization splitter-rotators are investigated exploiting continuous symmetry breaking thereby achieving significant device size and losses reduction in a single mask fabrication process for both SOI channel and ridge waveguides. A crosstalk lower than -25 dB is expected over 300nm bandwidth, making the device suitable for full grid CWDM and diplexer/triplexer FTTH applications at 1310, 1490 and 1550nm.
Lasing at 300 nm and below: Optical challenges and perspectives
Energy Technology Data Exchange (ETDEWEB)
Garzella, D. [Universite de Paris-Sud, Orsay (France); Couprie, M.E. [Universite de Paris-Sud, Orsay (France)]|[CEA DSM DRECAM SPAM, Gif Sur Yvette (France); Billardon, M. [ESPCI, Paris (France)
1995-12-31
The FEL experiment in the visible and near UV on the Super ACO storage ring has given, since 1989, important informations on the SRFEL dynamics and, furthermore, a very good beam stability has been achieved. In addition, the operation at 350 nm with this good stability and a long beam lifetime allowed us to perform the first user experiment in biology and to start with a campaign for using the laser as photons source for experiments in other domains, coupling FEL light and the Synchrotron Radiation. For this, FEL starts to be very competitive with respect to the other conventional laser sources, provided that it could oscillate further in the UV, say at 300 nm and below. So, the real challenge is now given by the lasing at shorter wavelengths and, for this, by the optical technology existing nowadays. Since 1992 the efforts have been concentrating to look for every kind of solution allowing us to overcome the problem of having a very low gain. From an optical point of view, in the range of wavelengths explored, there is a lack of transparents dielectric materials for substrates and coatings. Substrates are required at the same time to be relatively not absorbing (a few tens 10{sup -6}), to have a very good surface quality (RMS roughness below 10 {Angstrom}) because of scattering losses dramatically increasing in this spectral range and, due to the thermal load of the undulator emission, to have adequate thermal characteristics. In order to fulfill all these requirements, a good characterisation and modelisation of the substrates is needed, especially to correlate thermal loading and mechanical deformations from one hand, and roughness and scattering losses from the other hand. Coatings must be not absorbing too and, above all, the most amorphous as possible (this could be obtained with IBS deposition technique), in order to insure a good reproduction of the substrate roughness at the interfaces and on the top layer and an higher resistance to the XUV photons load.
Energy Technology Data Exchange (ETDEWEB)
Scarcella, Carmelo; Tosi, Alberto, E-mail: alberto.tosi@polimi.it; Villa, Federica; Tisa, Simone; Zappa, Franco [Politecnico di Milano, Dipartimento di Elettronica, Informazione e Bioingegneria, Piazza Leonardo da Vinci 32, I-20133 Milano (Italy)
2013-12-15
We developed a single-photon counting multichannel detection system, based on a monolithic linear array of 32 CMOS SPADs (Complementary Metal-Oxide-Semiconductor Single-Photon Avalanche Diodes). All channels achieve a timing resolution of 100 ps (full-width at half maximum) and a photon detection efficiency of 50% at 400 nm. Dark count rate is very low even at room temperature, being about 125 counts/s for 50 μm active area diameter SPADs. Detection performance and microelectronic compactness of this CMOS SPAD array make it the best candidate for ultra-compact time-resolved spectrometers with single-photon sensitivity from 300 nm to 900 nm.
Absorption coefficients for water vapor at 193 nm from 300 to 1073 K
Kessler, W. J.; Carleton, K. L.; Marinelli, W. J.
1993-01-01
Measurements of the water absorption coefficient at 193 nm from 300 to 1073 K are reported. The measurements were made using broadband VUV radiation and a monochromator-based detection system. The water vapor was generated by a saturator and metered into a flowing, 99 cm absorption cell via a water vapor mass flow meter. The 193 nm absorption coefficient measurements are compared to room temperature and high temperature shock tube measurements with good agreement. The absorption can be parameterized by a nu3 vibrational mode reaction coordinate and the thermal population of the nu3 mode.
New photo-convertible reactions of blue-fluorescent calf α-crystallin
International Nuclear Information System (INIS)
Fujimori, E.
1979-01-01
Both native blue fluorescent α-crystalline from calf lenses and UV (300 nm)-irradiated blue-fluorescent α-crystalline, when further irradiated with 365 nm-UV light, produce photo-products capable of emitting a new fluorescence at 455 nm. Illumination of the photo-products with 420 nm visible light regenerates the original fluorescence at 420-425 nm. In addition, another fluorescence at 400 nm has also been found in UV (300 nm)-irradiated blue-fluorescent α-crystallin, when exposed to 365 nm-UV light. (author)
300 mm arrays and 30 nm Features: Frontiers in Sorting Biological Objects
Austin, Robert; Comella, Brandon; D'Silva, Joseph; Sturm, James
2014-03-01
One of the great challenges in prediction of metastasis is determining when the metastatic process actually begins. It is presumed that this process occurs due to passage of biological objects in the blood from tumor to remote sites. We will discuss our attempts to find both very large objects (circulating tumor cell clumps) and very small (exosomes) using a combination of extremely large scale photolithography on 300 mm wafers and deep-UV lithography to produce sub-100 nm arrays to sort exosomes. These technologies push the envelope of present day academic facilities . Supported by the National Science Foundation and the National Cancer Institute.
International Nuclear Information System (INIS)
Catalano, O.; Agnetta, G.; Biondo, B.; Celi, F.; Di Raffaele, R.; Giarrusso, S.; Linsley, J.; La Rosa, G.; Lo Bue, A.; Mangano, A.; Russo, F.
2002-01-01
The balloon-borne experiment, named BAckground BYpass (BABY) belongs to a wider program that has as its final goal the detection and study of high-energy cosmic rays from space (satellite, Space Station). An information of fundamental importance for this class of projects concerns the nighttime background light. The instrument designed to detect fluorescence photons is basically composed of two collimated photomultipliers: a single photon-counting PMT and a charge integration PMT. We briefly report the details of the design, operation and performance of the detector, which was designed and completely built at the IFCAI-CNR Institute in Palermo. Preliminary analysis and results of the nocturnal background in the range of 300-400 nm are presented for the whole duration of the flight during the 1998 Mediterranean balloon flight campaign. A substantial part of the flight was at night over the sea
Catalano, O; Biondo, B; Celi, F; Di Raffaele, R; Giarrusso, S; Linsley, J; Lo Bue, A; Mangano, A; Russo, F
2002-01-01
The balloon-borne experiment, named BAckground BYpass (BABY) belongs to a wider program that has as its final goal the detection and study of high-energy cosmic rays from space (satellite, Space Station). An information of fundamental importance for this class of projects concerns the nighttime background light. The instrument designed to detect fluorescence photons is basically composed of two collimated photomultipliers: a single photon-counting PMT and a charge integration PMT. We briefly report the details of the design, operation and performance of the detector, which was designed and completely built at the IFCAI-CNR Institute in Palermo. Preliminary analysis and results of the nocturnal background in the range of 300-400 nm are presented for the whole duration of the flight during the 1998 Mediterranean balloon flight campaign. A substantial part of the flight was at night over the sea.
1.55-μm mode-locked quantum-dot lasers with 300 MHz frequency tuning range
Energy Technology Data Exchange (ETDEWEB)
Sadeev, T., E-mail: tagir@mailbox.tu-berlin.de; Arsenijević, D.; Bimberg, D. [Institut für Festkörperphysik, Technische Universität Berlin, 10623 Berlin (Germany); Franke, D.; Kreissl, J.; Künzel, H. [Heinrich-Hertz-Institut, Einsteinufer 37, 10587 Berlin (Germany)
2015-01-19
Passive mode-locking of two-section quantum-dot mode-locked lasers grown by metalorganic vapor phase epitaxy on InP is reported. 1250-μm long lasers exhibit a wide tuning range of 300 MHz around the fundamental mode-locking frequency of 33.48 GHz. The frequency tuning is achieved by varying the reverse bias of the saturable absorber from 0 to −2.2 V and the gain section current from 90 to 280 mA. 3 dB optical spectra width of 6–7 nm leads to ex-facet optical pulses with full-width half-maximum down to 3.7 ps. Single-section quantum-dot mode-locked lasers show 0.8 ps broad optical pulses after external fiber-based compression. Injection current tuning from 70 to 300 mA leads to 30 MHz frequency tuning.
1.55-μm mode-locked quantum-dot lasers with 300 MHz frequency tuning range
International Nuclear Information System (INIS)
Sadeev, T.; Arsenijević, D.; Bimberg, D.; Franke, D.; Kreissl, J.; Künzel, H.
2015-01-01
Passive mode-locking of two-section quantum-dot mode-locked lasers grown by metalorganic vapor phase epitaxy on InP is reported. 1250-μm long lasers exhibit a wide tuning range of 300 MHz around the fundamental mode-locking frequency of 33.48 GHz. The frequency tuning is achieved by varying the reverse bias of the saturable absorber from 0 to −2.2 V and the gain section current from 90 to 280 mA. 3 dB optical spectra width of 6–7 nm leads to ex-facet optical pulses with full-width half-maximum down to 3.7 ps. Single-section quantum-dot mode-locked lasers show 0.8 ps broad optical pulses after external fiber-based compression. Injection current tuning from 70 to 300 mA leads to 30 MHz frequency tuning
Large-scale lithography for sub-500nm features
International Nuclear Information System (INIS)
Pelzer, R L; Steininger, T; Belier, Benoit; Julie, Gwenaelle
2006-01-01
The interest in micro- and nanotechnologies has grown rapidly in the last years. The applications are versatile and different techniques found its way into several research domains as optics, electronics, magnetism, fluidics, etc. In all of these fields integration of more and more functions on steadily decreasing device dimensions lead to an increase in structural density and feature size. Expensive and slow processes utilizing projection steppers or e-beam direct writer equipment are used to fabricate nm features today. A high throughput and cost effective method adapted on a standard mask aligner will be demonstrated, making features of below 300nm available on wafer-level. We will demonstrate results of 4 different resists exposed on a DUV proximity aligner and plasma etched for optical and biological applications in the sub-300nm range
Large-scale lithography for sub-500nm features
Energy Technology Data Exchange (ETDEWEB)
Pelzer, R L [Technology group, EV Group, DI Erich Thallner Str. 1, A-4780 Schaerding (Austria); Steininger, T [Technology group, EV Group, DI Erich Thallner Str. 1, A-4780 Schaerding (Austria); Belier, Benoit [CNRS, Institut d' Electronique Fondamentale, Universite Paris-Sud Bat 220, F- 91405 Orsay Cedex (France); Julie, Gwenaelle [CNRS, Institut d' Electronique Fondamentale, Universite Paris-Sud Bat 220, F- 91405 Orsay Cedex (France)
2006-04-01
The interest in micro- and nanotechnologies has grown rapidly in the last years. The applications are versatile and different techniques found its way into several research domains as optics, electronics, magnetism, fluidics, etc. In all of these fields integration of more and more functions on steadily decreasing device dimensions lead to an increase in structural density and feature size. Expensive and slow processes utilizing projection steppers or e-beam direct writer equipment are used to fabricate nm features today. A high throughput and cost effective method adapted on a standard mask aligner will be demonstrated, making features of below 300nm available on wafer-level. We will demonstrate results of 4 different resists exposed on a DUV proximity aligner and plasma etched for optical and biological applications in the sub-300nm range.
Rottman, G. J.; Cebula, R. P.; Gillotay, D.; Simon, P. A.
1996-01-01
This report summarizes the activities of Working Group 2 and Working Group 3 of the SOLax Electromagnetic Radiation Study for Solar Cycle 22 (SOLERS22) Program. The international (SOLERS22) is Project 1.2 of the Solar-Terrestrial Energy Program (STEP) sponsored by SCOSTEP, a committee of the International Council of Scientific Unions). SOLERS22 is comprised of five Working Groups, each concentrating on a specific wave-length range: WG-1 - visible and infrared, WG-2 - mid-ultraviolet (200 < A < 300 nm), WG-3 - Far-ultraviolet (lambda greater than 100 and lambda less than 200 nanometers), WG-4 - extreme-ultraviolet (lambda greater than 10 and lambda less than 100 nm), and WG-5 - X-ray (lambda greater than 1 and lambda less than 10 nano meters). The overarching goals of SOLERS22 are to: 1) establish daily solar irradiance values in the specified wavelength ranges, 2) consider the evolving solar structures as the cause of temporal variations, and 3) understand the underlying physical processes driving these changes.
A General Model of the Atmospheric Scattering in the Wavelength Interval 300 - 1100nm
Directory of Open Access Journals (Sweden)
K. Dimitrov
2009-12-01
Full Text Available We have presented and developed new theoretic-empirical models of the extinction coefficients of the molecular scattering in the lower, close to the ground troposphere. We have included the indicatrices of backscattering. The models have been presented using general analytical functions valid for the whole wavelength interval 300-1100 nm and for the whole interval of visibility from 0.1 km up to 50 km. The results have been compared in quantity with the model and experimental data of other authors. The modeling of troposphere scattering is necessary for the analysis and design of all optoelectronic free space systems: atmospheric optical communication systems, location systems for atmospheric research (LIDAR, optical radiometric systems.
International Nuclear Information System (INIS)
Seely, J.F.; Feldman, Uri; Holland, G.E.; Weaver, J.L.; Mostovych, A.N.; Obenschain, S.P.; Schmitt, A.J.; Lehmberg, R.; Kjornarattanawanich, Benjawan; Back, C.A.
2005-01-01
High-resolution vacuum ultraviolet (VUV) spectra were recorded from plasmas generated by the NIKE KrF laser for the purpose of observing emission from the two-plasmon decay instability (TPDI) at 2/3 the NIKE wavelength (165 nm). The targets were irradiated by up to 43 overlapping beams with intensity up to ≅10 14 W/cm 2 and with beam smoothing by induced spatial incoherence (ISI). The targets consisted of planar foils of CH, BN, Al, Si, S, Ti, Pd, and Au. Titanium-doped silica aerogels in Pyrex cylinders were also irradiated. The spectra of the target elements were observed from charge states ranging from the neutral atoms to five times ionized. The spectrometer was absolutely calibrated using synchrotron radiation, and absolute VUV plasma emission intensities were determined. Emission from the TPDI at 165-nm wavelength was not observed from any of the irradiated targets. An upper bound on the possible TPDI emission was less than 4x10 -8 the incident NIKE laser energy. The NIKE laser radiation backscattered from the silica aerogel targets at 248 nm was typically 6x10 -6 the incident NIKE laser energy, and the spectral broadening corresponded to the 1-THz bandwidth of the ISI smoothing. The spectra from the moderately charged plasma ions (up to five times ionized), spectral linewidths, absolute continuum emission level, and slope of the continuum were consistent with plasma temperatures in the 100-300-eV range
International Nuclear Information System (INIS)
Sammartano, L.J.; Tuveson, R.W.
1984-01-01
Catalase incorporated into plating medium protects against inactivation and mutagenesis by broad-spectrum near-ultraviolet wavelength (300-400nm) (NUV) radiation in strains of Escherichia coli. Plating medium containing catalase does not provide protection against inactivation by wavelengths in the FUV region. Catalase added to the cell suspension during or added immediately after NUV exposure also protects against inactivation. The protection provided by catalase suggests a possible role for hydrogen peroxide in the processes of inactivation and mutagenesis by broad-spectrum NUV. (author)
Semiconductor resistance thermometer for the temperature range 300-0.3 K
International Nuclear Information System (INIS)
Zinov'eva, K.N.; Zarubin, L.I.; Nemish, I.Yu.; Vorobkalo, F.M.; Boldarev, S.T.; AN Ukrainskoj SSR, Kiev. Inst. Poluprovodnikov)
1979-01-01
Thermometric characteristics of semiconductor resistor thermometers for the temperature range from 300 to 0.3 K and from 77 to 0.3 K are given. Temperature dependence of thermometer resistances in the 300-1.3 K range was measured in cryostats with pumping-out of N 2 , H 2 and 4 He. For measurements below 1.3 K use was made of a 3 H- 4 He dissolving cryostat. The accuracy of measuring temperatures in the 1.3-0.3 K range is not below +-0.003 K, the error in determining thermometer resistances does not exceed 1%. The analysis of obtained thermometric characteristics of several series of semiconductor resistance thermometers showed that observed insignificant spread of resistances of thermometers in one series and identity of characteristics allows them to be used without preliminary calibration for relatively coarse measurements in the range from 3O0 to 0.3 K. Besides, it has been found that in the 4.2-0.3 K range the thermometric characteristics represent a straight line in the lgR-Tsup(-n) coordinates, where R is the thermometer resistance, T is the temperature and n=0.5. Thus, the thermometers of the same series can be calibrated only in 2 or 3 reference point measurements
Energy Technology Data Exchange (ETDEWEB)
Benter, T.; Broeske, R.
2001-11-01
The available literature data of the kinetic and spectroscopic properties of nitrylhalides (XNO{sub 2}), halogennitrites (XONO) and halogennitrates (XONO{sub 2}) are incomplete and partly contradictory. Some selected reactions and UV spectra of these compounds were investigated by the use of UV/VIS and long path fourier transform infrared spectroscopy. All compounds were prepared in situ in a static reaction chamber (V=420 l) by the photolysis of X{sub 2}/NO{sub 2} (X=Cl, Br, I) mixtures in the wavelength range 300 nm{<=}{lambda}{<=}500 nm or 500 nm{<=}{lambda}{<=}700 nm in nitrogen or synthetic air. (orig.)
Singh, Saurabh; Srivastav, Simant Kumar; Patel, Ashutosh; Chatterjee, Ratnamala; Pandey, Sudhir K.
2018-05-01
In oxide materials, nanostructuring effect has been found a very promising approach for the enhancement of figure-of-merit, ZT. In the present work, we have synthesized La0.7Sr0.3MnO3 (LSMO) compound using sol-gel method and samples of crystallite size of ∼20, ∼41, and ∼49 nm were obtained by giving different heat treatment. Seebeck coefficient (α), electrical resistivity (ρ), and thermal conductivity (κ) measurements were carried out in 300–600 K temperature range. The systematic change in the values of α from ∼‑19 μV/K to ∼‑24 μV/K and drastic reduction in the values of κ from ∼0.88 W/mK to ∼0.23 W/mK are observed as crystallite size is reduced from 49 nm to 20 nm at ∼600 K. Also, fall in the values of ρ in the paramagnetic (PM) insulator phase (400–600 K) are effectively responsible for the increasing trend in the values of ZT at high temperature. For the crystallite size of 41 nm, the value of ZT at 600 K was found to be ∼0.017.
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC420 (Link to dictyBase) - G01085 DDB0205634 Contig-U01169-1 | Contig-U15736-1 SLC4...20P (Link to Original site) SLC420F 333 SLC420Z 423 SLC420P 756 - - Show SLC420 Libra...ry SL (Link to library) Clone ID SLC420 (Link to dictyBase) Atlas ID - NBRP ID G01085 dictyBase ID DDB020563...cdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC420Q.Seq.d/ Representative seq. ID SLC420P (Link to Original site) R...epresentative DNA sequence >SLC420 (SLC420Q) /CSM/SL/SLC4-A/SLC420Q.Seq.d/ GCTAGCACACACATAAATAATACATACACACAT
Directory of Open Access Journals (Sweden)
Guanquan Liang
2011-12-01
Full Text Available A prototype of planar silicon photonic structure is designed and simulated to provide narrow resonant line-width (∼2 nm in a wide photonic band gap (∼210 nm with broad tunable resonant wavelength range (∼100 nm around the optical communication wavelength 1550 nm. This prototype is based on the combination of two modified basic photonic structures, i.e. a split tapered photonic crystal micro-cavity embedded in a photonic wire waveguide, and a slot waveguide with narrowed slabs. This prototype is then further integrated with a MEMS (microelectromechanical systems based electrostatic comb actuator to achieve “coarse tune” and “fine tune” at the same time for wide range and narrow-band filtering and modulating. It also provides a wide range tunability to achieve the designed resonance even fabrication imperfection occurs.
Time and spectrum-resolving multiphoton correlator for 300–900 nm
Energy Technology Data Exchange (ETDEWEB)
Johnsen, Kelsey D.; Thibault, Marilyne; Jennewein, Thomas [Institute for Quantum Computing and Department for Physics and Astronomy, University of Waterloo, 200 University Ave. West, Waterloo, Ontario N2L 3G1 (Canada); Kolenderski, Piotr, E-mail: kolenderski@fizyka.umk.pl [Institute for Quantum Computing and Department for Physics and Astronomy, University of Waterloo, 200 University Ave. West, Waterloo, Ontario N2L 3G1 (Canada); Faculty of Physics, Astronomy and Informatics, Institute of Physics, Nicolaus Copernicus University, Grudziadzka 5, 87-100 Torun (Poland); Scarcella, Carmelo; Tosi, Alberto [Dipartimento di Elettronica, Informazione e Bioingegneria, Politecnico di Milano, Piazza Leonardo da Vinci 32, I-20133 Milano (Italy)
2014-10-14
We demonstrate a single-photon sensitive spectrometer in the visible range, which allows us to perform time-resolved and multi-photon spectral correlation measurements at room temperature. It is based on a monochromator composed of two gratings, collimation optics, and an array of single photon avalanche diodes. The time resolution can reach 110 ps and the spectral resolution is 2 nm/pixel, limited by the design of the monochromator. This technique can easily be combined with commercial monochromators and can be useful for joint spectrum measurements of two photons emitted in the process of parametric down conversion, as well as time-resolved spectrum measurements in optical coherence tomography or medical physics applications.
Demirbas, Umit; Baali, Ilyes
2015-10-15
We report significant average power and efficiency scaling of diode-pumped Cr:LiSAF lasers in continuous-wave (cw), cw frequency-doubled, and mode-locked regimes. Four single-emitter broad-area laser diodes around 660 nm were used as the pump source, which provided a total pump power of 7.2 W. To minimize thermal effects, a 20 mm long Cr:LiSAF sample with a relatively low Cr-concentration (0.8%) was used as the gain medium. In cw laser experiments, 2.4 W of output power, a slope efficiency of 50%, and a tuning range covering the 770-1110 nm region were achieved. Intracavity frequency doubling with beta-barium borate (BBO) crystals generated up to 1160 mW of blue power and a record tuning range in the 387-463 nm region. When mode locked with a saturable absorber mirror, the laser produced 195 fs pulses with 580 mW of average power around 820 nm at a 100.3 MHz repetition rate. The optical-to-optical conversion efficiency of the system was 33% in cw, 16% in cw frequency-doubled, and 8% in cw mode-locked regimes.
18 CFR 420.44 - Cooling water.
2010-04-01
... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Cooling water. 420.44 Section 420.44 Conservation of Power and Water Resources DELAWARE RIVER BASIN COMMISSION ADMINISTRATIVE MANUAL BASIN REGULATIONS-WATER SUPPLY CHARGES Charges; Exemptions § 420.44 Cooling water. Water used...
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Tank design. 154.420 Section 154.420 Shipping COAST... SELF-PROPELLED VESSELS CARRYING BULK LIQUEFIED GASES Design, Construction and Equipment Integral Tanks § 154.420 Tank design. (a) The structure of an integral tank must meet the deep tank scantling standards...
Broadband semiconductor optical amplifiers of the spectral range 750 – 1100 nm
International Nuclear Information System (INIS)
Andreeva, E V; Il'chenko, S N; Lobintsov, A A; Shramenko, M V; Ladugin, M A; Marmalyuk, A A; Yakubovich, S D
2013-01-01
A line of travelling-wave semiconductor optical amplifiers (SOAs) based on heterostructures used for production of broadband superluminescent diodes is developed. The pure small-signal gains of the developed SOA modules are about 25 dB, while the gain bandwidths at a level of –10 dB reach 50 – 100 nm. As a whole, the SOA modules cover the IR spectral range from 750 to 1100 nm. The SOAs demonstrate a high reliability at a single-mode fibre-coupled cw output power up to 50 mW. Examples of application of two of the developed SOA modules as active elements of broadband fast-tunable lasers are presented. (lasers)
Broadband semiconductor optical amplifiers of the spectral range 750 – 1100 nm
Energy Technology Data Exchange (ETDEWEB)
Andreeva, E V; Il' chenko, S N; Lobintsov, A A; Shramenko, M V [Superlum Diodes Ltd., Moscow (Russian Federation); Ladugin, M A [' Sigm Plyus' Ltd, Moscow (Russian Federation); Marmalyuk, A A [Open Joint-Stock Company M.F. Stel' makh Polyus Research Institute, Moscow (Russian Federation); Yakubovich, S D [Moscow State Institute of Radio-Engineering, Electronics and Automation (Technical University), Moscow (Russian Federation)
2013-11-30
A line of travelling-wave semiconductor optical amplifiers (SOAs) based on heterostructures used for production of broadband superluminescent diodes is developed. The pure small-signal gains of the developed SOA modules are about 25 dB, while the gain bandwidths at a level of –10 dB reach 50 – 100 nm. As a whole, the SOA modules cover the IR spectral range from 750 to 1100 nm. The SOAs demonstrate a high reliability at a single-mode fibre-coupled cw output power up to 50 mW. Examples of application of two of the developed SOA modules as active elements of broadband fast-tunable lasers are presented. (lasers)
46 CFR 182.420 - Engine cooling.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Engine cooling. 182.420 Section 182.420 Shipping COAST...) MACHINERY INSTALLATION Specific Machinery Requirements § 182.420 Engine cooling. (a) Except as otherwise provided in paragraphs (b), (c), (d), and (e) of this section, all engines must be water cooled and meet...
46 CFR 119.420 - Engine cooling.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Engine cooling. 119.420 Section 119.420 Shipping COAST... Machinery Requirements § 119.420 Engine cooling. (a) Except as otherwise provided in paragraph (b) of this section, all engines must be water cooled and meet the requirements of this paragraph. (1) The engine head...
21 CFR 573.420 - Ethyl cellulose.
2010-04-01
... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Ethyl cellulose. 573.420 Section 573.420 Food and... Listing § 573.420 Ethyl cellulose. The food additive ethyl cellulose may be safely used in animal feed in accordance with the following prescribed conditions: (a) The food additive is a cellulose ether containing...
Magnetoresistance of samarium in the 4.2-300 K range
International Nuclear Information System (INIS)
Trubitsyn, V.A.; Shalashov, V.F.
1980-01-01
Electric conductivity, transverse and longitudinal magnetoresistance of polycrystalline samarium with the purity of 99.9% in the 4.2-300 K temperature range and in magnetic fields up to 50 ke, are measured. The constituent of specific electric conductivity caused by spin disorder is 30.7 μOhmxcm, m*/m=2.6, the exchange parameter is G=3.1 eVxA 3 . Both transverse and longitudinal magnetoresistance are positive at 4.2 K; and the increase of temperature reveals a number of anomalies, evidently conditioned by the alteration of samarium magnetic structure
Measurement of the fluorescence of crop residues: A tool for controlling soil erosion
Daughtry, C. S. T.; Mcmurtrey, J. E., III; Chappelle, E. W.; Hunter, W. J.
1994-01-01
Management of crop residues, the portion of a crop left in the field after harvest, is an important conservation practice for minimizing soil erosion and for improving water quality. Quantification of crop residue cover is required to evaluate the effectiveness of conservation tillage practices. Methods are needed to quantify residue cover that are rapid, accurate, and objective. The fluorescence of crop residue was found to be a broadband phenomenon with emission maxima at 420 to 495 nm for excitations of 350 to 420 nm. Soils had low intensity broadband emissions over the 400 to 690 nm region for excitations of 300 to 600 nm. The range of relative fluorescence intensities for the crop residues was much greater than the fluorescence observed of the soils. As the crop residues decompose their blue fluorescence values approach the fluorescence of the soil. Fluorescence techniques are concluded to be less ambiguous and better suited for discriminating crop residues and soils than reflectance methods. If properly implemented, fluorescence techniques can be used to quantify, not only crop residue cover, but also photosynthetic efficiency in the field.
Semiconductor lasers with a continuous tuning range above 100 nm in the nearest IR spectral region
Energy Technology Data Exchange (ETDEWEB)
Kostin, Yu O; Lobintsov, A A; Shramenko, M V [OOO ' Opton' , Moscow (Russian Federation); Ladugin, M A; Marmalyuk, A A [Open Joint-Stock Company M.F. Stel' makh Polyus Research Institute, Moscow (Russian Federation); Chamorovsky, A Yu [Superlum Ltd., Unit B3, Fota Point Enterprise Park, Carrigtwohill, Co Cork (Ireland); Yakubovich, S D [Moscow State Institute of Radio-Engineering, Electronics and Automation (Technical University), Moscow (Russian Federation)
2015-08-31
We have developed two new types of lasers based on quantum-confined semiconductor optical amplifiers with an acousto-optic tunable filter in an external fibre ring cavity. The lasers offer continuous wavelength tuning ranges from 780 to 885 and from 880 to 1010 nm, 20 mW of cw output power, and a tuning rate up to 10{sup 4} nm s{sup -1} at an instantaneous spectral linewidth less than 0.1 nm. (lasers)
Tuning range and output power optimization of an external-cavity GaN diode laser at 455 nm
DEFF Research Database (Denmark)
Chi, Mingjun; Jensen, Ole Bjarlin; Petersen, Paul Michael
2016-01-01
In this paper we discuss how different feedback gratings affect the tuning range and the output power of external feedback diode laser systems. A tunable high-power narrow-spectrum external-cavity diode laser system around 455 nm is investigated. The laser system is based on a high-power GaN diode...... laser in a Littrow external-cavity. Both a holographic diffraction grating and a ruled diffraction grating are used as feedback elements in the external cavity. The output power, spectral bandwidth, and tunable range of the external cavity diode laser system are measured and compared with the two...... gratings at different injected currents. When the holographic grating is used, the laser system can be tuned over a range of 1.4 nm with an output power around 530 mW. When the ruled grating is used, the laser system can be tuned over a range of 6.0 nm with an output power around 80 mW. The results can...
Obeidat, Abdalla; Jaradat, Adnan; Hamdan, Bushra; Abu-Ghazleh, Hind
2018-04-01
The best spherical cutoff radius, long range interaction and temperature controller were determined using surface tension, density, and diffusion coefficients of van Leeuwen and Smit methanol. A quite good range of cutoff radii from 0.75 to 1.45 nm has been studied on Coulomb cut-off and particle mesh Ewald (PME) long range interaction to determine the best cutoff radius and best long range interaction as well for four sets of temperature: 200, 230, 270 and 300 K. To determine the best temperature controller, the cutoff radius of 1.25 nm was fixed using PME long range interaction on calculating the above properties at low temperature range: 200-300 K.
Bryan, Zachary A.
defects in the films due to the increase in their formation energies during growth. This method improved the electrical properties of p-type GaN and n-type AlGaN and reduced stress thereby preventing films from cracking. The optical and structural quality of high Al-content AlGaN multiple quantum wells, light emitting diodes (LEDs), and laser diodes (LDs) grown on single crystalline AlN substrates are investigated. The use of bulk AlN substrates enabled the undoubtable distinction between the effect of growth conditions, such as V/III ratio, on the optical quality from the influence of dislocations. At a high V/III ratio and the proper MQW design, a record high IQE of 80% at a carrier density of 1018 cm-3 is achieved at 258 nm. With these structures, true sub-300 nm lasing is realized and distinguished from super luminescence for the first time by the observations of lasing characteristics such as longitudinal cavity modes, 100% polarized emission, and an elliptically shaped far-field pattern. A transverse electric to transverse magnetic polarization crossover at 245 nm is found. Lasing is observed in both asymmetric and symmetric waveguide structures with and without the presence of Si- and Mg-doping in the waveguide layer. The lowest measurable lasing threshold is 50 kW/cm2 and potentially a lower threshold is obtained in a symmetric waveguide structure while the lowest measured lasing wavelength is 237 nm. Gain measurements reveal a net modal gain greater than 100 cm-1 which is the highest reported value for sub-300 nm lasers. Furthermore, a lowest reported FWHM of 0.012 nm is observed indicating the high quality of the laser structure. Finally, electrically injected LED and LD structures are studied showing great potential for the realization of the first sub-300 nm LD.
20 CFR 628.420 - Job training plan.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Job training plan. 628.420 Section 628.420... THE JOB TRAINING PARTNERSHIP ACT Local Service Delivery System § 628.420 Job training plan. (a) The Governor shall issue instructions and schedules to assure that job training plans and plan modifications...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLD420 (Link to dictyBase) - - - Contig-U16325-1 SLD420E (Link... to Original site) - - - - - - SLD420E 434 Show SLD420 Library SL (Link to library) Clone ID SLD420 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16325-1 Original site URL http://dict... 7 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AF066071 ) Dict...yostelium discoideum SP85 (pspB) gene, comple... 860 0.0 1 ( AC117075 ) Dictyostelium
10 CFR 420.1 - Purpose and scope.
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Purpose and scope. 420.1 Section 420.1 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION STATE ENERGY PROGRAM General Provisions for State Energy Program Financial Assistance § 420.1 Purpose and scope. It is the purpose of this part to promote the conservation...
27 CFR 4.20 - Application of standards.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Application of standards. 4.20 Section 4.20 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF WINE Standards of Identity for Wine § 4.20...
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Batteries. 183.420 Section 183... SAFETY BOATS AND ASSOCIATED EQUIPMENT Electrical Systems Manufacturer Requirements § 183.420 Batteries. (a) Each installed battery must not move more than one inch in any direction when a pulling force of...
Physiology, Biochemistry, and Applications of F420- and Fo-Dependent Redox Reactions.
Greening, Chris; Ahmed, F Hafna; Mohamed, A Elaaf; Lee, Brendon M; Pandey, Gunjan; Warden, Andrew C; Scott, Colin; Oakeshott, John G; Taylor, Matthew C; Jackson, Colin J
2016-06-01
5-Deazaflavin cofactors enhance the metabolic flexibility of microorganisms by catalyzing a wide range of challenging enzymatic redox reactions. While structurally similar to riboflavin, 5-deazaflavins have distinctive and biologically useful electrochemical and photochemical properties as a result of the substitution of N-5 of the isoalloxazine ring for a carbon. 8-Hydroxy-5-deazaflavin (Fo) appears to be used for a single function: as a light-harvesting chromophore for DNA photolyases across the three domains of life. In contrast, its oligoglutamyl derivative F420 is a taxonomically restricted but functionally versatile cofactor that facilitates many low-potential two-electron redox reactions. It serves as an essential catabolic cofactor in methanogenic, sulfate-reducing, and likely methanotrophic archaea. It also transforms a wide range of exogenous substrates and endogenous metabolites in aerobic actinobacteria, for example mycobacteria and streptomycetes. In this review, we discuss the physiological roles of F420 in microorganisms and the biochemistry of the various oxidoreductases that mediate these roles. Particular focus is placed on the central roles of F420 in methanogenic archaea in processes such as substrate oxidation, C1 pathways, respiration, and oxygen detoxification. We also describe how two F420-dependent oxidoreductase superfamilies mediate many environmentally and medically important reactions in bacteria, including biosynthesis of tetracycline and pyrrolobenzodiazepine antibiotics by streptomycetes, activation of the prodrugs pretomanid and delamanid by Mycobacterium tuberculosis, and degradation of environmental contaminants such as picrate, aflatoxin, and malachite green. The biosynthesis pathways of Fo and F420 are also detailed. We conclude by considering opportunities to exploit deazaflavin-dependent processes in tuberculosis treatment, methane mitigation, bioremediation, and industrial biocatalysis. Copyright © 2016, American Society for
Eye safe high power laser diode in the 1410-1550nm range
Boucart, Julien; de Largy, Brian; Kearley, Mark; Lichtenstein, Norbert
2010-02-01
The demand for high power lasers emitting in the 14xx-15xxnm range is growing for applications in fields such as medical or homeland security. We demonstrate high power laser diodes with emission at 1430, 1470 and 1560 nm. Single multimode emitters at 1470nm emit about 3.5W in CW operation. Power conversion efficiency can reach values as high as 38.5%. With this base material, single and multi-emitter fiber coupled modules are built. Additionally, bars on passive and microchannel coolers are fabricated that deliver 25W and 38W respectively in CW mode, while obtaining more than 80 W in pulsed mode. All reliability tests show an outstanding stability of the material with no signs of wearout after 3750 hrs under strong acceleration conditions.
46 CFR 131.420 - Manning and supervision.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Manning and supervision. 131.420 Section 131.420 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS OPERATIONS Sufficiency and Supervision of Crew of Survival Craft § 131.420 Manning and supervision. (a) There must be enough trained persons aboard each survival craf...
Long-range pulselength scaling of 351nm laser damage thresholds
Foltyn, S. R.; Jolin, L. J.
1986-12-01
In a series of experiments incorporating 351nm pulselength of 9, 26, 54, and 625ns, it was found that laser damage thresholds increased as (pulselength)/sup x/, and that the exponent averaged 0.36 and ranged, for different samples, from 0.23 to 0.48. Similar results were obtained when only catastrophic damage was considered. Samples included Al2O3/SiO2 in both AR and HR multilayers, HR's of Sc2O3/SiO2 and HfO2/SiO2, and Al-on-pyrex mirror; 9ns thresholds were between 0.2 to 5.6 J/sq cm. When these data were compared with a wide range of other results - for wavelengths from 0.25 to 10.6 microns and pulselengths down to 4ps - a remarkably consistent picture emerged. Damage thresholds, on average, increase approximately as the cube-root of pulselength from picoseconds to nearly a microsecond, and do so regardless of wavelength or material under test.
Startup and mode competition in a 420 GHz gyrotron
Qixiang Zhao, A.; Sheng Yu, B.; Tianzhong Zhang, C.
2017-09-01
In the experiments of a 420 GHz second-harmonic gyrotron, it is found that the electron beam voltage and current ranges for single mode operation of TE17.4 are slightly narrower than those in the simulation. To explain this phenomenon, the startup scenario has been investigated with special emphasis on mode competition. The calculations indicate that the decreases of the operating ranges are caused by the voltage overshoot in the startup scenario.
Directory of Open Access Journals (Sweden)
Lavanya Challagundla
2018-01-01
Full Text Available The USA300 North American epidemic (USA300-NAE clone of methicillin-resistant Staphylococcus aureus has caused a wave of severe skin and soft tissue infections in the United States since it emerged in the early 2000s, but its geographic origin is obscure. Here we use the population genomic signatures expected from the serial founder effects of a geographic range expansion to infer the origin of USA300-NAE and identify polymorphisms associated with its spread. Genome sequences from 357 isolates from 22 U.S. states and territories and seven other countries are compared. We observe two significant signatures of range expansion, including decreases in genetic diversity and increases in derived allele frequency with geographic distance from the Pennsylvania region. These signatures account for approximately half of the core nucleotide variation of this clone, occur genome wide, and are robust to heterogeneity in temporal sampling of isolates, human population density, and recombination detection methods. The potential for positive selection of a gyrA fluoroquinolone resistance allele and several intergenic regions, along with a 2.4 times higher recombination rate in a resistant subclade, is noted. These results are the first to show a pattern of genetic variation that is consistent with a range expansion of an epidemic bacterial clone, and they highlight a rarely considered but potentially common mechanism by which genetic drift may profoundly influence bacterial genetic variation.
10 CFR 420.3 - Administration of financial assistance.
2010-01-01
... procedures which DOE may from time to time prescribe for the administration of financial assistance under... 10 Energy 3 2010-01-01 2010-01-01 false Administration of financial assistance. 420.3 Section 420... Energy Program Financial Assistance § 420.3 Administration of financial assistance. (a) Financial...
14 CFR 420.49 - Compliance monitoring.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Compliance monitoring. 420.49 Section 420.49 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION ADMINISTRATION, DEPARTMENT... Compliance monitoring. A licensee shall allow access by and cooperate with federal officers or employees or...
18 CFR 420.41 - Schedule of water charges.
2010-04-01
... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Schedule of water charges. 420.41 Section 420.41 Conservation of Power and Water Resources DELAWARE RIVER BASIN COMMISSION ADMINISTRATIVE MANUAL BASIN REGULATIONS-WATER SUPPLY CHARGES Charges; Exemptions § 420.41 Schedule of water...
Evaluation of skin melanoma in spectral range 450-950 nm using principal component analysis
Jakovels, D.; Lihacova, I.; Kuzmina, I.; Spigulis, J.
2013-06-01
Diagnostic potential of principal component analysis (PCA) of multi-spectral imaging data in the wavelength range 450- 950 nm for distant skin melanoma recognition is discussed. Processing of the measured clinical data by means of PCA resulted in clear separation between malignant melanomas and pigmented nevi.
Interlaced zone plate optics for hard X-ray imaging in the 10 nm range
Mohacsi, Istvan; Vartiainen, Ismo; Rösner, Benedikt; Guizar-Sicairos, Manuel; Guzenko, Vitaliy A.; McNulty, Ian; Winarski, Robert; Holt, Martin V.; David, Christian
2017-03-01
Multi-keV X-ray microscopy has been particularly successful in bridging the resolution gap between optical and electron microscopy. However, resolutions below 20 nm are still considered challenging, as high throughput direct imaging methods are limited by the availability of suitable optical elements. In order to bridge this gap, we present a new type of Fresnel zone plate lenses aimed at the sub-20 and the sub-10 nm resolution range. By extending the concept of double-sided zone plate stacking, we demonstrate the doubling of the effective line density and thus the resolution and provide large aperture, singlechip optical devices with 15 and 7 nm smallest zone widths. The detailed characterization of these lenses shows excellent optical properties with focal spots down to 7.8 nm. Beyond wave front characterization, the zone plates also excel in typical imaging scenarios, verifying their resolution close to their diffraction limited optical performance.
International Nuclear Information System (INIS)
Borowiec, A.; Tiedje, H.F.; Haugen, H.K.
2005-01-01
We present single pulse femtosecond laser ablation threshold measurements of InP obtained by optical, scanning electron, and atomic force microscopy. The experiments were conducted with laser pulses 65-175 fs in duration, in the wavelength range from 400 to 2050 nm, covering the photon energy region above and below the bandgap of InP. The ablation thresholds determined from depth and volume measurements varied from 87 mJ/cm 2 at 400 nm to 250 mJ/cm 2 at 2050 nm. In addition, crater depths and volumes were measured over a range of laser fluences extending well above the ablation threshold
18 CFR 420.22 - Prohibition; sanctions.
2010-04-01
... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Prohibition; sanctions. 420.22 Section 420.22 Conservation of Power and Water Resources DELAWARE RIVER BASIN COMMISSION... established water pricing schedules of the Commission) of any such use, withdrawal or diversion, and invoke...
Electric resistance of nickel and niobium in the temperature range of 300-1300 K
International Nuclear Information System (INIS)
Novikov, I.I.; Roshchupkin, V.V.; Mozgovoj, A.G.; Semashko, N.A.
1982-01-01
The results of experimental investigation of nickel and niobium electric resistance on the wire samples by the potentiometric method in the temperature range of 300-1300 K are presented. Experimental data processing by the least square method is carried out; approximating equations of temperature dependence of the nickel and niobium electric resistance are prepared
Abbasi-Khazaei, Bijan; Mollaahmadi, Akbar
2017-04-01
In this research, the effect of rapid tempering on the microstructure, mechanical properties and corrosion resistance of AISI 420 martensitic stainless steel has been investigated. At first, all test specimens were austenitized at 1050 °C for 1 h and tempered at 200 °C for 1 h. Then, the samples were rapidly reheated by a salt bath furnace in a temperature range from 300 to 1050 °C for 2 min and cooled in air. The tensile tests, impact, hardness and electrochemical corrosion were carried out on the reheated samples. Scanning electron microscopy was used to study the microstructure and fracture surface. To investigate carbides, transmission electron microscopy and also scanning electron microscopy were used. X-ray diffraction was used for determination of the retained austenite. The results showed that the minimum properties such as the tensile strength, impact energy, hardness and corrosion resistance were obtained at reheating temperature of 700 °C. Semi-continuous carbides in the grain boundaries were seen in this temperature. Secondary hardening phenomenon was occurred at reheating temperature of 500 °C.
Li, Yunxiang; Ouyang, Shuxin; Xu, Hua; Wang, Xin; Bi, Yingpu; Zhang, Yuanfang; Ye, Jinhua
2016-10-03
Efficient generation of active oxygen-related radicals plays an essential role in boosting advanced oxidation process. To promote photocatalytic oxidation for gaseous pollutant over g-C 3 N 4 , a solid-gas interfacial Fenton reaction is coupled into alkalinized g-C 3 N 4 -based photocatalyst to effectively convert photocatalytic generation of H 2 O 2 into oxygen-related radicals. This system includes light energy as power, alkalinized g-C 3 N 4 -based photocatalyst as an in situ and robust H 2 O 2 generator, and surface-decorated Fe 3+ as a trigger of H 2 O 2 conversion, which attains highly efficient and universal activity for photodegradation of volatile organic compounds (VOCs). Taking the photooxidation of isopropanol as model reaction, this system achieves a photoactivity of 2-3 orders of magnitude higher than that of pristine g-C 3 N 4 , which corresponds to a high apparent quantum yield of 49% at around 420 nm. In-situ electron spin resonance (ESR) spectroscopy and sacrificial-reagent incorporated photocatalytic characterizations indicate that the notable photoactivity promotion could be ascribed to the collaboration between photocarriers (electrons and holes) and Fenton process to produce abundant and reactive oxygen-related radicals. The strategy of coupling solid-gas interfacial Fenton process into semiconductor-based photocatalysis provides a facile and promising solution to the remediation of air pollution via solar energy.
High efficiency AlGaInN-based light emitting diode in the 360-380 nm wavelength range
Energy Technology Data Exchange (ETDEWEB)
Sato, Hisao; Wang, Hong-Xing; Sato, Daisuke; Takaki, Ryohei; Wada, Naoki; Tanahashi, Tetsuya; Yamashita, Kenji; Kawano, Shunsuke; Mizobuchi, Takashi; Dempo, Akihiko; Morioka, Kenji; Kimura, Masahiro; Nohda, Suguru [Nitride Semiconductors Co., Ltd., 115-7 Itayajima, Akinokami, Seto-cho, Naruto, Tokushima 771-0360 (Japan); Sugahara, Tomoya [Satellite Venture Business Laboratory, The University of Tokushima (Japan); Sakai, Shiro [Department of Electrical and Electronic Engineering, The University of Tokushima, 2-1 Minami-josanjima, Tokushima 770-8506 (Japan)
2003-11-01
High performance LEDs emitting in the wavelength range 360-380 nm, are fabricated on sapphire substrates by one-time metalorganic chemical vapor deposition (MOCVD) without using epitaxial lateral overgrowth (ELO) or similar techniques. By improving layer structures and growth conditions, the output power of the LEDs was much improved. The light output power of the LEDs at an injection current of 20 mA is 3.2 mW, 2.5 mW and 1 mW at wavelengths of 378 nm, 373 nm and 363 nm, which correspond to an external quantum efficiency of 4.8%, 3.8% and 1.4%, respectively. (copyright 2003 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
14 CFR 420.71 - Lightning protection.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Lightning protection. 420.71 Section 420.71... protection. (a) Lightning protection. A licensee shall ensure that the public is not exposed to hazards due to the initiation of explosives by lightning. (1) Elements of a lighting protection system. Unless an...
Peculiarities of near-ultraviolet (365 nm) and visible light effects in Paramecium Caudatum cells
International Nuclear Information System (INIS)
Samoilova, K.A.; Sushchenko, N.B.
1977-01-01
After treatment with 365 nm or visible light Paramecium caudatum cells fail to divide and die shortly after irradiation; no death occurs long after irradiation, as well as after several cell cycles, unlike the situation after the action of 254 nm or 300-380 nm. Irradiation inhibits mainly the first cell cycle following which the recovery of cells starts. Thus no after-effects take place after the action of 365 nm and visible light, and the patterns of their effects are rather similar. The photoreactivation of damages induced by 365 nm is quite small, being about 2 times less than that for 254 nm and 300-380 nm. Similarity of the action of 254, 300-380, 365 nm and visible light was established by the stimulation of cell division by low doses and increase in viability of infusoria from cultures with low survival and depressed rate of multiplication. This effect of 365 nm is not eliminated by visible light; moreover, the latter promotes the 'therapeutic' effect of the 365 nm line. (author)
Distinct Short-Range Order Is Inherent to Small Amorphous Calcium Carbonate Clusters (<2 nm)
Energy Technology Data Exchange (ETDEWEB)
Sun, Shengtong [Physical Chemistry, University of Konstanz, Universitätsstrasse 10 78457 Konstanz Germany; School of Chemical Engineering, State Key Laboratory of Chemical Engineering, Shanghai Key Laboratory of Multiphase Materials Chemical Engineering, East China University of Science and Technology, 130 Meilong Road Shanghai 200237 P.R. China; Chevrier, Daniel M. [Department of Chemistry and Institute for Research in Materials, Dalhousie University, Halifax Nova Scotia B3H 4R2 Canada; Zhang, Peng [Department of Chemistry and Institute for Research in Materials, Dalhousie University, Halifax Nova Scotia B3H 4R2 Canada; Gebauer, Denis [Physical Chemistry, University of Konstanz, Universitätsstrasse 10 78457 Konstanz Germany; Cölfen, Helmut [Physical Chemistry, University of Konstanz, Universitätsstrasse 10 78457 Konstanz Germany
2016-09-09
Amorphous intermediate phases are vital precursors in the crystallization of many biogenic minerals. While inherent short-range orders have been found in amorphous calcium carbonates (ACCs) relating to different crystalline forms, it has never been clarified experimentally whether such orders already exist in very small clusters less than 2 nm in size. Here, we studied the stability and structure of 10,12-pentacosadiynoic acid (PCDA) protected ACC clusters with a core size of ca. 1.4 nm consisting of only seven CaCO3 units. Ligand concentration and structure are shown to be key factors in stabilizing the ACC clusters. More importantly, even in such small CaCO3 entities, a proto-calcite short-range order can be identified but with a relatively high degree of disorder that arises from the very small size of the CaCO3 core. Our findings support the notion of a structural link between prenucleation clusters, amorphous intermediates, and final crystalline polymorphs, which appears central to the understanding of polymorph selection.
47 CFR 0.420 - Other Commission publications.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Other Commission publications. 0.420 Section 0... Information Printed Publications § 0.420 Other Commission publications. The following additional Commission publications may be purchased from the Superintendent of Documents: (a) Statistics of Communications Common...
Semiconductor optical amplifiers for the 1000-1100-nm spectral range
International Nuclear Information System (INIS)
Lobintsov, A A; Shramenko, M V; Yakubovich, S D
2008-01-01
Two types of semiconductor optical amplifiers (SOAs) based on a double-layer quantum-well (InGa)As/(GaAl)As/GaAs heterostructure are investigated. The optical gain of more than 30 dB and saturation output power of more than 30 mW are achived at 1060 nm in pigtailed SOA modules. These SOAs used as active elements of a tunable laser provide rapid continuous tuning within 85 nm and 45 nm at output powers of 0.5 mW and more than 30 mW, respectively. (active media, lasers, and amplifiers)
10 CFR 420.32 - Program guidance/solicitation.
2010-01-01
... SEP and the participating programs in the Office of Energy Efficiency and Renewable Energy; and (2... 10 Energy 3 2010-01-01 2010-01-01 false Program guidance/solicitation. 420.32 Section 420.32 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION STATE ENERGY PROGRAM Implementation of Special Projects...
EST Table: NM_001111334 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available NM_001111334 Br-c 10/09/29 81 %/420 aa ref|NP_001104804.1| broad-complex isoform Z1... [Bombyx mori] dbj|BAD23978.1| broad-complex Z1-isoform [Bombyx mori] dbj|BAD23983.1| broad-complex Z1-isofo...rm [Bombyx mori] dbj|BAD24045.1| Broad-Complex isoform Z1 [Bombyx mori] dbj|BAD24046.1| Broad-Complex isofor...m Z1 [Bombyx mori] dbj|BAD46732.1| broad-complex A-Z1 isoform [Bombyx mori] dbj|BAD46739.1| broad...-complex B-Z1 isoform [Bombyx mori] dbj|BAF43564.1| Broad-Complex isoform Z1 [Bombyx mori] 1
50 CFR 665.420 - Mariana coral reef ecosystem fisheries. [Reserved
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Mariana coral reef ecosystem fisheries. [Reserved] 665.420 Section 665.420 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL... PACIFIC Mariana Archipelago Fisheries § 665.420 Mariana coral reef ecosystem fisheries. [Reserved] ...
Yoshihiro Tsujimoto; Yoshitaka Matsushita; Shan Yu; Kazunari Yamaura; Tetsuo Uchikoshi
2015-01-01
Corundum-type Ti2O3 has been investigated over the last half century because it shows unusual insulator–metal (I-M) transition over a broad temperature range (420–550 K). In this work, we successfully synthesized Ti2O3 nanoparticles (20, 70, 300 nm in size) by the low-temperature reduction between precursors of rutile-type TiO2 and the reductant CaH2, in a non-topotactic manner. The reaction time required for obtaining the reduced phase increases with increasing the particle size. Synchrotron...
International Nuclear Information System (INIS)
Bulatova, T.M.
1990-01-01
By the method of stress relaxation dependences of platic deformation rate on effective strain in CdS monocrystals for the temperatures of 25-300 deg C both in the darkness and in the light are obtained. In the range of the temperatures up to 150 deg C deformation activation energy is determined, which correlates with the value of point defect diffusion activation energy in the crystal. Anomalous temperature dependence of plastic deformation rate, i.e. its decrease with the temperature increase in the range of 150-300 deg C is detected
A compact design for monochromatic OSL measurements in the wavelength range 380-1020 NM
DEFF Research Database (Denmark)
Bøtter-Jensen, L.; Poolton, N.R.J.; Willumsen, F.
1994-01-01
automated Riso TL/OSL dating apparatus, thus allowing for either routine scanning or more detailed thermo-optical investigations. The high throughput efficiency of the unit means that the existing 75 W tungsten-halogen lamp can be directly used for such measurements on both quartz and feldspar samples......The development and performance of a compact module is described that allows for the monochromatic illumination of samples in the wavelength range 380-1020 nm, enabling the measurement of energy-resolved optically stimulated luminescence. The unit is designed to couple directly to the existing....... The design allows for rapid spectral scanning with a choice of resolution of anywhere between 10 and 80 nm: stray light levels are less than 0.01%. The unit can equally be used for recording wavelength-resolved emission spectra, whether photo-excited or thermally stimulated; the capabilities of the system...
24 CFR 203.420 - Nature of Mutual Mortgage Insurance Fund.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of Mutual Mortgage Insurance Fund. 203.420 Section 203.420 Housing and Urban Development Regulations Relating to Housing and Urban... and Distributive Shares § 203.420 Nature of Mutual Mortgage Insurance Fund. The Mutual Mortgage...
Enhanced Performance of Dye-Sensitized Solar Cells with Graphene/ZnO Nanoparticles Bilayer Structure
Directory of Open Access Journals (Sweden)
Chih-Hung Hsu
2014-01-01
Full Text Available This study reports characteristics of dye-sensitized solar cells (DSSCs with graphene/ZnO nanoparticle bilayer structure. The enhancement of the performance of DSSCs achieved using graphene/ZnO nanoparticle films is attributable to the introduction of an electron-extraction layer and absorption of light in the visible range and especially in the range 300–420 nm. DSSC that was fabricated with graphene/ZnO nanoparticle film composite photoanodes exhibited a Voc of 0.5 V, a Jsc of 17.5 mA/cm2, an FF of 0.456, and a calculated η of 3.98%.
High-power cw laser bars of the 750 – 790-nm wavelength range
International Nuclear Information System (INIS)
Degtyareva, N S; Kondakov, S A; Mikayelyan, G T; Gorlachuk, P V; Ladugin, M A; Marmalyuk, Aleksandr A; Ryaboshtan, Yu L; Yarotskaya, I V
2013-01-01
We have developed the effective design of semiconductor heterostructures, which allow one to fabricate cw laser diodes emitting in the 750 – 790-nm spectral range. The optimal conditions for fabrication of GaAsP/AlGaInP/GaAs heterostructures by MOCVD have been determined. It is shown that the use of quantum wells with a precisely defined quantity mismatch reduces the threshold current density and increases the external differential efficiency. The results of studies of characteristics of diode laser bars fabricated from these heterostructures are presented. (lasers)
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Right of way. 4.20 Section 4... TRAFFIC SAFETY § 4.20 Right of way. An operator of a motor vehicle shall yield the right of way to pedestrians, saddle and pack animals and vehicles drawn by animals. Failure to yield the right of way is...
31 CFR 515.420 - Travel to Cuba.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Travel to Cuba. 515.420 Section 515....420 Travel to Cuba. The prohibition on dealing in property in which Cuba or a Cuban national has an interest set forth in § 515.201(b)(1) includes a prohibition on the receipt of goods or services in Cuba...
Dielectric Properties of Cd1-xZnxSe Thin Film Semiconductors
International Nuclear Information System (INIS)
Wahab, L.A.; Farrag, A.A.; Zayed, H.A.
2012-01-01
Cd 1-x Zn x Se (x=0, 0.5 and 1) thin films of thickness 300 nm have been deposited on highly cleaned glass substrates (Soda-lime glass) by thermal evaporation technique under pressure 10-5 Torr. The crystal structure, lattice parameters and grain size were determined from X-ray diffraction patterns of these films. The dielectric response and ac conductivity of the films are investigated in the frequency range from 80 Hz to 5 MHz and temperature range from 300 K to 420 K. AC conductivity increases linearly with the frequency according to the power relation σ a c (ψ)=A (ψ) s . The dielectric constant and loss show low values at high frequencies. The relaxation time t, resistance R and capacitance C were calculated from Nyquist diagram. The behavior can be modeled by an equivalent parallel RC circuit.
40 CFR 420.60 - Applicability; description of the continuous casting subcategory.
2010-07-01
... continuous casting subcategory. 420.60 Section 420.60 Protection of Environment ENVIRONMENTAL PROTECTION... Continuous Casting Subcategory § 420.60 Applicability; description of the continuous casting subcategory. The... owned treatment works resulting from the continous casting of molten steel into intermediate or semi...
Garakhin, S. A.; Zabrodin, I. G.; Zuev, S. E.; Kas'kov, I. A.; Lopatin, A. Ya.; Nechay, A. N.; Polkovnikov, V. N.; Salashchenko, N. N.; Tsybin, N. N.; Chkhalo, N. I.; Svechnikov, M. V.
2017-05-01
We describe a laboratory reflectometer developed at the IPM RAS for precision measurements of spectral and angular dependences of the reflection and transmission coefficients of optical elements in a wavelength range of 5-50 nm. The radiation is monochromatised using a high-resolution Czerny-Turner spectrometer with a plane diffraction grating and two spherical collimating mirrors. A toroidal mirror focuses the probe monochromatic beam on a sample. The X-ray source is a highly ionised plasma produced in the interaction of a high-power laser beam with a solid target at an intensity of 1011-1012 W cm-2. To stabilise the emission characteristics, the target executes translatory and rotary motions in such a way that every pulse irradiates a new spot. The short-focus lens is protected from contamination by erosion products with the use of a specially designed electromagnetic system. The samples under study are mounted on a goniometer is accommodated in a dedicated chamber, which provides five degrees of freedom for samples up to 500 mm in diameter and two degrees of freedom for a detector. The sample mass may range up to 10 kg. The X-ray radiation is recorded with a detector composed of a CsI photocathode and two microchannel plates. A similar detector monitors the probe beam intensity. The spectral reflectometer resolution is equal to 0.030 nm with the use of ruled gratings with a density of 900 lines mm-1 (spectral range: 5-20 nm) and to 0.067 nm for holographic gratings with a density of 400 lines mm-1 (spectral range: 10-50 nm). We analyse the contribution of higher diffraction orders to the probe signal intensity and the ways of taking it into account in the measurements. Examples are given which serve to illustrate the reflectometer application to the study of multilayer mirrors and filters.
Rapidly solidified long-range-ordered alloys
International Nuclear Information System (INIS)
Lee, E.H.; Koch, C.C.; Liu, C.T.
1981-01-01
The influence of rapid solidification processing on the microstructure of long-range-ordered alloys in the (Fe, Co, Ni) 3 V system has been studied by transmission electron microscopy. The main microstructural feature of the as-quenched alloys was a fine cell structure (approx. 300 nm diameter) decorated with carbide particles. This structure was maintained aftr annealing treatments which develop the ordered crystal structure. Other features of the microstructures both before and after annealing are presented and discussed. 6 figures
23 CFR 420.101 - What is the purpose of this part?
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false What is the purpose of this part? 420.101 Section 420.101 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION PLANNING AND RESEARCH PLANNING AND RESEARCH PROGRAM ADMINISTRATION Administration of FHWA Planning and Research Funds § 420.101...
17 CFR 201.420 - Appeal of determinations by self-regulatory organizations.
2010-04-01
... self-regulatory organizations. 201.420 Section 201.420 Commodity and Securities Exchanges SECURITIES... Review § 201.420 Appeal of determinations by self-regulatory organizations. (a) Application for review... by a self-regulatory organization determination as to which a notice is required to be filed with the...
A InGaN/GaN quantum dot green (λ=524 nm) laser
Zhang, Meng
2011-01-01
The characteristics of self-organized InGaN/GaN quantum dot lasers are reported. The laser heterostructures were grown on c-plane GaN substrates by plasma-assisted molecular beam epitaxy and the laser facets were formed by focused ion beam etching with gallium. Emission above threshold is characterized by a peak at 524 nm (green) and linewidth of 0.7 nm. The lowest measured threshold current density is 1.2 kA/ cm2 at 278 K. The slope and wall plug efficiencies are 0.74 W/A and ∼1.1%, respectively, at 1.3 kA/ cm 2. The value of T0 =233 K in the temperature range of 260-300 K. © 2011 American Institute of Physics.
Wang, Peng; Minegishi, Tsutomu; Ma, Guijun; Takanabe, Kazuhiro; Satou, Yasushi; Maekawa, Shunsuke; Kobori, Yoshihiro; Kubota, Jun; Domen, Kazunari
2012-01-01
the irradiation of a 300 W Xe lamp with a 420 nm cutoff filter. The yield of MC was measured by gas chromatography, and an 88% faradaic efficiency was estimated. This study suggests the possibility of direct energy conversion from solar energy to MC as an energy
Noninvasive diagnosis of oral cancer by Stokes shift spectroscopy
Ebenezar, Jeyasingh; Ganesan, Singaravelu; Aruna, Prakasrao; Muralinaidu, Radhakrishnan
2014-03-01
The objective of this study is to evaluate the diagnostic potential of stokes shift (SS) spectroscopy (S3) for normal, precancer and cancerous oral lesions in vivo. The SS spectra were recorded in the 250 - 650 nm spectral range by simultaneously scanning both the excitation and emission wavelengths while keeping a fixed wavelength interval Δλ=20 nm between them. Characteristic, highly resolved peaks and significant spectral differences between normal and different pathological oral lesions observed around 300, 355, 395, and 420 nm which are attributed to tryptophan, collagen, and NADH respectively. Using S3 technique one can obtain the key fluorophores in a single scan and hence they can be targeted as a tumor markers in this study. In order to quantify the altered spectral differences between normal and different pathological oral lesions are verified by different ratio parameters.
Microhardness and Stress Analysis of Laser-Cladded AISI 420 Martensitic Stainless Steel
Alam, Mohammad K.; Edrisy, Afsaneh; Urbanic, Jill; Pineault, James
2017-03-01
Laser cladding is a surface treatment process which is starting to be employed as a novel additive manufacturing. Rapid cooling during the non-equilibrium solidification process generates non-equilibrium microstructures and significant amounts of internal residual stresses. This paper investigates the laser cladding of 420 martensitic stainless steel of two single beads produced by different process parameters (e.g., laser power, laser speed, and powder feed rate). Metallographic sample preparation from the cross section revealed three distinct zones: the bead zone, the dilution zone, and the heat-affected zone (HAZ). The tensile residual stresses were in the range of 310-486 MPa on the surface and the upper part of the bead zone. The compressive stresses were in the range of 420-1000 MPa for the rest of the bead zone and the dilution zone. The HAZ also showed tensile residual stresses in the range of 140-320 MPa for both samples. The post-cladding heat treatment performed at 565 °C for an hour had significantly reduced the tensile stresses at the surface and in the subsurface and homogenized the compressive stress throughout the bead and dilution zones. The microstructures, residual stresses, and microhardness profiles were correlated for better understanding of the laser-cladding process.
20 CFR 664.420 - What are leadership development opportunities?
2010-04-01
..., including team leadership training; (e) Training in decision-making, including determining priorities; and... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What are leadership development opportunities? 664.420 Section 664.420 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF...
International Nuclear Information System (INIS)
Wyart, J.-F.; Ecole Polytech., Palaiseau; Fajardo, M.; Missalla, T.; Gauthier, J.-C.; Chenais-Popovics, C.; Klopfel, D.; Uschmann, I.; Foerster, E.
1999-01-01
The spectra of highly-charged ions produced by laser irradiation on flat targets at about 5 x 10 14 Wcm -2 are recorded in the range from 0.60 nm to 0.95 nm (6 A to 9.5 A) by means of two spectrographs (a flat ADP crystal and a Johann SiO 2 crystal spectrograph). The identification of the lines is supported by calculations of energies and transition probabilities in the relativistic parametric potential model. New identifications in several spectra of iron (Fe XXIII to Fe XXI), sodium-like strontium, Sr XXVIII, magnesium-like indium. In XXXVIII, and cobalt-like samarium, Sm XXXVI, are given. In the case of Fe XXIII, relativistic and non-relativistic (Cowan) ab initio calculations are compared. (orig.)
40 CFR 415.420 - Applicability; description of the hydrogen cyanide production subcategory.
2010-07-01
... hydrogen cyanide production subcategory. 415.420 Section 415.420 Protection of Environment ENVIRONMENTAL... SOURCE CATEGORY Hydrogen Cyanide Production Subcategory § 415.420 Applicability; description of the hydrogen cyanide production subcategory. This subpart applies to discharges to waters of the United States...
Effects of heat treatment conditions on microstructure and mechanical properties of AISI 420 steel
Energy Technology Data Exchange (ETDEWEB)
Scheuer, C.J.; Fraga, R.A.; Cardoso, R.P.; Brunatto, S.F. [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil). Departamento de Engenharia Mecanica. Grupo de Tecnologia de Fabricacao Assistida por Plasma e Metalurgia do Po
2014-07-01
The cycle control of heat treatments, on the quenching and tempering operation of AISI 420 stainless steel, is essential for improved material performance. The adequate choice of heat treatment parameters, can lead an optimization on its mechanical properties and corrosion resistance. Thus, this paper aims to investigate the effects of quenchants medium, and austenitizing and tempering temperatures, on the microstructure and mechanical properties of AISI 420 steel. Different heat treatments cycles were studied: 1) samples were austenitized at 1050°C and water, oil and air quenched; 2) samples were austenitized at range temperatures of 950-1050°C and oil quenched; and 3) as-quenched samples were tempering at range temperatures of 400-500°C. Treated samples were characterized by optical microscopy, X-ray diffractometry and hardness measurements. The samples hardness increases with increasing cooling rate (water > oil > air quenched). Water quenched samples presented crack after cooling to room temperature. Samples hardness also increases with austenitizing temperature increasing, and decreases with increasing tempering temperature. (author)
Dusty plasma in a glow discharge in helium in temperature range of 5–300 K
Energy Technology Data Exchange (ETDEWEB)
Samoilov, I. S.; Baev, V. P.; Timofeev, A. V., E-mail: timofeevalvl@gmail.com; Amirov, R. Kh.; Kirillin, A. V.; Nikolaev, V. S.; Bedran, Z. V. [Russian Academy of Sciences, Joint Institute for High Temperatures (Russian Federation)
2017-03-15
Dusty plasma structures in glow discharge in helium in the temperature range of 5–300 K are investigated experimentally. We have described the experimental setup that makes it possible to continuously vary the temperature regime. The method for experimental data processing has been described. We have measured interparticle distances in the temperature range of 9–295 K and compared them with the Debye radius. We indicate the ranges of variations in experimental parameters in which plasma–dust structures are formed and various types of their behavior are manifested (rotation, vibrations of structures, formation of vertical linear chains, etc.). The applicability of the Yukawa potential to the description of the structural properties of a dusty plasma in the experimental conditions is discussed.
A Short-Range Distance Sensor with Exceptional Linearity
Simmons, Steven; Youngquist, Robert
2013-01-01
A sensor has been demonstrated that can measure distance over a total range of about 300 microns to an accuracy of about 0.1 nm (resolution of about 0.01 nm). This represents an exceptionally large dynamic range of operation - over 1,000,000. The sensor is optical in nature, and requires the attachment of a mirror to the object whose distance is being measured. This work resulted from actively developing a white light interferometric system to be used to measure the depths of defects in the Space Shuttle Orbiter windows. The concept was then applied to measuring distance. The concept later expanded to include spectrometer calibration. In summary, broadband (i.e., white) light is launched into a Michelson interferometer, one mirror of which is fixed and one of which is attached to the object whose distance is to be measured. The light emerging from the interferometer has traveled one of two distances: either the distance to the fixed mirror and back, or the distance to the moving mirror and back. These two light beams mix and produce an interference pattern where some wavelengths interfere constructively and some destructively. Sending this light into a spectrometer allows this interference pattern to be analyzed, yielding the net distance difference between the two paths. The unique feature of this distance sensor is its ability to measure accurately distance over a dynamic range of more than one million, the ratio of its range (about 300 microns) to its accuracy (about 0.1 nanometer). Such a large linear operating range is rare and arises here because both amplitude and phase-matching algorithms contribute to the performance. The sensor is limited by the need to attach a mirror of some kind to the object being tracked, and by the fairly small total range, but the exceptional dynamic range should make it of interest.
Thermal Stability of Austempered Ductile Iron Evaluated in a Temperature Range of 20-300K
Directory of Open Access Journals (Sweden)
Dawid MYSZKA
2016-05-01
Full Text Available The aim of this article was to determine through changes in magnetic properties the stability of the austempered ductile iron (ADI microstructure during temperature changes in a range of 20 – 300 K. The measurements were taken in a vibrating sample magnetometer (VSM using Fe27Ni2TiMoAlNb austenitic stainless steel and four types of austempered ductile iron obtained under various heat treatment conditions. The plotted curves showing changes in the magnetisation degree as a function of temperature had a number of characteristic points illustrating changes taking place in the microstructure. For each of the materials examined, the martensite start temperature Ms and the temperature range within which the martensitic transformation takes place were identified.
Charge carrier transport mechanisms in perovskite CdTiO3 fibers
Directory of Open Access Journals (Sweden)
Z. Imran
2014-06-01
Full Text Available Electrical transport properties of electrospun cadmium titanate (CdTiO3 fibers have been investigated using ac and dc measurements. Air annealing of as spun fibers at 1000 °C yielded the single phase perovskite fibers having diameter ∼600 nm - 800 nm. Both the ac and dc electrical measurements were carried out at temperatures from 200 K – 420 K. The complex impedance plane plots revealed a single semicircular arc which indicates the interfacial effect due to grain boundaries of fibers. The dielectric properties obey the Maxwell-Wagner theory of interfacial polarization. In dc transport study at low voltages, data show Ohmic like behavior followed by space charge limited current (SCLC with traps at higher voltages at all temperatures (200 K – 420 K. Trap density in our fibers system is Nt = 6.27 × 1017 /cm3. Conduction mechanism in the sample is governed by 3-D variable range hopping (VRH from 200 K – 300 K. The localized density of states were found to be N(EF = 5.51 × 1021 eV−1 cm−3 at 2 V. Other VRH parameters such as hopping distance (Rhop and hopping energy (Whop were also calculated. In the high temperature range of 320 K – 420 K, conductivity follows the Arrhenius law. The activation energy found at 2 V is 0.10 eV. Temperature dependent and higher values of dielectric constant make the perovskite CdTiO3 fibers efficient material for capacitive energy storage devices.
40 CFR 98.420 - Definition of the source category.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Definition of the source category. 98.420 Section 98.420 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... distribution of CO2. (4) Purification, compression, or processing of CO2. (5) On-site use of CO2 captured on...
Miniature Packaging Concept for LNAs in the 200-300 GHz Range
Samoska, Lorene; Fung, Andy; Varonen, Mikko; Lin, Robert; Peralta, Alejandro; Soria, Mary; Lee, Choonsup; Padmanabhan, Sharmila; Sarkozy, Stephen; Lai, Richard
2016-01-01
In this work, we describe new miniaturized low noise amplifier modules which we developed for incorporation in small-scale satellites or Cubesats, and which exhibit similar or better performance compared to previously reported LNAs in the literature. We have targeted the WR4 (170-260 GHz) and WR3 (220-325 GHz) waveguide bands for the module development. The modules include two different methods of E-plane probes which have been developed for low loss, and stability at high frequencies. MMIC LNAs were also developed for these frequency ranges and fabricated in Northrop Grumman Corporation's 35 nm InP HEMT technology, and we have experimentally verified that noise performance is lower than reported in prior work. The best results include a miniature LNA module with 550K noise at 224 GHz, and a wideband LNA module with 15 dB gain from 230-280 GHz.
Miyoshi, Makoto; Yamanaka, Mizuki; Egawa, Takashi; Takeuchi, Tetsuya
2018-05-01
AlInN epitaxial films with film thicknesses up to approximately 300 nm were grown nearly lattice-matched to a c-plane GaN-on-sapphire template by metalorganic chemical vapor deposition. The AlInN films showed relative good crystal qualities and flat surfaces, despite the existence of surface pits connected to dislocations in the underlying GaN film. The refractive index derived in this study agreed well with a previously reported result obtained over the whole visible wavelength region. The extinction coefficient spectrum exhibited a clear absorption edge, and the bandgap energy for AlInN nearly lattice-matched to GaN was determined to be approximately 4.0 eV.
New semiconductor laser technology for gas sensing applications in the 1650nm range
Morrison, Gordon B.; Sherman, Jes; Estrella, Steven; Moreira, Renan L.; Leisher, Paul O.; Mashanovitch, Milan L.; Stephen, Mark; Numata, Kenji; Wu, Stewart; Riris, Haris
2017-08-01
Atmospheric methane (CH4) is the second most important anthropogenic greenhouse gas with approximately 25 times the radiative forcing of carbon dioxide (CO2) per molecule. CH4 also contributes to pollution in the lower atmosphere through chemical reactions leading to ozone production. Recent developments of LIDAR measurement technology for CH4 have been previously reported by Goddard Space Flight Center (GSFC). In this paper, we report on a novel, high-performance tunable semiconductor laser technology developed by Freedom Photonics for the 1650nm wavelength range operation, and for LIDAR detection of CH4. Devices described are monolithic, with simple control, and compatible with low-cost fabrication techniques. We present 3 different types of tunable lasers implemented for this application.
EG-17SUV420-MEDIATED HETEROCHROMATIN CHANGES IN PEDIATRIC BRAIN CANCERS
Van Meter, Timothy E.; Terry, Jocelyn; Rockwell, Nathan; Goggin, Sarah; Nethala, Priya; Khan, Asadullah
2014-01-01
Silencing mechanisms play a role in genomic stability by maintaining condensed, non-active regions of the genome. SUV420 enzymes contain a SET domain conferring methyltransferase activity toward histones. The Histone H4 lysine 20 trimethylation (H4K20me3) mark maintained by SUV420H2 is associated with heterochromatin formation and gene silencing, whereas the dimethylated mark (H4K20me2) is associated with DNA repair. In studies of epigenetic factors in large patient cohorts with ependymoma, it was found that SUV420H2 expression was lost or diminished in patients with reciprocal increases in prognostic markers such as hTERT. To better understand the normal function of Suv4-20H1/H2 enzyme in neural progenitors, and pathological changes in cancers, a variety of differentiation paradigms were used. The NT2D1 neurally restricted cell line, and BGO1V and H9 human embryonic stem cells (ESCs), and differentiated progeny, were used alongside tumors to better understand enzyme targets and functional outcomes (e.g.,lineage, differentiation, regional chromatin modifications). Lineage stages were verified with stage-specific markers by immunofluorescence and qPCR. Suv4-20 H1 and H2 were present in ESCs and neural progenitors and decreased thereafter. RNAi knockdown of SUV420 enzymes led to decreased H4K20 methylation in cancer cells. DNA methylation microarrays and ChIP-PCR suggest 1) that SUV420 is not regulated by DNA methylation in ependymomas; 2) that active chromatin marks such as H3K4 dimethylation are enriched near the transcriptional start site in the SUV420H2 gene, and 3) that hTERT is hyper-methylated at specific CpG islands and histones in a tumor sub-group-specific manner. This data supports the hypothesis that Suv4-20H2 is highly active in progenitor cells and functionally lost in some brain cancers. These studies begin to elucidate coincident mechanisms of gene silencing active in neural progenitors that may be altered in a subset of pediatric brain cancers.
Ocular effects of ultraviolet radiation from 295 to 365 nm
International Nuclear Information System (INIS)
Pitts, D.G.; Cullen, A.P.; Hacker, P.D.
1977-01-01
A 5,000 watt Xe--Hg source and a double monochromator were used to produce 6.6 nm full band-pass ultraviolet (UV) radiation. Pigmented rabbit eyes were exposed to the 6.6 nm band-pass UV radiant energy in 5 nm steps from 295 to 320 nm and at random intervals above 320 nm. Corneal and lenticular damage was assessed and classified with a biomicroscope. Corneal threshold radiant exposure (Hc) rose very rapidly from 0.022 Jcm -2 at 300 nm to 10.99 Jcm -2 at 335 nm. Radiant exposures exceeding 2 x Hc resulted in irreversible corneal damage. Lenticular damage was limited to wavebands above 295 nm. The action spectrum for the lens began at 295 nm and extended to about 315 nm. Permanent lenticular damage occurred at radiant exposure levels approximately twice the threshold for lenticular radiant exposure. The importance in establishing both corneal and lenticular damage criteria is emphasized
28 CFR 54.420 - Access to schools operated by LEAs.
2010-07-01
....420 Section 54.420 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) NONDISCRIMINATION ON THE... operated by LEAs. A recipient that is a local educational agency shall not, on the basis of sex, exclude...; or (b) Any other school or educational unit operated by such recipient, unless such recipient...
Jiang, Jing; Jacobs, Alan G; Wenning, Brandon; Liedel, Clemens; Thompson, Michael O; Ober, Christopher K
2017-09-20
Laser spike annealing was applied to PS-b-PDMS diblock copolymers to induce short-time (millisecond time scale), high-temperature (300 to 700 °C) microphase segregation and directed self-assembly of sub-10 nm features. Conditions were identified that enabled uniform microphase separation in the time frame of tens of milliseconds. Microphase ordering improved with increased temperature and annealing time, whereas phase separation contrast was lost for very short annealing times at high temperature. PMMA brush underlayers aided ordering under otherwise identical laser annealing conditions. Good long-range order for sub-10 nm cylinder morphology was achieved using graphoepitaxy coupled with a 20 ms dwell laser spike anneal above 440 °C.
Meany, Holly J; Fox, Elizabeth; McCully, Cynthia; Tucker, Chris; Balis, Frank M
2008-08-01
Erlotinib hydrochloride is a small molecule inhibitor of epidermal growth factor receptor (EGFR). EGFR is over-expressed in primary brain tumors and solid tumors that metastasize to the central nervous system. We evaluated the plasma and cerebrospinal fluid (CSF) pharmacokinetics of erlotinib and its active metabolite OSI-420 after an intravenous (IV) dose in a non-human primate model. Erlotinib was administered as a 1 h IV infusion to four adult rhesus monkeys. Serial blood and CSF samples were drawn over 48 h and erlotinib and OSI-420 were quantified with an HPLC/tandem mass spectroscopic assay. Pharmacokinetic parameters were estimated using non-compartmental and compartmental methods. CSF penetration was calculated from the AUC(CSF):AUC(plasma). Erlotinib disappearance from plasma after a short IV infusion was biexponential with a mean terminal half-life of 5.2 h and a mean clearance of 128 ml/min per m(2). OSI-420 exposure (AUC) in plasma was 30% (range 12-59%) of erlotinib, and OSI-420 clearance was more than 5-fold higher than erlotinib. Erlotinib and OSI-420 were detectable in CSF. The CSF penetration (AUC(CSF):AUC(plasma)) of erlotinib and OSI-420 was OSI-420 are measurable in CSF after an IV dose. The drug exposure (AUC) in the CSF is limited relative to total plasma concentrations but is substantial relative the free drug exposure in plasma.
Luminescence characterization of a sodium rich feldspar
International Nuclear Information System (INIS)
Correcher, V.; Sanchez M, L.; Garcia G, J.; Rivera, T.
2006-01-01
This paper reports on the radioluminescence (RL) and thermoluminescence (TL) properties of a sodium rich feldspar ((Na,K)[AlSi 3 O 8 ]) with a mean molecular composition of orthoclase (Or) and albite (Ab) of Or 1 Ab 99 . Despite the complexity of the luminescence signals of the sample, it is possible to determine six different emission bands at about 300, 380, 420, 460, 550 and 680 nm. The 300 nm emission can be associated to structural defects related to the recombination process in which the Na + ion diffusion-limited is involved. The UV-blue emission band at (i) 380 nm is characteristic of mineral phases containing SiO 4 tetrahedral and could be related to intrinsic defects in the lattice, (ii) the 420 nm band could be associated to the presence of Cu (II) ions placed next to the hole traps or the recombination on a centre formed from a hole-oxygen atom adjacent to two Al atoms (Al-O-Al) and (iii) the 460 nm waveband could be due to the presence of Ti 4+ . The green and red emissions are respectively associated to the presence of Mn 2+ and Fe 3+ ions. The ratio between the relative intensities, peaked at 290 (the more intense waveband) and 550 nm is about 10:1 in both TL and RL; this fact indicates that the efficiency of recombination centres does no changes regardless on the type of the process. (Author)
2010-01-01
... § 420.5 Reports. (a) Each State receiving financial assistance under this part shall submit to the cognizant Regional Office Director a quarterly program performance report and a quarterly financial status report. (b) Reports under this section shall contain such information as the Secretary may prescribe in...
International Nuclear Information System (INIS)
Chen, T.P.; Lee, T.C.; Fung, S.; Beling, C.D.
1994-01-01
In this note we present the results of the temperature dependence of the SBH in Au/n-Si, Ag/n-GaAs, and Au/n-GaAs in the temperature range of 7 to 300 K from our internal photoemission measurements. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Merabet, H [Mathematic and Sciences Unit, Dhofar University, Salalah 211, Sultanate of (Oman); Bista, R [Department of Physics, University of Nevada Reno, Reno, NV 89557 (United States); Bruch, R [Department of Physics, University of Nevada Reno, Reno, NV 89557 (United States); Fuelling, S [Department of Physics, University of Nevada Reno, Reno, NV 89557 (United States)
2007-03-01
We have measured and identified numerous Extreme UltraViolet (EUV) radiative line structures arising from xenon (Xe) ions in charge state q = 1 to 10 in the wavelength range 40-80 nm. To obtain reasonable intensities of different charged Xe ions, we have used a compact microwave plasma source which was designed and developed at the Lawrence Berkeley National Laboratory (LBNL). The EUV emission of the ECR plasma has been measured by a 1.5 m grazing incidence monochromator that was absolutely calibrated in the 10-80 nm wavelength range using well known and calibrated EUV light at the Advanced Light Source (ALS), LBNL. This calibration has enabled us to determine absolute intensities of previously measured EUV radiative lines in the wavelengths regions investigated for different ionization stages of Xe. In addition, emission spectra of xenon ions for corresponding measured lines have been calculated. The calculations have been carried out within the relativistic Hartree-Fock (HF) approximation. Results of calculations are found to be in good agreement with current and available experimental and theoretical data.
2010-04-01
... SECURITIES EXCHANGE ACT OF 1934 LARGE POSITION REPORTING § 420.3 Reporting. (a) A reporting entity is subject... large position threshold specified by the Department for a specific Treasury security issue. The... or dates (as of close of business) for which the large position information must be reported; and the...
808-nm diode-pumped continuous-wave Tm:GdVO4 laser at room temperature
Urata, Yoshiharu; Wada, Satoshi
2005-05-01
A high-quality gadolinium vanadate (GdVO4) crystal with 7-at. % thulium as the starting material was grown by the Czochralski technique. The measured absorption spectra exhibited sufficient absorption coefficients for laser diodes (LDs) for neodymium laser pumping: 6.0 cm^-1 for pi polarization and 6.2 cm^-1 for sigma polarization at 808 nm. Laser oscillation was carried out with single-stripe 808-nm LDs in an end-pumping configuration. A slope efficiency of 28% and a threshold of 750 mW were exhibited with respect to the absorbed pump power. An output power of 420 mW was achieved at an absorbed power of 2.4 W. It was demonstrated that Tm:GdVO4 is a useful material for 2-μm lasers, particularly in a compact LD-pumped system.
International Nuclear Information System (INIS)
Petchenko, A.M.; Petchenko, G.A.
2007-01-01
The damped dislocation resonance in preliminary deformed up to 1 % single crystals KBr was investigated. The measurements of a frequency dependence of a dislocation damping decrement of ultrasonic sound were conducted in range of frequencies 7,5...217,5 MHz and temperature range 77...300 K. From the analysis of frequency spectrums the temperature course of a coefficient of phonon viscosity B was determined, which is agreed both with the theory and experimental literary data. The influencing temperature changes of length of a dislocation segment on parameters of a resonant maximum and dynamic drag of dislocations by phonons was revealed and analyzed
International Nuclear Information System (INIS)
Tester, J.R.; Ternes, J.W.; Siniff, D.B.
1977-01-01
Free-ranging raccoons (Procyon lotor), snowshoe hares (Lepus americanus), and striped skunks (Mephitis mephitis) exposed to 300 R cesium-137 radiation were monitored by an automatic radio-tracking system. Five irradiated juvenile raccoons died within 30 days postirradiation, but no controls died. One irradiated and one control snowshoe hare were killed by predators within 30 days after irradiation. No skunks died. No consistent patterns of effects of the irradiation were detected in terms of size or location of home range or in the circadian rhythms
23 CFR 420.109 - What are the requirements for distribution of metropolitan planning funds?
2010-04-01
... and Research Funds § 420.109 What are the requirements for distribution of metropolitan planning funds... 23 Highways 1 2010-04-01 2010-04-01 false What are the requirements for distribution of metropolitan planning funds? 420.109 Section 420.109 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF...
2010-07-01
... PARK SYSTEM UNITS IN ALASKA Subsistence § 13.420 Definitions. Local rural resident. As used in this... wildlife resources taken for personal or family consumption; for barter or sharing for personal or family... permanent basis; and (2) “Barter” shall mean the exchange of fish or wildlife or their parts taken for...
Contiguous polarisation spectra of the Earth from 300-850 nm measured by GOME-2 onboard MetOp-A
Tilstra, L. G.; Lang, R.; Munro, R.; Aben, I.; Stammes, P.
2013-12-01
In this paper we present the first contiguous high-resolution spectra of the Earth's polarisation observed by a satellite instrument. The measurements of the Stokes fraction Q/I are performed by the spectrometer GOME-2 onboard the MetOp-A satellite. Polarisation measurements by GOME-2 are performed by onboard polarisation measurement devices (PMDs) and the high-resolution measurements discussed in this paper are taken in the special "PMD RAW" mode of operation. The spectral resolution of these PMD RAW polarisation measurements varies from 3 nm in the ultraviolet (UV) to 35 nm in the near-infrared wavelength range. We first compare measurements of the polarisation from cloud-free scenes with radiative transfer calculations for a number of cases. We find good agreement but also a spectral discrepancy at 800 nm, which we attribute to remaining imperfections in the calibration key data. Secondly, we study the polarisation of scenes with special scattering geometries that normally lead to near-zero Q/I. The GOME-2 polarisation spectra indeed show this behaviour and confirm the existence of the small discrepancy found earlier. Thirdly, we study the Earth polarisation for a variety of scenes. This provides a blueprint of Q/I over land and sea surfaces for various degrees of cloud cover. Fourthly, we compare the spectral dependence of measurements of Q/I in the UV with the generalised distribution function that was proposed in the past (Schutgens and Stammes, 2002) to describe the shape of the UV polarisation spectrum. The GOME-2 data confirm that these functions match the spectral behaviour captured by the GOME-2 PMD RAW mode.
Phase diagram of Ti-B-C system in the temperature range of 300-3500 K
International Nuclear Information System (INIS)
Gusev, A.I.
1996-01-01
Calculation of phase equilibrium in the ternary system Ti-B-C in the areas of the TiC y -TiB 2 and B 4 C y -TiB 2 cross sections as well as partial construction of three-dimensional (spatial)diagram of the Ti-B-C system within the temperature range of 300-3500 K is carried out. The form of the isothermal cross section of the ternary system remains almost unchanged up to 1900 K. The most essential change is related to disordering of the low-temperature ordered phases Ti 2 C, Ti 3 C and Ti 6 C 5 of the titanium carbide at T > 950 K [ru
21 CFR 111.420 - What requirements apply to repackaging and relabeling?
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What requirements apply to repackaging and relabeling? 111.420 Section 111.420 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN...
H2S cracking resistance of type 420 stainless steel tubulars
International Nuclear Information System (INIS)
Klein, L.J.
1984-01-01
Type 420 stainless steel (13Cr) production tubing is being used successfully in deep sour gas wells in the Tuscaloosa Trend. Despite their reputation for poor H 2 S cracking resistance in laboratory tests, 12-13% Cr steels continue to perform well in sour environments. NACE Tensile Test and Shell bent beam test results indicate Type 420 is more resistant to H 2 S cracking than Type 410, but is not as resistant as carbon steel, at to 586-690 MPa (85-100 ksi) yield strength level. In addition to evaluating Type 420 stainless steel in the standard NACE Tensile and Shell bent beam tests, the effects on cracking tendency of chloride concentration, pH, and H 2 S gas concentration in the NACE Test solution were also examined. Type 420 appears to be more resistant to H 2 S cracking than is indicated by standard laboratory tests, at least in low H 2 S level sour environments
Characterization of LANDSAT Panels Using the NIST BRDF Scale from 1100 nm to 2500 nm
Markham, Brian; Tsai, Benjamin K.; Allen, David W.; Cooksey, Catherine; Yoon, Howard; Hanssen, Leonard; Zeng, Jinan; Fulton, Linda; Biggar, Stuart; Markham, Brian
2010-01-01
Many earth observing sensors depend on white diffuse reflectance standards to derive scales of radiance traceable to the St Despite the large number of Earth observing sensors that operate in the reflective solar region of the spectrum, there has been no direct method to provide NIST traceable BRDF measurements out to 2500 rim. Recent developments in detector technology have allowed the NIST reflectance measurement facility to expand the operating range to cover the 250 nm to 2500 nm range. The facility has been modified with and additional detector using a cooled extended range indium gallium arsenide (Extended InGaAs) detector. Measurements were made for two PTFE white diffuse reflectance standards over the 1100 nm to 2500 nm region at a 0' incident and 45' observation angle. These two panels will be used to support the OLI calibration activities. An independent means of verification was established using a NIST radiance transfer facility based on spectral irradiance, radiance standards and a diffuse reflectance plaque. An analysis on the results and associated uncertainties will be discussed.
Browell, Edward V.; Ismail, Syed; Grossmann, Benoist E.
1991-01-01
Recently measured properties of water vapor (H2O) absorption lines have been used in calculations to evalute the temperature sensitivity of differential absorption lidar (Dial) H2O measurements. This paper estimates the temperature sensitivity of H2O lines in the 717-733-nm region for both H2O mixing ratio and number density measurements, and discusses the influence of the H2O line ground state energies E-double-prime, the H2O absorption linewidths, the linewidth temperature dependence parameter, and the atmospheric temperature and pressure variations with altitude and location on the temperature sensitivity calculations. Line parameters and temperature sensitivity calculations for 67 H2O lines in the 720-nm band are given which can be directly used in field experiments. Water vapor lines with E-double-prime values in the 100-300/cm range were found to be optimum for Dial measurements of H2O number densities, while E-double-prime values in the 250-500/cm range were found to be optimum for H2O mixing ratio measurements.
14 CFR 420.21 - Launch site location review-launch site boundary.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Launch site location review-launch site boundary. 420.21 Section 420.21 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION... travels given a worst-case launch vehicle failure in the launch area. An applicant must clearly and...
Optimization of a dual mode Rowland mount spectrometer used in the 120-950 nm wavelength range
McDowell, M. W.; Bouwer, H. K.
In a recent article, several configurations were described whereby a Rowland mount spectrometer could be modified to cover a wavelength range of 120-950 nm. In one of these configurations, large additional image aberration is introduced which severely limits the spectral resolving power. In the present article, the theoretical imaging properties of this configuration are considered and a simple method is proposed to reduce this aberration. The optimized system possesses an image quality similar to the conventional Rowland mount with the image surface slightly displaced from the Rowland circle but concentric to it.
Energy Technology Data Exchange (ETDEWEB)
Kiahosseini, Seyed Rahim, E-mail: rkiahoseyni@yahoo.com [Young Researchers and Elite Club, Damghan Branch, Islamic Azad University, Damghan (Iran, Islamic Republic of); Afshar, Abdollah [Department of Material Science and Engineering, Sharif University of Technology, Tehran (Iran, Islamic Republic of); Mojtahedzadeh Larijani, Majid [Radiation Applications Research School, Nuclear Science and Technology Research Institute, Tehran (Iran, Islamic Republic of); Yousefpour, Mardali [Faculty of Materials and Metallurgical Engineering, Semnan University, Semnan, 35131-19111 (Iran, Islamic Republic of)
2017-04-15
Highlights: • The thickness of HA coatings increase by ion beam sputtering time. • The residual strain in HA structure decrease by deposition time increment. • Crystallite size of HA coatings increase by deposition time increment. • The best corrosion resistance occurs at intermediate deposition time. - Abstract: The adhesion of hydroxyapatite (HA) as a coating for the AZ91 magnesium alloy substrate can be improved by using the sputtering method and an intermediate layer, such as ZrN. In this study, HA coatings were applied on ZrN intermediate layers at a temperature of 300 °C for 180, 240, 300, 360, and 420 min by ion beam sputtering. A profilometer device was used to study the HA coating thickness, which changed from 2 μm for the 180-min deposition to 4.7 μm for 420-min deposition. The grazing incidence X-ray diffraction analysis method and the Williamson–Hall analysis were used for structural investigation. As the deposition time increased, the crystalline size increased from 50 nm to 690 nm. However, given sufficient time for stress relief on the coating structure, the lattice strain values were close to zero. Energy-dispersive X-ray spectroscopy results showed that the Ca/P ratio ranged from 1.73 to 1.81. The external indentation method was used to evaluate the coating adhesion to the substrate. The slope of curve for applied force changes versus the radius of cracks in the coating (dP/dr) varied in the range of 0.2–0.07 by the deposition time, indicating that the adhesion increased with the increase in coating thickness. The potentiodynamic polarization technique was used to study the corrosion behavior. With increasing deposition time, the corrosion potential of samples did not show a significant change, and the corrosion potential of all samples (coated and uncoated substrates) was more positive than approximately 55 mV. When the deposition time increased to 360 min, the corrosion current density decreased from 5.5 μA/cm{sup 2} to 0.33
2010-07-01
... achievable (BAT). 420.73 Section 420.73 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Subcategory § 420.73 Effluent limitations representing the degree of effluent reduction attainable by the...
Contiguous polarisation spectra of the Earth from 300 to 850 nm measured by GOME-2 onboard MetOp-A
Tilstra, L. G.; Lang, R.; Munro, R.; Aben, I.; Stammes, P.
2014-07-01
In this paper we present the first contiguous high-resolution spectra of the Earth's polarisation observed by a satellite instrument. The measurements of the Stokes fraction Q/I are performed by the spectrometer GOME-2 onboard the MetOp-A satellite. Polarisation measurements by GOME-2 are performed by onboard polarisation measurement devices (PMDs) and the high-resolution measurements discussed in this paper are taken in the special "PMD RAW" mode of operation. The spectral resolution of these PMD RAW polarisation measurements varies from 3 nm in the ultraviolet (UV) to 35 nm in the near-infrared wavelength range. We first compare measurements of the polarisation from cloud-free scenes with radiative transfer calculations for a number of cases. We find good agreement but also a spectral discrepancy at 800 nm, which we attribute to remaining imperfections in the calibration key data. Secondly, we study the polarisation of scenes with special scattering geometries that normally lead to near-zero Q/I. The GOME-2 polarisation spectra indeed show this behaviour and confirm the existence of the small discrepancy found earlier. Thirdly, we study the Earth polarisation for a variety of scenes. This provides a blueprint of Q/I over land and sea surfaces for various degrees of cloud cover. Fourthly, we compare the spectral dependence of measurements of Q/I in the UV with the generalised distribution function proposed by Schutgens and Stammes (2002) to describe the shape of the UV polarisation spectrum. The GOME-2 data confirm that these functions match the spectral behaviour captured by the GOME-2 PMD RAW mode.
International Nuclear Information System (INIS)
Pagaran, J.; Weber, M.; Burrows, J.
2009-01-01
The change of spectral decomposition of the total radiative output on various timescales of solar magnetic activity is of large interest to terrestrial and solar-stellar atmosphere studies. Starting in 2002, SCIAMACHY was the first satellite instrument to observe daily solar spectral irradiance (SSI) continuously from 230 nm (UV) to 1750 nm (near-infrared; near-IR). In order to address the question of how much UV, visible (vis), and IR spectral regions change on 27 day and 11 year timescales, we parameterize short-term SSI variations in terms of faculae brightening (Mg II index) and sunspot darkening (photometric sunspot index) proxies. Although spectral variations above 300 nm are below 1% and, therefore, well below the accuracy of absolute radiometric calibration, relative accuracy for short-term changes is shown to be in the per mill range. This enables us to derive short-term spectral irradiance variations from the UV to the near-IR. During Halloween solar storm in 2003 with a record high sunspot area, we observe a reduction of 0.3% in the near-IR to 0.5% in the vis and near-UV. This is consistent with a 0.4% reduction in total solar irradiance (TSI). Over an entire 11 year solar cycle, SSI variability covering simultaneously the UV, vis, and IR spectral regions have not been directly observed so far. Using variations of solar proxies over solar cycle 23, solar cycle spectral variations have been estimated using scaling factors that best matched short-term variations of SCIAMACHY. In the 300-400 nm region, which strongly contributes to TSI solar cycle change, a contribution of 34% is derived from SCIAMACHY observations, which is lower than the reported values from SUSIM satellite data and the empirical SATIRE model. The total UV contribution (below 400 nm) to TSI solar cycle variations is estimated to be 55%.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What are the planning requirements for receiving supplemental youth services funding? 668.420 Section 668.420 Employees' Benefits EMPLOYMENT AND... WORKFORCE INVESTMENT ACT Supplemental Youth Services § 668.420 What are the planning requirements for...
Organtini, Lindsey J.; Zhang, Sheng; Hafenstein, Susan L.; Holmes, Edward C.
2015-01-01
ABSTRACT Sylvatic carnivores, such as raccoons, have recently been recognized as important hosts in the evolution of canine parvovirus (CPV), a pandemic pathogen of domestic dogs. Although viruses from raccoons do not efficiently bind the dog transferrin receptor (TfR) or infect dog cells, a single mutation changing an aspartic acid to a glycine at capsid (VP2) position 300 in the prototype raccoon CPV allows dog cell infection. Because VP2 position 300 exhibits extensive amino acid variation among the carnivore parvoviruses, we further investigated its role in determining host range by analyzing its diversity and evolution in nature and by creating a comprehensive set of VP2 position 300 mutants in infectious clones. Notably, some position 300 residues rendered CPV noninfectious for dog, but not cat or fox, cells. Changes of adjacent residues (residues 299 and 301) were also observed often after cell culture passage in different hosts, and some of the mutations mimicked changes seen in viruses recovered from natural infections of alternative hosts, suggesting that compensatory mutations were selected to accommodate the new residue at position 300. Analysis of the TfRs of carnivore hosts used in the experimental evolution studies demonstrated that their glycosylation patterns varied, including a glycan present only on the domestic dog TfR that dictates susceptibility to parvoviruses. Overall, there were significant differences in the abilities of viruses with alternative position 300 residues to bind TfRs and infect different carnivore hosts, demonstrating that the process of infection is highly host dependent and that VP2 position 300 is a key determinant of host range. IMPORTANCE Although the emergence and pandemic spread of canine parvovirus (CPV) are well documented, the carnivore hosts and evolutionary pathways involved in its emergence remain enigmatic. We recently demonstrated that a region in the capsid structure of CPV, centered around VP2 position 300
The dynamics of femtosecond pulsed laser removal of 20 nm Ni films from an interface
Energy Technology Data Exchange (ETDEWEB)
Schrider, Keegan J.; Yalisove, Steven M. [Department of Materials Science and Engineering, University of Michigan, Ann Arbor, Michigan 48109 (United States); Torralva, Ben [Department of Atmospheric, Oceanic, and Space Sciences, University of Michigan, Ann Arbor, Michigan 48109 (United States)
2015-09-21
The dynamics of femtosecond laser removal of 20 nm Ni films on glass substrates was studied using time-resolved pump-probe microscopy. 20 nm thin films exhibit removal at two distinct threshold fluences, removal of the top 7 nm of Ni above 0.14 J/cm{sup 2}, and removal of the entire 20 nm film above 0.36 J/cm{sup 2}. Previous work shows the top 7 nm is removed through liquid spallation, after irradiation the Ni melts and rapidly expands leading to tensile stress and cavitation within the Ni film. This work shows that above 0.36 J/cm{sup 2} the 20 nm film is removed in two distinct layers, 7 nm and 13 nm thick. The top 7 nm layer reaches a speed 500% faster than the bottom 13 nm layer at the same absorbed fluence, 500–2000 m/s and 300–700 m/s in the fluence ranges studied. Significantly different velocities for the top 7 nm layer and bottom 13 nm layer indicate removal from an interface occurs by a different physical mechanism. The method of measuring film displacement from the development of Newton's rings was refined so it could be shown that the 13 nm layer separates from the substrate within 70 ps and accelerates to its final velocity within several hundred picoseconds. We propose that removal of the bottom 13 nm is consistent with heterogeneous nucleation and growth of vapor at the Ni-glass interface, but that the rapid separation and acceleration of the 13 nm layer from the Ni-glass interface requires consideration of exotic phases of Ni after excitation.
10 CFR 420.13 - Annual State applications and amendments to State plans.
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Annual State applications and amendments to State plans. 420.13 Section 420.13 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION STATE ENERGY PROGRAM Formula..., renewable energy, and alternative transportation fuel goals to be achieved, including wherever practicable...
Energy Technology Data Exchange (ETDEWEB)
Silva, Maycon J.; Spinelli, Rafaela O.; Moreno, Rogerio M.B.; Mattoso, Luiz H.C.; Martins, Maria Alice, E-mail: maria-alice.martins@embrapa.br [Embrapa Instrumentacao/LNNA, Sao Carlos, SP (Brazil); Scaloppi Junior, Erivaldo J. [Instituto Agronomico (IAC), Votuporanga, SP (Brazil). Centro de Seringueira e Sistemas Agroflorestais; Goncalves, Paulo de S. [Instituto Agronomico (IAC), Campinas, SP (Brazil)
2015-07-01
The natural rubber (NR) is present in more than 2500 species of plants, being the Hevea brasiliensis the most commercially exploited. It is a raw material of great importance to the Brazilian economy, but the country faces a production's deficit, having to import about 60% of its consumption. In this work , the latex obtained from rubber tree of new clones of PB series 300 (PB 311, PB 312, PB 314 , PB 326, PB 346 and PB 350 ) and RRIM 600 (control) were characterized by dry rubber content (DRC), total solids content, distribution of particle size, Zeta potential, thermogravimetry, differential scanning calorimetry, infrared in the spectroscopy (FTIR), nuclear magnetic resonance (NMR) and technological properties. The DRC values ranged from 33% to 40%, and total solids of 38% to 44%. All of the clones showed average particle diameter between 180.0 to 192.1 nm, excluding clones PB 326 and PB 346 with 150.0 nm and 157.9 nm, respectively. The NMR spectra and FTIR showed that the structure of the natural rubber from all clones studied is cis -1,4- polyisoprene. Natural rubber from the new clones showed good thermal stability up to 285 °C and glass transition temperature of -64 °C. (author)
Advances in 750 nm VECSELs (Conference Presentation)
Saarinen, Esa J.; Ranta, Sanna; Lyytikäinen, Jari; Saarela, Antti; Sirbu, Alexei; Iakovlev, Vladimir; Kapon, Eli; Guina, Mircea
2017-03-01
Lasers operating in the transmission window of tissue at wavelengths between 700 and 800 nm are needed in numerous medical and biomedical applications, including photodynamic therapy and fluorescence microscopy. However, the performance of diode lasers in this spectral range is limited by the lack of appropriate compound semiconductors. Here, we review our recent research on 750 nm VECSELs. Two approaches to reaching the 750 nm wavelength will be discussed. The first approach relies on intra-cavity frequency doubling a wafer-fused 1500 nm VECSEL. The VECSEL gain chip comprises a GaAs-based DBR and an InP-based gain section, which allows for optical pumping with low-cost commercial diodes at 980 nm. With this scheme we have achieved watt-level output powers and tuning of the laser wavelength over a 40 nm band at around 750 nm. The second approach is direct emission at 750 nm using the AlGaAs/GaAs material system. In this approach visible wavelengths are required for optical pumping. However, the consequent higher costs compared to pumping at 980 nm are mitigated by the more compact laser setup and prospects of doubling the frequency to the ultraviolet range.
300 Junior Novel Anticipation Guides
Polette, Nancy
2006-01-01
In this book, the author has created reproducible anticipation guides to 300 popular junior novels (grades 4-8) ranging from classics like Ben and Me and Cricket in Times Square to the current award winner, Kira, Kira. The book consists of 300 reproducible sets of open ended values questions to pique the interest of readers. Librarians and…
On-chip measurements of Brownian relaxation of magnetic beads with diameters from 10 nm to 250 nm
DEFF Research Database (Denmark)
Østerberg, Frederik Westergaard; Rizzi, Giovanni; Hansen, Mikkel Fougt
2013-01-01
We demonstrate the use of planar Hall effect magnetoresistive sensors for AC susceptibility measurements of magnetic beads with frequencies ranging from DC to 1 MHz. This wide frequency range allows for measuring Brownian relaxation of magnetic beads with diameters ranging from 10 nm to 250 nm....... Brownian relaxation is measured for six different magnetic bead types and their hydrodynamic diameters are determined. The hydrodynamic diameters are found to be within 40% of the nominal bead diameters. We discuss the applicability of the different bead types for volume-based biosensing with respect...... to sedimentation, magnetic trapping, and signal per bead. Among the investigated beads, we conclude that the beads with a nominal diameter of 80 nm are best suited for future on-chip volume-based biosensing experiments using planar Hall effect sensors....
Energy Technology Data Exchange (ETDEWEB)
Ibnaouf, K.H., E-mail: kheo90@gmail.com [Al Imam Mohammad Ibn Saud Islamic University (IMSIU), Physics Department, College of Science, P.O. Box 90905, Riyadh 11623 (Saudi Arabia); Prasad, Saradh; Al Salhi, M.S.; Hamdan, A. [Department of Physics and Astronomy, College of Science, King Saud University, P.O. Box 2455, Riyadh 11451 (Saudi Arabia); Research Chair for Laser Diagnosis of Cancer, King Saud University (Saudi Arabia); Zaman, M.B. [CEREM, College of Engineering, King Saud University (Saudi Arabia); Advanced Medical Research Institute of Canada, Sudbury (Canada); El Mir, L. [Al Imam Mohammad Ibn Saud Islamic University (IMSIU), Physics Department, College of Science, P.O. Box 90905, Riyadh 11623 (Saudi Arabia)
2014-05-01
The spectral properties of 5 nm size of bare CdSe and (CdSe)ZnS core–shell quantum dots (QDs) have been recorded and investigated under different solvent environments with different polarities and different concentrations. The results showed that the spectral profile of absorption did not change for both quantum dots in different solvents under a wide range of concentrations. On the other hand, the photoluminescence (PL) spectra of (CdSe)ZnS core–shell quantum dots in non-polar solvents showed two bands; the primary around 420 nm and the secondary around 620 nm. In contrast, the PL spectra of bare CdSe in non-polar solvents, showed a very strong band around 590 nm, with a total absence of the primary wavelength band at 420 nm. Under high polar solvent environments, bare CdSe showed a new peak around 420 nm, which was totally absent in non-polar solvent. Therefore, the solvent plays an important role in the PL spectra of bare CdSe and (CdSe)ZnS core–shell quantum dots.
Huiszoon, B.; Jonker, R.J.W.; Bennekom, van P.K.; Khoe, G.D.; Waardt, de H.
2005-01-01
This paper presents successful 20 and 40 Gb/s potentially low-cost transmission experiments using 1310 nm directly modulated distributed feedback lasers (DMLs) in the very-short- to medium-range distances. This paper will recommend operating conditions for error-free transmission at these bit rates
Hönes, Katharina; Stangl, Felix; Sift, Michael; Hessling, Martin
2015-07-01
The Ulm University of Applied Sciences is investigating a technique using visible optical radiation (405 nm and 460 nm) to inactivate health-hazardous bacteria in water. A conceivable application could be point-of-use disinfection implementations in developing countries for safe drinking water supply. Another possible application field could be to provide sterile water in medical institutions like hospitals or dental surgeries where contaminated pipework or long-term disuse often results in higher germ concentrations. Optical radiation for disinfection is presently mostly used in UV wavelength ranges but the possibility of bacterial inactivation with visible light was so far generally disregarded. One of the advantages of visible light is, that instead of mercury arc lamps, light emitting diodes could be used, which are commercially available and therefore cost-efficient concerning the visible light spectrum. Furthermore they inherit a considerable longer life span than UV-C LEDs and are non-hazardous in contrast to mercury arc lamps. Above all there are specific germs, like Bacillus subtilis, which show an inactivation resistance to UV-C wavelengths. Due to the totally different deactivation mechanism even higher disinfection rates are reached, compared to Escherichia coli as a standard laboratory germ. By 460 nm a reduction of three log-levels appeared with Bacillus subtilis and a half log-level with Escherichia coli both at a dose of about 300 J/cm². By the more efficient wavelength of 405 nm four and a half log-levels are reached with Bacillus subtilis and one and a half log-level with Escherichia coli also both at a dose of about 300 J/cm². In addition the employed optical setup, which delivered a homogeneous illumination and skirts the need of a stirring technique to compensate irregularities, was an important improvement compared to previous published setups. Evaluated by optical simulation in ZEMAX® the designed optical element provided proven
International Nuclear Information System (INIS)
Il'chenko, S N; Kostin, Yu O; Kukushkin, I A; Ladugin, M A; Lapin, P I; Lobintsov, A A; Marmalyuk, Aleksandr A; Yakubovich, S D
2011-01-01
We have studied superluminescent diodes (SLDs) and semiconductor optical amplifiers (SOAs) based on an (Al x Ga 1-x )As/GaAs single quantum well structure with an Al content x ∼ 0.1 in a 10-nm-thick active layer. Depending on the length of the active channel, the single-mode fibre coupled cw output power of the SLDs is 1 to 30 mW at a spectral width of about 50 nm. The width of the optical gain band in the active channel exceeds 40 nm. Preliminary operating life tests have demonstrated that the devices are sufficiently reliable. (lasers)
Electrical resistivity anisotropy of osmium single crystals in the range 4,2 to 300 K
International Nuclear Information System (INIS)
Volkenshtejn, N.V.; Dyakina, V.P.; Dyakin, V.V.; Startsev, V.E.; Cherepanov, V.I.; Azhazha, V.M.; Kovtun, G.P.; Elenskij, V.A.; AN Ukrainskoj SSR, Kharkov. Fiziko-Tekhnicheskij Inst.)
1981-01-01
Electrical resistivity and size effect anisotropies of pure osmium single crystals with rhosub(273.2/rhosub(4.2)2600 were investigated in the temperature range 4.2 to 300 K. It is found that the electrical resistivity anisotropy (αT)=rhosub( )/rhosub( ) is less than unit and has a maximum at T approximately 50 K; the size effect anisotropy (rho1)sub( )/(rho1)sub( ) is 0.39+-0.07 at T=4.2 K; at liquid helium temperature, the dependence of thin samples is controlled by the scattering of conduction electrons by the surface of the sample. The results are discussed for the specific shape of the Fermi surface geometry of osmium with an account for the scattering processes of conduction electrons by phonons and by surface of the sample
Continuous-wave laser at 440 nm based on frequency-doubled diode-pumped Nd:GdVO(4) crystal.
Castaing, Marc; Balembois, François; Georges, Patrick
2008-09-01
We present for the first time, to the best of our knowledge, a frequency-doubled Nd:GdVO(4) laser operating in a cw on the pure three-level laser line at 880 nm. We obtained 300 mW at 440 nm for 23 W of incident pump power at 808 nm. Moreover, with a 25% output coupler we obtained a cw power of 1.9 W at the fundamental wavelength at 880 nm.
Propagation of long-range surface plasmon polaritons in photonic band gap structures
DEFF Research Database (Denmark)
Boltasseva, Alexandra; Søndergaard, Thomas; Nikolajsen, Thomas
2005-01-01
We study the interaction of long-range surface plasmon polaritons (LR-SPPs), excited at telecommunication wavelengths, with photonic crystals (PCs) formed by periodic arrays of gold bumps that are arranged in a triangular lattice and placed symmetrically on both sides of a thin gold fil embedded...... in polymer. Radiation is delivered to and from the PC structures with the help of LR-SPP guides that consist of 8 mm wide and 15 nm thick gold stripes attached to wide film sections (of the same thickness) covered with bumps (diameter ~300 nm, height up to 150 nm on each side of the film). We investigate......, is rather weak, so that the photonic bandgap effect might be expected to take place only for some particular propagation directions. Preliminary experiments on LR-SPP bending and splitting at large angles are reported, and further research directions are discussed....
Damage Accumulation and Recovery in Gold-Ion-Irradiated Barium Titanate
Energy Technology Data Exchange (ETDEWEB)
Jiang, Weilin; Weber, William J.; Thevuthasan, Suntharampillai
2001-06-04
Single-crystal barium titanate (BaTiO) wafers were irradiated 60? off the surface normal at 170 and 300 K using 1.0 MeV Au ions over a fluence range from 0.03 to 0.19 ions/nm. Disorder on both the Ba and Ti sublattices has been studied in situ using Rutherford backscattering spectrometry along the <110> axial direction. At these irradiation temperatures, the temperature dependence of disordering is small. The dose for amorphization under these conditions is on the order of 0.5 dpa, which is 50% of that required to amorphize SrTiO under similar conditions. At low damage levels, recovery of disorder is observed at room temperature, suggesting at least one lower temperature recovery stage. For more highly damaged states, two distinct recovery stages have been identified between 420 and 570 K and between 720 and 870 K. The recovery stage between 420 and 570 K is associated with the critical temperature for full amorphization ({approx}550 K) in BaTiO. The higher temperature recovery stage is most likely associated with epitaxial recrystallization.
48 CFR 9904.420-40 - Fundamental requirement.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Fundamental requirement..., OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.420-40 Fundamental requirement. (a) The basic unit for...
High power diode lasers emitting from 639 nm to 690 nm
Bao, L.; Grimshaw, M.; DeVito, M.; Kanskar, M.; Dong, W.; Guan, X.; Zhang, S.; Patterson, J.; Dickerson, P.; Kennedy, K.; Li, S.; Haden, J.; Martinsen, R.
2014-03-01
There is increasing market demand for high power reliable red lasers for display and cinema applications. Due to the fundamental material system limit at this wavelength range, red diode lasers have lower efficiency and are more temperature sensitive, compared to 790-980 nm diode lasers. In terms of reliability, red lasers are also more sensitive to catastrophic optical mirror damage (COMD) due to the higher photon energy. Thus developing higher power-reliable red lasers is very challenging. This paper will present nLIGHT's released red products from 639 nm to 690nm, with established high performance and long-term reliability. These single emitter diode lasers can work as stand-alone singleemitter units or efficiently integrate into our compact, passively-cooled Pearl™ fiber-coupled module architectures for higher output power and improved reliability. In order to further improve power and reliability, new chip optimizations have been focused on improving epitaxial design/growth, chip configuration/processing and optical facet passivation. Initial optimization has demonstrated promising results for 639 nm diode lasers to be reliably rated at 1.5 W and 690nm diode lasers to be reliably rated at 4.0 W. Accelerated life-test has started and further design optimization are underway.
48 CFR 9904.420-60 - Illustrations.
2010-10-01
... Segment X. The company and the contracting officer agree that the nature of the business activity of... direct charge does not meet with the requirements of 9904.420-50(a). (b) Company B has five segments. The company undertakes an IR&D project which is part of IR&D plans of segments X, Y, and Z, and will be of...
2010-07-01
... concerning photographs for news, advertising or commercial purposes? 102-74.420 Section 102-74.420 Public..., Advertising Or Commercial Purposes § 102-74.420 What is the policy concerning photographs for news, advertising or commercial purposes? Except where security regulations, rules, orders, or directives apply or a...
Three hundred patients treated with ultrapulsed 980 nm diode laser for skin disorders
Directory of Open Access Journals (Sweden)
Uwe Wollina
2016-01-01
Full Text Available The use of lasers in skin diseases is quite common. In contrast to other laser types, medical literature about 980 nm ultrapulsed diode laser is sparse in dermatology. Herein, we report the use of ultrapulsed diode 980 nm laser in 300 patients with vascular lesions, cysts and pseudocysts, infectious disease, and malignant tumors. This laser is a versatile tool with excellent safety and efficacy in the hands of the experienced user.
Three Hundred Patients Treated with Ultrapulsed 980 nm Diode Laser for Skin Disorders
Wollina, Uwe
2016-01-01
The use of lasers in skin diseases is quite common. In contrast to other laser types, medical literature about 980 nm ultrapulsed diode laser is sparse in dermatology. Herein, we report the use of ultrapulsed diode 980 nm laser in 300 patients with vascular lesions, cysts and pseudocysts, infectious disease, and malignant tumors. This laser is a versatile tool with excellent safety and efficacy in the hands of the experienced user. PMID:27688445
International Nuclear Information System (INIS)
Tuveson, R.W.; Jonas, R.B.
1979-01-01
Stationary cells of isogenic pairs of Escherichia coli K12 strains presumably differing only in the recA function, were inactivated with near-UV (300-400 nm) radiation. Based on near-UV inactivation kinetics, the strains can be divided into two discrete categories in which near-UV sensitivity does not necessarily correlate with far-UV sensitivity conferred by two different recA alleles. Lack of overlap between near-UV and far-UV (recA) sensitivity can be explained by assuming that a different chromosomal gene (nur) controls near-UV sensitivity. Support for this hypothesis came from a mating experiment in which four selected recombinants, isogenic with respect to auxotrophic markers, were identified exhibiting all four possible combinations of far-UV (recA1 vs recA + ) and near-UV sensitivity (nur vs nur + ). Transduction with phase P1 showed that introduction of the recA1 allele into a recA + recipient did not affect the near-UV sensitivity of the recipient. Additional matings together with transduction experiments suggested that the nur gene is located at a position on the E. coli linkage map clearly separable from recA (minute 58). (author)
41 CFR 301-10.420 - When may I use a taxi, shuttle service or other courtesy transportation?
2010-07-01
..., shuttle service or other courtesy transportation? 301-10.420 Section 301-10.420 Public Contracts and... Courtesy Transportation § 301-10.420 When may I use a taxi, shuttle service or other courtesy... other courtesy transportation (if charges result), in the following manner: (1) At your official station...
2010-04-01
... Administration of FHWA Planning and Research Funds § 420.121 What other requirements apply to the administration... 23 Highways 1 2010-04-01 2010-04-01 false What other requirements apply to the administration of FHWA planning and research funds? 420.121 Section 420.121 Highways FEDERAL HIGHWAY ADMINISTRATION...
Li, Q.; Jia, Z. X.; Weng, H. Z.; Li, Z. R.; Yang, Y. D.; Xiao, J. L.; Chen, S. W.; Huang, Y. Z.; Qin, W. P.; Qin, G. S.
2018-05-01
We demonstrate broadband multi-wavelength Brillouin lasers with an operating wavelength range of 1500–1600 nm and a frequency separation of ~9.28 GHz generated by four-wave mixing in a dual wavelength Brillouin fiber laser cavity. By using one continuous-wave laser as the pump source, multi-wavelength Brillouin lasers with an operating wavelength range of 1554–1574 nm were generated via cascaded Brillouin scattering and four-wave mixing. Interestingly, when pumped by two continuous-wave lasers with an appropriate frequency separation, the operating wavelength range of the multi-wavelength Brillouin lasers was increased to 1500–1600 nm due to cavity-enhanced cascaded four-wave mixing among the frequency components generated by two pump lasers in the dual wavelength Brillouin laser cavity.
Electron multibeam technology for mask and wafer writing at 0.1 nm address grid
Platzgummer, Elmar; Klein, Christof; Loeschner, Hans
2013-07-01
IMS Nanofabrication realized a 50 keV electron multibeam proof-of-concept (POC) tool confirming writing principles with 0.1 nm address grid and lithography performance capability. The POC system achieves the predicted 5 nm 1 sigma blur across the 82 μm×82 μm array of 512×512 (262,144) programmable 20 nm beams. 24-nm half pitch (HP) has been demonstrated and complex patterns have been written in scanning stripe exposure mode. The first production worthy system for the 11-nm HP mask node is scheduled for 2014 (Alpha), 2015 (Beta), and first-generation high-volume manufacturing multibeam mask writer (MBMW) tools in 2016. In these MBMW systems the max beam current through the column is 1 μA. The new architecture has also the potential for 1× mask (master template) writing. Substantial further developments are needed for maskless e-beam direct write (EBDW) applications as a beam current of >2 mA is needed to achieve 100 wafer per hour industrial targets for 300 mm wafer size. Necessary productivity enhancements of more than three orders of magnitude are only possible by shrinking the multibeam optics such that 50 to 100 subcolumns can be placed on the area of a 300 mm wafer and by clustering 10 to 20 multicolumn tools. An overview of current EBDW efforts is provided.
In this study, we developed a nondestructive method for discriminating viable cucumber (Cucumis sativus) seeds based on hyperspectral fluorescence imaging. The fluorescence spectra of cucumber seeds in the 420–700 nm range were extracted from hyperspectral fluorescence images obtained using 365 nm u...
2010-04-01
... and Research Funds § 420.111 What are the documentation requirements for use of FHWA planning and... 23 Highways 1 2010-04-01 2010-04-01 false What are the documentation requirements for use of FHWA planning and research funds? 420.111 Section 420.111 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF...
Treatment of experimental colitis in mice with LMP-420, an inhibitor of TNF transcription
Directory of Open Access Journals (Sweden)
Cianciolo George
2008-03-01
Full Text Available Abstract Background LMP-420 is a boronic acid-containing purine nucleoside analogue that transcriptionally inhibits TNF production but is non-cytotoxic to TNF-producing cells. Methods This study investigated the efficacy of LMP-420 as an anti-inflammatory agent in acute and chronic colitis induced by oral administration of dextran sulfate sodium (DSS to mice and in chronic colitis following piroxicam administration to IL-10-deficient mice. The severity of colon inflammation was assessed histologically. TNF levels were measured by enzyme immunoassay. Results Administration of DSS for 7 days resulted in severe acute colitis that was associated with a marked increase in stool and colon tissue TNF levels. Initiation of therapy with intraperitoneal (i.p. LMP-420 on day 4 of DSS exposure decreased colonic TNF to near normal levels on day 7. However, neither i.p. nor oral treatment with LMP-420 affected the development or severity of acute DSS colitis. Initiation of LMP-420 therapy after 3 cycles of DSS administration to establish chronic colitis also had no effect on the severity of chronic colitis. Analysis of colonic TNF combined with longitudinal analysis of TNF and TNF receptor (TNF-RII levels in stool during the development of chronic DSS colitis demonstrated that the initially elevated colonic TNF levels returned to normal despite intense on-going inflammation in mice with chronic colitis. RAG-2-/- mice deficient in T and B cells also developed severe ongoing colitis in response to 3 cycles of DSS, but showed marked differences vs. wild type mice in stool TNF and TNF-RII in response to DSS exposure. Systemic and oral LMP-420 treatment for 16 days decreased colonic TNF levels in IL-10-deficient mice with chronic colitis, with a trend to decreased histologic inflammation for oral LMP-420. Conclusion These studies demonstrate that short-term treatment with a transcriptional inhibitor of TNF production can decrease systemic and local colonic levels
40 CFR 86.420-78 - Engine families.
2010-07-01
...) Rotary families. To be classed in the same engine family, rotary combustion cycle engines must be... characteristics. (e) At the manufacturer's option, rotary combustion cycle engines identical in all the respects... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Engine families. 86.420-78 Section 86...
20 CFR 655.420 - Request for hearing.
2010-04-01
... FOREIGN WORKERS IN THE UNITED STATES Enforcement of H-1A Attestations § 655.420 Request for hearing. (a) Any interested party desiring to request an administrative hearing on a determination issued pursuant... address stated in the notice of determination. (b) An interested party may request a hearing in the...
Facile photoreduction of graphene oxide by an NAD(P)H model: Hantzsch 1,4-dihydropyridine.
Zhang, Hui-Hui; Liu, Qiang; Feng, Ke; Chen, Bin; Tung, Chen-Ho; Wu, Li-Zhu
2012-05-29
To make "clean" reduced GO sheets in high quality and in large scale, a natural reduced nicotinamine adenine dinucleotide NAD(P)H model, Hantzsch 1,4-dihydropyridine (HEH), is used as a mild organic photoreductant in this work. Benefiting from the intense absorption of HEH in the range of 300-420 nm, the graphene oxide (GO) can be readily reduced by HEH under UV light irradiation (λ > 320 nm) to afford single or few-layer reduced graphene oxide at room temperature. Studies on reduction extent reveal that both irradiation time and concentration ratio of HEH to GO are important for effective reduction of GO under UV light. The as-prepared photochemically reduced graphene oxide (PRGO) dispersion is stable without the need for any polymeric or surfactant stabilizers. Simply by extraction treatment, the "clean" PRGO sheets can be obtained in large quantities, and its conductivity approaches to 4680 S·m(-1) that is the highest value reported by photochemical approaches so far.
Repair of 313-nm induced lesions and photoprotection in yeast Candida guilliermondii
International Nuclear Information System (INIS)
Fraikin, G.Y.; Pospelov, M.E.; Rubin, L.B.
1977-01-01
The present communication is concerned with the effects of near-UV radiation (300-380 nm) on yeast Candida guilliermondii. It was found that certain doses of 313 nm irradiation caused inactivation of the yeast which was exhibited in a way different from the lethal action of far-UV radiation. It was also found that the cells inactivated by 313 nm are capable of recovering vitality, if incubated for some time in a non-nutrient medium. The yeast inactivated by far-UV radiation also proved to be capable of recovering, though to a lesser degree. Both 334 nm radiation and non-lethal doses at 313 nm induced the photoprotective effect against far-UV damage. The effect was exhibited if there was a certain time interval (2-4 h) between the exposures to photoprotective light and subsequent far-UV radiation. Within this time interval the extent of photoprotection was dependent on temperature. (author)
Investigation of EBT2 and EBT3 films for proton dosimetry in the 4-20 MeV energy range.
Reinhardt, S; Würl, M; Greubel, C; Humble, N; Wilkens, J J; Hillbrand, M; Mairani, A; Assmann, W; Parodi, K
2015-03-01
Radiochromic films such as Gafchromic EBT2 or EBT3 films are widely used for dose determination in radiation therapy because they offer a superior spatial resolution compared to any other digital dosimetric 2D detector array. The possibility to detect steep dose gradients is not only attractive for intensity-modulated radiation therapy with photons but also for intensity-modulated proton therapy. Their characteristic dose rate-independent response makes radiochromic films also attractive for dose determination in cell irradiation experiments using laser-driven ion accelerators, which are currently being investigated as future medical ion accelerators. However, when using these films in ion beams, the energy-dependent dose response in the vicinity of the Bragg peak has to be considered. In this work, the response of these films for low-energy protons is investigated. To allow for reproducible and background-free irradiation conditions, the films were exposed to mono-energetic protons from an electrostatic accelerator, in the 4-20 MeV energy range. For comparison, irradiation with clinical photons was also performed. It turned out that in general, EBT2 and EBT3 films show a comparable performance. For example, dose-response curves for photons and protons with energies as low as 11 MeV show almost no differences. However, corrections are required for proton energies below 11 MeV. Care has to be taken when correction factors are related to an average LET from depth-dose measurements, because only the dose-averaged LET yields similar results as obtained in mono-energetic measurements.
Mooser, Matthias; Burri, Christian; Stoller, Markus; Luggen, David; Peyer, Michael; Arnold, Patrik; Meier, Christoph; Považay, Boris
2017-07-01
Ocular optical coherence tomography at the wavelengths ranges of 850 and 1060 nm have been integrated with a confocal scanning laser ophthalmoscope eye-tracker as a clinical commercial-class system. Collinear optics enables an exact overlap of the different channels to produce precisely overlapping depth-scans for evaluating the similarities and differences between the wavelengths to extract additional physiologic information. A reliable segmentation algorithm utilizing Graphcuts has been implemented and applied to automatically extract retinal and choroidal shape in cross-sections and volumes. The device has been tested in normals and pathologies including a cross-sectional and longitudinal study of myopia progress and control with a duplicate instrument in Asian children.
Laser hypersensitisation using 266nm light
DEFF Research Database (Denmark)
Sørensen, Henrik Rokkjær; Canning, J.; Kristensen, Martin
2005-01-01
UV hypersensitisation using CW 266 nm light on hydrogenated Ge-doped fibre is reported. The optimum sensitisation fluence is found to be in the range of 5 to 10 kJ/cm2, coinciding with previous results obtained using 355 nm light, indicating the same end-process used in the photochemical reaction...
Energy Technology Data Exchange (ETDEWEB)
Binetti, Simona [Department of Materials Science and Milano-Bicocca Solar Energy Research Center (MIB-SOLAR), University of Milano-Bicocca, Via Cozzi 55, 20125 Milano (Italy); Le Donne, Alessia, E-mail: alessia.ledonne@mater.unimib.it [Department of Materials Science and Milano-Bicocca Solar Energy Research Center (MIB-SOLAR), University of Milano-Bicocca, Via Cozzi 55, 20125 Milano (Italy); Rolfi, Andrea [Department of Materials Science and Milano-Bicocca Solar Energy Research Center (MIB-SOLAR), University of Milano-Bicocca, Via Cozzi 55, 20125 Milano (Italy); Jäggi, Beat; Neuenschwander, Beat [Bern University of Applied Sciences, Engineering and Information Technology, Institute for Applied Laser, Photonics and Surface Technologies ALPS, Pestalozzistrasse 20, CH-3400 Burgdorf (Switzerland); Busto, Chiara [ENI Spa, Via Giacomo Fauser, 4, 28100 Novara (Italy); Frigeri, Cesare [CNR-IMEM Institute, Parco Area Delle Scienze 37/A, Fontanini, 43010 Parma (Italy); Scorticati, Davide; Longoni, Luca; Pellegrino, Sergio [Laserpoint Srl, Via Della Burrona 51, 20090 Vimodrone, Milano (Italy)
2016-05-15
Highlights: • Self-organized surface structures were produced by picosecond laser pulses on mc-Si. • Three laser wavelengths were used which effectively reduce Si reflectivity up to 8%. • The subsurface damage induced by the three lasers was studied in detail. • μ-Raman, PL and TEM proved that UV laser provides the lowest subsurface damage. • UV laser induced damage is located above the depletion region of the p–n junction. - Abstract: Self-organized surface structures were produced by picosecond laser pulses on multi-crystalline silicon for photovoltaic applications. Three different laser wavelengths were employed (i.e. 1064 nm, 532 nm and 355 nm) and the resulting morphologies were observed to effectively reduce the reflectivity of the samples after laser irradiation. Besides, a comparative study of the laser induced subsurface damage generated by the three different wavelengths was performed by confocal micro-Raman, photoluminescence and transmission electron microscopy. The results of both the structural and optical characterization showed that the mc-Si texturing performed with the laser at 355 nm provides surface reflectivity between 11% and 8% over the spectral range from 400 nm to 1 μm, while inducing the lowest subsurface damage, located above the depletion region of the p–n junction.
The reaction π+ + d = 2p in the 300 MeV range
International Nuclear Information System (INIS)
Braun, M.A.; Suslov, V.M.; Kallies, W.
1977-01-01
The inelastic pion deuteron scattering is studied for pion impulses in the centre-of-mass system at 50 to 300 MeV/c and polarization effects in the reaction p + p = π + + d for the case of polarized protons are analyzed too. A detailed comparison with experiments is given. (author)
Wide modulation bandwidth terahertz detection in 130 nm CMOS technology
Nahar, Shamsun; Shafee, Marwah; Blin, Stéphane; Pénarier, Annick; Nouvel, Philippe; Coquillat, Dominique; Safwa, Amr M. E.; Knap, Wojciech; Hella, Mona M.
2016-11-01
Design, manufacturing and measurements results for silicon plasma wave transistors based wireless communication wideband receivers operating at 300 GHz carrier frequency are presented. We show the possibility of Si-CMOS based integrated circuits, in which by: (i) specific physics based plasma wave transistor design allowing impedance matching to the antenna and the amplifier, (ii) engineering the shape of the patch antenna through a stacked resonator approach and (iii) applying bandwidth enhancement strategies to the design of integrated broadband amplifier, we achieve an integrated circuit of the 300 GHz carrier frequency receiver for wireless wideband operation up to/over 10 GHz. This is, to the best of our knowledge, the first demonstration of low cost 130 nm Si-CMOS technology, plasma wave transistors based fast/wideband integrated receiver operating at 300 GHz atmospheric window. These results pave the way towards future large scale (cost effective) silicon technology based terahertz wireless communication receivers.
Use of the harmonic blade in face lifting: a report based on 420 operations.
Firmin, Francoise O; Marchac, Alexandre C; Lotz, Nicholas C
2009-07-01
An important concern for patients who undergo a face lift is the recovery time. Use of the Harmonic blade (Ethicon Endo-Surgery, Cincinnati, Ohio) for surgical dissection and hemostasis in face lift has improved recovery time and greatly reduced the risk of hematomas in the senior author's practice. A retrospective study evaluated the complication rate using the Harmonic blade in face and neck lifting (n = 420) between 2001 and 2007. A prospective study was conducted on 100 cases (October of 2006 to May of 2008) to evaluate the mean operative time, drainage, and recovery time. Results at day 8 were evaluated using on a scale of 1 to 4 (1 = nil tracking to 4 = marked tracking). The complication rate in 420 cases was low and decreased with experience. Complications included hematoma (n = 5), temporary facial paresis (n = 4), submental lipolysis (n = 3), skin perforation (n = 1), minor skin burn (n = 1), skin necrosis (n = 0), and hair loss (n = 0). Mean operative time for face lift with a superficial musculoaponeurotic system procedure and anterior platysmaplasty was 180 minutes (range, 140 to 210 minutes). Drainage at day 1 was 20 cc (range, 0 to 30 cc). Average return to normal social life was by day 8 (range, 5 to 20 days). Results at day 8 were graded 1 for edema and ecchymosis. The beneficial effects of the Harmonic blade are obvious objectively and subjectively to both the surgeon and the patients. Understanding the key technical details involved with its use will improve the learning curve for the surgeon as this technology becomes an asset in face lifting.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Are there any special requirements for enrollment related to the Military Selective Service Act? 670.420 Section 670.420 Employees' Benefits... INVESTMENT ACT Recruitment, Eligibility, Screening, Selection and Assignment, and Enrollment § 670.420 Are...
Gain optimization and saturation of the Xe III 109 nm auger laser
International Nuclear Information System (INIS)
Macklin, J.J.; Sher, M.H.; Barty, C.P.J.; King, D.A.; Yin, G.Y.; Harris, S.E.; Young, J.F.
1988-01-01
The authors describe the construction and operation of a 109 nm, photoionization-pumped, single-pass laser in Xe III. The laser is pumped by soft x-rays emitted from a laser-produced plasma in a traveling-wave geometry. Using a 3.5 J, 300 psec, 1064 nm laser pump pulse, they measure a small-signal gain coefficient of 4.4 cm -1 and a total small signal gain of exp(40). The laser is fully saturated and produces an output energy of 20 μJ in a beam with 10 mrad divergence
2010-04-01
... RESEARCH PROGRAM ADMINISTRATION Administration of FHWA Planning and Research Funds § 420.107 What is the... 23 Highways 1 2010-04-01 2010-04-01 false What is the minimum required expenditure of State planning and research funds for research development and technology transfer? 420.107 Section 420.107...
Performance of diethylene glycol-based particle counters in the sub-3 nm size range
Wimmer, D; Franchin, A; Kangasluoma, J; Kreissl, F; Kürten, A; Kupc, A; Metzger, A; Mikkilä, J; Petäjä, J; Riccobono, F; Vanhanen, J; Kulmala, M; Curtius, J
2013-01-01
When studying new particle formation, the uncertainty in determining the "true" nucleation rate is considerably reduced when using condensation particle counters (CPCs) capable of measuring concentrations of aerosol particles at sizes close to or even at the critical cluster size (1–2 nm). Recently, CPCs able to reliably detect particles below 2 nm in size and even close to 1 nm became available. Using these instruments, the corrections needed for calculating nucleation rates are substantially reduced compared to scaling the observed formation rate to the nucleation rate at the critical cluster size. However, this improved instrumentation requires a careful characterization of their cut-off size and the shape of the detection efficiency curve because relatively small shifts in the cut-off size can translate into larger relative errors when measuring particles close to the cut-off size. Here we describe the development of two continuous-flow CPCs using diethylene glycol (DEG) as the working fluid. The desig...
Project W-420 stack monitoring system upgrades
International Nuclear Information System (INIS)
CARPENTER, K.E.
1999-01-01
This project will execute the design, procurement, construction, startup, and turnover activities for upgrades to the stack monitoring system on selected Tank Waste Remediation System (TWRS) ventilation systems. In this plan, the technical, schedule, and cost baselines are identified, and the roles and responsibilities of project participants are defined for managing the Stack Monitoring System Upgrades, Project W-420
34 CFR 300.300 - Parental consent.
2010-07-01
...; and (iii) Is not required to convene an IEP Team meeting or develop an IEP under §§ 300.320 and 300... related services; and (iv) Is not required to convene an IEP Team meeting or develop an IEP under §§ 300...
Microeconomics of 300-mm process module control
Monahan, Kevin M.; Chatterjee, Arun K.; Falessi, Georges; Levy, Ady; Stoller, Meryl D.
2001-08-01
Simple microeconomic models that directly link metrology, yield, and profitability are rare or non-existent. In this work, we validate and apply such a model. Using a small number of input parameters, we explain current yield management practices in 200 mm factories. The model is then used to extrapolate requirements for 300 mm factories, including the impact of simultaneous technology transitions to 130nm lithography and integrated metrology. To support our conclusions, we use examples relevant to factory-wide photo module control.
Zhang, Qiang; Li, Weiyang; Moran, Christine; Zeng, Jie; Chen, Jingyi; Wen, Long-Ping; Xia, Younan
2010-08-18
Silver nanocubes with edge lengths controllable in the range of 30-200 nm were synthesized using an approach based on seeded growth. The keys to the success of this synthesis are the use of single-crystal Ag seeds to direct the growth and the use of AgNO(3) as a precursor to elemental Ag, where the byproduct HNO(3) can block both the homogeneous nucleation and evolution of single-crystal seeds into twinned nanoparticles. Either spherical (in the shape of a cuboctahedron) or cubic seeds could be employed for this growth process. The edge length of the resultant Ag nanocubes can be readily controlled by varying the amount of Ag seeds used, the amount of AgNO(3) added, or both. For the first time, we could obtain Ag nanocubes with uniform edge lengths controllable in the range of 30-200 nm and then compare their localized surface plasmon resonance and surface-enhanced Raman scattering properties.
Characterization of the natural rubber from new rubber tree clones of PB 300 series
International Nuclear Information System (INIS)
Silva, Maycon J.; Spinelli, Rafaela O.; Moreno, Rogerio M.B.; Mattoso, Luiz H.C.; Martins, Maria Alice; Scaloppi Junior, Erivaldo J.
2015-01-01
The natural rubber (NR) is present in more than 2500 species of plants, being the Hevea brasiliensis the most commercially exploited. It is a raw material of great importance to the Brazilian economy, but the country faces a production's deficit, having to import about 60% of its consumption. In this work , the latex obtained from rubber tree of new clones of PB series 300 (PB 311, PB 312, PB 314 , PB 326, PB 346 and PB 350 ) and RRIM 600 (control) were characterized by dry rubber content (DRC), total solids content, distribution of particle size, Zeta potential, thermogravimetry, differential scanning calorimetry, infrared in the spectroscopy (FTIR), nuclear magnetic resonance (NMR) and technological properties. The DRC values ranged from 33% to 40%, and total solids of 38% to 44%. All of the clones showed average particle diameter between 180.0 to 192.1 nm, excluding clones PB 326 and PB 346 with 150.0 nm and 157.9 nm, respectively. The NMR spectra and FTIR showed that the structure of the natural rubber from all clones studied is cis -1,4- polyisoprene. Natural rubber from the new clones showed good thermal stability up to 285 °C and glass transition temperature of -64 °C. (author)
Directory of Open Access Journals (Sweden)
Kuo-Ting Ho
2017-11-01
Full Text Available Elevated resistin levels and the polymorphisms located at gene encoding resistin (RETN are associated with diabetic pathogenesis. However, the correlation between RETN genotypes and T2DM is controversial due to discrepancies among reports. This study aimed at investigating and clarifying the putative association of RETN and T2DM in Taiwanese population. The resistin levels and RETN -420C>G genotypes in 244 control and 305 T2DM subjects were examined. Meanwhile, the association between genetic polymorphism of RETN -420C>G and resistin levels, as well as between RETN -420C>G and subjects’ clinical characteristics was statistically analyzed. The RETN -420C>G genotypes (p = 0.01 and G allele (p = 0.002 were significantly associated with T2DM. In addition, concanavalin A-stimulated peripheral blood mononuclear cells from T2DM subjects had higher resistin-secreting ability (p = 0.044. Nevertheless, no significant association between the subjects’ biochemical data and RETN -420 SNPs was found. Our results indicate that RETN -420C>G SNPs and G allele are significantly associated with T2DM. Investigation of RETN polymorphisms in T2DM patients from various ethnic populations are crucial and will contribute to the understanding of this gene in the diabetic etiology. The present results may contribute to gain knowledge on the complex genetic heterogeneity of type 2 diabetes.
Widely Tunable High-Power Tapered Diode Laser at 1060 nm
DEFF Research Database (Denmark)
Jensen, Ole Bjarlin; Sumpf, Bernd; Erbert, Götz
2011-01-01
We report a large tuning range from 1018 to 1093 nm from a InGaAs single quantum-well 1060-nm external cavity tapered diode laser. More than 2.5-W output power has been achieved. The tuning range is to our knowledge the widest obtained from a high-power InGaAs single quantum-well tapered laser...... operating around 1060 nm. The light emitted by the laser has a nearly diffraction limited beam quality and a narrow linewidth of less than 6 pm everywhere in the tuning range....
PILOT STUDY: Report on the CCPR Pilot Comparison: Spectral Responsivity 10 nm to 20 nm
Scholze, Frank; Vest, Robert; Saito, Terubumi
2010-01-01
The CCPR Pilot Comparison on spectral responsivity in the 10 nm to 20 nm spectral range was carried out within the framework of the CIPM Mutual Recognition Arrangement by three laboratories: PTB (Germany), NIST (USA), and NMIJ/AIST (Japan) with PTB acting as the central and reporting laboratory. All participating laboratories used monochromatized synchrotron radiation. PTB and NIST used a cryogenic radiometer as the primary standard detector and NMIJ, an ionization chamber with extrapolation by a wavelength-independent detector. The aim of the pilot comparison was to check the accuracy of the radiometric scale of spectral responsivity in the short wavelength EUV spectral range which has recently gained in technological importance. The wavelengths of measurement were from 11.5 nm to 20 nm in 0.5 nm steps and additionally 12.2 nm. The comparison was carried out through the calibration of a group of transfer standard detectors. Two sets of three diodes of types AXUV and SXUV from International Radiation Detectors, Inc. were used for the comparison. The comparison had the form of a star comparison: Pilot-lab A-pilot-lab B-pilot, PTB acting as the pilot laboratory. All results were communicated directly to the pilot laboratory. The report describes in detail the measurements made at PTB and summarizes the reports submitted by the participants. Measurements carried out by the pilot laboratory before and after the circulation of the detectors proved that the stability of the detectors was sufficient for the comparison. For the type AXUV detectors, however, changes in their responsivity contributed to the uncertainty of the comparison. Measurement results from participants and their associated uncertainties were analyzed in this report according to the Guidelines for CCPR Comparison Report Preparation. The uncertainty contributions were separated, as to whether they are wavelength dependent or not. All bilateral DoE are well within the respective k = 2 expanded uncertainty
Micropropagação do porta-enxerto de videira '420-A' Micropropagation of '420-A' grapevine rootstock
Directory of Open Access Journals (Sweden)
Pryscilla Menarin Dzazio
2002-12-01
Full Text Available O objetivo deste trabalho foi estabelecer um protocolo para a micropropagação do porta-enxerto de videira 420-A. O estabelecimento das culturas foi realizado com segmento nodal, cuja fonte dos explantes foram brotações de estacas lenhosas armazenadas sob refrigeração. No cultivo inicial, foram testados: o efeito de 6-benzilaminopurina e cinetina nas concentrações de 0; 1; 5 e 10 µM, diferentes meios de cultura (MS, NN e WPM e diluições do meio básico (MS, MS/2, MS/4 e MS/8. Na fase de alongamento e multiplicação, os meios de cultura testados foram MS, MS/2, NN e WPM. No enraizamento, foram testados: o meio de cultura MS/2 sem e com carvão ativado (1gL-1. Na aclimatização, foram testados vermiculita, Plantmax® e casca de arroz carbonizada como substrato. A cinetina não apresentou efeito sobre a brotação e o crescimento dos segmentos nodais. Já o BAP promoveu um aumento no número de brotos por explante. O aumento na concentração de BAP reduziu o número de folhas emitidas por explante e aumentou os sintomas de vitrificação, sendo os melhores resultados obtidos com 1 µM de BAP. No cultivo inicial, o meio de cultura MS, com a concentração normal de sais, permitiu o maior crescimento das brotações. As diluições do meio MS em 1/4 e 1/8 mostraram-se prejudiciais ao desenvolvimento do porta-enxerto '420-A', afetando o crescimento das brotações após o primeiro subcultivo. Durante a multiplicação o meio MS/2 foi o que proporcionou melhores resultados. O enraizamento ocorreu naturalmente durante a multiplicação, sendo desnecessário o uso de carvão ativado no meio de cultura. A aclimatização foi realizada com sucesso em câmara de nebulização, com substrato vermiculita (95,8% e Plantmax® (87%. Conclui-se que o porta-enxerto '420-A' pode ser micropropagado pelo cultivo inicial de segmentos nodais em meio de cultura MS + 1 µM de BAP, alongamento das brotações e multiplicação pelo seccionamento das mesmas em
Thermodynamic properties of fluid n-D2 in the 75 to 300 K and 2- to 20-kbar range
International Nuclear Information System (INIS)
Liebenberg, D.H.; Mills, R.L.; Bronson, J.C.
1978-03-01
The hydrogen isotope deuterium is an important material for use in various energy technologies. This report is a summary of new pressure, volume, temperature, and sound velocity measurements of fluid n-D 2 in the 75 to 300 K and 2- to 20-kbar range. An equation of state (EOS) was fit to these data. The thermodynamic quantities, volume V, sound velocity v/sub s/, thermal expansivity α/sub p/, heat capacity at constant pressure C/sub p/, isothermal compressibility chi/sub T/, and molar entropy S, are given at 25 0 K and 0.5-kbar increments over the range of measurements. Computer-drawn graphs of the isothermal pressure variation of these quantities are shown. Characteristics of the EOS at high temperature and pressure are determined and compared with theoretical and phenomenological equations of state
21 CFR 520.420 - Chlorothiazide tablets and boluses.
2010-04-01
... higher doses. Certain animals may respond adequately to intermittent therapy; in these cases, the drug... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS ORAL DOSAGE FORM NEW ANIMAL DRUGS § 520.420...) Limitations. (a) Dosage must be adjusted to meet the changing needs of the individual animal. In mild and...
Trends in nanosecond melanosome microcavitation up to 1540 nm
Schmidt, Morgan S.; Kennedy, Paul K.; Noojin, Gary D.; Vincelette, Rebecca L.; Thomas, Robert J.; Rockwell, Benjamin A.
2015-09-01
Thresholds for microcavitation of bovine and porcine melanosomes were previously reported, using single nanosecond (ns) laser pulses in the visible (532 nm) and the near-infrared (NIR) from 1000 to 1319 nm. Here, we report average radiant exposure thresholds for bovine melanosome microcavitation at additional NIR wavelengths up to 1540 nm, which range from ˜0.159 J/cm2 at 800 nm to 4.5 J/cm2 at 1540 nm. Melanosome absorption coefficients were also estimated, and decreased with increasing wavelength. These values were compared to retinal pigment epithelium coefficients, and to water absorption, over the same wavelength range. Corneal total intraocular energy retinal damage threshold values were estimated and compared to the previous (2007) and recently changed (2014) maximum permissible exposure (MPE) safe levels. Results provide additional data that support the recent changes to the MPE levels, as well as the first microcavitation data at 1540 nm, a wavelength for which melanosome microcavitation may be an ns-pulse skin damage mechanism.
Project W-420 Stack Monitoring system upgrades conceptual design report
International Nuclear Information System (INIS)
TUCK, J.A.
1998-01-01
This document describes the scope, justification, conceptual design, and performance of Project W-420 stack monitoring system upgrades on six NESHAP-designated, Hanford Tank Farms ventilation exhaust stacks
Project W-420 Stack Monitoring system upgrades conceptual design report
Energy Technology Data Exchange (ETDEWEB)
TUCK, J.A.
1998-11-06
This document describes the scope, justification, conceptual design, and performance of Project W-420 stack monitoring system upgrades on six NESHAP-designated, Hanford Tank Farms ventilation exhaust stacks.
International Nuclear Information System (INIS)
Yoon, Min-Seok; Kwon, Oh-Jang; Kim, Hyun-Joo; Chu, Su-Ho; Kim, Gil-Hwan; Lee, Sang-Bae; Han, Young-Geun
2010-01-01
We developed a broadband optical coupler based on a photonic crystal fiber (PCF), which is very useful for applications to optical coherence tomography (OCT). The PCF-based coupler is fabricated by using a fused biconical tapering (FBT) method. The PCF has six hexagonally-stacked layers of air holes. The PCF-based coupler has a nearly-flat 50/50 coupling ratio in a broad bandwidth range of 800 nm, which is much wider than that previously reported for a PCF-based coupler and a singlemode-fiber-based coupler. The bandwidth and the bandedge wavelength of the broadband coupler are controlled by changing the elongation length. The fabricated broadband optical coupler has great potential for realizing a broadband interferogram with a high resolution in an OCT system.
Damage accumulation and recovery in gold-ion-irradiated barium titanate
Energy Technology Data Exchange (ETDEWEB)
Jiang, W.; Weber, W.J. E-mail: bill.weber@pnl.gov; Thevuthasan, S
2001-04-01
Single-crystal barium titanate (BaTiO{sub 3}) wafers were irradiated 60 deg. off the surface normal at 170 and 300 K using 1.0 MeV Au{sup 2+} ions over a fluence range from 0.03 to 0.19 ions/nm{sup 2}. Disorder on both the Ba and Ti sublattices has been studied in situ using Rutherford backscattering spectrometry along the <1 1 0> axial direction. At these irradiation temperatures, the temperature dependence of disordering is small. The dose for amorphization under these conditions is on the order of 0.5 dpa, which is 50% of that required to amorphize SrTiO{sub 3} under similar conditions. At low damage levels, recovery of disorder is observed at room temperature, suggesting at least one lower temperature recovery stage. For more highly damaged states, two distinct recovery stages have been identified between 420 and 570 K and between 720 and 870 K. The recovery stage between 420 and 570 K is associated with the critical temperature for full amorphization ({approx}550 K) in BaTiO{sub 3}. The higher temperature recovery stage is most likely associated with epitaxial recrystallization.
130-nm tunable grating-mirror VCSEL
DEFF Research Database (Denmark)
Chung, Il-Sug; Mørk, Jesper
2014-01-01
configuration instead of the extended cavity configuration can bring 130-nm tuning range around 1330-nm wavelength. The air-coupled cavity is known to reduce the quantum confinement factor in VCSELs, increasing threshold. In our air-coupled cavity HCG VCSEL case, the very short power penetration length...... in the HCG minimizes this reduction of the quantum confinement factor, not as significant as in the air-coupled cavity DBR VCSEL....
Marciniak, L.; Prorok, K.; Francés-Soriano, L.; Pérez-Prieto, J.; Bednarkiewicz, A.
2016-02-01
The chemical architecture of lanthanide doped core-shell up-converting nanoparticles can be engineered to purposely design the properties of luminescent nanomaterials, which are typically inaccessible to their homogeneous counterparts. Such an approach allowed to shift the up-conversion excitation wavelength from ~980 to the more relevant ~808 nm or enable Tb or Eu up-conversion emission, which was previously impossible to obtain or inefficient. Here, we address the issue of limited temperature sensitivity range of optical lanthanide based nano-thermometers. By covering Yb-Er co-doped core nanoparticles with the Yb-Nd co-doped shell, we have intentionally combined temperature dependent Er up-conversion together with temperature dependent Nd --> Yb energy transfer, and thus have expanded the temperature response range ΔT of a single nanoparticle based optical nano-thermometer under single ~808 nm wavelength photo-excitation from around ΔT = 150 K to over ΔT = 300 K (150-450 K). Such engineered nanocrystals are suitable for remote optical temperature measurements in technology and biotechnology at the sub-micron scale.The chemical architecture of lanthanide doped core-shell up-converting nanoparticles can be engineered to purposely design the properties of luminescent nanomaterials, which are typically inaccessible to their homogeneous counterparts. Such an approach allowed to shift the up-conversion excitation wavelength from ~980 to the more relevant ~808 nm or enable Tb or Eu up-conversion emission, which was previously impossible to obtain or inefficient. Here, we address the issue of limited temperature sensitivity range of optical lanthanide based nano-thermometers. By covering Yb-Er co-doped core nanoparticles with the Yb-Nd co-doped shell, we have intentionally combined temperature dependent Er up-conversion together with temperature dependent Nd --> Yb energy transfer, and thus have expanded the temperature response range ΔT of a single nanoparticle
46 CFR 121.420 - Charts and nautical publications.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 121.420 Section 121... publications. (a) As appropriate for the intended voyage, a vessel must carry adequate and up-to-date: (1... publication; (3) Coast Guard Light List; (4) Tide tables; and (5) Current tables, or a river current...
Haidar, M. T.; Preu, S.; Cesar, J.; Paul, S.; Hajo, A. S.; Neumeyr, C.; Maune, H.; Küppers, F.
2018-01-01
Continuous-wave (CW) terahertz (THz) photomixing requires compact, widely tunable, mode-hop-free driving lasers. We present a single-mode microelectromechanical system (MEMS)-tunable vertical-cavity surface-emitting laser (VCSEL) featuring an electrothermal tuning range of 64 nm (7.92 THz) that exceeds the tuning range of commercially available distributed-feedback laser (DFB) diodes (˜4.8 nm) by a factor of about 13. We first review the underlying theory and perform a systematic characterization of the MEMS-VCSEL, with particular focus on the parameters relevant for THz photomixing. These parameters include mode-hop-free CW tuning with a side-mode-suppression-ratio >50 dB, a linewidth as narrow as 46.1 MHz, and wavelength and polarization stability. We conclude with a demonstration of a CW THz photomixing setup by subjecting the MEMS-VCSEL to optical beating with a DFB diode driving commercial photomixers. The achievable THz bandwidth is limited only by the employed photomixers. Once improved photomixers become available, electrothermally actuated MEMS-VCSELs should allow for a tuning range covering almost the whole THz domain with a single system.
Zhang, Qiang; Li, Weiyang; Moran, Christine; Zeng, Jie; Chen, Jingyi; Wen, Long-Ping; Xia, Younan
2010-01-01
Silver nanocubes with edge lengths controllable in the range of 30–200 nm were synthesized using an approach based on seeded growth. The key to the success of this synthesis is the use of single-crystal Ag seeds to direct the growth and the use of AgNO3 as a precursor to elemental Ag where the by-product HNO3 can block both the homogeneous nucleation and evolution of single-crystal seeds into twinned nanoparticles. Either spherical (in the shape of cubooctahedron) or cubic seeds could be employed for this growth process. The edge length of resultant Ag nanocubes can be readily controlled by varying the amount of Ag seeds used, the amount of AgNO3 added, or both. For the first time, we could obtain Ag nanocubes with uniform edge lengths controllable in the range of 30–200 nm and then compare their localized surface plasmon resonance and surface-enhanced Raman scattering properties. PMID:20698704
20 CFR 669.420 - What must be included in an on-the-job training contract?
2010-04-01
... in an on-the-job training contract? At a minimum, an on-the-job training contract must comply with... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What must be included in an on-the-job training contract? 669.420 Section 669.420 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION...
Limestone: some observations on luminescence in the region of 360 nm
International Nuclear Information System (INIS)
Galloway, R.B.
2003-01-01
An empirical study of luminescence around 360 nm from limestone is presented. Thermoluminescence glow curves from natural limestone show broad peaks at 440 deg. C, 350 deg. C, 530 deg. C and 286 deg. C in order of decreasing amplitude in contrast to the usual observation, for luminescence around 535 nm, of a sharp peak at 286 deg. C with a broader less intense peak at 350 deg. C. Recuperation occurs around 350 deg. C and 525 deg. C, which has a time dependence consistent with quantum tunnelling. Dependent on the history of heating and light exposure of the sample, sharp peaks at about 325 deg. C and 425 deg. C can be observed. Laboratory irradiated limestone shows a peak at 140 deg. C. The stimulation of luminescence by light of 470 nm with preheating at 145 deg. C for 300 s, shows an increasing signal for successive cycles of measurement associated with the heating, light exposure having little influence. Beta irradiation of a sample, with the same measurement conditions, gives a signal which increases in proportion to radiation dose but which does not survive storage for 17 h. Time resolved luminescence spectra, with no preheating, show a luminescence lifetime between stimulation and emission of less than a few μs for natural limestone, and an exponential increase in signal with increase in temperature (over the rang 20-167 deg. C) during stimulation. A signal proportional to laboratory applied beta dose is measurable at room temperature, with lifetime between stimulation and emission of this signal of 35 μs, but it does not survive heating to 100 deg. C
Investigation of the impact of water absorption on retinal OCT imaging in the 1060 nm range
DEFF Research Database (Denmark)
Marschall, Sebastian; Pedersen, Christian; Andersen, Peter E.
2012-01-01
the optimal resolution by spectral shaping. As our results show, with currently available semiconductor-based light sources with up to 100–120 nm bandwidth centered close to 1060 nm, the resolution degradation caused by the water absorption spectrum is smaller than 10%, and it can be compensated by spectral...
International Nuclear Information System (INIS)
Kageyama, Takeo; Miyamoto, Tomoyuki; Ohta, Masataka; Matsuura, Tetsuya; Matsui, Yasutaka; Furuhata, Tatsuya; Koyama, Fumio
2004-01-01
A surfactant effect of antimony (Sb) on highly strained GaInAs quantum wells (QWs) was studied by molecular beam epitaxy. Noticeable improvement of the photoluminescence (PL) was observed by adding the dilute Sb. The QWs showed an increased PL intensity and narrow linewidth of 23 meV for the wavelength range up to 1180 nm. An atomic force microscope study showed a flattened surface morphology by the introduction of the Sb. Broad-area lasers with a GaInAsSb/GaAs double-QW active layer emitting at 1170 nm showed a low threshold current density of 125 A/cm 2 per well for an infinite cavity length
Reaction CH3 + OH studied over the 294-714 K temperature and 1-100 bar pressure ranges.
Sangwan, Manuvesh; Chesnokov, Evgeni N; Krasnoperov, Lev N
2012-08-30
Reaction of methyl radicals with hydroxyl radicals, CH(3) + OH → products (1) was studied using pulsed laser photolysis coupled to transient UV-vis absorption spectroscopy over the 294-714 K temperature and 1-100 bar pressure ranges (bath gas He). Methyl radicals were produced by photolysis of acetone at 193.3 nm. Hydroxyl radicals were generated in reaction of electronically excited oxygen atoms O((1)D), produced in the photolysis of N(2)O at 193.3 nm, with H(2)O. Temporal profiles of CH(3) were recorded via absorption at 216.4 nm using xenon arc lamp and a spectrograph; OH radicals were monitored via transient absorption of light from a dc discharge H(2)O/Ar low pressure resonance lamp at ca. 308 nm. The absolute intensity of the photolysis light inside the reactor was determined by an accurate in situ actinometry based on the ozone formation in the presence of molecular oxygen. The results of this study indicate that the rate constant of reaction 1 is pressure independent within the studied pressure and temperature ranges and has slight negative temperature dependence, k(1) = (1.20 ± 0.20) × 10(-10)(T/300)(-0.49) cm(3) molecule(-1) s(-1).
14 CFR 420.17 - Bases for issuance of a license.
2010-01-01
...) Issuing a license would not jeopardize foreign policy or national security interests of the United States... § 420.15; (2) The FAA has completed an analysis of the environmental impacts associated with the...
Energy Technology Data Exchange (ETDEWEB)
Spizzo, F., E-mail: spizzo@fe.infn.it [Dipartimento di Fisica e Scienze della Terra and CNISM, Università di Ferrara, I-44122 Ferrara (Italy); Tamisari, M. [Dipartimento di Fisica e Scienze della Terra and CNISM, Università di Ferrara, I-44122 Ferrara (Italy); Dipartimento di Fisica e Geologia and CNISM, Università di Perugia, I-06123 Perugia (Italy); Chinni, F.; Bonfiglioli, E. [Dipartimento di Fisica e Scienze della Terra and CNISM, Università di Ferrara, I-44122 Ferrara (Italy); Gerardino, A. [Istituto di Fotonica e Nanotecnologie, CNR, I-00156 Roma (Italy); Barucca, G. [Dipartimento SIMAU, Università Politecnica delle Marche, I-60131 Ancona (Italy); Bisero, D.; Fin, S.; Del Bianco, L. [Dipartimento di Fisica e Scienze della Terra and CNISM, Università di Ferrara, I-44122 Ferrara (Italy)
2016-02-15
We studied the exchange bias effect in an array of IrMn(3 nm)/NiFe(3 nm) circular dots (size ~140 nm and center-to-center distance ~200 nm, as revealed by microscopy analyses), prepared on a large area (3×3 mm{sup 2}) by electron beam lithography and lift-off, using dc sputtering deposition. Hysteresis loops were measured by SQUID magnetometer at increasing values of temperature T (in the 5–300 K range) after cooling from 300 K down to 5 K in zero field (ZFC mode) and in a saturating magnetic field (FC mode). The exchange bias effect disappears above T~200 K and, at each temperature, the exchange field H{sub EX} measured in ZFC is substantially lower than the FC one. Micromagnetic calculations indicate that, at room temperature, each dot is in high-remanence ground state, but magnetic dipolar interactions establish a low-remanence configuration of the array as a whole. Hence, at low temperature, following the ZFC procedure, the exchange anisotropy in the dot array is averaged out, tending to zero. However, even the FC values of H{sub EX} and of the coercivity H{sub C} are definitely smaller compared to those measured in a reference continuous film with the same stack configuration (at T=5 K, H{sub EX}~90 Oe and H{sub C}~180 Oe in the dots and H{sub EX}~1270 Oe and H{sub C}~860 Oe in the film). Our explanation is based on the proven glassy magnetic nature of the ultrathin IrMn layer, implying the existence of magnetic correlations among the spins, culminating in a collective freezing below T~100 K. We propose, also by the light of micromagnetic simulations, that the small dot size imposes a spatial constraint on the magnetic correlation length among the IrMn spins so that, even at the lowest temperature, their thermal stability, especially at the dot border, is compromised. - Highlights: • Exchange bias in 140 nm-sized IrMn(3 nm)/NiFe(3 nm) dots much weaker than in a film. • Glassy magnetic nature of the IrMn phase and collective spin freezing at T<100 K
International Nuclear Information System (INIS)
Spizzo, F.; Tamisari, M.; Chinni, F.; Bonfiglioli, E.; Gerardino, A.; Barucca, G.; Bisero, D.; Fin, S.; Del Bianco, L.
2016-01-01
We studied the exchange bias effect in an array of IrMn(3 nm)/NiFe(3 nm) circular dots (size ~140 nm and center-to-center distance ~200 nm, as revealed by microscopy analyses), prepared on a large area (3×3 mm"2) by electron beam lithography and lift-off, using dc sputtering deposition. Hysteresis loops were measured by SQUID magnetometer at increasing values of temperature T (in the 5–300 K range) after cooling from 300 K down to 5 K in zero field (ZFC mode) and in a saturating magnetic field (FC mode). The exchange bias effect disappears above T~200 K and, at each temperature, the exchange field H_E_X measured in ZFC is substantially lower than the FC one. Micromagnetic calculations indicate that, at room temperature, each dot is in high-remanence ground state, but magnetic dipolar interactions establish a low-remanence configuration of the array as a whole. Hence, at low temperature, following the ZFC procedure, the exchange anisotropy in the dot array is averaged out, tending to zero. However, even the FC values of H_E_X and of the coercivity H_C are definitely smaller compared to those measured in a reference continuous film with the same stack configuration (at T=5 K, H_E_X~90 Oe and H_C~180 Oe in the dots and H_E_X~1270 Oe and H_C~860 Oe in the film). Our explanation is based on the proven glassy magnetic nature of the ultrathin IrMn layer, implying the existence of magnetic correlations among the spins, culminating in a collective freezing below T~100 K. We propose, also by the light of micromagnetic simulations, that the small dot size imposes a spatial constraint on the magnetic correlation length among the IrMn spins so that, even at the lowest temperature, their thermal stability, especially at the dot border, is compromised. - Highlights: • Exchange bias in 140 nm-sized IrMn(3 nm)/NiFe(3 nm) dots much weaker than in a film. • Glassy magnetic nature of the IrMn phase and collective spin freezing at T<100 K • Confinement of IrMn magnetic
International Nuclear Information System (INIS)
Shaldin, Yu. V.; Matyjasik, S.; Novikova, N. E.; Tseitlin, M.; Mozhaev, E.; Roth, M.
2010-01-01
The temperature dependences of the pyroelectric coefficients of KTiOAsO 4 and RbTiOAsO 4 single crystals grown by flux crystallization have been investigated in the temperature range of 4.2-300 K. With an increase in temperature, superionic conductivity first arises in KTiOAsO4 (at T > 200 K) and then (at T > 270 K) in RbTiOAsO 4 . This conductivity is much higher in the samples polarized at T = 4.2 K. An exponential change in the crystal resistivity along the polar direction is simultaneously observed. The results of measurements in the range of 4.2-200 K indicate larger values of pyroelectric coefficients when compared with potassium and rubidium titanyl-phosphate crystals. A correlation between the pyroelectric coefficients and a change in the lattice constants at isomorphic substitutions of K atoms for Rb and P atoms for As has been revealed within the symmetry approach.
Energy Technology Data Exchange (ETDEWEB)
Shaldin, Yu. V., E-mail: yuri1999@rambler.ru [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Matyjasik, S. [International Laboratory of Strong Magnetic Fields and Low Temperatures (Poland); Novikova, N. E. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Tseitlin, M.; Mozhaev, E. [Ariel University Center of Samaria (Israel); Roth, M. [Hebrew University, School of Applied Sciences (Israel)
2010-11-15
The temperature dependences of the pyroelectric coefficients of KTiOAsO{sub 4} and RbTiOAsO{sub 4} single crystals grown by flux crystallization have been investigated in the temperature range of 4.2-300 K. With an increase in temperature, superionic conductivity first arises in KTiOAsO4 (at T > 200 K) and then (at T > 270 K) in RbTiOAsO{sub 4}. This conductivity is much higher in the samples polarized at T = 4.2 K. An exponential change in the crystal resistivity along the polar direction is simultaneously observed. The results of measurements in the range of 4.2-200 K indicate larger values of pyroelectric coefficients when compared with potassium and rubidium titanyl-phosphate crystals. A correlation between the pyroelectric coefficients and a change in the lattice constants at isomorphic substitutions of K atoms for Rb and P atoms for As has been revealed within the symmetry approach.
Persistent luminescence and thermoluminescence of UV/VIS -irradiated SrAl2O4: Eu2+, Dy3+ phosphor
International Nuclear Information System (INIS)
Pereyda-Pierre, C.; Meléndrez, R.; García, R.; Pedroza-Montero, M.; Barboza-Flores, M.
2011-01-01
The persistent luminescence and thermoluminescence properties of SrAl 2 O 4 : Eu 2+ , Dy 3+ phosphors excited with UV–VIS light in the 200–500 nm region were investigated. The thermoluminescence glow curve was found to be composed of peaks around 70, 125 and 245 °C. The persistent luminescence and thermoluminescence excitation spectra exhibited a broad band around 300–500 nm centered at 400 and 420 nm respectively. A linear behavior of the integrated thermoluminescence intensity and persistent luminescence versus irradiation time was found for the first 60 s. The charge detrapping from the 70 °C trapping levels was the major contributor to the observed persistent luminescence at room temperature. The SrAl 2 O 4 : Eu 2+ , Dy 3+ phosphors have suitable properties to be applied as storage and persistent luminescence UV–VIS irradiation dose phosphor. -- Highlights: ► SrAl 2 O 4 :Eu 2+ , Dy 3+ persistent luminescence and thermoluminescence was measured. ► The phosphor was irradiated with UV–VIS photons in the 200–500 nm wavelength range. ► SrAl 2 O 4 :Eu 2+ , Dy 3+ behaves adequately as persistent and storage UV–VIS dosimeter. ► The persistent luminescence dosimetry does not require heat or light stimulation.
P--V--T and sound velocity data for fluid n-D2 in the range 75-300 K and 2-20 kbar
International Nuclear Information System (INIS)
Liebenberg, D.H.; Mills, R.L.; Bronson, J.C.
1977-11-01
Simultaneous static measurements of pressure, volume, temperature, and sound velocity are reported in deuterium fluid in the range 75 less than or equal to T less than or equal to 300K and 2 less than or equal to P less than or equal to 20 kbar [0.2 to 2.0 GPa]. The 1340 sets of data points along the 33 different isotherms are presented so that they may be available for use in equation-of-state development
Latest evolution in a 300mm graphoepitaxy pilot line flow for L/S applications
Claveau, G.; Argoud, M.; Pimenta-Barros, P.; Chamiot-Maitral, G.; Tiron, R.; Chevalier, X.; Navarro, C.
2017-03-01
Directed Self Assembly (DSA) of block-copolymers (BCPs) used as a complementary technique to the 193nm immersion lithography has demonstrated sub-10nm node applications in both via and line/space patterning. We propose however to study the performance of graphoepitaxy which allows DSA with thicker initial BCP layer, higher multiplication factors and stronger orientation control of lamellae. The aim of this work is to use the 300mm pilot line available at LETI and Arkema's advanced materials to evaluate the performances of a novel graphoepitaxy process based on the work on a 38nm period lamellar PS-b-PMMA (L38) reported before.
International Nuclear Information System (INIS)
Firlej, M.; Fiutowski, T.; Idzik, M.; Moroń, J.; Świentek, K.
2015-01-01
The design and measurements results of a wide frequency range ultra-low power Phase-Locked Loop (PLL) for applications in readout systems of particle physics detectors are presented. The PLL was fabricated in a 130 nm CMOS technology. To allow the implementation of different data serialisation schemes multiple division factors (6, 8, 10, 16) were implemented in the PLL feedback loop. The main PLL block—VCO works in 16 frequency ranges/modes, switched either manually or automatically. A dedicated automatic frequency mode switching circuit was developed to allow simple frequency tuning. Although the PLL was designed and simulated for a frequency range of 30 MHz–3 GHz, due to the SLVS interface limits, the measurements were done only up to 1.3 GHz. The full PLL functionality was experimentally verified, confirming a very low and frequency scalable power consumption (0.7 mW at 1 GHz)
Firlej, M.; Fiutowski, T.; Idzik, M.; Moroń, J.; Świentek, K.
2015-12-01
The design and measurements results of a wide frequency range ultra-low power Phase-Locked Loop (PLL) for applications in readout systems of particle physics detectors are presented. The PLL was fabricated in a 130 nm CMOS technology. To allow the implementation of different data serialisation schemes multiple division factors (6, 8, 10, 16) were implemented in the PLL feedback loop. The main PLL block—VCO works in 16 frequency ranges/modes, switched either manually or automatically. A dedicated automatic frequency mode switching circuit was developed to allow simple frequency tuning. Although the PLL was designed and simulated for a frequency range of 30 MHz-3 GHz, due to the SLVS interface limits, the measurements were done only up to 1.3 GHz. The full PLL functionality was experimentally verified, confirming a very low and frequency scalable power consumption (0.7 mW at 1 GHz).
Characterizations of Some Semi magnetic Chalcopyrite Compounds
International Nuclear Information System (INIS)
Farrag, A.A.A.
2012-01-01
Cd 1-x Zn x Se (x=0, 0.5 and 1) and Cd 0.5 Zn 0.5 X 0.02 Se (X= Mn, Fe and Co) semiconductor and semi magnetic semiconductor compounds were prepared in the bulk form by melt quenching technique in ice water. Thin films of thickness 300 nm have been deposited on ultra cleaned soda lime glass substrates, at room temperature by thermal evaporation technique. The structural, optical and electrical properties of Cd 1-x Zn x Se (x=0, 0.5 and 1) and Cd 0.5 Zn 0.5 X 0.02 Se (X= Mn, Fe and Co) thin film samples have been studied. ESR and magnetic properties of Cd 0.5 Zn 0.5 X 0.02 Se (X= Mn, Fe and Co) powder samples also have been studied. The structural properties of Cd 1-x Zn x Se (x=0, 0.5 and 1) and Cd 0.5 Zn 0.5 X 0.02 Se (X= Mn, Fe and Co) thin film and powder samples have been investigated by using X-ray diffraction (XRD) technique. The crystal structure, lattice parameters, grain size, micro strain and dislocation density were determined from the X- ray diffraction patterns of the investigated samples. The optical properties of the investigated thin film samples were studied. Transmittance and reflectance were measured in wavelength range from 400 nm to 2500 nm and used to calculate the optical constants like absorption coefficient, refractive index and optical band gap. The obtained values of the optical band gap illustrated that the films exhibit direct band gap. The analysis of the obtained values of the refractive index yielded the high frequency dielectric constant and other optical dispersion parameters. The photon energy dependence of the relaxation time, dissipation factor and optical conductivity of the investigated thin film samples were studied also. The temperature dependence of dc conductivity for the investigated thin films was studied in temperature range from 300 K to 420 K. The obtained results showed that there are two different conduction mechanisms with two different values of activation energy in the defined temperature range. The temperature
9 CFR 93.420 - Ruminants from Canada for immediate slaughter other than bovines, sheep, and goats.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Ruminants from Canada for immediate slaughter other than bovines, sheep, and goats. 93.420 Section 93.420 Animals and Animal Products ANIMAL AND... goats. The requirements for the importation of sheep and goats from Canada for immediate slaughter are...
Broadband superluminescent diodes with bell-shaped spectra emitting in the range from 800 to 900 nm
Energy Technology Data Exchange (ETDEWEB)
Andreeva, E V; Il' ichenko, S N; Kostin, Yu O; Lapin, P I [Superlum Diodes Ltd., Moscow (Russian Federation); Ladugin, M A; Marmalyuk, A A [Open Joint-Stock Company ' M.F. Stel' makh Polyus Research and Development Institute' , Moscow (Russian Federation); Yakubovich, S D [Moscow State Institute of Radio-Engineering, Electronics and Automation (Technical University), Moscow (Russian Federation)
2013-08-31
Quantum-well superluminescent diodes (SLD) with extremely thin active (AlGa)As and (InGa)As layers and centre wavelengths about 810, 840, 860 and 880 nm are experimentally studied. Their emission spectrum possesses the shape close to Gaussian, its FWHM being 30 – 60 nm depending on the length of the active channel and the level of pumping. Under cw injection, the output power of light-emitting modules based on such SLDs can amount to 1.0 – 25 mW at the output of a single-mode fibre. It is demonstrated that the operation lifetime of these devices exceeds 30000 hours. Based on the light-emitting modules the prototypes of combined BroadLighter series light sources are implemented having a bell-shaped spectrum with the width up to 100 nm. (optical radiation sources)
Monolithic PM Raman fiber laser at 1679 nm for Raman amplification at 1810 nm
DEFF Research Database (Denmark)
Svane, Ask Sebastian; Rottwitt, Karsten
2013-01-01
Stimulated Raman scattering (SRS) has been subject to much attention within the field of fiber lasers and amplifiers as it provides an extended wavelength coverage in comparison to rare-earth based devices. Motivated by the projected capacity crunch [1], different approaches are being explored...... demonstrate a monolithic RM Raman fiber laser (RFL), which acts as a pump for a Raman amplifier (RA) at 1810 nm. The lasing wavelength of a RFL, thus also for a RA, can in principle be designed arbitrarily within the entire wavelength range from the Erbium band up to the Thulium/Holmium band...... of OFS PM Raman fiber, with an estimated propagation loss of 0.42/0.46/1.3 dB/km at 1564/1679/1810 nm. The Raman gain coefficient was measured to be gR=2.66/2.35 W-1km-1 at 1679/1810 nm. The laser curve of the RFL is depicted in Fig. 1b, with a slope efficiency of 67 %. The high slope efficiency...
40 CFR 300.300 - Phase I-Discovery or notification.
2010-07-01
... 40 Protection of Environment 27 2010-07-01 2010-07-01 false Phase I-Discovery or notification. 300.300 Section 300.300 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SUPERFUND... person in charge of a vessel or a facility shall, as soon as he or she has knowledge of any discharge...
Morozov, O.; Mats, O.; Mats, V.; Zhurba, V.; Khaimovich, P.
2018-01-01
The present article introduces the data of analysis of ranges of ion-implanted deuterium desorption from Zr-1% Nb alloy. The samples studied underwent plastic deformation, low temperature extrusion and electron irradiation. Plastic rolling of the samples at temperature ∼300 K resulted in plastic deformation with the degree of ε = 3.9 and the formation of nanostructural state with the average grain size of d = 61 nm. The high degree of defectiveness is shown in thermodesorption spectrum as an additional area of the deuterium desorption in the temperature ranges 650-850 K. The further processing of the sample (that had undergone plastic deformation by plastic rolling) with electron irradiation resulted in the reduction of the average grain size (58 nm) and an increase in borders concentration. As a result the amount of deuterium desorpted increased in the temperature ranges 650-900 K. In case of Zr-1% Nb samples deformed by extrusion the extension of desorption area is observed towards the temperature reduction down to 420 K. The formation of the phase state of deuterium solid solution in zirconium was not observed. The structural state behavior is a control factor in the process of deuterium thermodesorption spectrum structure formation with a fixed implanted deuterium dose (hydrogen diagnostics). It appears as additional temperature ranges of deuterium desorption depending on the type, character and defect content.
Poliovirus Polymerase Leu420 Facilitates RNA Recombination and Ribavirin Resistance
Kempf, Brian J.; Peersen, Olve B.
2016-01-01
ABSTRACT RNA recombination is important in the formation of picornavirus species groups and the ongoing evolution of viruses within species groups. In this study, we examined the structure and function of poliovirus polymerase, 3Dpol, as it relates to RNA recombination. Recombination occurs when nascent RNA products exchange one viral RNA template for another during RNA replication. Because recombination is a natural aspect of picornavirus replication, we hypothesized that some features of 3Dpol may exist, in part, to facilitate RNA recombination. Furthermore, we reasoned that alanine substitution mutations that disrupt 3Dpol-RNA interactions within the polymerase elongation complex might increase and/or decrease the magnitudes of recombination. We found that an L420A mutation in 3Dpol decreased the frequency of RNA recombination, whereas alanine substitutions at other sites in 3Dpol increased the frequency of recombination. The 3Dpol Leu420 side chain interacts with a ribose in the nascent RNA product 3 nucleotides from the active site of the polymerase. Notably, the L420A mutation that reduced recombination also rendered the virus more susceptible to inhibition by ribavirin, coincident with the accumulation of ribavirin-induced G→A and C→U mutations in viral RNA. We conclude that 3Dpol Leu420 is critically important for RNA recombination and that RNA recombination contributes to ribavirin resistance. IMPORTANCE Recombination contributes to the formation of picornavirus species groups and the emergence of circulating vaccine-derived polioviruses (cVDPVs). The recombinant viruses that arise in nature are occasionally more fit than either parental strain, especially when the two partners in recombination are closely related, i.e., members of characteristic species groups, such as enterovirus species groups A to H or rhinovirus species groups A to C. Our study shows that RNA recombination requires conserved features of the viral polymerase. Furthermore, a
Jordan, C. E.; Anderson, B. E.; Beyersdorf, A. J.; Corr, C. A.; Dibb, J. E.; Greenslade, M. E.; Martin, R. F.; Moore, R. H.; Scheuer, E.; Shook, M. A.;
2015-01-01
We introduce a new instrument for the measurement of in situ ambient aerosol extinction over the 300-700 nm wavelength range, the Spectral Aerosol Extinction (SpEx) instrument. This measurement capability is envisioned to complement existing in situ instrumentation, allowing for simultaneous measurement of the evolution of aerosol optical, chemical, and physical characteristics in the ambient environment. In this work, a detailed description of the instrument is provided along with characterization tests performed in the laboratory. Measured spectra of NO2 and polystyrene latex spheres agreed well with theoretical calculations. Good agreement was also found with simultaneous aerosol extinction measurements at 450, 530, and 630 nm using CAPS PMex instruments in a series of 22 tests including non-absorbing compounds, dusts, soot, and black and brown carbon analogs. SpEx can more accurately distinguish the presence of brown carbon from other absorbing aerosol due to its 300 nm lower wavelength limit compared to measurements limited to visible wavelengths. In addition, the spectra obtained by SpEx carry more information than can be conveyed by a simple power law fit that is typically defined by the use of Angstrom Exponents. Future improvements aim at lowering detection limits and ruggedizing the instrument for mobile operation.
ANALYSIS OF ISOKINETIC KNEE EXTENSION / FLEXION IN MALE ELITE ADOLESCENT WRESTLERS
Directory of Open Access Journals (Sweden)
Sanli Sadi Kurdak
2005-12-01
Full Text Available Wrestling requires strength of the upper and lower body musculature which is critical for the athletic performance. Evaluation of the adolescent's skeletal muscle is important to understand body movement, especially including those involved in sports. Strength, power and endurance capacity are defined as parameters of skeletal muscle biomechanical properties. The isokinetic dynamometer is an important toll for making this type of evaluation. However, load range phase of range of motion has to be considered to interpret the data correctly. With this in mind we aimed to investigate the lover body musculature contractile characteristics of adolescent wrestlers together with detailed analyses of load range phase of motion. Thirteen boys aged 12 - 14 years participated to this study. Concentric load range torque, work and power of knee extension and flexion were measured by a Cybex Norm dynamometer at angular velocities from 450°/sec to 30°/sec with 30°/sec decrements for each set. None of the wrestlers were able to attain load range for angular velocities above 390°/sec and 420°/sec for extension and flexion respectively. Detailed analyses of the load range resulted in statistically significant differences in the normalized load range peak torque for extension at 270°/sec (1.44 ± 0.28 Nm·kg-1 and 1.14 ± 0.28 Nm·kg-1 for total and load range peak torque respectively, p < 0.05, and for flexion at 300°/sec (1.26 ± 0.28 Nm·kg-1 and 1.03 ± 0.23 Nm·kg-1 for total and load range peak torque respectively, p < 0.05, compared to total peak torque data. Similarly, the significant difference was found for the work values at 90°/sec (1.91 ± 0.23 Nm·kg-1 and 1.59 ± 0.24 Nm·kg-1 for total and load range work respectively for extension and 1.73 ± 0.21 Nm·kg-1 and 1.49 ± 0.19 Nm·kg-1 for total and load range work respectively for flexion, p < 0.05, and was evident at higher angular velocities (p < 0.001 for both extension and flexion. At
Rabus, H; Richter, M; Ulm, G; Friese, J; Gernhäuser, R; Kastenmüller, A; Maier-Komor, P; Zeitelhack, K
1999-01-01
Differently prepared CsI samples have been investigated in the 120-220 nm spectral range for their quantum efficiency, spatial uniformity and the effect of radiation aging. The experiments were performed at the PTB radiometry laboratory at the Berlin synchrotron radiation facility BESSY. A calibrated GaAsP Schottky photodiode was used as transfer detector standard to establish traceability to the primary detector standard, because this type of photodiode - unlike silicon p-on-n photodiodes - proved to be of sufficiently stable response when exposed to vacuum ultraviolet radiation. The paper reviews the experimental procedures that were employed to characterize and calibrate the GaAsP photodiode and reports the results that were obtained on the investigated CsI photocathodes.
Zhang, Jie; Tao, Sha; Wang, Brian; Zhao, Jay
2017-02-01
In this paper, micro-processing of three kinds of super-hard materials of poly-crystal diamond (PCD)/tungsten-carbide (WC), CVD-diamond and cubic boron nitride (CNB) has been systematically studied using nanosecond laser (532nm and 355nm), and ultrafast laser (532nm and 515nm). Our purpose is to investigate a full laser micro-cutting solution to achieve a ready-to-use cutting tool insert (CTI). The results show a clean cut with little burns and recasting at edge. The cutting speed of 2-10mm/min depending on thickness was obtained. The laser ablation process was also studied by varying laser parameters (wavelength, pulse width, pulse energy, repetition rate) and tool path to improve cutting speed. Also, studies on material removal efficiency (MRE) of PCD/WC with 355nm-ns and 515nm-fs laser as a function of laser fluence show that 355nm-ns laser is able to achieve higher MRE for PCD and WC. Thus, ultrafast laser is not necessarily used for superhard material cutting. Instead, post-polishing with ultrafast laser can be used to clean cutting surface and improve smoothness.
Bravo, Adrian J; Pearson, Matthew R; Conner, Bradley T; Parnes, Jamie E
2017-01-01
Given the popular association between April 20 ("4/20") and marijuana, the present study examined marijuana use and consequences on 4/20 compared with other days in order to test whether 4/20 is a high-risk, event-specific marijuana use holiday among college student marijuana users. Fifty-nine college student marijuana users from three different, large U.S. universities located in Virginia, New Mexico, and Colorado completed daily brief surveys (<10 minutes) over a 12-day (April 15-April 26) period assessing prior-day marijuana use (i.e., percentage of users who consumed marijuana, number of unique marijuana use sessions, subjective high/intoxication while under the influence of marijuana, and number of grams of marijuana consumed) and marijuana-related consequences. Using oneway repeated-measures analyses of variance, we found that (a) 50% of students reported using marijuana on 4/20, which was significantly more than weekdays (28%) and weekend days (37%); (b) students reported a significantly higher number of unique marijuana use sessions on 4/20 (M = 1.47) compared with weekdays (M = 0.91); and (c) students reported a significantly higher number of grams consumed on 4/20 (M = 0.79) compared with weekdays (M = 0.35) and weekend days (M = 0.47). Our study provides preliminary support that 4/20 is a day associated with increased marijuana use but provides little evidence for an association with more problematic use.
Utilisation des modules ATM pour le projet FP420
Renaglia, T
2006-01-01
Le but de cette note est de résumer les premières caractéristiques de l'intégration de 2 modules ATM pour le projet FP420 (voir note technique EDMS n° 743628) ainsi que la liste des problèmes découverts à ce jour sur l
Electron multi-beam technology for mask and wafer writing at 0.1nm address grid
Platzgummer, Elmar; Klein, Christof; Loeschner, Hans
2013-03-01
An overview of electron beam tool configurations is provided. The adoption of multi-beam writing is mandatory in order to fulfill industrial needs for 11nm HP nodes and below. IMS Nanofabrication realized a 50keV electron multibeam proof-of-concept (POC) tool confirming writing principles with 0.1nm address grid and lithography performance capability. The new architecture will be introduced for mask writing at first, but has also the potential for 1xmask (master template) and direct wafer writing. The POC system achieves the predicted 5nm 1sigma blur across the 82μm x 82μm array of 512 x 512 (262,144) programmable 20nm beams. 24nm HP has been demonstrated and complex patterns have been written in scanning stripe exposure mode. The first production worthy system for the 11nm HP mask node is scheduled for 2014 (Alpha), 2015 (Beta) and 1st generation HVM mask writer tools in 2016. Implementing a multi-axis column configuration, 50x / 100x productivity enhancements are possible for direct 300mm / 450mm wafer writing.
31 CFR 535.420 - Transfers of accounts under § 535.508 from demand to interest-bearing status.
2010-07-01
....508 from demand to interest-bearing status. 535.420 Section 535.420 Money and Finance: Treasury... from demand to interest-bearing status. Section 535.508 authorizes transfer of a blocked demand deposit account to interest-bearing status at the instruction of the Iranian depositor at any time. [44 FR 76784...
Xia, Ke; Shen, Guang-Bin; Zhu, Xiao-Qing
2015-06-14
32 F420 coenzyme models with alkylation of the three different N atoms (N1, N3 and N10) in the core structure (XFH(-)) were designed and synthesized and the thermodynamic driving forces (defined in terms of the molar enthalpy changes or the standard redox potentials in this work) of the 32 XFH(-) releasing hydride ions, hydrogen atoms and electrons, the thermodynamic driving forces of the 32 XFH˙ releasing protons and hydrogen atoms and the thermodynamic driving forces of XF(-)˙ releasing electrons in acetonitrile were determined using titration calorimetry and electrochemical methods. The effects of the methyl group at N1, N3 and N10 and a negative charge on N1 and N10 atoms on the six thermodynamic driving forces of the F420 coenzyme models and their related reaction intermediates were examined; the results show that seating arrangements of the methyl group and the negative charge have remarkably different effects on the thermodynamic properties of the F420 coenzyme models and their related reaction intermediates. The effects of the substituents at C7 and C8 on the six thermodynamic driving forces of the F420 coenzyme models and their related reaction intermediates were also examined; the results show that the substituents at C7 and C8 have good Hammett linear free energy relationships with the six thermodynamic parameters. Meanwhile, a reasonable determination of possible reactions between members of the F420 family and NADH family in vivo was given according to a thermodynamic analysis platform constructed using the elementary step thermodynamic parameter of F420 coenzyme model 2FH(-) and NADH model MNAH releasing hydride ions in acetonitrile. The information disclosed in this work can not only fill a gap in the chemical thermodynamics of F420 coenzyme models as a class of very important organic sources of electrons, hydride ions, hydrogen atoms and protons, but also strongly promote the fast development of the chemistry and applications of F420 coenzyme.
International Nuclear Information System (INIS)
Ao Huilan; Xing Da; Wei Huajiang; Gu Huaimin; Wu Guoyong; Lu Jianjun
2008-01-01
The absorption coefficients, the reduced scattering coefficients and the optical penetration depths for native and coagulated human normal and adenomatous colon tissues in vitro were determined over the range of 400-1100 nm using a spectrophotometer with an internal integrating sphere system, and the inverse adding-doubling method was applied to calculate the tissue optical properties from diffuse reflectance and total transmittance measurements. The experimental results showed that in the range of 400-1100 nm there were larger absorption coefficients (P < 0.01) and smaller reduced scattering coefficients (P < 0.01) for adenomatous colon tissues than for normal colon tissues, and there were smaller optical penetration depths for adenomatous colon tissues than for normal colon tissues, especially in the near-infrared wavelength. Thermal coagulation induced significant increase of the absorption coefficients and reduced scattering coefficients for the normal and adenomatous colon tissues, and significantly reduced decrease of the optical penetration depths for the normal and adenomatous colon tissues. The smaller optical penetration depth for coagulated adenomatous colon tissues is a disadvantage for laser-induced thermotherapy (LITT) and photodynamic therapy (PDT). It is necessary to adjust the application parameters of lasers to achieve optimal therapy
17 CFR Appendix A to Part 420 - Separate Reporting Entity
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Separate Reporting Entity A... Part 420—Separate Reporting Entity Subject to the following conditions, one or more aggregating entity(ies) (e.g., parent, subsidiary, or organizational component) in a reporting entity, either separately...
18 CFR 420.51 - Hydroelectric power plant water use charges.
2010-04-01
... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Hydroelectric power... BASIN COMMISSION ADMINISTRATIVE MANUAL BASIN REGULATIONS-WATER SUPPLY CHARGES Hydroelectric Power Water Use Charges § 420.51 Hydroelectric power plant water use charges. (a) Annual base charges. Owners of...
ORF Alignment: NC_004757 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available SKSLGNFFTVREVLTRYQPEVVRFFIVRAHYRS 300 ... Query: 361 PEAVAVLFDLASEANRTGDSHYASXXXXXXXXXXXXXXXXXXXXXXXXXXXDGQYSVE...EI 420 ... PEAVAVLFDLASEANRTGDSHYAS ... DGQYSVEEI Sbjct: 361 PEAVAVLFDLASEANRTGDSHYASLLKALGGVLGLLQQPPQQYLQYPAHLQDGQYSVEEI 420 ...
Epstein-Barr Virus Nuclear Antigen Leader Protein Coactivates EP300.
Wang, Chong; Zhou, Hufeng; Xue, Yong; Liang, Jun; Narita, Yohei; Gerdt, Catherine; Zheng, Amy Y; Jiang, Runsheng; Trudeau, Stephen; Peng, Chih-Wen; Gewurz, Benjamin E; Zhao, Bo
2018-05-01
LCL genes regulated by a broad range of host TFs. IMPORTANCE Epstein-Barr virus was the first human DNA tumor virus discovered over 50 years ago. EBV is causally linked to ∼200,000 human malignancies annually. These cancers include endemic Burkitt lymphoma, Hodgkin lymphoma, lymphoma/lymphoproliferative disease in transplant recipients or HIV-infected people, nasopharyngeal carcinoma, and ∼10% of gastric carcinoma cases. EBV-immortalized human B cells faithfully model key aspects of EBV lymphoproliferative diseases and are useful models of EBV oncogenesis. EBNALP is essential for EBV to transform B cells and transcriptionally coactivates EBNA2 by removing repressors from EBNA2-bound DNA sites. Here, we found that EBNALP can also modulate the activity of the key transcription activator EP300, an acetyltransferase that activates a broad range of transcription factors. Our data suggest that EBNALP regulates a much broader range of host genes than was previously appreciated. A small-molecule inhibitor of EP300 abolished EBNALP coactivation of multiple target genes. These findings suggest novel therapeutic approaches to control EBV-associated lymphoproliferative diseases. Copyright © 2018 American Society for Microbiology.
Germanium thermometers in the temperature range .1000K to 4.20K
International Nuclear Information System (INIS)
Hsieh, S.Y.; Sanchez, D.H.
1974-01-01
The sensitivity characteristics of two germanium thermometers that proved to be convenient sensors in the temperature range from .100 0 K to 4.2 0 K, are described. Their resistances change from about 8 x 10 5 ohms at .100 0 K to about 100 ohms at 4.2 0 K. The calibration curves were fitted to natural spline functions of order 3 in the whole range of temperatures. These functions give less than half millidegree standard dispersion against 15 millidegree standard dispersion when usual polynomial interpolations are used. It is discussed what spline functions are, and compare the goodness of spline interpolation with polynomial methods [pt
Nasouri, Babak; Murphy, Thomas E.; Berberoglu, Halil
2014-07-01
For understanding the mechanisms of low-level laser/light therapy (LLLT), accurate knowledge of light interaction with tissue is necessary. We present a three-dimensional, multilayer reduced-variance Monte Carlo simulation tool for studying light penetration and absorption in human skin. Local profiles of light penetration and volumetric absorption were calculated for uniform as well as Gaussian profile beams with different spreads over the spectral range from 1000 to 1900 nm. The results showed that lasers within this wavelength range could be used to effectively and safely deliver energy to specific skin layers as well as achieve large penetration depths for treating deep tissues, without causing skin damage. In addition, by changing the beam profile from uniform to Gaussian, the local volumetric dosage could increase as much as three times for otherwise similar lasers. We expect that this tool along with the results presented will aid researchers in selecting wavelength and laser power in LLLT.
Optical properties of InGaAs/InGaAlAs quantum wells for the 1520–1580 nm spectral range
Energy Technology Data Exchange (ETDEWEB)
Gladyshev, A. G., E-mail: andrey.gladyshev@connector-optics.com; Novikov, I. I.; Karachinsky, L. Ya.; Denisov, D. V. [Connector Optics OOO (Russian Federation); Blokhin, S. A.; Blokhin, A. A.; Nadtochiy, A. M. [Russian Academy of Sciences, Ioffe Physical–Technical Institute (Russian Federation); Kurochkin, A. S. [St. Petersburg National Research University of Information Technologies, Mechanics, and Optics (Russian Federation); Egorov, A. Yu. [Connector Optics OOO (Russian Federation)
2016-09-15
The optical properties of elastically strained semiconductor heterostructures with InGaAs/InGaAlAs quantum wells (QWs), intended for use in the formation of the active region of lasers emitting in the spectral range 1520–1580 nm, are studied. Active regions with varied lattice mismatch between the InGaAs QWs and the InP substrate are fabricated by molecular beam epitaxy. The maximum lattice mismatch for the InGaAs QWs is +2%. The optical properties of the elastically strained InGaAlAs/InGaAs/InP heterostructures are studied by the photoluminescence method in the temperature range from 20 to 140°C at various power densities of the excitation laser. Investigation of the optical properties of InGaAlAs/InGaAs/InP experimental samples confirms the feasibility of using the developed elastically strained heterostructures for the fabrication of active regions for laser diodes with high temperature stability.
5.5nm wavelength-tunable high-power MOPA diode laser system at 971 nm
Tawfieq, Mahmoud; Müller, André; Fricke, Jörg; Della Casa, Pietro; Ressel, Peter; Ginolas, Arnim; Feise, David; Sumpf, Bernd; Tränkle, Günther
2018-02-01
In this work, a widely tunable hybrid master oscillator power amplifier (MOPA) diode laser with 6.2 W of output power at 971.8 nm will be presented. The MO is a DBR laser, with a micro heater embedded on top of the DBR grating for wavelength tunability. The emitted light of the MO is collimated and coupled into a tapered amplifier using micro cylindrical lenses, all constructed on a compact 25 mm × 25 mm conduction cooled laser package. The MOPA system emits light with a measured spectral width smaller than 17 pm, limited by the spectrometer, and with a beam propagation factor of M2 1/e2 = 1.3 in the slow axis. The emission is thus nearly diffraction limited with 79% of the total power within the central lobe (4.9 W diffraction limited). The electrically controlled micro-heater provides up to 5.5 nm of wavelength tunability, up to a wavelength of 977.3 nm, while maintaining an output power variation of only +/- 0.16 % for the entire tuning range.
Ranković, Miloš Lj.; Maljković, Jelena B.; Tökési, Károly; Marinković, Bratislav P.
2018-02-01
Measurements and calculations for electron elastic differential cross sections (DCS) of argon atom in the energy range from 40 to 300 eV are presented. DCS have been measured in the crossed beam arrangement of the electron spectrometer with an energy resolution of 0.5 eV and angular resolution of 1.5∘ in the range of scattering angles from 20∘ to 126∘. Both angular behaviour and energy dependence of DCS are obtained in a separate sets of experiments, while the absolute scale is achieved via relative flow method, using helium as a reference gas. All data is corrected for the energy transmission function, changes of primary electron beam current and target pressure, and effective path length (volume correction). DCSs are calculated in relativistic framework by expressing the Mott's cross sections in partial wave expansion. Our results are compared with other available data.
Directory of Open Access Journals (Sweden)
Yoshihiro Tsujimoto
2015-09-01
Full Text Available Corundum-type Ti2O3 has been investigated over the last half century because it shows unusual insulator–metal (I-M transition over a broad temperature range (420–550 K. In this work, we successfully synthesized Ti2O3 nanoparticles (20, 70, 300 nm in size by the low-temperature reduction between precursors of rutile-type TiO2 and the reductant CaH2, in a non-topotactic manner. The reaction time required for obtaining the reduced phase increases with increasing the particle size. Synchrotron X-ray powder diffraction and electron microscopy studies reveal that the symmetry of all the present samples remains the same as that of bulk samples. However, the particle-size reduction results in three important features compared with bulk samples as follows, (i color shift from dark brown to bluish black, (ii anisotropic volume contraction involving the shrinkage of Ti–Ti bonds in the ab plane and along the c axis, (iii reduction of the I-M transition temperature from 420 K to 350 K. These suggest that the a1g band broadening caused by the surface strain effects, which favors narrowing of the band gap, may play a critical role in the suppression of IM transition.
23 CFR 420.209 - What are the conditions for approval?
2010-04-01
... Management § 420.209 What are the conditions for approval? (a) As a condition for approval of FHWA planning... management process that identifies and results in implementation of RD&T activities expected to address high priority transportation issues. The management process must include: (1) An interactive process for...
Reaction OH + OH studied over the 298-834 K temperature and 1-100 bar pressure ranges.
Sangwan, Manuvesh; Chesnokov, Evgeni N; Krasnoperov, Lev N
2012-06-21
Self-reaction of hydroxyl radicals, OH + OH → H(2)O + O (1a) and OH + OH → H(2)O(2) (1b), was studied using pulsed laser photolysis coupled to transient UV-vis absorption spectroscopy over the 298-834 K temperature and 1-100 bar pressure ranges (bath gas He). A heatable high-pressure flow reactor was employed. Hydroxyl radicals were prepared using reaction of electronically excited oxygen atoms, O((1)D), produced in photolysis of N(2)O at 193 nm, with H(2)O. The temporal behavior of OH radicals was monitored via transient absorption of light from a dc discharge in H(2)O/Ar low-pressure resonance lamp at ca. 308 nm. The absolute intensity of the photolysis light was determined by accurate in situ actinometry based on the ozone formation in the presence of molecular oxygen. The results of this study combined with the literature data indicate that the rate constant of reaction 1a, associated with the pressure independent component, decreases with temperature within the temperature range 298-414 K and increases above 555 K. The pressure dependent rate constant for (1b) was parametrized using the Troe expression as k(1b,inf) = (2.4 ± 0.6) × 10(-11)(T/300)(-0.5) cm(3) molecule(-1) s(-1), k(1b,0) = [He] (9.0 ± 2.2) × 10(-31)(T/300)(-3.5±0.5) cm(3) molecule(-1) s(-1), F(c) = 0.37.
Absolute frequency atlas from 915 nm to 985 nm based on laser absorption spectroscopy of iodine
Nölleke, Christian; Raab, Christoph; Neuhaus, Rudolf; Falke, Stephan
2018-04-01
This article reports on laser absorption spectroscopy of iodine gas between 915 nm and 985 nm. This wavelength range is scanned utilizing a narrow linewidth and mode-hop-free tunable diode-laser whose frequency is actively controlled using a calibrated wavelength meter. This allows us to provide an iodine atlas that contains almost 10,000 experimentally observed reference lines with an uncertainty of 50 MHz. For common lines, good agreement is found with a publication by Gerstenkorn and Luc (1978). The new rich dataset allows existing models of the iodine molecule to be refined and can serve as a reference for laser frequency calibration and stabilization.
Influence of Cryogenic Treatments on the Wear Behavior of AISI 420 Martensitic Stainless Steel
Prieto, G.; Tuckart, W. R.
2017-11-01
The objective of the present work is to characterize the wear behavior of a cryogenically treated low-carbon AISI 420 martensitic stainless steel, by means of ball-on-disk tribological tests. Wear tests were performed under a range of applied normal loads and in two different environments, namely a petrolatum bath and an argon atmosphere. Wear tracks were analyzed by both optical and scanning electron microscopy and Raman spectroscopy to evaluate wear volume, track geometry, surface features and the tribolayers generated after testing. This paper is an extension of the work originally reported in the VIII Iberian Conference of Tribology (Prieto and Tuckart, in: Ballest Jiménez, Rodríguez Espinosa, Serrano Saurín, Pardilla Arias, Olivares Bermúdez (eds) VIII Iberian conference of tribology, Cartagena, 2015). In this study, it has been experimentally demonstrated that cryogenically treated specimens showed a wear resistance improvement ranging from 35 to 90% compared to conventionally treated ones.
Study on the oxidation and reduction of tungsten surface for sub-50 nm patterning process
Energy Technology Data Exchange (ETDEWEB)
Kim, Jong Kyu; Nam, Seok Woo; Cho, Sung Il; Jhon, Myung S.; Min, Kyung Suk; Kim, Chan Kyu; Jung, Ho Bum; Yeom, Geun Young [Memory Division Semiconductor Business, Samsung Electronics, San No. 16 Banwol-Ri, Taean-Eup, Hwasung-City, Gyeonggi-Do 449-711, South Korea and Department of Advanced Materials Science and Engineering, Sungkyunkwan University, Suwon, Gyeonggi-do 440-746 (Korea, Republic of); Memory Division Semiconductor Business, Samsung Electronics, San No. 16 Banwol-Ri, Taean-Eup, Hwasung-City, Gyeonggi-Do 449-711 (Korea, Republic of); Department of Chemical Engineering and Data Storage Systems Center, Carnegie Mellon University, Pittsburgh, Pennsylvania 15213 (United States); Department of Advanced Materials Science and Engineering, Sungkyunkwan University, Suwon, Gyeonggi-do 440-746 (Korea, Republic of)
2012-11-15
The oxidation characteristics of tungsten line pattern during the carbon-based mask-layer removal process using oxygen plasmas have been investigated for sub-50 nm patterning processes, in addition to the reduction characteristics of the WO{sub x} layer formed on the tungsten line surface using hydrogen plasmas. The surface oxidation of tungsten lines during the mask layer removal process could be minimized by using low-temperature (300 K) plasma processing for the removal of the carbon-based material. Using this technique, the thickness of WO{sub x} on the tungsten line could be decreased to 25% compared to results from high-temperature processing. The WO{sub x} layer could also be completely removed at a low temperature of 300 K using a hydrogen plasma by supplying bias power to the tungsten substrate to provide a activation energy for the reduction. When this oxidation and reduction technique was applied to actual 40-nm-CD device processing, the complete removal of WO{sub x} formed on the sidewall of tungsten line could be observed.
40 CFR 420.08 - Non-process wastewater and storm water.
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Non-process wastewater and storm water...-process wastewater and storm water. Permit and pretreatment control authorities may provide for increased loadings for non-process wastewaters defined at § 420.02 and for storm water from the immediate process...
2010-04-01
... applied to local areas for poor performance? 666.420 Section 666.420 Employees' Benefits EMPLOYMENT AND... sanction be applied to local areas for poor performance? (a) If a local area fails to meet the levels of... achieving poor levels of performance; or (3) Requires other appropriate measures designed to improve the...
International Nuclear Information System (INIS)
Qin, J.; Roesner-Kuhn, M.; Drewes, K.; Thiedemann, U.; Kuppermann, G.; Camin, B.; Blume, R.; Frohberg, M.G.
1997-01-01
A review is given of the literature data for spectral emissivities at wavelengths (λ) in the range 500--653 nm, the enthalpies, and heat capacities of the liquid phases of cobalt, titanium, and zirconium. Emissivity measurements were carried out by means of electromagnetic levitation at the solid-to-liquid transition with a partial-radiation pyrometer operating at λ = 547 and 650 nm. Considering the sensitivity of the optical properties to surface impurities, investigations on the surfaces of several titanium and zirconium samples by X-ray photoelectron spectroscopy (XPS) and secondary ion mass spectrometry (SIMS) were performed that confirmed a nitrogen- and oxygen-free process atmosphere during the measurements. Liquid phase normal emissivities obtained were var-epsilon n,547 = 0.365 and var-epsilon n,650 = 0.331 for cobalt, var-epsilon n,547 = 0.409 and var-epsilon n,650 = 0.393 for titanium, and var-epsilon n,547 = 0.365 and var-epsilon n,650 = 0.355 for zirconium. Enthalpy measurements on the liquid metals were carried out by means of levitation-drop calorimetry in the range 1591--2159 K for cobalt, 1847--2430 K for titanium, and 2025--2897 K for zirconium. The resulting heat capacities (values in J·mol -1 ·K -1 ) obtained were 42.78 for cobalt, 43.79 for titanium, and 39.81 for zirconium
Optical breakdown threshold investigation of 1064 nm laser induced air plasmas
International Nuclear Information System (INIS)
Thiyagarajan, Magesh; Thompson, Shane
2012-01-01
We present the theoretical and experimental measurements and analysis of the optical breakdown threshold for dry air by 1064 nm infrared laser radiation and the significance of the multiphoton and collisional cascade ionization process on the breakdown threshold measurements over pressures range from 10 to 2000 Torr. Theoretical estimates of the breakdown threshold laser intensities and electric fields are obtained using two distinct theories namely multiphoton and collisional cascade ionization theories. The theoretical estimates are validated by experimental measurements and analysis of laser induced breakdown processes in dry air at a wavelength of 1064 nm by focusing 450 mJ max, 6 ns, 75 MW max high-power 1064 nm IR laser radiation onto a 20 μm radius spot size that produces laser intensities up to 3 - 6 TW/cm 2 , sufficient for air ionization over the pressures of interest ranging from 10 to 2000 Torr. Analysis of the measured breakdown threshold laser intensities and electric fields are carried out in relation with classical and quantum theoretical ionization processes, operating pressures. Comparative analysis of the laser air breakdown results at 1064 nm with corresponding results of a shorter laser wavelength (193 nm) [M. Thiyagarajan and J. E. Scharer, IEEE Trans. Plasma Sci. 36, 2512 (2008)] and a longer microwave wavelength (10 8 nm) [A. D. MacDonald, Microwave Breakdown in Gases (Wiley, New York, 1966)]. A universal scaling analysis of the breakdown threshold measurements provided a direct comparison of breakdown threshold values over a wide range of frequencies ranging from microwave to ultraviolet frequencies. Comparison of 1064 nm laser induced effective field intensities for air breakdown measurements with data calculated based on the collisional cascade and multiphoton breakdown theories is used successfully to determine the scaled collisional microwave portion. The measured breakdown threshold of 1064 nm laser intensities are then scaled to
International Nuclear Information System (INIS)
Brasil, D A; Alves, J A P; Pekelsky, J R
2015-01-01
This work describes the development of a grating diffratometer to provide traceable calibration of grating pitch in range 20 μm to 350 nm. The approach is based on the Littrow configuration in which a laser beam is directed onto the grating which is mounted on a rotary table and can be turned so that each selected diffraction order is retro-reflected in the laser incidence direction. A beamsplitter and a lens direct the reflected diffraction order to form a small image spot on a CCD camera and the spot centering is used to adjust to rotation angle, thereby giving the diffraction angle. Knowing the diffraction angle for several orders and the wavelength of the laser, the average grating pitch can be determined to an uncertainty the order of 14 pm. (paper)
Fiber optic probe of free electron evanescent fields in the optical frequency range
Energy Technology Data Exchange (ETDEWEB)
So, Jin-Kyu, E-mail: js1m10@orc.soton.ac.uk; MacDonald, Kevin F. [Optoelectronics Research Centre and Centre for Photonic Metamaterials, University of Southampton, Highfield, Southampton SO17 1BJ (United Kingdom); Zheludev, Nikolay I. [Optoelectronics Research Centre and Centre for Photonic Metamaterials, University of Southampton, Highfield, Southampton SO17 1BJ (United Kingdom); Centre for Disruptive Photonic Technologies, Nanyang Technological University, Singapore 637371 (Singapore)
2014-05-19
We introduce an optical fiber platform which can be used to interrogate proximity interactions between free-electron evanescent fields and photonic nanostructures at optical frequencies in a manner similar to that in which optical evanescent fields are sampled using nanoscale aperture probes in scanning near-field microscopy. Conically profiled optical fiber tips functionalized with nano-gratings are employed to couple electron evanescent fields to light via the Smith-Purcell effect. We demonstrate the interrogation of medium energy (30–50 keV) electron fields with a lateral resolution of a few micrometers via the generation and detection of visible/UV radiation in the 700–300 nm (free-space) wavelength range.
International Nuclear Information System (INIS)
Cheung, A.S.C.; Yoshino, K.; Parkinson, W.H.; Freeman, D.E.
1985-01-01
The continuum cross section of oxygen at 296-300 K has been measured with a resolution of 0.13 nm throughout the wavelength region 205-241 nm with oxygen pressures from 5 to 760 torr and optical lengths from 13.3 to 133 m. The three processes contributing to the observed cross section are absorption into two continua, viz., the Herzberg continuum of O 2 and a pressure-dependent continuum involving two molecules of O 2 , and Rayleigh scattering. Comparison between different laboratory measurements and in situ stratospheric studies will also be presented. 1 reference
TUNABLE DIODE LASER MEASUREMENTS OF NO2 NEAR 670 NM AND 395 NM. (R823933)
Two single-mode diode lasers were used to record high-resolution absorption spectra of NO2 (dilute in Ar) near 670.2 and 394.5 nm over a range of temperatures (296 to 774 K) and total pressures (2.4 x 10(-2) to 1 atm). A commercial InGaAsP laser was tuned 1.3 cm(-1) at a repetiti...
17 CFR Appendix B to Part 420 - Sample Large Position Report
2010-04-01
..., and as collateral for financial derivatives and other securities transactions $ Total Memorandum 1... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sample Large Position Report B Appendix B to Part 420 Commodity and Securities Exchanges DEPARTMENT OF THE TREASURY REGULATIONS UNDER...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Can the Administrator of General Services waive the postpayment auditing provisions of this subpart? 102-118.420 Section 102-118... Transportation Audits § 102-118.420 Can the Administrator of General Services waive the postpayment auditing...
Pressure dependent photolysis quantum yields for CH3C(O)CH3 at 300 and 308 nm and at 298 and 228 K.
Khamaganov, V G; Crowley, J N
2013-07-07
The quantum yield of formation of CH3 and CH3CO in the pulsed laser photo-excitation of acetone at 300 and 308 nm was investigated at several pressures (60 to 740 Torr) and at either 298 or 228 K. The organic radicals generated were monitored indirectly following conversion (by reaction with Br2) to Br atoms, which were detected by resonance fluorescence. The photolysis of Cl2 in back-to-back experiments at the same wavelength and under identical experimental conditions served as chemical actinometer. The pressure and temperature dependent quantum yields obtained with this method are in good agreement with previous literature values and are reproduced using the parameterisation developed by Blitz et al. The Br formation kinetics deviated from that expected from reactions of CH3 and CH3CO alone and Br atoms were still observed at high yield even when the quantum yield of formation of CH3 and CH3CO was low. This is explained by the reactive quenching of thermalized triplet acetone (T1) by Br2. High yields of T1 (>80%) at the highest pressure in this study indicate that any dissociation from the first excited singlet state (S1) occurs in competition with intersystem crossing, and that physical quenching of S1 to the electronic ground (S0) is not a major process at these wavelengths. The rate coefficient for reaction of T1 with Br2 was found to be ∼3 × 10(-10) cm(3) molecule(-1) s(-1), independent of pressure or temperature.
Energy Technology Data Exchange (ETDEWEB)
Nguyen, N.D., E-mail: Duy.Nguyen@imec.b [IMEC, Kapeldreef 75, B-3001 Leuven (Belgium); Rosseel, E. [IMEC, Kapeldreef 75, B-3001 Leuven (Belgium); Takeuchi, S. [IMEC, Kapeldreef 75, B-3001 Leuven (Belgium); Department of Physics and Astronomy, KU Leuven, B-3001 Leuven (Belgium); Everaert, J.-L. [IMEC, Kapeldreef 75, B-3001 Leuven (Belgium); Yang, L. [IMEC, Kapeldreef 75, B-3001 Leuven (Belgium); Department of Chemistry and INPAC Institute, KU Leuven, B-3001 Leuven (Belgium); Goossens, J.; Moussa, A.; Clarysse, T.; Richard, O.; Bender, H. [IMEC, Kapeldreef 75, B-3001 Leuven (Belgium); Zaima, S. [Department of Crystalline Materials Science, Graduate School of Engineering, Nagoya University, Furo-cho, Nagoya, 464-8603 (Japan); Sakai, A. [Department of System Innovation, Graduate School of Engineering Science, Osaka University, 1-3 Machikaneyama-cho, Toyonaka, Osaka 560-8531 (Japan); Loo, R. [IMEC, Kapeldreef 75, B-3001 Leuven (Belgium); Lin, J.C. [TSMC, R and D, 8, Li-Hsin 6th Rd., Hsinchu Science-Based Park, Hsinchu, Taiwan (China); TSMC assignee at IMEC, Kapeldreef 75, B-3001 Leuven (Belgium); Vandervorst, W. [IMEC, Kapeldreef 75, B-3001 Leuven (Belgium); Instituut voor Kern- en Stralingsfysika - IKS, KU Leuven, B-3001 Leuven (Belgium); Caymax, M. [IMEC, Kapeldreef 75, B-3001 Leuven (Belgium)
2010-01-01
We evaluated the combination of vapor phase doping and sub-melt laser anneal as a novel doping strategy for the fabrication of source and drain extension junctions in sub-32 nm CMOS technology, aiming at both planar and non-planar device applications. High quality ultra shallow junctions with abrupt profiles in Si substrates were demonstrated on 300 mm Si substrates. The excellent results obtained for the sheet resistance and the junction depth with boron allowed us to fulfill the requirements for the 32 nm as well as for the 22 nm technology nodes in the PMOS case by choosing appropriate laser anneal conditions. For instance, using 3 laser scans at 1300 {sup o}C, we measured an active dopant concentration of about 2.1 x 10{sup 20} cm{sup -} {sup 3} and a junction depth of 12 nm. With arsenic for NMOS, ultra shallow junctions were achieved as well. However, as also seen for other junction fabrication schemes, low dopant activation level and active dose (in the range of 1-4 x 10{sup 13} cm{sup -} {sup 2}) were observed although dopant concentration versus depth profiles indicate that the dopant atoms were properly driven into the substrate during the anneal step. The electrical deactivation of a large part of the in-diffused dopants was responsible for the high sheet resistance values.
International Nuclear Information System (INIS)
Nguyen, N.D.; Rosseel, E.; Takeuchi, S.; Everaert, J.-L.; Yang, L.; Goossens, J.; Moussa, A.; Clarysse, T.; Richard, O.; Bender, H.; Zaima, S.; Sakai, A.; Loo, R.; Lin, J.C.; Vandervorst, W.; Caymax, M.
2010-01-01
We evaluated the combination of vapor phase doping and sub-melt laser anneal as a novel doping strategy for the fabrication of source and drain extension junctions in sub-32 nm CMOS technology, aiming at both planar and non-planar device applications. High quality ultra shallow junctions with abrupt profiles in Si substrates were demonstrated on 300 mm Si substrates. The excellent results obtained for the sheet resistance and the junction depth with boron allowed us to fulfill the requirements for the 32 nm as well as for the 22 nm technology nodes in the PMOS case by choosing appropriate laser anneal conditions. For instance, using 3 laser scans at 1300 o C, we measured an active dopant concentration of about 2.1 x 10 20 cm - 3 and a junction depth of 12 nm. With arsenic for NMOS, ultra shallow junctions were achieved as well. However, as also seen for other junction fabrication schemes, low dopant activation level and active dose (in the range of 1-4 x 10 13 cm - 2 ) were observed although dopant concentration versus depth profiles indicate that the dopant atoms were properly driven into the substrate during the anneal step. The electrical deactivation of a large part of the in-diffused dopants was responsible for the high sheet resistance values.
32nm and below logic patterning using optimized illumination and double patterning
Smayling, Michael C.; Axelrad, Valery
2009-03-01
Line/space dimensions for 32nm generation logic are expected to be ~45-50nm at ~90-100nm pitch. It is likely that the node will begin at the upper end of the range, and then shrink by ~10% to a "28nm" node. For the lower end of the range, even with immersion scanners, the Rayleigh k1 factor is below 0.32. The 22nm logic node should begin with minimum pitches of approximately 70nm, requiring some form of double patterning to maintain k1 above 0.25. Logic patterning has been more difficult than NAND Flash patterning because random logic was designed with complete "freedom" compared to the very regular patterns used in memory. The logic layouts with bends and multiple pitches resulted in larger rules, un-optimized illumination, and a poorly understood process windows with little control of context-dependent "hot spots."[1] The introduction of logic design styles which use strictly one-directional lines for the critical levels now gives the opportunity for illumination optimization. Gridded Design Rules (GDR) have been demonstrated to give areacompetitive layouts at existing 90, 65, and 45nm logic nodes while reducing CD variability.[2] These benefits can be extended to <=32nm logic using selective double pass patterning.
He, Anqi; Kang, Xiaoyan; Xu, Yizhuang; Noda, Isao; Ozaki, Yukihiro; Wu, Jinguang
2017-10-05
The interaction between berberine chloride and β-cyclodextrin (β-CyD) is investigated via 2D asynchronous UV-Vis spectrum. The occurrence of cross peaks around (420nm, 420nm) in 2D asynchronous spectrum reveals that specific intermolecular interaction indeed exists between berberine chloride and β-CyD. In spite of the difficulty caused by overlapping of cross peaks, we manage to confirm that the 420nm band of berberine undergoes a red-shift, and its bandwidth decreases under the interaction with β-CyD. The red-shift of the 420nm band that can be assigned to n-π* transition indicates the environment of berberine becomes more hydrophobic. The above spectral behavior is helpful in understanding why the solubility of berberine is enhanced by β-CyD. Copyright © 2017. Published by Elsevier B.V.
Hanford 300 Area Development Plan
International Nuclear Information System (INIS)
Daly, K.S.; Seiler, S.W.; Hail, J.C.
1991-09-01
The purpose of the Hanford 300 Area Development Plan (Development Plan) is to guide the physical development of the 300 Area in accordance with US Department of Energy (DOE) Order 4320.1B (DOE 1991b) by performing the following: (1) Establishing a land use plan, setting land use categories that meet the needs of existing and proposed activities; (2) Coordinating existing, 5-yr, and long-range development plans and guiding growth in accordance with those plans; (3) Establishing development guidelines to encourage cost-effective development and minimize conflicts between adjacent activities; (4) Identifying site development issues that need further analysis; Integrating program plans with development plans to ensure a logical progression of development; and, (6) Integrating DOE plans with local agency plans (i.e., city, country, state, and Tri-Cities Science and Technology Park plans)
International Nuclear Information System (INIS)
Petrov, K.; Will, G.
1981-01-01
High-temperature treatment of tungsten carbide-cobalt hard alloys in TiB 2 media leads to the formation of a surface diffusion coating which contains orthorhombic WCoB. The function of this compound in enhancing wear resistance of cutting tools, is discussed. The thermal expansion of WCoB is of primary interest, since the wear resistance of the coating reflects the degree of matching of the thermal expansion coefficients of the different phases. Preparation of the samples is described and experimental details of the X-ray diffraction measurements are given. The temperature dependence of the lattice parameters for the range 300 to 973 K, and the corresponding linear thermal expansion coefficients along the three principal crystallographic directions, are given. The results are discussed in terms of the bonding features of the solid. (U.K.)
Phosphorylation of p300 by ATM controls the stability of NBS1
International Nuclear Information System (INIS)
Jang, Eun Ryoung; Choi, Jae Duk; Jeong, Gajin; Lee, Jong-Soo
2010-01-01
Acetyltransferase, p300 is a transcriptional cofactor of signal-responsive transcriptional regulation. The surveillance kinase ataxia-telangiectasia mutated (ATM) plays a central role in regulation of a wide range of cellular DNA damage responses. Here, we investigated whether and how ATM mediates phosphorylation of p300 in response to DNA damage and how p300 phosphorylation is functionally linked to DNA damage. ATM-phosphorylated p300 in vitro and in vivo, in response to DNA damage. Phosphorylation of p300 proteins was observed upon γ-irradiation in ATM + cells but not ATM - cells. Importantly, expression of nonphosphorylatable serine to alanine form of p300 (S106A) destabilized both p300 and NBS1 proteins, after DNA damage. These data demonstrate that ATM transduces a DNA damage signal to p300, and that ATM-dependent phosphorylation of p300 is required for stabilization of NBS1 proteins in response to DNA damage.
43 CFR 46.420 - Terms used in an environmental impact statement.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Terms used in an environmental impact... IMPLEMENTATION OF THE NATIONAL ENVIRONMENTAL POLICY ACT OF 1969 Environmental Impact Statements § 46.420 Terms used in an environmental impact statement. The following terms are commonly used to describe concepts...
International Nuclear Information System (INIS)
Xia Changlong; Zhang Gangtai; Wu Jie; Liu Xueshen
2010-01-01
We investigate theoretic high-order harmonic generation and single attosecond pulse generation in an orthogonally polarized two-color laser field, which is synthesized by a mid-infrared (IR) pulse (12.5 fs, 2000 nm) in the y component and a much weaker (12 fs, 800 nm) pulse in the x component. We find that the width of the harmonic plateau can be extended when a static electric field is added in the y component. We also investigate emission time of harmonics in terms of a time-frequency analysis to illustrate the physical mechanism of high-order harmonic generation. We calculate the ionization rate using the Ammosov-Delone-Krainov model and interpret the variation of harmonic intensity for different static electric field strengths. When the ratio of strengths of the static and the y-component laser fields is 0.1, a continuous harmonic spectrum is formed from 220 to 420 eV. By superposing a properly selected range of the harmonic spectrum from 300 to 350 eV, an isolated attosecond pulse with a duration of about 75 as is obtained, which is near linearly polarized.
International Nuclear Information System (INIS)
Rothe, Erhard W; Manke, Charles W; Piparia, Reema; Baird, Ronald J
2008-01-01
Arrays of nanostructures are made starting with a template of close-packed, polystyrene spheres on a silicon surface. The spheres are either 1.091 or 2.99 μm in diameter (d) and are of polystyrene (PS). They are irradiated with a pulse of either 308 or 248 nm light to which they are transparent and semitransparent, respectively. A transparent sphere with d = 1.091 μm diameter concentrates incident light onto a small substrate area. As has been previously reported, that creates silicon nanobumps that rise from circular craters. At 248 nm and d = 2.99 μm, the light energy is mainly absorbed, destroys the sphere, and leaves a shrunken mass (typically about 500 nm wide and 100 nm high) of organic material that is probably polystyrene and its thermal degradation products. At 248 nm and d = 1.091 μm, the residual organic structures are on the order of 300 nm wide and 100 nm high. A distinctive feature is that these organic structures are connected by filaments that are on the order of 50 nm wide and 10 nm high. Filaments form because the close-packed PS spheres expand into each other during the early part of the laser pulse, and then, as the main structures shrink, their viscoelasticity leads to threads between them. Our results with 248 nm and d = 1.091 μm differ from those described by Huang et al with 248 nm and d = 1.0 μm. Future studies might include the further effect of wavelength and fluence upon the process as well the use of other materials and the replacement of nanospheres by other focusing shapes, such as ellipsoids or rods
DEFF Research Database (Denmark)
Zubov, F. I.; Zhukov, A. E.; Shernyakov, Yu M.
2015-01-01
It is demonstrated that the use of asymmetric barrier layers in a waveguide of a diode laser suppress non-linearity of light-current characteristic and thus improve its power characteristics under high current injection. The results are presented for 850-nm AlGaAs/GaAs broad-area lasers with Ga...
International Nuclear Information System (INIS)
Vie, M.; Baboulet, J.P.
1989-01-01
We have developed: - A sensor to measure locally X ray fluence rate amplitude and variation versus time during X ray pulses, - A spectrometer based on ROSS method to measure absolute X ray spectrum versus time during X ray pulses. This metrology is used to characterise single shot X ray pulsed sources emitting photons in the range of 5 to 300 keV. Fluence domain is between 10 -9 and 5 10 -4 J. cm -2 with a few nanoseconds time resolution [fr
Directory of Open Access Journals (Sweden)
Hiroshi Onuma
Full Text Available Insulin resistance is a feature of type 2 diabetes. Resistin, secreted from adipocytes, causes insulin resistance in mice. We previously reported that the G/G genotype of single nucleotide polymorphism (SNP at -420 (rs1862513 in the human resistin gene (RETN increased susceptibility to type 2 diabetes by enhancing its promoter activity. Plasma resistin was highest in Japanese subjects with G/G genotype, followed by C/G, and C/C. In this study, we cross-sectionally analyzed plasma resistin and SNPs in the RETN region in 2,019 community-dwelling Japanese subjects. Plasma resistin was associated with SNP-638 (rs34861192, SNP-537 (rs34124816, SNP-420, SNP-358 (rs3219175, SNP+299 (rs3745367, and SNP+1263 (rs3745369 (P<10(-13 in all cases. SNP-638, SNP -420, SNP-358, and SNP+157 were in the same linkage disequilibrium (LD block. SNP-358 and SNP-638 were nearly in complete LD (r(2 = 0.98, and were tightly correlated with SNP-420 (r(2 = 0.50, and 0.51, respectively. The correlation between either SNP-358 (or SNP-638 or SNP-420 and plasma resistin appeared to be strong (risk alleles for high plasma resistin; A at SNP-358, r(2 = 0.5224, P = 4.94x10(-324; G at SNP-420, r(2 = 0.2616, P = 1.71x10(-133. In haplotypes determined by SNP-420 and SNP-358, the estimated frequencies for C-G, G-A, and G-G were 0.6700, 0.2005, and 0.1284, respectively, and C-A was rare (0.0011, suggesting that subjects with A at -358, generally had G at -420. This G-A haplotype conferred the highest plasma resistin (8.24 ng/ml difference/allele compared to C-G, P<0.0001. In THP-1 cells, the RETN promoter with the G-A haplotype showed the highest activity. Nuclear proteins specifically recognized one base difference at SNP-358, but not at SNP-638. Therefore, A at -358 is required for G at -420 to confer the highest plasma resistin in the general Japanese population. In Caucasians, the association between SNP-420 and plasma resistin is not strong, and A at -358 may not exist
Crook, Damon J; Francese, Joseph A; Zylstra, Kelley E; Fraser, Ivich; Sawyer, Alan J; Bartels, David W; Lance, David R; Mastro, Victor C
2009-12-01
Retinal sensitivity of Agrilus planipennis Fairmaire (Coleoptera: Buprestidae) was examined with an aim to improve trap efficacy for the beetle. Electroretinogram (ERG) recordings from dark-adapted compound eyes of male and female were measured at different wavelengths across the spectrum ranging from 300 to 700 nm. The spectral sensitivity curves revealed peaks in the UV (340 nm), the violet/purple (420-430 nm), blue (460 nm), and green (540-560 nm) regions of the spectrum. Females were sensitive to red regions of the spectrum (640-670 nm), whereas males were not. A spectrophotometer was used to measure the wavelength and reflectance for ash foliage, purple corrugated plastic traps, as well as the elytra and abdomen of adult A. planipennis. Traps were painted using colors based on ERG and spectrophotometer measurements and compared with purple corrugated plastic traps currently used by the USDA-APHIS-PPQ-EAB National Survey. In a field assay conducted along the edges of several A. planipennis-infested ash stands, there were no significant differences in trap catch among green, red, or purple treatments. Dark blue traps caught significantly fewer A. planipennis than red, light green, or dark purple traps. In a second assay where purple and green treatments were placed in the mid canopy of ash trees (approximately 13 m in height), trap catch was significantly higher on green treatments. We hypothesize that when placed in the mid-canopy, green traps constitute a foliage-type stimulus that elicits food-seeking and/or host seeking behavior by A. planipennis.
Design of a picosecond-laser-driven Ni-like Mo x-ray laser near 20 nm
International Nuclear Information System (INIS)
Nilsen, J.
1997-01-01
The gain is predicted for a solid molybdenum target illuminated by several joules of combined energy from a nanosecond laser pulse to create a preplasma followed by a picosecond laser pulse to drive the gain. Gains greater than 300cm -1 are predicted for the Ni-like Mo 4d 1 S 0 →4p 1 P 1 transition at 18.9 nm, which is driven by the monopole collisional excitation. High gain is also predicted for a self-photo-pumped 4f 1 P 1 →4d 1 P 1 transition at 22.0 nm and several other transitions driven by inner shell collisional ionization. copyright 1997 Optical Society of America
Ion projection lithography: November 2000 status and sub-70-nm prospects
Kaesmaier, Rainer; Wolter, Andreas; Loeschner, Hans; Schunck, Stefan
2000-10-01
Among all next generation lithography (NGL) options Ion Projection Lithography (IPL) offers the smallest (particle) wavelength of 5x10- 5nm (l00keV Helium ions). Thus, 4x reduction ion-optics has diffraction limits IOS) has been realized and assembled. In parallel to the PDT-IOS effort, at Leica Jena a test bench for a vertical vacuum 300mm-wafer stage has been realized. Operation of magnetic bearing supported stage movement has already been demonstrated. As ASML vacuum compatible optical wafer alignment system, with 3nm(3(sigma) ) precision demonstrated in air, has been integrated to this wafer test bench system recently. Parallel to the IPL tool development, Infineon Technologies Mask House and the Institute for Microelectronics Stuttgart are intensively working on the development of IPL stencil masks with success in producing 150mm and 200mm stencil masks as reported elsewhere. This paper is focused on information about the status of the PDT-IOS tool.
In situ study of the effects of heavy-ion irradiation on co-evaporated CoSi2 films
International Nuclear Information System (INIS)
Allen, C.W.; Smith, D.A.
1990-11-01
The in situ ion irradiation capability of Argonne's HVEM-Tandem User Facility has been employed to determine the effects of 1.5 MeV Kr + irradiation and 300 kV electron irradiation on the crystallization of as-deposited and of partially crystallized 40 nm thick films of CoSi 2 . Ion fluxes ranged from 8.5 x 10 14 to 6.8 x 10 15 m -2 s -1 for which beam heating effects may be neglected. The maximum electron flux at 300 kV was 0.8 x 10 23 m -2 s -1 . The maximum temperature at which crystalline CoSi 2 is amorphized by the ion irradiation of flux = 6.8 x 10 15 m -2 s -1 is between 250 and 280 K. At higher temperatures amorphous material crystallizes by growth of any preexisting crystals and by classical nucleation and growth, with radial growth rates which are proportional to ion flux. The average degree of transformation per ion is 4 x 10 -26 m 3 per ion. Thermally induced crystallization of as-deposited films occurs above approximately 420 K. For ion doses at least as low as 3.4 x 10 16 m -2 ion irradiation at 300 K promotes thermal crystallization at 450 K, by virtue of enhanced apparant nucleation and at large doses, by enhanced growth rate. 8 refs., 2 figs
Scalability of Ferroelectric Tunnel Junctions to Sub-100 nm Dimensions
Abuwasib, Mohammad
films. A fully integrated FTJ device ( 300x300 nm2) was demonstrated with large ON/OFF ratio ( 200), large ON current densities ( 75A/cm 2) and long data retention (>12 h). The device tunneling current was modeled using the known band parameters, with no fitting constants, and in excellent agreement with experimental measurement. A new fabrication process using hydrogen silsesquioxane (HSQ) planarization was developed for the integration of sub-100 nm FTJs. A fully integrated 75x75 nm2 FTJ device with composite structures Ti/SrTiO3/BaTiO 3/SrRuO3 was fabricated and tested. These FTJs have large ON current densities (103 A/cm2), which shows a lot of promise for implementation of high-density BaTiO 3 based FTJ devices in future integrated circuits.
49 CFR 173.420 - Uranium hexafluoride (fissile, fissile excepted and non-fissile).
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Uranium hexafluoride (fissile, fissile excepted....420 Uranium hexafluoride (fissile, fissile excepted and non-fissile). (a) In addition to any other... non-fissile uranium hexafluoride must be offered for transportation as follows: (1) Before initial...
Improvement of the vibration isolation system for TAMA300
Takahashi, R
2002-01-01
The vibration isolation system for TAMA300 has a vibration isolation ratio large enough to achieve the requirement in the observation band around 300 Hz. At a lower frequency range, it is necessary to reduce the large fluctuation of mirrors for stable operation of the interferometer. With this aim, the mirror suspension systems were modified and an active vibration isolation system using pneumatic actuators was installed. These improvements contributed to the realization of a continuous interferometer lock for more than 24 h.
2010-10-01
... appeal and the State fair hearing are pending. 438.420 Section 438.420 Public Health CENTERS FOR MEDICARE... fair hearing are pending. (a) Terminology. As used in this section, “timely” filing means filing on or... continues or reinstates the enrollee's benefits while the appeal is pending, the benefits must be continued...
Energy Technology Data Exchange (ETDEWEB)
LL Hale; MK Wright; NA Cadoret
1999-01-07
The objective of this study was to define areas of previous disturbance in the 300 Area of the U.S. Department of Energy (DOE) Hanford Site to eliminate these areas from the cultural resource review process, reduce cultural resource monitoring costs, and allow cultural resource specialists to focus on areas where subsurface disturbance is minimal or nonexistent. Research into available sources suggests that impacts from excavations have been significant wherever the following construction activities have occurred: building basements and pits, waste ponds, burial grounds, trenches, installation of subsurface pipelines, power poles, water hydrants, and well construction. Beyond the areas just mentioned, substrates in the' 300 Area consist of a complex, multidimen- sional mosaic composed of undisturbed stratigraphy, backfill, and disturbed sediments; Four Geographic Information System (GIS) maps were created to display known areas of disturbance in the 300 Area. These maps contain information gleaned from a variety of sources, but the primary sources include the Hanford GIS database system, engineer drawings, and historic maps. In addition to these maps, several assumptions can be made about areas of disturbance in the 300 Area as a result of this study: o o Buried pipelines are not always located where they are mapped. As a result, cultural resource monitors or specialists should not depend on maps depicting subsurface pipelines for accurate locations of previous disturbance. Temporary roads built in the early 1940s were placed on layers of sand and gravel 8 to 12 in. thick. Given this information, it is likely that substrates beneath these early roads are only minimally disturbed. Building foundations ranged from concrete slabs no more than 6 to 8 in. thick to deeply excavated pits and basements. Buildings constructed with slab foundations are more numerous than may be expected, and minimally disturbed substrates may be expected in these locations. Historic
The FIREBall-2 UV sample grating efficiency at 200-208nm
Quiret, S.; Milliard, B.; Grange, R.; Lemaitre, G. R.; Caillat, A.; Belhadi, M.; Cotel, A.
2014-07-01
The FIREBall-2 (Faint Intergalactic Redshifted Emission Balloon-2) is a balloon-borne ultraviolet spectro-imaging mission optimized for the study of faint diffuse emission around galaxies. A key optical component of the new spectrograph design is the high throughput cost-effective holographic 2400 ℓ =mm, 110x130mm aspherized reflective grating used in the range 200 - 208nm, near 28°deviation angle. In order to anticipate the efficiency in flight conditions, we have developed a PCGrate model for the FIREBall grating calibrated on linearly polarized measurements at 12° deviation angle in the range 240-350nm of a 50x50mm replica of the same master selected for the flight grating. This model predicts an efficiency within [64:7; 64:9]+/-0:7% (S polarization) and [38:3; 45]+/-2:2% (P-polarization) for the baseline aluminum coated grating with an Al2O3 natural oxidation layer and within [63:5; 65] +/-1% (S-polarization) and [51:3; 54:8] +/-2:8% (P-polarization) for an aluminum plus a 70nm MgF2 coating, in the range 200 - 208nm and for a 28°deviation angle. The model also shows there is room for significant improvements at shorter wavelengths, of interest for future deep UV spectroscopic missions.
Dust Explosion Characteristics of Agglomerated 35 nm and 100 nm Aluminum Particles
Directory of Open Access Journals (Sweden)
Hong-Chun Wu
2010-01-01
Full Text Available In the experiment, nanoparticles of 35 nm Al and 100 nm Al powders, respectively, formed particles with average sizes of 161 nm and 167 nm in agglomeration. The characteristics of dust cloud explosions with the two powder sizes, 35 nm and 100 nm, revealed considerable differences, as shown here: (dp/dtmax-35 nm = 1254 bar/s, (dp/dtmax-100 nm = 1105 bar/s; Pmax-35 nm = 7.5 bar, Pmax-100 nm = 12.3 bar, and MEC-35 nm = 40 g/m3, MEC-100 nm = 50 g/m3. The reason of Pmax-35 nm value is smaller than Pmax-100 nm may be due to agglomeration. From an analysis of the explosive residue, the study found that nanoparticles of 35 nm Al powder became filamentous strands after an explosion, where most of 100 nm Al nanoparticles maintained a spherical structure, This may be because the initial melting temperature of 35 nm Al is 435.71°C, while that for 100 nm Al is 523.58°C, higher by 87.87°C. This study discovered that explosive property between the 35 nm Al and 100 nm Al powders after agglomeration were different.
42 CFR 420.303 - HHS criteria for requesting books, documents, and records.
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false HHS criteria for requesting books, documents, and... HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM PROGRAM INTEGRITY: MEDICARE Access to Books, Documents, and Records of Subcontractors § 420.303 HHS criteria for requesting books, documents, and records...
JB-300: An advanced medium size transport for 2005
Debrouwer, Giles; Graham, Katherine; Ison, Jim; Juarez, Vince; Moskalik, Steve; Pankonin, Jon; Weinstein, Arnold
1993-01-01
In the fall of 1992, the TAC Team was presented with a Request for Proposal (PFP) for a mid-size (250-350 passenger) commercial transport. The aircraft was to be extremely competitive in the areas of passenger comfort, performance, and economic aspects. Through the use of supercritical airfoils, a technologically advanced Very High By-pass Ratio (VHBR) turbofan engine, a low overall drag configuration, a comparable interior layout, and mild use of composites, the JB-300 offers an economically viable choice to the airlines. The cents per passenger mile of the JB-300 is 1.76, which is considerably lower than current aircraft in the same range. Overall, the JB-300 is a technologically advanced aircraft, which will meet the demands of the 21st century.
Directory of Open Access Journals (Sweden)
Gauri V Lapalikar
Full Text Available Two classes of F(420-dependent reductases (FDR-A and FDR-B that can reduce aflatoxins and thereby degrade them have previously been isolated from Mycobacterium smegmatis. One class, the FDR-A enzymes, has up to 100 times more activity than the other. F(420 is a cofactor with a low reduction potential that is largely confined to the Actinomycetales and some Archaea and Proteobacteria. We have heterologously expressed ten FDR-A enzymes from diverse Actinomycetales, finding that nine can also use F(420H(2 to reduce aflatoxin. Thus FDR-As may be responsible for the previously observed degradation of aflatoxin in other Actinomycetales. The one FDR-A enzyme that we found not to reduce aflatoxin belonged to a distinct clade (herein denoted FDR-AA, and our subsequent expression and analysis of seven other FDR-AAs from M. smegmatis found that none could reduce aflatoxin. Certain FDR-A and FDR-B enzymes that could reduce aflatoxin also showed activity with coumarin and three furanocoumarins (angelicin, 8-methoxysporalen and imperatorin, but none of the FDR-AAs tested showed any of these activities. The shared feature of the compounds that were substrates was an α,β-unsaturated lactone moiety. This moiety occurs in a wide variety of otherwise recalcitrant xenobiotics and antibiotics, so the FDR-As and FDR-Bs may have evolved to harness the reducing power of F(420 to metabolise such compounds. Mass spectrometry on the products of the FDR-catalyzed reduction of coumarin and the other furanocoumarins shows their spontaneous hydrolysis to multiple products.
Zhang, Qiang; Li, Weiyang; Moran, Christine; Zeng, Jie; Chen, Jingyi; Wen, Long-Ping; Xia, Younan
2010-01-01
Silver nanocubes with edge lengths controllable in the range of 30–200 nm were synthesized using an approach based on seeded growth. The key to the success of this synthesis is the use of single-crystal Ag seeds to direct the growth and the use of AgNO3 as a precursor to elemental Ag where the by-product HNO3 can block both the homogeneous nucleation and evolution of single-crystal seeds into twinned nanoparticles. Either spherical (in the shape of cubooctahedron) or cubic seeds could be empl...
Gowen, A A; O'Donnell, C P; Esquerre, C; Downey, G
2010-03-01
Hyperspectral imaging (HSI) has recently emerged as a useful tool for quality analysis of consumer goods (e.g., food and pharmaceutical products). These products are typically packaged in polymeric film prior to distribution; however, HSI experiments are typically carried out on such samples ex-packaging (either prior to or after removal from packaging). This research examines the effects of polymer packaging films (polyvinyl chloride (PVC) and polyethylene terephthalate (PET)) on spectral and spatial features of HSI data in order to investigate the potential of HSI for quality evaluation of packaged goods. The effects of packaging film were studied for hyperspectral images of samples obtained in the visible-near-infrared (Vis-NIR, i.e., 450-950 nm) wavelength range, which is relevant to many food, agricultural, and pharmaceutical products. The dominant influence of the films tested in this wavelength range could be attributed to light scattering. Relative position of the light source, film, and detector were shown to be highly influential on the scattering effects observed. Detection of features on samples imaged through film was shown to be possible after some data preprocessing. This suggests that quality analysis of products packaged in polymer film is feasible using HSI. These findings would be useful in the development of quality monitoring tools for consumer products post-packaging using HSI.
High-power, format-flexible, 885-nm vertical-cavity surface-emitting laser arrays
Wang, Chad; Talantov, Fedor; Garrett, Henry; Berdin, Glen; Cardellino, Terri; Millenheft, David; Geske, Jonathan
2013-03-01
High-power, format flexible, 885 nm vertical-cavity surface-emitting laser (VCSEL) arrays have been developed for solid-state pumping and illumination applications. In this approach, a common VCSEL size format was designed to enable tiling into flexible formats and operating configurations. The fabrication of a common chip size on ceramic submount enables low-cost volume manufacturing of high-power VCSEL arrays. This base VCSEL chip was designed to be 5x3.33 mm2, and produced up to 50 Watts of peak continuous wave (CW) power. To scale to higher powers, multiple chips can be tiled into a combination of series or parallel configurations tailored to the application driver conditions. In actively cooled CW operation, the VCSEL array chips were packaged onto a single water channel cooler, and we have demonstrated 0.5x1, 1x1, and 1x3 cm2 formats, producing 150, 250, and 500 Watts of peak power, respectively, in under 130 A operating current. In QCW operation, the 1x3 cm2 VCSEL module, which contains 18 VCSEL array chips packaged on a single water cooler, produced over 1.3 kW of peak power. In passively cooled packages, multiple chip configurations have been developed for illumination applications, producing over 300 Watts of peak power in QCW operating conditions. These VCSEL chips use a substrate-removed structure to allow for efficient thermal heatsinking to enable high-power operation. This scalable, format flexible VCSEL architecture can be applied to wavelengths ranging from 800 to 1100 nm, and can be used to tailor emission spectral widths and build high-power hyperspectral sources.
40 CFR 420.07 - Effluent limitations guidelines and standards for pH.
2010-07-01
...) EFFLUENT GUIDELINES AND STANDARDS IRON AND STEEL MANUFACTURING POINT SOURCE CATEGORY General Provisions § 420.07 Effluent limitations guidelines and standards for pH. (a) The pH level in process wastewaters... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Effluent limitations guidelines and...
International Nuclear Information System (INIS)
Radu, V.
1992-01-01
The low-cycle fatigue phenomenon in the framework of plastic deformation is studied considering the temperature parameter. The experimental results obtained for the plastic strain Δε p (1-7%), in the temperature range 20-300 o C are examined. The conclusion is that the lifetime, expressed by the number of stress cycles, N f , is given by the relation N f = C exp(-A/T)(Δε p ) β+αΔT , where T is the absolute temperature, Δε p is double of plastic deformation amplitude, and C, A, β, and α are material constants. This relation can be interpreted as being the generalization of a relation, known in literature as the 'Coffin-Manson relation', but which does not include the temperature parameter. The validation of this relation can be done either on the results presented in this paper or an those published in literature. (Author)
Atomic structure of the murine norovirus protruding domain and sCD300lf receptor complex.
Kilic, Turgay; Koromyslova, Anna; Malak, Virginie; Hansman, Grant S
2018-03-21
Human noroviruses are the leading cause of acute gastroenteritis in human. Noroviruses also infect animals such as cow, mice, cat, and dog. How noroviruses bind and enter host cells is still incompletely understood. Recently, the type I transmembrane protein CD300lf was recently identified as the murine norovirus receptor, yet it is unclear how the virus capsid and receptor interact at the molecular level. In this study, we determined the X-ray crystal structure of the soluble CD300lf (sCD300lf) and murine norovirus capsid-protruding domain complex at 2.05 Å resolution. We found that the sCD300lf binding site is located on the topside of the protruding domain and involves a network of hydrophilic and hydrophobic interactions. The sCD300lf locked nicely into a complementary cavity on the protruding domain that is additionally coordinated with a positive surface charge on the sCD300lf and a negative surface charge on the protruding domain. Five of six protruding domain residues interacting with sCD300lf were maintained between different murine norovirus strains, suggesting that the sCD300lf was capable of binding to a highly conserved pocket. Moreover, a sequence alignment with other CD300 paralogs showed that the sCD300lf interacting residues were partially conserved in CD300ld, but variable in other CD300 family members, consistent with previously reported infection selectivity. Overall, these data provide insights into how a norovirus engages a protein receptor and will be important for a better understanding of selective recognition and norovirus attachment and entry mechanisms. IMPORTANCE Noroviruses exhibit exquisite host-range specificity due to species-specific interactions between the norovirus capsid protein and host molecules. Given this strict host-range restriction it has been unclear how the viruses are maintained within a species between relatively sporadic epidemics. While much data demonstrates that noroviruses can interact with carbohydrates
Emission characteristics of uranium hexafluoride at high temperatures
International Nuclear Information System (INIS)
Krascella, N.L.
1976-01-01
An experimental study was conducted to ascertain the spectral characteristics of uranium hexafluoride (UF 6 ) and possible UF 6 thermal decomposition products as a function of temperature and pressure. Relative emission measurements were made for UF 6 /Argon mixtures heated in a plasma torch over a range of temperatures from 800 to about 3600 0 K over a wavelength range from 80 to 600 nm. Total pressures were varied from 1 to approximately 1.7 atm. Similarly absorption measurements were carried out in the visible region from 420 to 580 nm over a temperature range from about 1000 to 1800 0 K. Total pressure for these measurements was 1.0 atm
A 130 nm ASIC prototype for the NA62 Gigatracker readout
Dellacasa, G; Wheadon, R; Mazza, G; Rivetti, A; Marchetto, F; Garbolino, S
2011-01-01
One of the most challenging detectors of the NA62 experiment is the silicon tracker, called Gigatracker. It consists of three hybrid silicon pixel stations, each one covering an area of 27 mm x 60 mm. While the maximum pixel size is fairly large, 300 mu m x 300 mu m the system has to sustain a very high particle rate, 1.5 MHz/mm(2), which corresponds to 800 MHz for each station. To obtain an efficient tracking with such a high rate the required track timing resolution is 150 ps (rms). Therefore the front-end ASIC should provide for each pixel a 200 Ps time measurement capability, thus leading to the requirement of time walk compensation and very compact TDCs. Moreover, Single Event Upset protection has to be implemented in order to protect the digital circuitry. An ASIC prototype has been realized in CMOS 130 nm technology, containing three pixel columns. The chip performs the time walk compensation by a Constant Fraction Discriminator circuit, while the time measurement is performed by a Time to Amplitude Co...
Flutter Analysis of RX-420 Balistic Rocket Fin Involving Rigid Body Modes of Rocket Structures
Directory of Open Access Journals (Sweden)
Novi Andria
2013-03-01
Full Text Available Flutter is a phenomenon that has brought a catastrophic failure to the flight vehicle structure. In this experiment, flutter was analyzed for its symmetric and antisymmetric configuration to understand the effect of rocket rigid modes to the fin flutter characteristic. This research was also expected to find out the safety level of RX-420 structure design. The analysis was performed using half rocket model. Fin structure used in this research was a fin which has semispan 600 mm, thickness 12 mm, chord root 700 mm, chord tip 400 mm, made by Al 6061-T651, double spar configuration with skin thickness of 2 mm. Structural dynamics and flutter stability were analyzed using finite element software implemented on MSC. Nastran. The analysis shows that the antisymmetric flutter mode is more critical than symmetric flutter mode. At sea level altitude, antisymmetric flutter occurs at 6.4 Mach, and symmetric flutter occurs at 10.15 Mach. Compared to maximum speed of RX-420 which is 4.5 Mach at altitude 11 km or equivalent to 2.1 Mach at sea level, it can be concluded that the RX-420 structure design is safe, and flutter will not occur during flight.
Poirier, Yannick; Kuznetsova, Svetlana; Villarreal-Barajas, Jose Eduardo
2018-01-01
To investigate empirically the energy dependence of the detector response of two in vivo luminescence detectors, LiF:Mg,Cu,P (MCP-N) high-sensitivity TLDs and Al 2 O 3 :C OSLDs, in the 40-300-kVp energy range in the context of in vivo surface dose measurement. As these detectors become more prevalent in clinical and preclinical in vivo measurements, knowledge of the variation in the empirical dependence of the measured response of these detectors across a wide spectrum of beam qualities is important. We characterized a large range of beam qualities of three different kilovoltage x-ray units: an Xstrahl 300 Orthovoltage unit, a Precision x-Ray X-RAD 320ix biological irradiator, and a Varian On-Board Imaging x-ray unit. The dose to water was measured in air according to the AAPM's Task Group 61 protocol. The OSLDs and TLDs were irradiated under reference conditions on the surface of a water phantom to provide full backscatter conditions. To assess the change in sensitivity in the long term, we separated the in vivo dosimeters of each type into an experimental and a reference group. The experimental dosimeters were irradiated using the kilovoltage x-ray units at each beam quality used in this investigation, while the reference group received a constant 10 cGy irradiation at 6 MV from a Varian clinical linear accelerator. The individual calibration of each detector was verified in cycles where both groups received a 10 cGy irradiation at 6 MV. The nanoDot OSLDs were highly reproducible, with ±1.5% variation in response following >40 measurement cycles. The TLDs lost ~20% of their signal sensitivity over the course of the study. The relative light output per unit dose to water of the MCP-N TLDs did not vary with beam quality for beam qualities with effective energies <50 keV (~150 kVp/6 mm Al). At higher energies, they showed a reduced (~75-85%) light output per unit dose relative to 6 MV x rays. The nanoDot OSLDs exhibited a very strong (120
Safety design philosophy of gas turbine high temperature reactor (GTHTR300)
International Nuclear Information System (INIS)
Katanishi, Shoji; Kunitomi, Kazuhiko
2003-01-01
Japan Atomic Energy Research Institute has been developing design studies of the Gas Turbine High Temperature Reactor (GTHTR300). The original safety design philosophy has also been discussed and fixed for the GTHTR300. One of the unique feature of the safety philosophy of the GTHTR300 is that a depressurization accident is postulated as a design basis accident in order to show the high level of safety characteristics, though its probability of occurrence is much lower than the probability range of design basis accident. Another feature of safety design is to adopt a double confinement that is one of the original concepts for the GTHTR300. By using a double confinement, a feasibility of safety design without containment vessel was clarified even in case of a depressurization accident. This article describes the safety design philosophy and some results of preliminary evaluations which were conducted in order to clarify the feasibility of original safety design of the GTHTR300. (author)
Odor, Alin A.; Violant, Deborah; Badea, Victoria; Gutknecht, Norbert
2016-03-01
Backgrounds: Er,Cr:YSGG (2780nm) and diode (940 nm) lasers can be used adjacent to the conventional periodontal treatment as minimally invasive non-surgical devices. Aim: To describe the short-term clinical outcomes by combining Er,Cr:YSGG (2780nm) and diode 940 nm lasers in non-surgical periodontal treatment. Materials and methods: A total of 10 patients with periodontal disease (mild, moderate, severe) - 233 teeth and 677 periodontal pockets ranging from 4 mm to 12 mm - were treated with Er,Cr:YSGG (2780nm) and diode (940 nm) lasers in adjunct to manual and piezoelectric scaling and root planning (SRP). Periodontal parameters such as mean probing depth (PD), mean clinical attachment level (CAL) and mean bleeding on probing (BOP) were evaluated at baseline and 6 months after the laser treatment using an electronic periodontal chart. Results: At baseline, the mean PD was 4.06 ± 1.06 mm, mean CAL was 4.56 ± 1.43 mm, and mean BOP was 43.8 ± 23.84 %. At 6 months after the laser supported periodontal treatments the mean PD was 2.6 ± 0.58 mm (p laser wavelengths in adjunct to SRP offers significant improvements of periodontal clinical parameters such as PD, CAL and BOP. Keywords: Laser supported periodontal treatment concept, Er,Cr:YSGG and diode 940nm lasers, Scaling and root planning, Minimally invasive non-surgical device
Shi, Xixi; Pan, Lingling; Chen, Shuoping; Xiao, Yong; Liu, Qiaoyun; Yuan, Liangjie; Sun, Jutang; Cai, Lintao
2009-05-19
Hexagonal ZnO micronuts (HZMNs) have been successfully synthesized with the assistance of poly(ethylene glycol) (PEG) 300 via a hydrothermal method. The structure and morphology of the HZMNs were characterized by X-ray powder diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and selected area electron diffraction (SAED). An individual ZnO micronut is revealed as twinned crystals. Time-dependent investigation shows that the growth of HZMNs involves a dissolution-recrystallization process followed by Ostwald ripening, in which is the first formed solid ZnO particles dissolve and transform to HZMNs with hollow structure. PEG 300 has been found to play a crucial role in the growth of this unique hollow structure. TEM observations show that the PEG chains aggregate to globules in water, which then have interaction with the dissolved zinc species to form the globules in a coiled state under hydrothermal conditions. These Zn(II)-PEG 300 globules act as soft template for the growth of HZMNs, and the possible growth mechanism is proposed. The room-temperature photoluminescence (PL) spectrum shows red emission around 612 nm with a full width at half-maximum (fwhm) only about 13 nm.
Zhang, Meng; Banerjee, Animesh; Bhattacharya, Pallab
2011-01-01
peak at 495 nm at 300 K. The characteristics of tunnel injection InGaN/GaN quantum dot light emitting diodes are presented. The current density at maximum efficiency is 90.2 A/cm 2, which is superior to equivalent multiquantum well devices. © 2010
Bandgap Engineering of 1300 nm Quantum Dots/Quantum Well Nanostructures Based Devices
Alhashim, Hala H.
2016-05-29
The main objectives of this thesis are to develop viable process and/or device technologies for bandgap tuning of 1300-nm InGaAs/GaAs quantum-dot (QD) laser structures, and broad linewidth 1300-nm InGaAsP/InP quantum well (QW) superluminescent diode structures. The high performance bandgap-engineered QD laser structures were achieved by employing quantum-dot intermixing (QDI) based on impurity free vacancy diffusion (IFVD) technique for eventual seamless active-passive integration, and bandgap-tuned lasers. QDI using various dielectric-capping materials, such as HfO2, SrTiO3, TiO2, Al2O3 and ZnO, etc, were experimented in which the resultant emission wavelength can be blueshifted to ∼ 1100 nm ─ 1200 nm range depending on process conditions. The significant results extracted from the PL characterization were used to perform an extensive laser characterization. The InAs/GaAs quantum-dot lasers with QDs transition energies were blueshifted by ~185 nm, and lasing around ~1070 – 1190 nm was achieved. Furthermore, from the spectral analysis, a simultaneous five-state lasing in the InAs/InGaAs intermixed QD laser was experimentally demonstrated for the first time in the very important wavelength range from 1030 to 1125 nm. The QDI methodology enabled the facile formation of a plethora of devices with various emission wavelengths suitable for a wide range of applications in the infrared. In addition, the wavelength range achieved is also applicable for coherent light generation in the green – yellow – orange visible wavelength band via frequency doubling, which is a cost-effective way of producing compact devices for pico-projectors, semiconductor laser based solid state lighting, etc. [1, 2] In QW-based superluminescent diode, the problem statement lies on achieving a flat-top and ultra-wide emission bandwidth. The approach was to design an inhomogeneous active region with a comparable simultaneous emission from different transition states in the QW stacks, in
Energy Technology Data Exchange (ETDEWEB)
Canada, J.; Maj, A. [Departamento de Termodinamica Aplicada, Universidad Politecnica de Valencia, Camino de Vera, s/n. 46022 Valencia (Spain); Utrillas, M.P.; Martinez-Lozano, J.A.; Pedros, R.; Gomez-Amo, J.L. [Departamento de Fisica de la Tierra y Termodinamica, Facultat de Fisica, Universitat de Valencia, 46100 Burjassot (Valencia) (Spain)
2007-10-15
An automatic global and direct solar spectral irradiance system has been designed based on two LICOR spectro radiometers equipped with fibre optics and remote cosine sensors. To measure direct irradiance a sun tracker based on step motors has been developed. The whole system is autonomous and works continuously. From the measurements provided by this system a spectral irradiance database in the 330-1100 nm range has been created. This database contains normal direct and global horizontal irradiances as well as diffuse irradiance on a horizontal plane, together with total atmospheric optical thickness and aerosol optical depth. (author)
Directory of Open Access Journals (Sweden)
T. Tuch
2007-11-01
Full Text Available Atmospheric aerosol particle size distributions at a continental background site in Eastern Germany were examined for a one-year period. Particles were classified using a twin differential mobility particle sizer in a size range between 3 and 800 nm. As a novelty, every second measurement of this experiment involved the removal of volatile chemical compounds in a thermodenuder at 300°C. This concept allowed to quantify the number size distribution of non-volatile particle cores – primarily associated with elemental carbon, and to compare this to the original non-conditioned size distribution. As a byproduct of the volatility analysis, new particles originating from nucleation inside the thermodenuder can be observed, however, overwhelmingly at diameters below 6 nm. Within the measurement uncertainty, every particle down to particle sizes of 15 nm is concluded to contain a non-volatile core. The volume fraction of non-volatile particulate matter (non-conditioned diameter < 800 nm varied between 10 and 30% and was largely consistent with the experimentally determined mass fraction of elemental carbon. The average size of the non-volatile particle cores was estimated as a function of original non-conditioned size using a summation method, which showed that larger particles (>200 nm contained more non-volatile compounds than smaller particles (<50 nm, thus indicating a significantly different chemical composition. Two alternative air mass classification schemes based on either, synoptic chart analysis (Berliner Wetterkarte or back trajectories showed that the volume and number fraction of non-volatile cores depended less on air mass than the total particle number concentration. In all air masses, the non-volatile size distributions showed a more and a less volatile ("soot" mode, the latter being located at about 50 nm. During unstable conditions and in maritime air masses, smaller values were observed compared to stable or continental conditions
Ion generation and CPC detection efficiency studies in sub 3-nm size range
Energy Technology Data Exchange (ETDEWEB)
Kangasluoma, J.; Junninen, H.; Sipilae, M.; Kulmala, M.; Petaejae, T. [Department of Physics, P.O. Box 64, 00014, University of Helsinki, Helsinki (Finland); Lehtipalo, K. [Department of Physics, P.O. Box 64, 00014, University of Helsinki, Helsinki (Finland); Airmodus Ltd., Finland, Gustaf Haellstroemin katu 2 A, 00560 Helsinki (Finland); Mikkilae, J.; Vanhanen, J. [Airmodus Ltd., Finland, Gustaf Haellstroemin katu 2 A, 00560 Helsinki (Finland); Attoui, M. [University Paris Est Creteil, University Paris-Diderot, LISA, UMR CNRS 7583 (France); Worsnop, D. [Department of Physics, P.O. Box 64, 00014, University of Helsinki, Helsinki (Finland) and Aerodyne Research Inc., Billerica, MA (United States)
2013-05-24
We studied the chemical composition of commonly used condensation particle counter calibration ions with a mass spectrometer and found that in our calibration setup the negatively charged ammonium sulphate, sodium chloride and tungsten oxide are the least contaminated whereas silver on both positive and negative and the three mentioned earlier in positive mode are contaminated with organics. We report cut-off diameters for Airmodus Particle Size Magnifier (PSM) 1.1, 1.3, 1.4, 1.6 and 1.6-1.8 nm for negative sodium chloride, ammonium sulphate, tungsten oxide, silver and positive organics, respectively. To study the effect of sample relative humidity on detection efficiency of the PSM we used different humidities in the differential mobility analyzer sheath flow and found that with increasing relative humidity also the detection efficiency of the PSM increases.
Ion generation and CPC detection efficiency studies in sub 3-nm size range
International Nuclear Information System (INIS)
Kangasluoma, J.; Junninen, H.; Sipilä, M.; Kulmala, M.; Petäjä, T.; Lehtipalo, K.; Mikkilä, J.; Vanhanen, J.; Attoui, M.; Worsnop, D.
2013-01-01
We studied the chemical composition of commonly used condensation particle counter calibration ions with a mass spectrometer and found that in our calibration setup the negatively charged ammonium sulphate, sodium chloride and tungsten oxide are the least contaminated whereas silver on both positive and negative and the three mentioned earlier in positive mode are contaminated with organics. We report cut-off diameters for Airmodus Particle Size Magnifier (PSM) 1.1, 1.3, 1.4, 1.6 and 1.6-1.8 nm for negative sodium chloride, ammonium sulphate, tungsten oxide, silver and positive organics, respectively. To study the effect of sample relative humidity on detection efficiency of the PSM we used different humidities in the differential mobility analyzer sheath flow and found that with increasing relative humidity also the detection efficiency of the PSM increases.
Influence of chromium ions on the color center formation in crystals with garnet structure
International Nuclear Information System (INIS)
Ashurov, M.Kh.; Zharikov, E.V.; Laptev, V.V.
1985-01-01
The in fluence of chromium ions on the color center formation in crystals of yttrium-aluminium garnet, gadolinium-gallium garnet, gadolinium-scandium-gallium garnet, and yttrium-scandium-gallium garnet is studied. In addition to basic activator ions these crystals were coactivated also by chromium ions with two wide bands of fundamental absorption within the range of pump tube radiation with maximas close to 450 and 650 nm. The color centers for γ-irradiated samples were observed at 300 K by measuring the adsorption spectra within the 300-800 nm range. Temperature of destruction of the charge trapping sites was determined by the method of thermoluminescence measuring in the 100-500 K temperature range. Detection of recombination center luminescence was accomplished within the 200-1600 nm wavelength range. Chromium ions are found to hinder the formation of color centers as a result of γ-irradiation at room and higher temperatures within the wavelength range over 300 nm; i.e. Cr 3+ ions increase radiation resistance of all the investigated crystals
International Nuclear Information System (INIS)
Ding Huafeng; Lu, Jun Q; Wooden, William A; Kragel, Peter J; Hu Xinhua
2006-01-01
The refractive index of human skin tissues is an important parameter in characterizing the optical response of the skin. We extended a previously developed method of coherent reflectance curve measurement to determine the in vitro values of the complex refractive indices of epidermal and dermal tissues from fresh human skin samples at eight wavelengths between 325 and 1557 nm. Based on these results, dispersion relations of the real refractive index have been obtained and compared in the same spectral region
UOP LDR 300 All Assignments New
ADMIN
2018-01-01
UOP LDR 300 All Assignments New Check this A+ tutorial guideline at http://www.ldr300assignment.com/ldr-300-uop/ldr-300-all-assignments-latest For more classes visit http://www.ldr300assignment.com LDR 300 Week 1 Assignment Leadership Assessment (2 Papers) LDR 300 Week 2 Assignment Leadership Theories Matrix (2 Set) LDR 300 Week 2 Assignment Formulating Leadership Part I (2 Papers) LDR 300 Week 3 Assignment Interaction and Influence Amo...
Via patterning in the 7-nm node using immersion lithography and graphoepitaxy directed self-assembly
Doise, Jan; Bekaert, Joost; Chan, Boon Teik; Hori, Masafumi; Gronheid, Roel
2017-04-01
Insertion of a graphoepitaxy directed self-assembly process as a via patterning technology into integrated circuit fabrication is seriously considered for the 7-nm node and beyond. At these dimensions, a graphoepitaxy process using a cylindrical block copolymer that enables hole multiplication can alleviate costs by extending 193-nm immersion-based lithography and significantly reducing the number of masks that would be required per layer. To be considered for implementation, it needs to be proved that this approach can achieve the required pattern quality in terms of defects and variability using a representative, aperiodic design. The patterning of a via layer from an actual 7-nm node logic layout is demonstrated using immersion lithography and graphoepitaxy directed self-assembly in a fab-like environment. The performance of the process is characterized in detail on a full 300-mm wafer scale. The local variability in an edge placement error of the obtained patterns (4.0 nm 3σ for singlets) is in line with the recent results in the field and significantly less than of the prepattern (4.9 nm 3σ for singlets). In addition, it is expected that pattern quality can be further improved through an improved mask design and optical proximity correction. No major complications for insertion of the graphoepitaxy directed self-assembly into device manufacturing were observed.
New energy levels of atomic niobium (Nb I) discovered by laser-spectroscopic investigations
Kröger, S.; Windholz, L.; Başar, Gü.; Başar, Gö.
2018-06-01
We report the discovery of 9 previously unknown energy levels of the atomic niobium, all having even parity. Two levels have energies below 19,500 cm-1 and angular momentum J = 3/2, while the energies of the others are located between 39,700 and 43,420 cm-1. The levels were discovered by laser excitation of several unclassified spectral lines in the wavelength range between 554 nm and 650 nm and detection of laser-induced fluorescence with a monochromator.
42 CFR 420.304 - Procedures for obtaining access to books, documents, and records.
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false Procedures for obtaining access to books, documents... Books, Documents, and Records of Subcontractors § 420.304 Procedures for obtaining access to books... following elements: (1) Reasonable identification of the books, documents, and records to which access is...
International Nuclear Information System (INIS)
Phaneuf, R.A.; Taylor, P.O.; Dunn, G.H.
1976-01-01
Crossed beams of electrons and Hg + ions have been used to measure absolute cross sections for emission of 284.7-nm radiation, resulting from excitation of a predominantly ground-state Hg + target to the 7s 2 S 1 / 2 state. Values range from 3 x 10 -17 cm 2 near threshold, where the cross section is strongly peaked, to 1.3 x 10 -18 cm 2 at 280 eV. Also reported are some measurements of emission of 479.7-nm (Hg III) radiation, resulting from electron impact on both Hg + and Hg ++ targets. Cross sections range from approximately 5 x 10 -19 to 5 x 10 -20 cm 2 , and in the case of electron-Hg ++ collisions, are more than an order of magnitude smaller than predicted by an available semiclassical binary-encounter calculation
Directory of Open Access Journals (Sweden)
Dario Nicetto
Full Text Available Post-translational modifications (PTMs of histones exert fundamental roles in regulating gene expression. During development, groups of PTMs are constrained by unknown mechanisms into combinatorial patterns, which facilitate transitions from uncommitted embryonic cells into differentiated somatic cell lineages. Repressive histone modifications such as H3K9me3 or H3K27me3 have been investigated in detail, but the role of H4K20me3 in development is currently unknown. Here we show that Xenopus laevis Suv4-20h1 and h2 histone methyltransferases (HMTases are essential for induction and differentiation of the neuroectoderm. Morpholino-mediated knockdown of the two HMTases leads to a selective and specific downregulation of genes controlling neural induction, thereby effectively blocking differentiation of the neuroectoderm. Global transcriptome analysis supports the notion that these effects arise from the transcriptional deregulation of specific genes rather than widespread, pleiotropic effects. Interestingly, morphant embryos fail to repress the Oct4-related Xenopus gene Oct-25. We validate Oct-25 as a direct target of xSu4-20h enzyme mediated gene repression, showing by chromatin immunoprecipitaton that it is decorated with the H4K20me3 mark downstream of the promoter in normal, but not in double-morphant, embryos. Since knockdown of Oct-25 protein significantly rescues the neural differentiation defect in xSuv4-20h double-morphant embryos, we conclude that the epistatic relationship between Suv4-20h enzymes and Oct-25 controls the transit from pluripotent to differentiation-competent neural cells. Consistent with these results in Xenopus, murine Suv4-20h1/h2 double-knockout embryonic stem (DKO ES cells exhibit increased Oct4 protein levels before and during EB formation, and reveal a compromised and biased capacity for in vitro differentiation, when compared to normal ES cells. Together, these results suggest a regulatory mechanism, conserved
IM/DD vs. 4-PAM Using a 1550-nm VCSEL over Short-Range SMF/MMF Links for Optical Interconnects
DEFF Research Database (Denmark)
Karinou, Fotini; Rodes Lopez, Roberto; Prince, Kamau
2013-01-01
We experimentally compare the performance of 10.9-Gb/s IM/DD and 5-GBd 4-PAM modulation formats over 5-km SMF and 1-km MMF links, employing a commercially-available 1550-nm VCSEL as an enabling technology for use in optical interconnects.......We experimentally compare the performance of 10.9-Gb/s IM/DD and 5-GBd 4-PAM modulation formats over 5-km SMF and 1-km MMF links, employing a commercially-available 1550-nm VCSEL as an enabling technology for use in optical interconnects....
[Comparative investigation of underwater-LIBS using 532 and 1 064 nm lasers].
Song, Jiao-Jian; Tian, Ye; Lu, Yuan; Li, Ying; Zheng, Rong-Er
2014-11-01
With the hope of applying laser induced breakdown spectroscopy (LIBS) to the ocean applications, the laser energy at 532 and 1 064 nm wavelength with 3 and 40 mj respectively was used, which was near their breakdown threshold. Extensive experimental investigations of LIBS from CaCl2 water solution were carried out in this paper using different laser wavelengths of 532 and 1 064 nm. The obtained results show that compared with the 532 nm laser, the 1 064 nm laser can induce the plasma in water with higher emission intensity and longer lifetime, while the reproducibility of LIBS signal under 1 064 nm laser is poorer. On the other hand, due to the different attenuation ratios of 532 and 1 064 nm laser energies in water, the LIBS signal of 1 064 nm laser decreases a lot within the transmission distance range 2-5 cm, while LIBS signal of 532 nm remains the same, because that the wavelength of 532 nm lies in the "transmission window" of the water solution. This study will provide valuable design considerations for the development of LIBS-sea system in near future.
Bernstein, Eric F; Bhawalkar, Jay; Clifford, Joan; Hsia, James
2010-11-01
Multi-colored and even black tattoos often require more than one wavelength to remove the target pigment. The authors report here a novel alexandrite laser with two Nd:YAG laser handpieces pumped by the alexandrite treatment beam enabling the delivery of three wavelengths from a single device. To describe and evaluate the effectiveness of a novel Q-switched laser-pumped laser for treating tattoos. Twenty tattoos in 14 subjects were treated at four-week intervals using a combination of available wavelengths (532, 755 and 1064 nm) as determined by the treating physician. Digital cross-polarized photographs were taken before treatment and two months following the fourth and final treatment. Photographs were evaluated by three physician observers blinded as to the treatment condition and rated for clearance by the following scale: 1 = > 95 percent, 2 = 76-95 percent, 3 = 51-75 percent, 4 = 26-50 percent and 5 = 0-25 percent clearance. The average clearance score was 3.1, in the 51-75 percent range, two months following four treatments. No scarring, hyper- or hypopigmentation was noted on post-treatment photographs or by the treating physician. The alexandrite and alexandrite-pumped 532 nm and 1064 nm Q-switched lasers are effective for removing decorative tattoos, and represents the first commercial laser with laser-pumped, laser handpieces.
High-power 355 nm ultraviolet lasers operating at ultrahigh repetition rate
International Nuclear Information System (INIS)
Chen, H; Liu, Q; Yan, P; Gong, M
2013-01-01
In this letter, we demonstrate a novel 355 nm ultraviolet (UV) laser operating at ultrahigh repetition rate from 300 kHz to 1 MHz. The hybrid fiber-MOPA–bulk amplifiers based IR source exhibits a high average power of 105 W with near-diffraction-limited beam quality, narrow linewidth and high polarization extinction ratio. Two-cascaded LBO crystals are employed for high efficiency frequency tripling, and a maximum 43.7 W of average UV power is achieved at 400 kHz, corresponding to a conversion efficiency as high as 41.6%. The pulse duration of the UV pulse can be tuned from 5 to 10 ns with good pulse peak stability (better than 2.2% (RMS)). (letter)
24 CFR 401.420 - When must the Restructuring Plan require project-based assistance?
2010-04-01
... HOUSING ASSISTANCE RESTRUCTURING PROGRAM (MARK-TO-MARKET) Restructuring Plan § 401.420 When must the..., if: (a) The PAE determines there is a market-wide vacancy rate of 6 percent or less; (b) At least 50 percent of the units in the project are occupied by elderly families, disabled families, or elderly and...
New fractal structures for frequencies close to the visible range
DEFF Research Database (Denmark)
Malureanu, Radu; Sandru, A.; Andryieuski, Andrei
2011-01-01
In this paper we present a new type of fractal resonator to be used in the red/NIR region of the spectra. The structure presents high-transmission band in 795-825nm range. The stop band is in the 683-731 nm range. Due to the huge difference in the spectra within such a short range, the structure...
Itakura, Keisuke; Kayano, Keisuke; Nakazato, Kazuo; Niitsu, Kiichi
2018-01-01
We present an impedance-detection complementary metal oxide semiconductor (CMOS) biosensor circuit for cell-state observation. The proposed biosensor can measure the expected impedance values encountered by a cell-state observation measurement system within a 0.1-200 MHz frequency range. The proposed device is capable of monitoring the intracellular conditions necessary for real-time cell-state observation, and can be fabricated using a 55 nm deeply depleted channel CMOS process. Operation of the biosensor circuit with 0.9 and 1.7 V supply voltages is verified via a simulated program with integrated circuit emphasis (SPICE) simulation. The power consumption is 300 µW. Further, the standby power consumption is 290 µW, indicating that this biosensor is a low-power instrument suitable for use in Internet of Things (IoT) devices.
Fluorescence Imaging In Vivo at Wavelengths beyond 1500 nm.
Diao, Shuo; Blackburn, Jeffrey L; Hong, Guosong; Antaris, Alexander L; Chang, Junlei; Wu, Justin Z; Zhang, Bo; Cheng, Kai; Kuo, Calvin J; Dai, Hongjie
2015-12-01
Compared to imaging in the visible and near-infrared regions below 900 nm, imaging in the second near-infrared window (NIR-II, 1000-1700 nm) is a promising method for deep-tissue high-resolution optical imaging in vivo mainly owing to the reduced scattering of photons traversing through biological tissues. Herein, semiconducting single-walled carbon nanotubes with large diameters were used for in vivo fluorescence imaging in the long-wavelength NIR region (1500-1700 nm, NIR-IIb). With this imaging agent, 3-4 μm wide capillary blood vessels at a depth of about 3 mm could be resolved. Meanwhile, the blood-flow speeds in multiple individual vessels could be mapped simultaneously. Furthermore, NIR-IIb tumor imaging of a live mouse was explored. NIR-IIb imaging can be generalized to a wide range of fluorophores emitting at up to 1700 nm for high-performance in vivo optical imaging. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Percutaneous Drainage of 300 Intraperitoneal Abscesses with Long-Term Follow-Up
International Nuclear Information System (INIS)
Akinci, Devrim; Akhan, Okan; Ozmen, Mustafa N.; Karabulut, Nevzat; Ozkan, Orhan; Cil, Barbaros E.; Karcaaltincaba, Musturay
2005-01-01
The purpose of the study was to evaluate the efficacy of percutaneous drainage of intraperitoneal abscesses with attention to recurrence and failure rates. A retrospective analysis of percutaneous treatment of 300 intraperitoneal abscesses in 255 patients (147 male, 108 female; average age: 38 years; range: 40 days to 90 years) for whom at least 1-year follow-up data were available was performed. Abscesses were drained with fluoroscopic, sonographic, or computed tomographic guidance. Nine abscesses were drained by simple aspiration; catheter drainage either by Seldinger or trocar technique was used in the remaining 291 abscesses with 6F to 14 F catheters. Initial cure and failure rates were 68% (203/300) and 12% (36/300), respectively. Sixty-one abscesses (20%) were either palliated or temporized. The recurrence rate was 4% (12/300) and nine of them were cured by recatheterization, whereas three of them were treated by medication or surgery. The overall success and failure rates were 91% (273/300) and 9% (27/300), respectively, with temporized, palliated, and recatheterized recurred abscesses. The 30-day mortality rate was 3.1% (8/255). The mean duration of catheterization was 13 days. Intraperitoneal abscesses with safe access routes should be drained percutaneously because of high success and low morbidity, mortality, and recurrence rates
Hakeem, D A; Park, K
2015-07-01
The crystal structure and luminescence properties of Na(Sr0.97-xCax)PO4:0.03Eu2+ (0 phosphors were studied, depending on the Ca2+ concentration. All the Na(Sr0.97-xCax)PO4:0.03Eu2+ phosphors had a hexagonal crystal structure. The excitation spectra of the prepared phosphors showed a broad band ranging from 250 to 420 nm, which arises due to the 4f-5d transitions of Eu2+ ions. Upon the excitation of 334 nm wavelength, the emission spectra showed a broad blue band ranging from 400 to 700 nm peaking at 450 nm. Among the prepared phosphors, the Na(Sr0.72Ca0.25)PO4:0.03Eu2+ showed the strongest emission intensity and could be applied as a blue emitting phosphor for UV-based w-LEDs.
Economical evaluation on gas turbine high temperature reactor 300 (GTHTR300)
International Nuclear Information System (INIS)
Takei, Masanobu; Kosugiyama, Shinichi; Mouri, Tomoaki; Katanishi, Shoji; Kunitomi, Kazuhiko
2006-01-01
Japan Atomic Energy Research Institute (JAERI) has been developing a graphite moderate and helium cooled High Temperature Gas-cooled Reactor (HTGR) with gas turbine, the GTHTR300 based on experience gained in development and operations of the High Temperature Engineering Test Reactor (HTTR) in JAERI. The GTHTR300 is a simplified and economical power plant with a high level of safety characteristics and a high plant efficiency of approximately 46%. Cost evaluation for plant construction and power generation is studied in order to clarify the economical feasibility of the GTHTR300. The construction cost is estimated to be about 200 thousands Yen/kWe. The power generation cost is estimated to be about 3.8 Yen/kWh by the conditions of 90% load factor and 3% discount rate. The economical feasibility of the GTHTR300 is certified. The present study is entrusted from Ministry of Education, Culture, Sports, Science and Technology of Japan. (author)
High-performance 3D printing of hydrogels by water-dispersible photoinitiator nanoparticles.
Pawar, Amol A; Saada, Gabriel; Cooperstein, Ido; Larush, Liraz; Jackman, Joshua A; Tabaei, Seyed R; Cho, Nam-Joon; Magdassi, Shlomo
2016-04-01
In the absence of water-soluble photoinitiators with high absorbance in the ultraviolet (UV)-visible range, rapid three-dimensional (3D) printing of hydrogels for tissue engineering is challenging. A new approach enabling rapid 3D printing of hydrogels in aqueous solutions is presented on the basis of UV-curable inks containing nanoparticles of highly efficient but water-insoluble photoinitiators. The extinction coefficient of the new water-dispersible nanoparticles of 2,4,6-trimethylbenzoyl-diphenylphosphine oxide (TPO) is more than 300 times larger than the best and most used commercially available water-soluble photoinitiator. The TPO nanoparticles absorb significantly in the range from 385 to 420 nm, making them suitable for use in commercially available, low-cost, light-emitting diode-based 3D printers using digital light processing. The polymerization rate at this range is very fast and enables 3D printing that otherwise is impossible to perform without adding solvents. The TPO nanoparticles were prepared by rapid conversion of volatile microemulsions into water-dispersible powder, a process that can be used for a variety of photoinitiators. Such water-dispersible photoinitiator nanoparticles open many opportunities to enable rapid 3D printing of structures prepared in aqueous solutions while bringing environmental advantages by using low-energy curing systems and avoiding the need for solvents.
34 CFR Appendix E to Part 300 - Index for IDEA-Part B Regulations (34 CFR Part 300)
2010-07-01
... assessments 300.320(a)(6)(i). • State level activities in support of 300.704(b)(4)(x). ACT (Definition) 300.4... definition of “Secondary school” 300.36. • State-level activities regarding charter schools 300.704(b)(4)(ix... determination • Lack of instruction in reading or math (see § 300.306(b)(1)(i), (b)(1)(ii)) • Limited English...
Energy Technology Data Exchange (ETDEWEB)
Islam, Md. Ariful, E-mail: arifapee19@gmail.com [Department of Physics, Rajshahi University of Engineering & Technology (RUET), Rajshahi (Bangladesh); Roy, Ratan Chandra; Hossain, Jaker; Julkarnain, Md.; Khan, Khairul Alam [Department of Applied Physics & Electronic Engineering, University of Rajshahi (Bangladesh)
2017-01-15
Vanadium (5 at. %) doped Indium Oxide (V: In{sub 2}O{sub 3}) thin films with different thicknesses (50 nm, 100 nm and 150 nm) were prepared onto glass substrate by electron beam evaporation technique in a vacuum of about 4 x 10{sup -3} Pa. X-ray diffraction (XRD) pattern revealed that the prepared films of thickness 50 nm are amorphous in nature. Temperature dependence of electrical resistivity was studied in the 300 < T < 475 K temperature range. The films exhibit a metallic behavior in the 300 < T < 380 K range with a positive temperature coefficient of the resistivity (TCR), whereas at T > 380 K, the conduction behavior turns into a semiconductor with a negative TCR. Optical studies revealed that the films of thickness 50 nm possess high transmittance of about 86 % in the near-infrared spectral region. The direct optical band gap lies between 3.26 and 3.00 eV depending on the film thickness. (author)
Gün, Teoman; Metz, Philip; Huber, Günter
2011-03-15
We report efficient cw laser operation of laser diode pumped Pr(3+)-doped LiYF4 crystals in the visible spectral region. Using two InGaN laser diodes emitting at λ(P)=443.9 nm with maximum output power of 1 W each and a 2.9-mm-long crystal with a doping concentration of 0.5%, output powers of 938 mW, 418 mW, 384 mW, and 773 mW were achieved for the laser wavelengths 639.5 nm, 607.2 nm, 545.9 nm, and 522.6 nm, respectively. The maximum absorbed pump powers were approximately 1.5 W, resulting in slope efficiencies of 63.6%, 32.0%, 52.1%, and 61.5%, as well as electro-optical efficiencies of 9.4%, 4.2%, 3.8%, and 7.7%, respectively. Within these experiments, laser diode-pumped laser action at 545.9 nm was demonstrated for what is believed to be the first time.
20 CFR 663.420 - Can the duration and amount of ITA's be limited?
2010-04-01
... Training Accounts § 663.420 Can the duration and amount of ITA's be limited? (a) Yes, the State or Local Board may impose limits on ITA's, such as limitations on the dollar amount and/or duration. (b) Limits... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Can the duration and amount of ITA's be...
Thin film and multilayer optics for XUV spectral domain (1 nm to 60 nm)
International Nuclear Information System (INIS)
Delmotte, Franck
2010-02-01
The XUV spectral domain (1-60 nm wavelength range) has experienced rapid growth in recent years. On one side, the sources (synchrotron radiation, harmonic generation, x-ray laser, free-electron laser...) require ever more efficient optics, on the other hand, applications (diagnostics of hot plasma, solar physics, x-ray microscopy, EUV lithography, x-ray analysis...) provide new constraints on the design of multilayer stacks. The multilayer mirrors are the only way to achieve efficient optics operating at non-grazing incidence angles in this spectral range. Our work within the team XUV Optics at Laboratoire Charles Fabry de l'Institut d'Optique focuses on the study of materials in thin layers correlated to the study of optical properties of multilayers. The objective is to achieve new multilayer components previously unavailable in the XUV domain, through a better understanding of physical phenomena in these nano-layer stacks. We show through several examples of how we have managed both to improve the performance of multilayer mirrors in a broad spectral range, and secondly, to develop new optical functions: beam splitters, broadband mirrors, dual-band mirrors or phase compensation mirrors. (author)
Photonic bandgap structures for long-range surface plasmon polaritons
DEFF Research Database (Denmark)
Bozhevolnyi, Sergey I.; Boltasseva, Alexandra; Søndergaard, Thomas
2005-01-01
Propagation of long-range surface plasmon polaritons (LR-SPPs) along periodically thickness-modulated metal stripes embedded in dielectric is studied both theoretically and experimentally for light wavelengths in the telecom range. We demonstrate that symmetric (with respect to the film surface) nm......-size thickness variations result in the pronounced band gap effect, and obtain very good agreement between measured and simulated (transmission and reflection) spectra. This effect is exploited to realize a compact wavelength add-drop filter with the bandwidth of -20 nm centered at 1550 nm. The possibilities...
Multicomponent Protein Cage Architectures for Photocatalysis
Energy Technology Data Exchange (ETDEWEB)
Gupta, Arunava [Univ. of Alabama, Tuscaloosa, AL (United States); Prevelige, Peter E [Univ. of Alabama, Birmingham, AL (United States)
2016-01-04
The primary goal of the project was to develop protein-templated approaches for the synthesis and directed assembly of semiconductor nanomaterials that are efficient for visible light absorption and hydrogen production. In general, visible-light-driven photocatalysis reactions exhibit low quantum efficiency for solar energy conversion primarily because of materials-related issues and limitations, such as the control of the band gap, band structure, photochemical stability, and available reactive surface area of the photocatalyst. Synthesis of multicomponent hierarchical nano-architectures, consisting of semiconductor nanoparticles (NPs) with desired optical properties fabricated to maximize spatial proximity for optimum electron and energy transfer represents an attractive route for addressing the problem. Virus capsids are highly symmetrical, self-assembling protein cage nanoparticles that exist in a range of sizes and symmetries. Selective deposition of inorganic, by design, at specific locations on virus capsids affords precise control over the size, spacing, and assembly of nanomaterials, resulting in uniform and reproducible nano-architectures. We utilized the self-assembling capabilities of the 420 subunit, 60 nm icosahedral, P22 virus capsid to direct the nucleation, growth, and proximity of a range of component materials. Controlled fabrication on the exterior of the temperature stable shell was achieved by genetically encoding specific binding peptides into an externally exposed loop which is displayed on each of the 420 coat protein subunits. Localization of complimentary materials to the interior of the particle was achieved through the use “scaffolding-fusion proteins. The scaffolding domain drives coat protein polymerization resulting in a coat protein shell surrounding a core of approximately 300 scaffolding/fusion molecules. The fusion domain comprises a peptide which specifically binds the semiconductor material of interest.
Chiu, Shao-Pin; Chung, Hui-Fang; Lin, Yong-Han; Kai, Ji-Jung; Chen, Fu-Rong; Lin, Juhn-Jong
2009-03-01
Single-crystalline indium tin oxide (ITO) nanowires (NWs) were grown by the standard thermal evaporation method. The as-grown NWs were typically 100-300 nm in diameter and a few µm long. Four-probe submicron Ti/Au electrodes on individual NWs were fabricated by the electron-beam lithography technique. The resistivities of several single NWs have been measured from 300 down to 1.5 K. The results indicate that the as-grown ITO NWs are metallic, but disordered. The overall temperature behavior of resistivity can be described by the Bloch-Grüneisen law plus a low-temperature correction due to the scattering of electrons off dynamic point defects. This observation suggests the existence of numerous dynamic point defects in as-grown ITO NWs.
International Nuclear Information System (INIS)
Chiu, S-P; Lin, J-J; Chung, H-F; Kai, J-J; Chen, F-R; Lin, Y-H
2009-01-01
Single-crystalline indium tin oxide (ITO) nanowires (NWs) were grown by the standard thermal evaporation method. The as-grown NWs were typically 100-300 nm in diameter and a few μm long. Four-probe submicron Ti/Au electrodes on individual NWs were fabricated by the electron-beam lithography technique. The resistivities of several single NWs have been measured from 300 down to 1.5 K. The results indicate that the as-grown ITO NWs are metallic, but disordered. The overall temperature behavior of resistivity can be described by the Bloch-Grueneisen law plus a low-temperature correction due to the scattering of electrons off dynamic point defects. This observation suggests the existence of numerous dynamic point defects in as-grown ITO NWs.
Dudka, A. P.; Antipin, A. M.; Verin, I. A.
2017-09-01
Huber-5042 diffractometer with a closed-cycle Displex DE-202 helium cryostat is a unique scientific instrument for carrying out X-ray diffraction experiments when studying the single crystal structure in the temperature range of 20-300 K. To make the service life longer and develop new experimental techniques, the diffractometer control is transferred to a new hardware and software platform. To this end, a modern computer; a new detector reader unit; and new control interfaces for stepper motors, temperature controller, and cryostat vacuum pumping system are used. The system for cooling the X-ray tube, the high-voltage generator, and the helium compressor and pump for maintaining the desired vacuum in the cryostat are replaced. The system for controlling the primary beam shutter is upgraded. A biological shielding is installed. The new program tools, which use the Linux Ubuntu operating system and SPEC constructor, include a set of drivers for control units through the aforementioned interfaces. A program for searching reflections from a sample using fast continuous scanning and a priori information about crystal is written. Thus, the software package for carrying out the complete cycle of precise diffraction experiment (from determining the crystal unit cell to calculating the integral reflection intensities) is upgraded. High quality of the experimental data obtained on this equipment is confirmed in a number of studies in the temperature range from 20 to 300 K.
Regional cerebral blood flow and P300 in neurosurgical disorders
International Nuclear Information System (INIS)
Funahashi, Kazuyoshi; Hyoutani, Genhachi; Maeshima, Shinichirou; Miyamoto, Kazuki; Kuwata, Toshikazu; Terada, Tomoaki; Komai, Norihiko
1990-01-01
Changes in regional cerebral blood flow (rCBF), P300 and higher brain function were studied in neurosurgical patients with localized lesions on computed tomography (CT). Twenty-five patients ranging in age from 30 to 81 were studied. Nineteen of these suffered from cerebrovascular disease and six had tumors. Using the oddball paradigm, P300 components were elicited by rate tones (2 KHz) and recorded at Cz and Pz referred to linked ear-lobe electorodes. The P300 latencies of the patients were statistically compared with those of 27 normal subjects. Higher brain function was evaluated with the following psychological tests: a rating scale for psychological function (Sano and Tanemura), Mini-Mental State (MMS), Hasegawa's Dementia Scale (HDS) and the 'Kanahiroi' test. Regional CBF was measured in the bilateral cerebral cortices (the frontal, temporal and occipital lobes), thalamus and basal ganglia by means of a cold xenon CT method. The laterality indices of rCBF (Rt. rCBF/Lt. rCBF) in the bilateral symmetrical areas of the patients were compared to those of 8 normal subjects. Of the 25 patients, 12 revealed prolongation of P300 latency. Ten (86%) of the 12 with prolonged P300 latency showed reduction of rCBF in the right cerebral hemisphere (rt. frontal lobe, rt. thalamus and rt. basal ganglia). Significant correlations (P<0.025) were recognized between the P300 latencies and the laterality indices of rCBF in the frontal lobe and thalamus. There was a significant correlation (P<0.05) between the scores of MMS and HDS and the laterality indicies of rCBF in the frontal lobe only. In the 13 patients with normal P300 latency, 6 (46%) displayed no reduction in rCBF. The remaining 7 patients with normal P300 showed reduction of rCBF in the left hemisphere. Both right frontal lobe and right thalamus have an important role affecting the prolongation of P300 latency and disturbance of cognitive functions. (author)
20 CFR 658.420 - Establishment of JS complaint system at the ETA regional office.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Establishment of JS complaint system at the... Complaint System Federal Js Complaint System § 658.420 Establishment of JS complaint system at the ETA regional office. (a) Each Regional Administrator shall establish and maintain a JS complaint system at the...
Analysis of the quasi-continuum band emitted by highly ionised tungsten atoms in the 4-7 nm range
International Nuclear Information System (INIS)
Madeira, T.I.; Amorim, P.; Marques, J.P.; Parente, F.; Indelicato, P.
2013-01-01
For the next upcoming generation of fusion experiments, such as ITER,Tungsten has been chosen as the materials for plasma facing components. Spectra emitted by highly ionized tungsten atoms from magnetically confined plasmas show a common feature: a narrow structured quasi-continuum emission band most prominent in the range 4-7 nm, which accounts for 40-80% of the radiated power. This band has been fairly well explained by unresolved transitions from groups 4d-4p, 4f-4d (Δn = 0) and 5d-4f, 5g-4f and 5p-4d (Δn = 1). In this work we use a Multi-Configuration Dirac-Fock code in Breit self-consistent field mode to compute level energies and transition probabilities for W 27+ to W 37+ ions contributing to this emission band. Intra-shell correlation was introduced in the calculation for both initial and final states and all dipole and quadrupole radiative transitions have been considered. The wavefunctions in the initial and final states are optimized separately and the resulting non-orthogonality effect is fully taken into account. The importance of some satellite lines was assessed. Together with the ionic distributions obtained by using the FLYCHK application and assuming that the initial states population depends statistically on the temperature we were able to synthesize plasma emission spectrum profiles for several electron temperatures. (authors)
International Nuclear Information System (INIS)
Souza, Joao Henrique Campos de; Giacomet, Andrea Fatima; Cunha, Tarcisio; Drumond, Ivens; Sa, Fabiana O.; Mendes, Paula
2005-01-01
The Portaria of the Ministry of Health no. 279 (Ordinance 279), of February 22, 2005, establishes a Working Group-GT with the purpose to elaborate standards relating to human exposure to electromagnetic fields in the range of 9 kHz to 300 GHz in the Sistema Unico de Saude (National System of Health), Brazil. Since then, we have conducted several studies on the biological effects of radiation exposure in this spectral range. The GT proposes the use of the geographical instruments coupled information systems to define an alternative pattern of surveillance, based on the determination of Areas of Risks. Each source of electromagnetic radiation is associated with territorial boundaries that surround it using progressively larger distances, thus determining areas of influence whose intensity is attenuated as the distance to the source increases. This paper presents the main results obtained by the Working Group
Green synthesis, structure and fluorescence spectra of new azacyanine dyes
Enchev, Venelin; Gadjev, Nikolai; Angelov, Ivan; Minkovska, Stela; Kurutos, Atanas; Markova, Nadezhda; Deligeorgiev, Todor
2017-11-01
A series of symmetric and unsymmetric monomethine azacyanine dyes (monomethine azacyanine and merocyanine sulfobetaines) were synthesized with moderate to high yields via a novel method using microwave irradiation. The compounds are derived from a condensation reaction between 2-thiomethylbenzotiazolium salts and 2-imino-3-methylbenzothiazolines proceeded under microwave irradiation. The synthetic approach involves the use of green solvent and absence of basic reagent. TD-DFT calculations were performed to simulate absorption and fluorescent spectra of synthesized dyes. Absorption maxima, λmax, of the studied dyes were found in the range 364-394 nm. Molar absorbtivities were evaluated in between 40300 and 59200 mol-1 dm3 cm-1. Fluorescence maxima, λfl, were registered around 418-448 nm upon excitation at 350 nm. A slight displacements of theoretically estimated absorption maxima according to experimental ones is observed. The differences are most probably due to the fact that the DFT calculations were carried out without taking into account the solvent effect. In addition, the merocyanine sulfobetaines also fluorescence in blue optical range (420-480 nm) at excitation in red range (630-650 nm).
A dynamic range upgrade for neutron backscattering spectroscopy
International Nuclear Information System (INIS)
Cook, J.C.; Petry, W.; Heidemann, A.; Barthelemy, J.F.
1992-01-01
We report on an instrumental development of the cold neutron backscattering spectrometer IN10 at the Institut Laue-Langevin which has led to a significant increase in its dynamic range. Thermal expansion of a variety of neutron monochromator crystals is used instead of a mechanical oscillation of the monochromator, yielding an increase in the energy transfer range by nearly two orders of magnitude in an elastic wave vector transfer range of 0.07≤Q (A -1 )≤2.0. Using this new configuration, first inelastic measurements have been performed using the (200) reflections from KCl and NaCl monochromators with crystal temperatures between 80 K and 700 K. The thermal expansion of these crystals in this temperature range gives rise to energy transfer ranges (neutron energy gain) of -16<ℎω(μeV)<+83 for KCl and -530<ℎω(μeV)<-420 for NaCl with energy resolution (FWHM) of around 0.6 and 1.4 μeV for KCl and NaCl respectively. These figures represent the highest energy resolution currently available at these energy and wave vector transfers. (orig.)
Leakage radiation spectroscopy of organic/dielectric/metal systems
DEFF Research Database (Denmark)
Fiutowski, Jacek; Kawalec, Tomasz; Kostiučenko, Oksana
2014-01-01
side of a hemisphere fused silica prism with an index matching liquid was illuminated under normal incidence by a He-Cd 325 nm laser. Two orthogonal linear polarizations were used both parallel and perpendicular to the detection plane. Spectrally resolved leakage radiation was observed on the opposite......Leakage radiation spectroscopy of organic para-Hexaphenylene (p-6P) molecules has been performed in the spectral range 420-675 nm which overlaps with the p-6P photoluminescence band. The p-6P was deposited on 40 nm silver (Ag) films on BK7 glass, covered with SiO2 layers. The SiO2 layer thickness...
Mansour, A. M.; El-Taweel, F. M. A.; Abu El-Enein, R. A. N.; El-Menyawy, E. M.
2017-12-01
2-Amino-4-(5-bromothiophen-2-yl)-5,6-dihydro-6-methyl-5-oxo-4 H-pyrano[3,2-c] quinoline-3-carbonitrile (ABDQC) powder was synthesized and showed thermal stability up to 535 K. ABDQC films were successfully prepared using thermal evaporation. X-ray diffraction showed that the prepared ABDQC powder had a polycrystalline structure, whereas the deposited film had an amorphous structure. The surface morphology of the films was characterized by using a transmission electron microscope. Optical absorption properties of ABDQC films were investigated by spectrophotometric measurements of the transmittance and reflectance in the wavelength range 200-2500 nm. The films were found to have indirect allowed optical band gap of 2.5 eV. Current-voltage characteristics of Au/ABDQC/ p-Si/Al were measured at different temperatures (300-420 K) in which the temperature dependence of the diode parameters has been discussed. Under illumination, the device showed open-circuit voltage and short-circuit current of 0.09 V and 3.26 × 10-4 A, respectively.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Mediation. 300.506 Section 300.506 Education... DISABILITIES Procedural Safeguards Due Process Procedures for Parents and Children § 300.506 Mediation. (a... due process complaint, to resolve disputes through a mediation process. (b) Requirements. The...
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Evaluation. 300.122 Section 300.122 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES State Eligibility Additional Eligibility Requirements § 300.122 Evaluation. Children with...
2010-01-01
... CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Canning and Canned Products § 381.300 Definitions. (a... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Definitions. 381.300 Section 381.300 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY...
Formation of nickel germanides from Ni layers with thickness below 10 nm
Energy Technology Data Exchange (ETDEWEB)
Jablonka, Lukas; Kubart, Tomas; Primetzhofer, Daniel; Abedin, Ahmad; Hellström, Per-Erik; Östling, Mikael; Jordan-Sweet, Jean; Lavoie, Christian; Zhang, Shi-Li; Zhang, Zhen
2017-03-01
The authors have studied the reaction between a Ge (100) substrate and thin layers of Ni ranging from 2 to 10 nm in thickness. The formation of metal-rich Ni5Ge3Ni5Ge3 was found to precede that of the monogermanide NiGe by means of real-time in situ x-ray diffraction during ramp-annealing and ex situ x-ray pole figure analyses for phase identification. The observed sequential growth of Ni5Ge3Ni5Ge3 and NiGe with such thin Ni layers is different from the previously reported simultaneous growth with thicker Ni layers. The phase transformation from Ni5Ge3Ni5Ge3 to NiGe was found to be nucleation-controlled for Ni thicknesses <5 nm<5 nm, which is well supported by thermodynamic considerations. Specifically, the temperature for the NiGe formation increased with decreasing Ni (rather Ni5Ge3Ni5Ge3) thickness below 5 nm. In combination with sheet resistance measurement and microscopic surface inspection of samples annealed with a standard rapid thermal processing, the temperature range for achieving morphologically stable NiGe layers was identified for this standard annealing process. As expected, it was found to be strongly dependent on the initial Ni thickness
40 CFR 63.300 - Applicability.
2010-07-01
... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Applicability. 63.300 Section 63.300 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL... Oven Batteries § 63.300 Applicability. (a) Unless otherwise specified in §§ 63.306, 63.307, and 63.311...
International Nuclear Information System (INIS)
Sambruna, R.M.; Ghisellini, G.; Hooper, E.; Kollgaard, R.I.; Pesce, J.E.; Urry, C.M.
1999-01-01
We present ASCA observations of the radio-selected BL Lacertae objects 1749+096 (z=0.32) and 2200+420 (BL Lac, z=0.069) performed in 1995 September and November, respectively. The ASCA spectra of both sources can be described as a first approximation by a power law with photon index Γ∼2. This is flatter than for most X-ray endash selected BL Lacs observed with ASCA, in agreement with the predictions of current blazar unification models. While 1749+096 exhibits tentative evidence for spectral flattening at low energies, a concave continuum is detected for 2200+420: the steep low-energy component is consistent with the high-energy tail of the synchrotron emission responsible for the longer wavelengths, while the harder tail at higher energies is the onset of the Compton component. The two BL Lacs were observed with ground-based telescopes from radio to TeV energies contemporaneously with ASCA. The spectral energy distributions are consistent with synchrotron self-Compton emission from a single homogeneous region shortward of the IR/optical wavelengths, with a second component in the radio domain related to a more extended emission region. For 2200+420, comparing the 1995 November state with the optical/GeV flare of 1997 July, we find that models requiring inverse Compton scattering of external photons provide a viable mechanism for the production of the highest (GeV) energies during the flare. In particular, an increase of the external radiation density and of the power injected in the jet can reproduce the flat γ-ray continuum observed in 1997 July. A directly testable prediction of this model is that the line luminosity in 2200+420 should vary shortly after (∼1 month) a nonthermal synchrotron flare. copyright copyright 1999. The American Astronomical Society
Qadri, Talat; Javed, Fawad; Johannsen, Gunnar; Gustafsson, Anders
2015-11-01
The purpose of this study was to systematically review currently available evidence regarding the role of diode lasers (810-980 nm) as adjuncts to scaling and root planing (SRP) in the treatment of chronic periodontitis (CP). Mechanical instrumentation of periodontal tissues followed by diode laser application leads to complete removal of pocket epithelium compared with conventional SRP. To address the focused question "Is SRP with adjunct diode lasers (810-980 nm) therapy more effective in the treatment of CP than when CP is treated by SRP alone?" databases were searched using the following key words: chronic periodontitis, diode laser, surgical, AND scaling and root planing, periodontal diseases, periodontal therapy, AND periodontal treatment. Original studies were included. Letters to the editor, case reports, commentaries, and reviews were excluded. Ten clinical studies were included. In all studies, patients were systemically healthy, and cigarette smokers were included in two studies. In five studies, SRP plus diode laser application was more effective in the treatment of CP than SRP, and three studies showed no difference. In two studies, there was a moderate reduction in periodontal inflammation using SRP plus diode laser. The diameter of optic fiber, laser wavelengths, power, pulse repetition rate, and duration of laser exposure ranged between 300 μm and 2 mm, 810-980 nm, 0.8-2.5 W, 10-60 Hz, and 10-100 ms, respectively. In CP patients with probing depths ≤5 mm, diode lasers, SRP plus diode laser (800-980 nm) is more effective in the treatment of CP than when SRP is used alone.
Valentijn, Linda J.; Koster, Jan; Versteeg, Rogier
2006-01-01
NM23-H1 and NM23-H2 are neighboring genes on chromosome 17q. They encode nucleoside diphosphate kinases that have additional roles in signal transduction, transcription, and apoptosis. NM23-H1 expression is a strong marker for prognosis and metastatic behavior in many tumor types. A new
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Office. 300.9 Section 300.9 Housing... NATIONAL MORTGAGE ASSOCIATION, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT GENERAL § 300.9 Office. The Association directs its operations from its office located at 451 Seventh Street, SW., Washington DC 20410. ...
International Nuclear Information System (INIS)
Snir, M.; Margaliot, M.; Amitzi, A.
2004-01-01
During the 1970's, Ruby (Q switched) laser based range finders with a wavelength of 694nm were first used. These lasers operated in a pulse mode within the visible light range and produced a risk for the eye retina. The laser beam striking the macula could damage the eye and might cause blindness. Over the years, Nd:YAG (Q switched) lasers were developed (operating at 1064nm) for range finding and designation uses. The wavelength of these lasers, operating in the near Infra-Red range (invisible), is also focused tightly on the retina. The human eye does not respond to the invisible light so there is no natural protection (eye blink reflex) as in the visible light. The operation of these lasers worldwide, especially when the laser beam is exposed, causes occasional eye accidents. Another risk is stemming from the use of observation systems with a high optical gain, in the laser operation areas, which enlarge the range of risk quite significantly. Therefore, research and development efforts were invested in order to introduce eye safe lasers. One of the solutions for this problem is presented in following document
Project W-420 Ventilation Stack Monitoring System Year 2000 Compliance Assessment Project Plan
International Nuclear Information System (INIS)
BUSSELL, J.H.
1999-01-01
This document contains a limited assessment of Year 2000 compliance for Project W-420. Additional information is provided as a road map to project documents and other references that may be used to verify Year 2000 compliance. This assessment describes the potential Year 2000 (Y2K) problems and describes the methods for achieving Y2K Compliance for Project W-420, Ventilation Stack Monitoring Systems Upgrades. The purpose of this assessment is to give an overview of the project. This document will not be updated and any dates contained in this document are estimates and may change. The project work scope includes upgrades to ventilation stacks and generic effluent monitoring systems (GEMS) at the 244-A Double Contained Receiver Tank (DCRT), the 244-BX DCRT, the 244-CR Vault, tanks 241-C-105 and 241-C-106, the 244-S DCRT, and the 244-TX DCRT. A detailed description of system dates, functions, interfaces, potential Y2K problems, and date resolutions can not be described since the project is in the definitive design phase, This assessment will describe the methods, protocols, and practices to ensure that equipment and systems do not have Y2K problems
Energy Technology Data Exchange (ETDEWEB)
Lu, Zhansheng; Li, Shuo; Lv, Peng [College of Physics and Electronic Engineering, Henan Normal University, Xinxiang 453007 (China); He, Chaozheng, E-mail: hecz2013@nynu.edu.cn [College of Physics and Electronic Engineering, Nanyang Normal University, Nanyang 473061 (China); Ma, Dongwei [School of Physics, Anyang Normal University, Anyang 455000 (China); Yang, Zongxian, E-mail: yzx@henannu.edu.cn [College of Physics and Electronic Engineering, Henan Normal University, Xinxiang 453007 (China); Collaborative Innovation Center of Nano Functional Materials and Applications, Kaifeng (China)
2016-01-01
Graphical abstract: - Highlights: • The NM adatoms belong to embedded adsorption in 18C-hexagon of GDY. • The Rh and Ir/GDY can be applied to single metal catalysts or sensors. • A simple linear relationship between E{sub e-ads} and E{sub b} is presented. • The linear relationship can be used in the noble metal modified GDY. - Abstract: Based on the dispersion-corrected density functional calculations (DFT-D), we systematically studied the adsorption of noble metals (NM), Pd, Pt, Rh and Ir, on graphdiyne (GDY). We present a systematic study on the geometry, embedded adsorption energy and electronic structure of four different adatoms adsorbed on the GDY. The strong interaction between the NM adatoms and the GDY substrate is found with the NM embedded in the 18C-hexagon of the GDY. We investigated the mobility of the NM adatoms on the GDY, and found that the mobility barrier energy increases along with the increasing of the embedded adsorption energy. We present the NM adatoms growth of high concentrations on the GDY. Upon the analysis of the electronic structure and the frontier molecular orbitals, Rh and Ir adatoms of low concentrations (about 1.37 at%) on the GDY have the potential to be applied as single metal catalysts or gas molecule sensors.
Nanostructured composite layers for electromagnetic shielding in the GHz frequency range
Suchea, M.; Tudose, I. V.; Tzagkarakis, G.; Kenanakis, G.; Katharakis, M.; Drakakis, E.; Koudoumas, E.
2015-10-01
We report on preliminary results regarding the applicability of nanostructured composite layers for electromagnetic shielding in the frequency range of 4-20 GHz. Various combinations of materials were employed including poly(3,4-ethylenedioxythiophene)-poly(styrenesulfonate) (PEDOT:PSS), polyaniline, graphene nanoplatelets, carbon nanotubes, Cu nanoparticles and Poly(vinyl alcohol). As shown, paint-like nanocomposite layers consisting of graphene nanoplatelets, polyaniline PEDOT:PSS and Poly(vinyl alcohol) can offer quite effective electromagnetic shielding, similar or even better than that of commercial products, the response strongly depending on their thickness and resistivity.
International Nuclear Information System (INIS)
Thome, T.; Braga, D.; Blaise, G.; Cousty, J.; Pham Van, L.; Costantini, J.M.
2006-01-01
A study performed with a dedicated scanning electron microscope (SEM) on the surface electrical properties of (1 0 0)-oriented yttria-stabilized zirconia (YSZ) single crystals irradiated with 1 MeV electrons is presented. When compared with virgin YSZ, the 1 MeV-irradiated YSZ shows a decrease of the intrinsic total electron emission coefficient σ 0 and an increase of the time constant τ associated with the charging kinetics of the material at room temperature. These measurements performed with the SEM beam at 10 keV indicate that the defects induced by the 1 MeV-electron irradiation generate a positive electric field of the order of 0.5 x 10 6 V/m at a depth of about 1 μm that prevents electrons to escape. When the SEM beam with a 1.1 keV energy is used, a smaller field (∼0.5 x 10 3 V/m) is detected closer to the surface (∼20 nm). The fading of these fields during the thermal annealing in the 400-1000 K temperature range provides information on the nature of defects induced by the 1 MeV-electron irradiation
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Act. 300.4 Section 300.4 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES... Definitions Used in This Part § 300.4 Act. Act means the Individuals with Disabilities Education Act, as...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority. 300.301 Section 300.301 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS EMPLOYMENT (GENERAL) Details of Employees § 300.301 Authority. (a) In accordance with 5 U.S.C. 3341, an agency may detail an employee in the...
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false State. 300.40 Section 300.40 Education Regulations of... SERVICES, DEPARTMENT OF EDUCATION ASSISTANCE TO STATES FOR THE EDUCATION OF CHILDREN WITH DISABILITIES General Definitions Used in This Part § 300.40 State. State means each of the 50 States, the District of...
2010-10-01
... Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.420 Accounting for independent research and development costs and bid and proposal costs. ...
Comparison of 193 nm and 308 nm laser liquid printing by shadowgraphy imaging
Energy Technology Data Exchange (ETDEWEB)
Palla-Papavlu, A., E-mail: apalla@nipne.ro [National Institute for Lasers, Plasma and Radiation Physics, P.O. Box MG-36, Magurele, RO-077125 Bucharest (Romania); Shaw-Stewart, J. [EMPA, Swiss Federal Laboratories for Materials Testing and Research, Laboratory for Functional Polymers, Überlandstrasse 129, 8600 Dübendorf (Switzerland); Paul Scherrer Institute, General Energy Research Department, 5232 Villigen PSI (Switzerland); Mattle, T. [Paul Scherrer Institute, General Energy Research Department, 5232 Villigen PSI (Switzerland); Dinca, V. [National Institute for Lasers, Plasma and Radiation Physics, P.O. Box MG-36, Magurele, RO-077125 Bucharest (Romania); Lippert, T.; Wokaun, A. [Paul Scherrer Institute, General Energy Research Department, 5232 Villigen PSI (Switzerland); Dinescu, M. [National Institute for Lasers, Plasma and Radiation Physics, P.O. Box MG-36, Magurele, RO-077125 Bucharest (Romania)
2013-08-01
Over the last years laser-induced forward transfer has emerged as a versatile and powerful tool for engineering surfaces with active compounds. Soft, easily damageable materials can be transferred using a triazene polymer as a sacrificial layer which acts as a pressure generator and at the same time protects the material from direct laser irradiation. To understand and optimize the transfer process of biomolecules in liquid solution by using an intermediate triazene polymer photosensitive layer, shadowgraphy imaging is carried out. Two laser systems i.e. an ArF laser operating at 193 nm and a XeCl laser operating at 308 nm are applied for the transfer. Solutions with 50% v/v glycerol concentration are prepared and the influence of the triazene polymer sacrificial layer thickness (60 nm) on the deposits is studied. The shadowgraphy images reveal a pronounced difference between laser-induced forward transfer using 193 nm or 308 nm, i.e. very different shapes of the ejected liquid.
Compact corner-pumped Nd:YAG/YAG composite slab 1319 nm/1338 nm laser
International Nuclear Information System (INIS)
Liu, H; Gong, M; Wushouer, X; Gao, S
2010-01-01
A corner-pumped type is a new pumping type in the diode-pumped solid-state lasers, which has the advantages of high pump efficiency and favorable pump uniformity. A corner-pumped Nd:YAG/YAG composite slab continuous-wave 1319 nm/1338 nm dual-wavelength laser is first demonstrated in this paper. When the cavity length is 25 mm, the maximal output power is up to 7.62 W with a slope efficiency of 16.6% and an optical-to-optical conversion efficiency of 17%. The corresponding spectral line widths of 1319 nm laser and 1338 nm laser are 0.11 and 0.1 nm, respectively. The short-term instability of the output power is better than 1% when the pumping power is 39.5 W. The experimental results show that a corner-pumped type is a kind of feasible schedules in the design of diode-pumped solid-state 1.3 μm lasers with low or medium output powers
34 CFR 300.519 - Surrogate parents.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Surrogate parents. 300.519 Section 300.519 Education... DISABILITIES Procedural Safeguards Due Process Procedures for Parents and Children § 300.519 Surrogate parents... parent (as defined in § 300.30) can be identified; (2) The public agency, after reasonable efforts...
Spectroscopy and decay kinetics of Pr3+-doped chloride crystals for 1300-nm optical amplifiers
International Nuclear Information System (INIS)
Page, R.H.; Schaffers, K.I.; Wilke, G.D.
1995-01-01
Several Pr 3+ -doped chloride crystals have been tested spectroscopically for suitability as 1300-nm optical amplifiers operating on the 1 G 4 - 3 H 5 transition. 1 G 4 lifetimes are much longer than in fluoride hosts, ranging up to 1300 μsec and suggesting a near-unity luminescence quantum yield. Emission spectra are typically broad (FWHM ∼ 70 nm) and include the 1310-nm zero-dispersion wavelength of standard telecommunications fiber
High-resolution magnetic-domain imaging by Fourier transform holography at 21 nm wavelength
International Nuclear Information System (INIS)
Schaffert, Stefan; Pfau, Bastian; Günther, Christian M; Schneider, Michael; Korff Schmising, Clemens von; Eisebitt, Stefan; Geilhufe, Jan
2013-01-01
Exploiting x-ray magnetic circular dichroism at the L-edges of 3d transition metals, Fourier transform holography has become a standard technique to investigate magnetic samples with sub-100 nm spatial resolution. Here, magnetic imaging in the 21 nm wavelength regime using M-edge circular dichroism is demonstrated. Ultrafast pulses in this wavelength regime are increasingly available from both laser- and accelerator-driven soft x-ray sources. We explain the adaptations concerning sample preparation and data evaluation compared to conventional holography in the 1 nm wavelength range. We find the correction of the Fourier transform hologram to in-plane Fourier components to be critical for high-quality reconstruction and demonstrate 70 nm spatial resolution in magnetization imaging with this approach. (paper)
Photonic band gap structures for long-range surface plasmon polaritons
DEFF Research Database (Denmark)
Bozhevolnyi, Sergey I.; Boltasseva, Alexandra; Søndergaard, Thomas
2005-01-01
Propagation of long-range surface plasmon polaritons (LR-SPPs) along periodically thickness-modulated metal stripes embedded in dielectric is studied both theoretically and experimentally for light wavelengths in the telecom range. We demonstrate that symmetric (with respect to the film surface) nm......-size thickness variations result in the pronounced band gap effect, and obtain very good agreement between measured and simulated (transmission and reflection) spectra. This effect is exploited to realize a compact wavelength add-drop filter with the bandwidth of ~20 nm centered at 1550 nm. The possibilities...
34 CFR 300.516 - Civil action.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Civil action. 300.516 Section 300.516 Education... DISABILITIES Procedural Safeguards Due Process Procedures for Parents and Children § 300.516 Civil action. (a... aggrieved by the findings and decision under § 300.514(b), has the right to bring a civil action with...
Influence of crystallite size on the magnetic properties of Fe{sub 3}O{sub 4} nanoparticles
Energy Technology Data Exchange (ETDEWEB)
Upadhyay, Sneha [Dept of Applied Science, Symbiosis Institute of Technology, SIU, Lavale, Mulshi, Pune 412 115 (India); Parekh, Kinnari [K C Patel R & D Center, Charotar University of Science & Technology, Changa 388421 (India); Pandey, Brajesh, E-mail: bpandey@gmail.com [Dept of Applied Science, Symbiosis Institute of Technology, SIU, Lavale, Mulshi, Pune 412 115 (India)
2016-09-05
Structural and magnetic properties of chemically synthesized magnetite nanoparticles have been studied using X-ray diffraction, Transmission Electron Microscopy and Vibrating Sample Magnetometer. Magnetically the synthesized nanoparticles are ranging from superparamagnetic to multi domain state. Average crystallite size of the synthesized magnetite nanoparticles were determined using X-ray line broadening and are found to be in the range of 9–53 nm. On the other hand, the TEM images show that the size is ranging between 7.9 and 200 nm with the transition from spherical superparamagnetic particles to faceted cubic multi domain particles. Magnetic parameters of the samples show a strong dependence on average crystallite size. The ratio of coercive field at 20 K to that at 300 K (H{sub c} (20 K)/H{sub c} (300 K)) increased sharply with decrease in crystallite size. A critical crystallite diameter of order 36 nm may be inferred as boundary between single domain to multi domain transition. Zero-field-cooled (ZFC) and field-cooled (FC) measurements at 10 Oe field validate the same for smallest and largest size samples, confirming that the anisotropy energy is greater than thermal energy upto 300 K temperature. For 9 nm sample broad ZFC curve with overlapping of FC curve is observed just at 300 K, indicating the effect of strong dipolar field in superparamagnetic system. - Graphical abstract: We present our study on magnetite nanoparticles. We observed that the synthesized nanoparticles behave like single domain particles in the range of 14 nm–36 nm. They show superparamagnetic properties if particles are smaller than 14 nm and multi-domain properties when the particles are bigger than 36 nm. - Highlights: • Magnetite nanoparticles have been synthesized using chemical precipitation method. • Smaller magnetite particles below 14 nm in size are in super-paramagnetic state. • Bigger particles show multi-domain character. • Magnetite in the size range 14–36 is
Energy Technology Data Exchange (ETDEWEB)
Fitzen, M.; Hatz, W.; Eiser, A.; Heiduk, T.; Riegner, J. [Audi AG, Ingolstadt (Germany)
2008-07-01
The 3.0l TFSI represents the new top-of-the-range V6 engine from Audi. In its basic form this engine design delivers 213 kW (290 bhp) and 420 Nm. The fundamental design of the engine has been adopted from the naturally aspirated V6 engines as revised in 2006, including the measures to reduce frictional losses. An entirely new development is the supercharger module, with integrated Roots blower, bypass regulation and charge air intercooling. All the components are accommodated inside the V. As a result of the extremely compact dimensions it has also been possible to adopt the arrangement of the inlet and exhaust systems directly from the naturally aspirated engines without any changes. In conjunction with direct injection, this sets new standards in terms of responsiveness, efficiency and noise levels. The new Audi V6 3.0l TFSI combines excellent torque and power output with outstanding responsiveness, along with the package and exhaust-related benefits of a naturally aspirated engine. That makes it ideally suitable for a wide range of applications within the Audi model portfolio. The initial launch of the engine will be in the new A6 for the autumn of 2008. (orig.)
Giver, L. P.; Gentry, B.; Schwemmer, G.; Wilkerson, T. D.
1982-01-01
Intensities were measured for 97 lines of H2O vapor between 932 and 961 nm. The lines were selected for their potential usefulness for remote laser measurements of H2O vapor in the earth's atmosphere. The spectra were obtained with several different H2O vapor abundances and N2 broadening gas pressures; the spectral resolution was 0.046/cm FWHM. Measured H2O line intensities range from 7 x 10 to the -25th to 7 x 10 to the -22nd/cm per (molecules/sq cm). H2O self-broadening coefficients were measured for 13 of these strongest lines; the mean value was 0.5/cm per atm. N2-collision-broadening coefficients were measured for 73 lines, and the average was 0.11 cm per atm HWHM. Pressure shifts in air were determined for a sample of six lines between 948 and 950 nm; these lines shift to lower frequency by an amount comparable to 0.1 of the collision-broadened widths measured in air or N2. The measured intensities of many lines of 300-000 band are much larger than expected from prior computations, in some cases by over an order of magnitude. Coriolis interactions with the stronger 201-000 band appear to be the primary cause of the enhancement of these line intensities.
Effect of ultraviolet radiation (300-400 nanometers) on polypropylene
International Nuclear Information System (INIS)
Lerman, S.
1983-01-01
Polypropylene discs and shavings were exposed to simulated ambient ultraviolet (UV) radiation (lambda 300-400 nm) for a period equivalent to at least two years of wear within the eye, assuming the eye to be exposed to ambient UV radiation for four hours per day at 1 mW/cm2. The polypropylene and the incubation media were measured by several forms of optical spectroscopy, and there was no photochemical change in either. Where polypropylene discs were exposed to a very high level of UV radiation (greater than 500 W/cm2), they became brittle and discolored within five to ten days. This level of exposure, however, was equivalent to a total of over 20 million joules/cm2, which is at least one million times levels for expected ambient UV exposure to polypropylene within the eye
300 Area Process Trenches Verification Package
International Nuclear Information System (INIS)
Lerch, J.A.
1998-03-01
The purpose of this verification package is to document achievement of the remedial action objectives for the 300 Area Process Trenches (300 APT) located within the 300-FF-1 Operable Unit (OU). The 300 APT became active in 1975 as a replacement for the North and South Process Pond system that is also part of the 300-FF-1 OU. The trenches received 300 Area process effluent from the uranium fuel fabrication facilities. Waste from the 300 Area laboratories that was determined to be below discharge limits based on monitoring performed at the 307 retention basin was also released to the trenches. Effluent flowed through the headworks sluice gates, down a concrete apron, and into the trenches. From the beginning of operations in 1975 until 1993, a continuous, composite sampler was located at the headwork structure to analyze process effluent at the point of discharge to the environment
XUV-laser spectroscopy of HD at 92-98 nm.
Hinnen, P.C.; Werners, S.E.; Stolte, S.; Hogervorst, W.; Ubachs, W.M.G.
1995-01-01
Sub-Doppler excitation spectra of HD have been recorded in the range 9298 nm with the use of a narrow-band and tunable extreme ultraviolet laser in combination with a molecular beam. Frequencies of 147 transitions to the B 1u+, C 1 u, and EF 1g+ states have been calibrated with an average absolute
Directory of Open Access Journals (Sweden)
Asmalina Mohamed Saat
2014-01-01
Full Text Available Partially phosphorylated polyvinyl alcohol (PPVA films were prepared at five mole ratios of phosphoric acid (PA using solution casting technique. The optical properties of the PPVA films were examined using UV-visible (UV and photoluminescence (PL spectroscopy. The UV absorption spectra reveal that the absorption peaks are blue-shifted with an increase in PA concentration added to the pure PVA. The PL spectra show the presence of peaks which are characteristic of isotactic (389–398, 460–462 nm, syndiotactic (418–420 nm, and atactic (440–446 nm configurations of the PPVA. The results also show the peak of O–P–O bonding at a wavelength range of 481–489 nm.
Thickness measurement of SiO2 films thinner than 1 nm by X-ray photoelectron spectroscopy
International Nuclear Information System (INIS)
Joong Kim, Kyung; Park, Ki Tae; Lee, Jong Wan
2006-01-01
The thickness measurement of ultra-thin SiO 2 films thinner than 1 nm was studied by X-ray photoelectron spectroscopy (XPS). Amorphous SiO 2 thin films were grown on amorphous Si films to avoid the thickness difference due to the crystalline structure of a substrate. SiO 2 thin films were grown by ion beam sputter deposition under oxygen gas flow and the thickness was measured by in situ XPS. The attenuation length was determined experimentally by a SiO 2 film with a known thickness. The straight line fit between the measured thickness using XPS and the nominal thickness showed a good linear relation with a gradient of 0.969 and a small offset of 0.126 nm. The gradient measured at the range of 3.4-0.28 nm was very close to that measured at sub-nanometer range of 1.13-0.28 nm. This result means that the reliable measurement of SiO 2 film thickness below 1 nm is possible by XPS
270 nm Pseudomorphic Ultraviolet Light-Emitting Diodes with Over 60 mW Continuous Wave Output Power
Grandusky, James R.; Chen, Jianfeng; Gibb, Shawn R.; Mendrick, Mark C.; Moe, Craig G.; Rodak, Lee; Garrett, Gregory A.; Wraback, Michael; Schowalter, Leo J.
2013-03-01
In this letter, the achievement of over 60 mW output power from pseudomorphic ultraviolet light-emitting diodes in continuous wave operation is reported. Die thinning and encapsulation improved the photon extraction efficiency to over 15%. Improved thermal management and a high characteristic temperature resulted in a low thermal rolloff up to 300 mA injection current with an output power of 67 mW, an external quantum efficiency (EQE) of 4.9%, and a wall plug efficiency (WPE) of 2.5% for a single-chip device emitting at 271 nm in continuous wave operation.
International Nuclear Information System (INIS)
Logvinenko, S.P.; Derbysheva, S.L.
1978-01-01
The investigation results are reported of various methods for approximating the calibration characteristics of technical resistance thermometers made from p-GaAs and of thermodiodes from n- p-GaAs. The following methods may by used for approximating thermometric characteristics and obtaining calibration tables: method of approximating function describing a physical model (P); method of power polynoms (PP); and the spline method (S). Studies of thermometric characteristics have been achieved in the 4.2-300 K temperature range for thermodiodes, and at 4.2-100 K for thermoresistances. The obtained data show that the use of the S and PP methods for describing monotonous thermometric characteristics of thermodiodes and thermoresistances is equivalent and leads to satisfactory results. Method S affords the best results for describing thermometric characteristics with specific features. The error in approximating thermometric characteristics by method S does not exceed 0.01 K
Shortwave Array Spectroradiometer–Zenith (SASZe) Instrument Handbook
Energy Technology Data Exchange (ETDEWEB)
Flynn, Connor J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2016-04-01
The Shortwave Array Spectroradiometer – Zenith (SASZe) provides measurements of zenith spectral shortwave radiance at 1Hz over a continuous spectral range from approximately 300 nm to 1700 nm. The SASZe design connects an optical collector located outdoors to a pair of spectrometers and data collections system located indoors within a climate-controlled building via an umbilical cable of fiber optic and electrical cables. The light collector incorporates a collimator yielding a 1-degree Full Width at Half Maximum (FWHM) field of view. The data-acquisition electronics and spectrometers include an in-line fiber optic shutter and two Avantes fiber-coupled grating spectroradiometers within a temperature-controlled container. The Avantes Avaspec ULS 2048 charge-coupled device (CCD) spectrometer covers the wavelength range from about 300-1100 nm with a pixel spacing of less than 0.6 nm and a spectral resolution of about 2.4 nm FWHM. The Avantes Avaspec NIR256-1.7 spectrometer covers the wavelength range from about 950 nm to 1700 nm with a pixel spacing of less than 4 nm and a spectral resolution of about 6 nm FWHM.
ORF Alignment: NC_002929 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available LGNFRTIRQTIAQGPLSDTQAEYAVNP 300 ... Query: 361 FKAAMDDDFNSSGAVAALFELASEANRTGSARAVGQLKALGAVLGLLQQDPPAYFQSPTR 420... ... FKAAMDDDFNSSGAVAALFELASEANRTGSARAVGQLKALGAVLGLLQQDPPAYFQSPTR Sbjct: 361 FKAAMDDDFNSSGAVAALFELASEAN
Li4SrCa(SiO4)2:Ce3+, a highly efficient near-UV and blue emitting orthosilicate phosphor
International Nuclear Information System (INIS)
Zhang, Jilin; Zhang, Weilu; Qiu, Zhongxian; Zhou, Wenli; Yu, Liping; Li, Zhiqiang; Lian, Shixun
2015-01-01
High quantum efficiency is a vital parameter of phosphors for practical application. An efficient near-UV and blue emitting phosphor Li 4 SrCa(SiO 4 ) 2 :Ce 3+ was synthesized by a traditional solid-state reaction, and luminescent properties were studied in detail. The Ce 3+ -activated phosphor can emit both a near-UV light centred at 345 nm and a blue light peaking at 420 nm when Ce 3+ occupies the Sr and Ca site, respectively. The internal quantum efficiency (IQE) of Li 4 SrCa(SiO 4 ) 2 :0.03Ce 3+ is as high as 97% under the excitation at 288 nm, while the external quantum efficiency (EQE) is 66%. The IQE and EQE values of Li 4 SrCa(SiO 4 ) 2 :0.03Ce 3+ under the excitation at 360 nm are 82% and 31%, respectively. - Highlights: • Phosphor Li 4 SrCa(SiO 4 ) 2 :Ce 3+ emits a near-UV (345 nm) and a blue light (420 nm). • Emission band at 345 nm originates from Ce 3+ on Sr site. • Emission band at 420 nm belongs to Ce 3+ on Ca site. • Internal quantum efficiency is 97% for Li 4 SrCa(SiO 4 ) 2 :0.03Ce 3+ excited at 288 nm
Diode-pumped CW frequency-doubled Nd:CNGG-BiBO blue laser at 468 nm
International Nuclear Information System (INIS)
Lü, Y F; Xia, J; Lin, J Q; Gao, X; Dong, Y; Xu, L J; Sun, G C; Zhao, Z M; Tan, Y; Chen, J F; Liu, Z X; Li, C L; Cai, H X; Liu, Z T; Ma, Z Y; Ning, G B
2011-01-01
Efficient and compact blue laser output at 468 nm is generated by intracavity frequency doubling of a continuous-wave (CW) diode-pumped Nd:CNGG laser at 935 nm. With 17.8 W of diode pump power and the frequency-doubling crystal BiB 3 O 6 (BiBO), a maximum output power of 490 mW in the blue spectral range at 468 nm has been achieved, corresponding to an optical-to-optical conversion efficiency of 2.8%; the output power stability over 4 h is better than 2.6%. To the best of our knowledge, this is first work on intracavity frequency doubling of a diode pumped Nd:CNGG laser at 935 nm
Irradiation Effect of Argon Ion on Interfacial Structure Fe(2nm/Si(tsi=0.5-2 nm Multilayer thin Film
Directory of Open Access Journals (Sweden)
S. Purwanto
2010-04-01
Full Text Available Investigation includes formation of interfacial structure of Fe(2nm/Si(tSi= 0.5-2 nm multilayer thin film and the behavior of antiferromagnetic coupling between Fe layers due to Argon ion irradiation was investigated. [Fe(2nm/Si]30 multilayers (MLs with a thickness of Si spacer 0.5 - 2 nanometer were prepared on n-type (100 Si substrate by the helicon plasma sputtering method. Irradiation were performed using 400keV Ar ion to investigate the behavior of magnetic properties of the Fe/Si MLs. The magnetization measurements of Fe/Si MLs after 400keV Ar ion irradiation show the degradation of antiferromagnetic behavior of Fe layers depend on the ion doses. The Magnetoresistance (MR measurements using by Four Point Probe (FPP method also confirm that MR ratio decrease after ion irradiation. X-ray diffraction (XRD patterns indicate that the intensity of a satellite peak induced by a superlattice structure does not change within the range of ion dose. These results imply that the surface of interface structures after ion irradiation become rough although the layer structures are maintained. Therefore, it is considered that the MR properties of Fe/Si MLs also are due to the metallic superlattice structures such as Fe/Cr and Co/Cu MLs.
300 Area Revitalization Project Management Plan
International Nuclear Information System (INIS)
Downey, H. D.
1999-01-01
The 300 Area Revitalization Team has been tasked with the responsibility to develop an integrated path forward for the 300 Area, as part of a commitment stemming from the 300 Area Disposition Workshop that was held on March 17, 1998. The integrated path forward that is needed must ensure that budget, schedule, and work scopes are complementary between the Programs that are involved in the 300Area. This Project Management Plan (PMP) defines the roles and responsibilities, and the overall approach, to development of a prioritized schedule for 300 Area activities that will achieve the end-state condition
Basic design and economical evaluation of Gas Turbine High Temperature Reactor 300 (GTHTR300)
International Nuclear Information System (INIS)
Kazuhiko, Kunitomi; Shusaku, Shiozawa; Xing, Yan
2007-01-01
High Temperature Gas-cooled Reactor (HTGR) combined with a direct cycle gas turbine offers one of the most promising nuclear electricity generation options after 2010. Japan Atomic Energy Agency has been engaging in the basic design and development of Gas Turbine High Temperature Reactor 300 (GTHTR300) since 2003. Costs of capital, fuel, and operation and maintenance have been estimated. The capital cost of the GTHTR300 is lower than that of the existing light water reactor (LWR) because the generation efficiency is considerably higher whereas the construction cost is lower owing to the design simplicity of the gas turbine power conversion unit and the reactor safety system. The fuel cost is shown to equal that of LWR. The operation and maintenance cost has a slight advantage due to the use of chemically inert helium coolant. In sum, the cost of electricity for the GTHTR300 is estimated to be below US 3.3 cents/kWh (4 yen/kWh), which is about two-third of that of current LWRs in Japan. The results confirm that the net power generation cost of the GTHTR300 is much lower than that of the LWR, indicating that the GTHTR300 plant consisting of small-scale reactor units can be economically competitive to the latest large-scale LWR. (authors)
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false What are the requirements for research, development, and..., DEPARTMENT OF TRANSPORTATION PLANNING AND RESEARCH PLANNING AND RESEARCH PROGRAM ADMINISTRATION Research, Development and Technology Transfer Program Management § 420.207 What are the requirements for research...
Green high-power tunable external-cavity GaN diode laser at 515 nm
DEFF Research Database (Denmark)
Chi, Mingjun; Jensen, Ole Bjarlin; Petersen, Paul Michael
2016-01-01
A 480 mW green tunable diode laser system is demonstrated for the first time to our knowledge. The laser system is based on a GaN broad-area diode laser and Littrow external-cavity feedback. The green laser system is operated in two modes by switching the polarization direction of the laser beam...... incident on the grating. When the laser beam is p-polarized, an output power of 50 mW with a tunable range of 9.2 nm is achieved. When the laser beam is s-polarized, an output power of 480 mW with a tunable range of 2.1 nm is obtained. This constitutes the highest output power from a tunable green diode...... laser system....
Passively mode-locked Nd:YVO4 laser operating at 1073 nm and 1085 nm
Waritanant, Tanant; Major, Arkady
2018-02-01
A passively mode-locked Nd:YVO4 laser operating at 1073 nm and 1085 nm was demonstrated with an intracavity birefringent filter as the wavelength selecting element. The average output powers achieved were 2.17 W and 2.18 W with optical-to-optical efficiency of 19.6% and 19.7%, respectively. The slope efficiencies were more than 31% at both output wavelengths. The pulse durations at the highest average output power were 10.3 ps and 8.4 ps, respectively. We believe that this is the first report of mode locking of a Nd:YVO4 laser operating at 1073 nm or 1085 nm lines.
Mapping the Use of Engineered NM in Quebec's Industries and Research Laboratories
International Nuclear Information System (INIS)
Ostiguy, Claude; Emond, Claude; Dossa, Inès; Plavski, Anton; Malki, Yasmina; Boily, Chantale; Roughley, David; Endo, Charles-Anica
2013-01-01
Engineered NanoMaterials (NM) offer an opportunity to develop a wide variety of new products with unique properties but many studies have shown potential OHS risks specific to NM. Addressing these risks requires knowledge about release of NM into the workplaces. This research aimed to map the state of nanotechnology OHS practices in Quebec through a questionnaire following a first contact by telephone when possible and by compiling the type and volumes of NM used as well as gathering information related to the working conditions and OHS aspects. This survey was conducted among 1310 Quebec industries and 653 researchers working in different specialties potentially involved in the development/production/distribution/integration of NM and use of NM containing products. Overall, 90 questionnaires, including 51 from the industries, were completed. These showed that NM are mainly used into the powder form, in many different sectors and deserve a wide range of markets. The prevention measures implemented vary widely from a workplace to another but about one third of the participants report that they have implemented NP adapted prevention measures but they remain worried on some specific operations. More than 50% of the participants request more information about the safe laboratory/plant design, toxicity, regulation, good work practices and prevention measures, efficiency of personal protective equipment and environmental impacts.
Mapping the Use of Engineered NM in Quebec's Industries and Research Laboratories
Ostiguy, Claude; Emond, Claude; Dossa, Inès; Malki, Yasmina; Boily, Chantale; Roughley, David; Plavski, Anton; Endo, Charles-Anica
2013-04-01
Engineered NanoMaterials (NM) offer an opportunity to develop a wide variety of new products with unique properties but many studies have shown potential OHS risks specific to NM. Addressing these risks requires knowledge about release of NM into the workplaces. This research aimed to map the state of nanotechnology OHS practices in Quebec through a questionnaire following a first contact by telephone when possible and by compiling the type and volumes of NM used as well as gathering information related to the working conditions and OHS aspects. This survey was conducted among 1310 Quebec industries and 653 researchers working in different specialties potentially involved in the development/production/distribution/integration of NM and use of NM containing products. Overall, 90 questionnaires, including 51 from the industries, were completed. These showed that NM are mainly used into the powder form, in many different sectors and deserve a wide range of markets. The prevention measures implemented vary widely from a workplace to another but about one third of the participants report that they have implemented NP adapted prevention measures but they remain worried on some specific operations. More than 50% of the participants request more information about the safe laboratory/plant design, toxicity, regulation, good work practices and prevention measures, efficiency of personal protective equipment and environmental impacts.
International Nuclear Information System (INIS)
Riedmüller, Benjamin; Huber, Felix; Herr, Ulrich
2014-01-01
In this work, we present a detailed investigation of a focused ion beam (FIB) assisted nano-structuring process for giant magneto-resistive (GMR) spin valve sensors. We have performed a quantitative study of the dependence of the GMR ratio as well as the sensor resistance on the ion dose, which is implanted in the active region of our sensors. These findings are correlated with the decrease of magneto-resistive properties after micro- and nano-structuring by the FIB and reveal the importance of ion damage which limits the applicability of FIB milling to GMR devices in the low μm range. Deposition of a protective layer (50 nm SiO 2 ) on top of the sensor structure before milling leads to a preservation of the magneto-resistive properties after the milling procedure down to sensor dimensions of ∼300 nm. The reduction of the sensor dimensions to the nanometer regime is accompanied by a shift of the GMR curves, and a modification of the saturation behavior. Both effects can be explained by a micromagnetic model including the magnetic interaction of free and pinned layer as well as the effect of the demagnetizing field of the free layer on the sensor behavior. The results demonstrate that the FIB technology can be successfully used to prepare spintronic nanostructures
Improvement of optical damage in specialty fiber at 266 nm wavelength
Tobisch, T.; Ohlmeyer, H.; Zimmermann, H.; Prein, S.; Kirchhof, J.; Unger, S.; Belz, M.; Klein, K.-F.
2014-02-01
Improved multimode UV-fibers with core diameters ranging from 70 to 600 μm diameter have been manufactured based on novel preform modifications and fiber processing techniques. Only E'-centers at 214 nm and NBOHC at 260 nm are generated in these fibers. A new generation of inexpensive laser-systems have entered the market and generated a multitude of new and attractive applications in the bio-life science, chemical and material processing field. However, for example pulsed 355 nm Nd:YAG lasers generate significant UV-damages in commercially available fibers. For lower wavelengths, no results on suitable multi-mode or low-mode fibers with high UV resistance at 266 nm wavelength (pulsed 4th harmonic Nd:YAG laser) have been published. In this report, double-clad fibers with 70 μm or 100 μm core diameter and a large claddingto- core ratio will be recommended. Laser-induced UV-damages will be compared between these new fiber type and traditional UV fibers with similar core sizes. Finally, experimental results will be cross compared against broadband cw deuterium lamp damage standards.
Design of Polymer Wavelength Splitter 1310 nm/1550 nm Based on Multimode Interferences
Directory of Open Access Journals (Sweden)
V. Prajzler
2010-12-01
Full Text Available We report about design of 1x2 1310/1550 nm optical wavelength division multiplexer based on polymer waveguides. The polymer splitter was designed by using RSoft software based on beam propagation method. Epoxy novolak resin polymer was used as core waveguides layer, silicon substrate with silica layer was used as buffer layer and polymethylmethacrylate was used as protection cover layer. The simulation shows that the output energy for the fundamental mode is 67.1 % for 1310 nm and 67.8 % for 1550 nm wavelength.
2011-08-05
... Airworthiness Directives; Airbus Model A300 B4-600, A300 B4-600R, and A300 F4-600R Series Airplanes, and Model..., B4-622R, F4-605R, F4-622R, and C4-605R Variant F airplanes; and Model A310-203, -204, -221, -222...
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false What is the FHWA's policy for research, development, and... TRANSPORTATION PLANNING AND RESEARCH PLANNING AND RESEARCH PROGRAM ADMINISTRATION Research, Development and Technology Transfer Program Management § 420.205 What is the FHWA's policy for research, development, and...
International Nuclear Information System (INIS)
Qu, Ailan; Xie, Haolong; Xu, Xinmei; Zhang, Yangyu; Wen, Shengwu; Cui, Yifan
2016-01-01
Highlights: • High concentration yellow GQDs and TiO_2 nanotubes were achieved by a simple and green method. • High quantum yield GQDs enhanced the photodegradation capacity of TiO_2 nanotube. • The catalytic performance of GQDs/TiO_2 depends on the GQDs loading. • The improved photocatalytic activity of GQDs/TiO_2 was attributed to three aspects. - Abstract: Graphene quantum dots (GQDs) with high quantum yield (about 23.6% at an excitation wavelength of 320 nm) and GQDs/TiO_2 nanotubes (GQDs/TiO_2 NTs) composites were achieved by a simple hydrothermal method at low temperature. Photoluminescence characterization showed that the GQDs exhibited the down-conversion PL features at excitation from 300 to 420 nm and up-conversion photoluminescence in the range of 600–800 nm. The photocatalytic activity of prepared GQDs/TiO_2 NTs composites on the degradation of methyl orange (MO) was significantly enhanced compared with that of pure TiO_2 nanotubes (TiO_2 NTs). For the composites coupling with 1.5%, 2.5% and 3.5% GQDs, the degradation of MO after 20 min irradiation under UV–vis light irradiation (λ = 380–780 nm) were 80.52%, 94.64% and 51.91%, respectively, which are much higher than that of pure TiO_2 NTs (35.41%). It was inferred from the results of characterization that the improved photocatalytic activity of the GQDs/TiO_2 NTs composites was attributed to the synergetic effect of up-conversion properties of the GQDs, enhanced visible light absorption and efficient separation of photogenerated electron-holes of the GQDs/TiO_2 composite.
2011-05-04
... Airworthiness Directives; Airbus Model A300 B4-600, A300 B4-600R, and A300 F4-600R Series Airplanes, and Model...-605R, B4-622R, F4-605R, F4-622R, and C4-605R Variant F airplanes; and Model A310-203, -204, -221, -222...
Kirichek, O; Timms, J D; Kelleher, J F; Down, R B E; Offer, C D; Kabra, S; Zhang, S Y
2017-02-01
Internal stresses in materials have a considerable effect on material properties including strength, fracture toughness, and fatigue resistance. The ENGIN-X beamline is an engineering science facility at ISIS optimized for the measurement of strain and stress using the atomic lattice planes as a strain gauge. Nowadays, the rapidly rising interest in the mechanical properties of engineering materials at low temperatures has been stimulated by the dynamic development of the cryogenic industry and the advanced applications of the superconductor technology. Here we present the design and discuss the test results of a new cryogenic sample environment system for neutron scattering measurements of internal stresses in engineering materials under a load of up to 100 kN and in the temperature range of 6 K to 300 K. Complete cooling of the system starting from the room temperature down to the base temperature takes around 90 min. Understanding of internal stresses in engineering materials at cryogenic temperatures is vital for the modelling and designing of cutting-edge superconducting magnets and other superconductor based applications.
Thermodynamic properties of molybdenum borides at temperatures above 300 K
International Nuclear Information System (INIS)
Bolgar, A.S.; Blinder, A.V.; Serbova, M.I.
1990-01-01
Enthalpy of Mo 2 B, MoB, Mo 2 B 5 borides within the range of temperatures above 300 K has been experimentally studied. Parameters of temperature dependences of enthalpy, heat capacity, entropy and the reduced Gibbs energy of the studied substances are calculated within a wide range. It is stated that high-temperature heat capacity of the studied borides can be presented as a sum of the electron component, a harmonic part of the lattice component and a contribution caused by anharmonic oscillations of lattice atoms. Values of coefficients of isothermal compressibility of Mo 2 , MoB, Mo 2 B 5 within the high temperature range are estimated
Optical limiting properties of 3,5-dipyrenylvinyleneBODIPY dyes at 532 nm
Kubheka, Gugu; Sanusi, Kayode; Mack, John; Nyokong, Tebello
2018-02-01
The optical limiting (OL) properties of 3,5-dipyrenylvinyleneBODIPY dyes that contain both electron withdrawing and donating moieties have been investigated by using the z-scan technique at 532 nm in the nanosecond pulse range. The extension of the π-conjugation at the 3,5-positions with pyrenylvinylene groups results in a ca. 200 nm red shift of the main BODIPY spectral band to ca. 700 nm, so there is relatively weak absorbance at 532 nm under ambient light conditions. Reverse saturable absorbance (RSA) profiles are observed in response to incident pulsed laser light that is consistent with a two photon absorption-assisted excited state absorption (ESA) mechanism in CH2Cl2 solution and when the dyes are embedded in poly(bisphenol carbonate A) (PBC) polymer thin films. This demonstrates that 3,5-divinyleneBODIPY dyes are potentially suitable for use in OL applications, since limiting threshold fluence (Ilim) values of below 0.95 J cm-2 are observed when thin films are prepared.
DEFF Research Database (Denmark)
Jozefowski, Leszek; Fiutowski, Jacek; Bordo, Vladimir
2012-01-01
of detection. The leakage radiation was observed on the opposite side of the Ag film at the phase matching angle. The spectrally resolved intensity of the scattered radiation has been measured as a function of scattering angle at normally incident light. The spectrum contains a distinct peak at an wavelength......Leakage radiation spectroscopy of organic nanofibers composed of self-assembled organic molecules (para-Hexaphenylene, p-6P) deposited on a thin (40-60 nm) Ag film has been performed in the spectral range 420-675 nm which overlaps with the nanofiber photoluminescence band. Using a soft transfer...
Astigmatism-free high-brightness 1060 nm edge-emitting lasers with narrow circular beam profile.
Miah, Md Jarez; Kalosha, Vladimir P; Bimberg, Dieter; Pohl, Johannes; Weyers, Markus
2016-12-26
1060 nm high-brightness vertical broad-area edge-emitting lasers providing anastigmatic high optical power into a narrow circular beam profile are demonstrated. Ridge-waveguide (RW) lasers yield record 2.2 W single-transverse mode power in the 1060-nm wavelength range under continuous-wave (cw) operation at room temperature with excellent beam quality factor M2 ≤ 2. Independent of operating current the astigmatism is only 2.5 µm. 3 mm long broad-area (BA) lasers produce a θvert as narrow as 9° full width at half maximum, which agrees well with our simulation results, being insensitive to drive current. 5 mm long BA lasers deliver highest ever reported cw 12 W multimode output power among lasers showing θvert <10° in the 1060-nm wavelength range. The emitted laser beams from both RW and BA lasers show a perfect circular shape with ≤10° divergence angle at record 2.1 W and 4.2 W cw-mode output power, respectively.
Thermoluminescence and electron spin resonance studies of irradiated biological single crystals
International Nuclear Information System (INIS)
Cooke, D.W.
1977-01-01
Single crystals of x-irradiated L-alanine:Cr 3+ have been studied between 90 and 300K by electron spin resonance (ESR) and thermoluminescence (TL) techniques. Ultraviolet (uv) photobleaching of the Cr 3+ electron traps and L-alanine radical centers was also investigated. The results demonstrate that the x-ray generated radical centers can be destroyed by uv-induced electron transport activity, and this destruction follows first order kinetics. Also, the transformation of the primary neutral radical species to a secondary radical in L-alanine was found not to be induced by intermolecular electron transport. The TL glow was determined to proceed by first-order kinetics at a temperature of 160K with an activation energy of 0.3 eV and a frequency factor of 1.0 x 10 8 s -1 . The emission spectrum consisted of a broad band (FWHM approx. = 100 nm) which peaked at approximately 420 nm. Scintillation activity was observed in the ferroelectric crystals triglycine sulfate (TGS), deuterated TGS, and TGS: L-alanine. The emission spectrum of TGS:L-alanine was obtained. New observations of scintillations and current pulses from glycine, a nonferroelectric crystal, which result from heating or cooling the sample between 77 and 300K with no previous irradiation were made. The scintillations and current pulses occur approximately in coincidence. Scintillations were also observed from the potent oncogen 3-hydroxyxanthine by cooling the sample from 300 to 90K with no previous irradiation
50 CFR 300.104 - Scientific research.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Scientific research. 300.104 Section 300... REGULATIONS Antarctic Marine Living Resources § 300.104 Scientific research. (a) The management measures... vessel for research purposes, unless otherwise indicated. (b) Catches taken by any vessel for research...
50 CFR 300.37 - Radio monitoring.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Radio monitoring. 300.37 Section 300.37 Wildlife and Fisheries INTERNATIONAL FISHING AND RELATED ACTIVITIES INTERNATIONAL FISHERIES REGULATIONS South Pacific Tuna Fisheries § 300.37 Radio monitoring. The international distress frequency, 2.182 mHz...
Shen, Ming-Yi
The improvement of wafer equipment productivity has been a continuous effort of the semiconductor industry. Higher productivity implies lower product price, which economically drives more demand from the market. This is desired by the semiconductor manufacturing industry. By raising the ion beam current of the ion implanter for 300/450mm platforms, it is possible to increase the throughput of the ion implanter. The resulting dose rate can be comparable to the performance of conventional ion implanters or higher, depending on beam current and beam size. Thus, effects caused by higher dose rate must be investigated further. One of the major applications of ion implantation (I/I) is source-drain extension (SDE) I/I for the silicon FinFET device. This study investigated the dose rate effects on the material properties and device performance of the 10-nm node silicon FinFET. In order to gain better understanding of the dose rate effects, the dose rate study is based on Synopsys Technology CAD (TCAD) process and device simulations that are calibrated and validated using available structural silicon fin samples. We have successfully shown that the kinetic monte carlo (KMC) I/I simulation can precisely model both the silicon amorphization and the arsenic distribution in the fin by comparing the KMC simulation results with TEM images. The results of the KMC I/I simulation show that at high dose rate more activated arsenic dopants were in the source-drain extension (SDE) region. This finding matches with the increased silicon amorphization caused by the high dose-rate I/I, given that the arsenic atoms could be more easily activated by the solid phase epitaxial regrowth process. This increased silicon amorphization led to not only higher arsenic activation near the spacer edge, but also less arsenic atoms straggling into the channel. Hence, it is possible to improve the throughput of the ion implanter when the dopants are implanted at high dose rate if the same doping level
34 CFR 300.307 - Specific learning disabilities.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Specific learning disabilities. 300.307 Section 300.307... Educational Placements Additional Procedures for Identifying Children with Specific Learning Disabilities § 300.307 Specific learning disabilities. (a) General. A State must adopt, consistent with § 300.309...
34 CFR 300.505 - Electronic mail.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Electronic mail. 300.505 Section 300.505 Education... DISABILITIES Procedural Safeguards Due Process Procedures for Parents and Children § 300.505 Electronic mail. A....508 by an electronic mail communication, if the public agency makes that option available. (Authority...
34 CFR 300.110 - Program options.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Program options. 300.110 Section 300.110 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES State Eligibility Other Fape Requirements § 300.110 Program options. The State must ensure that...
34 CFR 300.606 - Public attention.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Public attention. 300.606 Section 300.606 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND..., and Enforcement § 300.606 Public attention. Whenever a State receives notice that the Secretary is...
34 CFR 300.19 - Homeless children.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Homeless children. 300.19 Section 300.19 Education... REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION ASSISTANCE TO STATES FOR THE EDUCATION OF CHILDREN WITH DISABILITIES General Definitions Used in This Part § 300.19 Homeless children. Homeless children has the...
34 CFR 300.512 - Hearing rights.
2010-07-01
... REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION ASSISTANCE TO STATES FOR THE EDUCATION OF CHILDREN WITH DISABILITIES Procedural Safeguards Due Process Procedures for Parents and Children § 300.512 Hearing rights. (a... 34 Education 2 2010-07-01 2010-07-01 false Hearing rights. 300.512 Section 300.512 Education...
34 CFR 300.13 - Elementary school.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Elementary school. 300.13 Section 300.13 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES General Definitions Used in This Part § 300.13 Elementary school. Elementary school means a...
9 CFR 300.3 - FSIS organization.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false FSIS organization. 300.3 Section 300.3... ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION AGENCY MISSION AND ORGANIZATION § 300.3 FSIS organization. (a) General. The organization of FSIS...
34 CFR 300.36 - Secondary school.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Secondary school. 300.36 Section 300.36 Education... DISABILITIES General Definitions Used in This Part § 300.36 Secondary school. Secondary school means a nonprofit institutional day or residential school, including a public secondary charter school that provides...
34 CFR 300.105 - Assistive technology.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Assistive technology. 300.105 Section 300.105 Education... DISABILITIES State Eligibility Other Fape Requirements § 300.105 Assistive technology. (a) Each public agency must ensure that assistive technology devices or assistive technology services, or both, as those terms...
Temperature dependent optical properties of ZnO thin film using ellipsometry and photoluminescence
Bouzourâa, M.-B.; Battie, Y.; Dalmasso, S.; Zaïbi, M.-A.; Oueslati, M.; En Naciri, A.
2018-05-01
We report the temperature dependence of the dielectric function, the exciton binding energy and the electronic transitions of crystallized ZnO thin film using spectroscopic ellipsometry (SE) and photoluminescence (PL). ZnO layers were prepared by sol-gel method and deposited on crystalline silicon (Si) by spin coating technique. The ZnO optical properties were determined between 300 K and 620 K. Rigorous study of optical responses was achieved in order to demonstrate the quenching exciton of ZnO as a function of temperature. Numerical technique named constrained cubic splines approximation (CCS), Tauc-Lorentz (TL) and Tanguy dispersion models were selected for the ellipsometry data modeling in order to obtain the dielectric function of ZnO. The results reveals that the exciton bound becomes widely flattening at 470 K on the one hand, and on the other that the Tanguy dispersion law is more appropriate for determining the optical responses of ZnO thin film in the temperature range of 300 K-420 K. The Tauc-Lorentz, for its part, reproduces correctly the ZnO dielectric function in 470 K-620 K temperature range. The temperature dependence of the electronic transition given by SE and PL shows that the exciton quenching was observed in 420 K-∼520 K temperature range. This quenching effect can be explained by the equilibrium between the Coulomb force of exciton and its kinetic energy in the film. The kinetic energy was found to induce three degrees of freedom of the exciton.
34 CFR 300.29 - Native language.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Native language. 300.29 Section 300.29 Education... DISABILITIES General Definitions Used in This Part § 300.29 Native language. (a) Native language, when used with respect to an individual who is limited English proficient, means the following: (1) The language...
46 CFR 177.300 - Structural design.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Structural design. 177.300 Section 177.300 Shipping...) CONSTRUCTION AND ARRANGEMENT Hull Structure § 177.300 Structural design. Except as otherwise allowed by this subpart, a vessel must comply with the structural design requirements of one of the standards listed below...
34 CFR 300.44 - Universal design.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Universal design. 300.44 Section 300.44 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES General Definitions Used in This Part § 300.44 Universal design. Universal design has the meaning...
11 CFR 300.35 - Office buildings.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Office buildings. 300.35 Section 300.35 Federal... FUNDS State, District, and Local Party Committees and Organizations § 300.35 Office buildings. (a) General provision. For the purchase or construction of its office building, a State or local party...
34 CFR 300.7 - Charter school.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Charter school. 300.7 Section 300.7 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES General Definitions Used in This Part § 300.7 Charter school. Charter school has the meaning given...
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Child find. 300.111 Section 300.111 Education... REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION ASSISTANCE TO STATES FOR THE EDUCATION OF CHILDREN WITH... child with a disability under § 300.8 and in need of special education, even though they are advancing...
Energy Technology Data Exchange (ETDEWEB)
Moss, O R; Wong, V A, E-mail: moss@thehamner.or [Hamner Institutes for Health Sciences, Research Triangle Park, NC 27509-2137 (United States)
2009-02-01
When macrophages accumulate 28 nm and 250 nm diameter polystyrene latex (PSL) beads, the accumulation rates should reflect differences in molecular and cellular function. We used a confocal microscope to measure the accumulation rates of nanoparticles by F344-rat-alveolar macrophages (approx25,000 cells adhered to a 0.7 cm{sup 2} surface). Over the cells were layered 0.1 ml of media, and 0.1 ml of media-with-beads. Fresh cells were introduced for each exposure scenario. The maximum possible individual macrophage exposures were as follows: 8x10{sup 6}, 8x10{sup 5}, and 8x10{sup 4} 28 nm beads per macrophage; and 8x10{sup 4} and 1.12x10{sup 4} 250 nm beads per macrophage. Accumulation rates were estimated over 23 minutes. The increase in bead accumulation-rate matched changes in bead-availability: 7x increase for 250 nm beads; 100x increase for 28 nm beads; and 700x increase for all bead availabilities. The maximum sustained 28 nm bead accumulation rate was > 30,000 /min (for 5 min). Increases in bead accumulation could be explained by two mechanisms: bead-diffusion; and, for the macrophage, macropinocytosis. Also for the highest concentrations of 28 nm beads, we saw a colligative threshold - possibly due to beads masking the cell surface or obstructing cellular mechanisms.
Narrow line width operation of a 980 nm gain guided tapered diode laser bar
DEFF Research Database (Denmark)
Vijayakumar, Deepak; Jensen, Ole Bjarlin; Barrientos-Barria, Jessica
2011-01-01
We demonstrate two different schemes for the spectral narrowing of a 12 emitter 980 nm gain guided tapered diode laser bar. In the first scheme, a reflective grating has been used in a Littman Metcalf configuration and the wavelength of the laser emission could be narrowed down from more than 5.......5 nm in the free running mode to 0.04 nm (FWHM) at an operating current of 30 A with an output power of 8 W. The spectrum was found to be tunable within a range of 16 nm. In the second scheme, a volume Bragg grating has been used to narrow the wavelength of the laser bar from over 5 nm to less than 0.......2 nm with an output of 5 W at 20 A. To our knowledge, this is the first time spectral narrowing has been performed on a gain guided tapered diode laser bar. In the Littman Metcalf configuration, the spectral brightness has been increased by 86 times and in the volume Bragg grating cavity the spectral...
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Excess costs. 300.16 Section 300.16 Education... DISABILITIES General Definitions Used in This Part § 300.16 Excess costs. Excess costs means those costs that... for an example of how excess costs must be calculated.) (Authority: 20 U.S.C. 1401(8)) ...
46 CFR 116.300 - Structural design.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Structural design. 116.300 Section 116.300 Shipping... Structure § 116.300 Structural design. Except as otherwise allowed by this subpart, a vessel must comply with the structural design requirements of one of the standards listed below for the hull material of...
29 CFR 99.300 - Auditee responsibilities.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Auditee responsibilities. 99.300 Section 99.300 Labor Office... § 99.300 Auditee responsibilities. The auditee shall: (a) Identify, in its accounts, all Federal awards... the schedule of expenditures of Federal awards in accordance with § 99.310. (e) Ensure that the audits...
34 CFR 300.625 - Children's rights.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Children's rights. 300.625 Section 300.625 Education... § 300.625 Children's rights. (a) The SEA must have in effect policies and procedures regarding the extent to which children are afforded rights of privacy similar to those afforded to parents, taking into...
30 CFR 250.300 - Pollution prevention.
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Pollution prevention. 250.300 Section 250.300... OPERATIONS IN THE OUTER CONTINENTAL SHELF Pollution Prevention and Control § 250.300 Pollution prevention. (a... pollution occurs as a result of operations conducted by or on behalf of the lessee and the pollution damages...
Repair of near-UV (365nm or 313 nm) induced DNA strand breaks
International Nuclear Information System (INIS)
Miguel, A.G.
1981-01-01
The action of near-UV (365 nm or 313 nm) radiation in cellular inactivaton (biological measurements) and induction and repair of breaks (physical measurements) is studied in repair proficient strain and in pol A, rec A and uvr A deficient strains of Escherichia coli K-12. (M.A.C.) [pt
Gas Time-of-Flight Cherenkov Detector with Radiofrequency Phototube for FP420
International Nuclear Information System (INIS)
Margaryan, A.
2011-01-01
In this paper, the gas Cherenkov detector with radiofrequency phototube is considered as a fast-timing detector for FP420 project. The detector serves for precise Time-of-Flight measurements of forward going protons, capable of accurate vertex reconstruction and background rejection at high luminosities. The proposed technique is a high resolution (∼ 5 ps FWHM for a single proton), high rate (∼ MHz) and highly stable (less than 1 ps) timing technique capable to detect up to several tens events in a short (∼ 1 ns) time interval. (author)
Directory of Open Access Journals (Sweden)
J. Gröbner
2017-09-01
Full Text Available A high-resolution extraterrestrial solar spectrum has been determined from ground-based measurements of direct solar spectral irradiance (SSI over the wavelength range from 300 to 500 nm using the Langley-plot technique. The measurements were obtained at the Izaña Atmospheric Research Centre from the Agencia Estatal de Meteorología, Tenerife, Spain, during the period 12 to 24 September 2016. This solar spectrum (QASUMEFTS was combined from medium-resolution (bandpass of 0.86 nm measurements of the QASUME (Quality Assurance of Spectral Ultraviolet Measurements in Europe spectroradiometer in the wavelength range from 300 to 500 nm and high-resolution measurements (0.025 nm from a Fourier transform spectroradiometer (FTS over the wavelength range from 305 to 380 nm. The Kitt Peak solar flux atlas was used to extend this high-resolution solar spectrum to 500 nm. The expanded uncertainties of this solar spectrum are 2 % between 310 and 500 nm and 4 % at 300 nm. The comparison of this solar spectrum with solar spectra measured in space (top of the atmosphere gave very good agreements in some cases, while in some other cases discrepancies of up to 5 % were observed. The QASUMEFTS solar spectrum represents a benchmark dataset with uncertainties lower than anything previously published. The metrological traceability of the measurements to the International System of Units (SI is assured by an unbroken chain of calibrations leading to the primary spectral irradiance standard of the Physikalisch-Technische Bundesanstalt in Germany.
50 CFR 300.40 - Civil penalties.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Civil penalties. 300.40 Section 300.40... South Pacific Tuna Fisheries § 300.40 Civil penalties. The procedures of 15 CFR part 904 apply to the assessment of civil penalties, except as modified by the requirements of section 8 of the Act. ...
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false IEP Team. 300.321 Section 300.321 Education Regulations... Placements Individualized Education Programs § 300.321 IEP Team. (a) General. The public agency must ensure that the IEP Team for each child with a disability includes— (1) The parents of the child; (2) Not less...
International Nuclear Information System (INIS)
Peak, J.G.; Peak, M.J.
1982-01-01
Reciprocity (total applied fluence produces the same response, regardless of the fluence rate) for the lethal effects caused by 365 and 254 nm ultraviolet light (UV) was studied for repair-proficient and -deficient Escherichia coli strains. In the repair-proficient strain, E. coli WP2 uvr A + recA + , reciprocity after 365 nm UV was only observed at fluence rates of about 750 Wm -2 and above. Below this rate, the cells became increasingly sensitive as the fluence rate was decreased. Similar lack of reciprocity was obtained whether the cells were exposed at 0 or 25 0 C. The double repair-defective mutant, E. coli WP100 uvr A recA, showed complete reciprocity after 365 nm UV over the same range of fluence rates measured for the repair-proficient strain. For 254 nm UV, complete reciprocity occurred in both strains over a range of fluence rates differing by an order of magnitude. (author)
Bactericidal effect of a 405-nm diode laser on Porphyromonas gingivalis
Energy Technology Data Exchange (ETDEWEB)
Kotoku, Y; Kato, J; Akashi, G; Hirai, Y [Department of Operative Dentistry, Tokyo Dental College, 1-2-2, Masago, Mihama-ku, Chiba, 261-8502 (Japan); Ishihara, K [Department of Microbiology, Tokyo Dental College, 1-2-2, Masago, Mihama-ku, Chiba, 261-8502 (Japan)
2009-05-15
The study was conducted to determine the effect of 405-nm diode laser irradiation on periodontopathic bacteria such as Porphyromonas gingivalis in vitro. A diluted suspension of P. gingivalis was irradiated directly with a 405-nm diode laser under conditions of 100 mW-10 sec, 100 mW-20 sec, 200 mW-5 sec, 200 mW-10 sec, 200 mW-20 sec, 400 mW-5 sec, 400 mW-10 sec, and 400 mW-20 sec. The energy density ranged from 2.0 to 16.0 J/cm{sup 2}. The irradiated bacterial suspension was spread on a blood agar plate and growth of the colonies was examined after an anaerobic culture for 7 days. Bacterial growth was inhibited under all irradiation conditions, but the bactericidal effect of the 405-nm diode laser depended on the energy density. More than 97% of bacterial growth was inhibited with irradiation at an energy density > 4.0 J/cm{sup 2}. The mechanism of the bactericidal effect is photochemical, rather than photothermal. These findings suggest that a 405-nm diode laser has a high bactericidal effect on P. gingivalis.
Bactericidal effect of a 405-nm diode laser on Porphyromonas gingivalis
International Nuclear Information System (INIS)
Kotoku, Y; Kato, J; Akashi, G; Hirai, Y; Ishihara, K
2009-01-01
The study was conducted to determine the effect of 405-nm diode laser irradiation on periodontopathic bacteria such as Porphyromonas gingivalis in vitro. A diluted suspension of P. gingivalis was irradiated directly with a 405-nm diode laser under conditions of 100 mW-10 sec, 100 mW-20 sec, 200 mW-5 sec, 200 mW-10 sec, 200 mW-20 sec, 400 mW-5 sec, 400 mW-10 sec, and 400 mW-20 sec. The energy density ranged from 2.0 to 16.0 J/cm 2 . The irradiated bacterial suspension was spread on a blood agar plate and growth of the colonies was examined after an anaerobic culture for 7 days. Bacterial growth was inhibited under all irradiation conditions, but the bactericidal effect of the 405-nm diode laser depended on the energy density. More than 97% of bacterial growth was inhibited with irradiation at an energy density > 4.0 J/cm 2 . The mechanism of the bactericidal effect is photochemical, rather than photothermal. These findings suggest that a 405-nm diode laser has a high bactericidal effect on P. gingivalis
Bactericidal effect of a 405-nm diode laser on Porphyromonas gingivalis
Kotoku, Y.; Kato, J.; Akashi, G.; Hirai, Y.; Ishihara, K.
2009-05-01
The study was conducted to determine the effect of 405-nm diode laser irradiation on periodontopathic bacteria such as Porphyromonas gingivalis in vitro. A diluted suspension of P. gingivalis was irradiated directly with a 405-nm diode laser under conditions of 100 mW-10 sec, 100 mW-20 sec, 200 mW-5 sec, 200 mW-10 sec, 200 mW-20 sec, 400 mW-5 sec, 400 mW-10 sec, and 400 mW-20 sec. The energy density ranged from 2.0 to 16.0 J/cm2. The irradiated bacterial suspension was spread on a blood agar plate and growth of the colonies was examined after an anaerobic culture for 7 days. Bacterial growth was inhibited under all irradiation conditions, but the bactericidal effect of the 405-nm diode laser depended on the energy density. More than 97% of bacterial growth was inhibited with irradiation at an energy density > 4.0 J/cm2. The mechanism of the bactericidal effect is photochemical, rather than photothermal. These findings suggest that a 405-nm diode laser has a high bactericidal effect on P. gingivalis.
Efficiency of soft tissue incision with a novel 445-nm semiconductor laser.
Braun, Andreas; Kettner, Moritz; Berthold, Michael; Wenzler, Johannes-Simon; Heymann, Paul Günther Baptist; Frankenberger, Roland
2018-01-01
Using a 445-nm semiconductor laser for tissue incision, an effective cut is expected due to the special absorption properties of blue laser light in soft tissues. The aim of the present study was the histological evaluation of tissue samples after incision with a 445-nm diode laser. Forty soft tissue specimens were obtained from pork oral mucosa and mounted on a motorized linear translation stage. The handpiece of a high-frequency surgery device, a 970-nm semiconductor laser, and a 445-nm semiconductor laser were connected to the slide, allowing a constant linear movement (2 mm/s) and the same distance of the working tip to the soft tissue's surface. Four incisions were made each: (I) 970-nm laser with conditioned fiber tip, contact mode at 3-W cw; (II-III): 445-nm laser with non-conditioned fiber tip, contact mode at 2-W cw, and non-contact mode (1 mm) at 2 W; and (IV): high-frequency surgery device with straight working tip, 90° angulation, contact mode at 50 W. Histological analysis was performed after H&E staining of the embedded specimens at 35-fold magnification. The comparison of the incision depths showed a significant difference depending on the laser wavelength and the selected laser parameters. The highest incision depth was achieved with the 445-nm laser contact mode (median depth 0.61 mm, min 0.26, max 1.17, interquartile range 0.58) (p laser, a higher cutting efficiency can be expected when compared with a 970-nm diode laser and high-frequency surgery. Even the 445-nm laser application in non-contact mode shows clinically acceptable incision depths without signs of extensive soft tissue denaturation.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.300-9 Section 179.300-9... Specifications for Multi-Unit Tank Car Tanks (Classes DOT-106A and 110AW) § 179.300-9 Welding. (a) Longitudinal... fusion welded on class DOT-110A tanks. Welding procedures, welders and fabricators must be approved in...
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Carrot oil. 73.300 Section 73.300 Food and Drugs... ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.300 Carrot oil. (a) Identity. (1) The color additive carrot oil is the liquid or the solid portion of the mixture or the mixture itself obtained by the hexane...
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Fire pumps. 181.300 Section 181.300 Shipping COAST GUARD... EQUIPMENT Fire Main System § 181.300 Fire pumps. (a) A self priming, power driven fire pump must be..., the minimum capacity of the fire pump must be 189 liters (50 gallons) per minute at a pressure of not...
Molecular cloud-scale star formation in NGC 300
Energy Technology Data Exchange (ETDEWEB)
Faesi, Christopher M.; Lada, Charles J.; Forbrich, Jan [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Menten, Karl M. [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Bouy, Hervé [Centro de Astrobiología, (INTA-CSIC), Departamento de Astrofísica, POB 78, ESAC Campus, 28691 Villanueva dela Cañada (Spain)
2014-07-01
We present the results of a galaxy-wide study of molecular gas and star formation in a sample of 76 H II regions in the nearby spiral galaxy NGC 300. We have measured the molecular gas at 250 pc scales using pointed CO(J = 2-1) observations with the Atacama Pathfinder Experiment telescope. We detect CO in 42 of our targets, deriving molecular gas masses ranging from our sensitivity limit of ∼10{sup 5} M {sub ☉} to 7 × 10{sup 5} M {sub ☉}. We find a clear decline in the CO detection rate with galactocentric distance, which we attribute primarily to the decreasing radial metallicity gradient in NGC 300. We combine Galaxy Evolution Explorer far-ultraviolet, Spitzer 24 μm, and Hα narrowband imaging to measure the star formation activity in our sample. We have developed a new direct modeling approach for computing star formation rates (SFRs) that utilizes these data and population synthesis models to derive the masses and ages of the young stellar clusters associated with each of our H II region targets. We find a characteristic gas depletion time of 230 Myr at 250 pc scales in NGC 300, more similar to the results obtained for Milky Way giant molecular clouds than the longer (>2 Gyr) global depletion times derived for entire galaxies and kiloparsec-sized regions within them. This difference is partially due to the fact that our study accounts for only the gas and stars within the youngest star-forming regions. We also note a large scatter in the NGC 300 SFR-molecular gas mass scaling relation that is furthermore consistent with the Milky Way cloud results. This scatter likely represents real differences in giant molecular cloud physical properties such as the dense gas fraction.
High-q microring resonator with narrow free spectral range for pulse repetition rate multiplication
DEFF Research Database (Denmark)
Pu, Minhao; Ji, Hua; Frandsen, Lars Hagedorn
2009-01-01
We demonstrate a silicon-on-insulator microring resonator with a free-spectral-range of 0.32 nm, an extinction ratio of 27 dB, and a quality factor of ~140900 at 1550 nm that is used for pulse repetition-rate multiplication from 10 to 40 GHz.......We demonstrate a silicon-on-insulator microring resonator with a free-spectral-range of 0.32 nm, an extinction ratio of 27 dB, and a quality factor of ~140900 at 1550 nm that is used for pulse repetition-rate multiplication from 10 to 40 GHz....
355-nm hypersensitization of optical fibers
Canagasabey, A.; Canning, J.; Groothoff, N.
2003-01-01
A study is presented on 355-nm hypersensitization of optical fibers. It is found that the intrinsic 244-nm photosensitivity of boron-codoped germanosilicate optical fibers is enhanced by 355-nm hypersensitization. Hypersensitization through standard polymer coating is also demonstrated.
Long term monitoring of Gamma-Ray emission from the BL Lacertae object (1ES 2200+420)
Gunawardhana, Isuru; VERITAS Collaboration
2016-03-01
Blazars are a class of Active Galactic Nuclei (AGN) that have relativistic jets pointing along the observer line of sight. Blazars exhibit variable emission extending from radio to TeV energies. The variability timescale of the TeV flux is a key component of understanding the location of the very high energy emission zones. Deep observations of the quiescent state measurements are also required to disentangle the flaring state emission from quiescent state emission, a prerequisite for understanding the origin of blazar spectral variability. BL Lacertae (also known as 1ES 2200+420), as the namesake for all BL Lac objects, is a prime example of one such blazar. The VERITAS Observatory, an Imaging Atmospheric Cherenkov Telescope (IACT) array sensitive to gamma rays in the range from 85 GeV to 30 TeV, dedicates approximately 110 hours per year on deep observations of known gamma-ray blazars. In this talk, I will describe the TeV photon flux variability of BL Lacertae measured by VERITAS from 2013 to 2015.
International Nuclear Information System (INIS)
Han, Bang Woo; Kim, Hak Joon; Kim, Yong Jin; Song, Dong Keun; Hong, Won Seok; Shin, Wan Ho
2011-01-01
The charging of 10-nm-class nanoparticles in an electrostatic precipitator (ESP) according to particle charging ratio has been investigated and compared to the diffusion effect of the nanoparticles. The competition between the charging probability and the diffusion loss effect determines the collection efficiency of nanoparticles in the ESP. The collection efficiency of nanoparticles decreased continuously with decreasing particle diameter. This indicates that the partial charging effect of 10-nm-class nanoparticles is more dominant than their diffusion loss effect in the ESP for nanoparticles in the particle size range of less than 10 nm. The charging ratios based on unipolar diffusion charging calculations were in good agreement with the experimental collection efficiencies for nanoparticles less than 10 nm in diameter
Biosynthesis and structural characterization of silver nanoparticles from bacterial isolates
International Nuclear Information System (INIS)
Zaki, Sahar; El Kady, M.F.; Abd-El-Haleem, Desouky
2011-01-01
Graphical abstract: In this study five bacterial isolates belong to different genera were found to be able to biosynthesize silver nanoparticles. Biosynthesis and spectral characterization are reported here. Highlights: → About 300 bacterial isolates were screened for their ability to produce nanosilvers → Five of them were potential candidates for synthesis of silver nanoparticles → Production of silver nanoparticles was examined using UV-Vis, XRD, SEM and EDS. → The presence of nanoparticles with all five bacterial isolates was confirmed. -- Abstract: This study aimed to develop a green process for biosynthesis of silver nanomaterials by some Egyptian bacterial isolates. This target was achieved by screening an in-house culture collection consists of 300 bacterial isolates for silver nanoparticle formation. Through screening process, it was observed that strains belonging to Escherichia coli (S30, S78), Bacillus megaterium (S52), Acinetobacter sp. (S7) and Stenotrophomonas maltophilia (S54) were potential candidates for synthesis of silver nanoparticles. The extracellular production of silver nanoparticles by positive isolates was investigated by UV-Vis spectroscopy, X-ray diffraction (XRD), transmission electron microscope (TEM), scanning electron microscopy (SEM) and energy dispersive X-ray spectroscopy (EDS). The results demonstrated that UV-visible spectrum of the aqueous medium containing silver ion showed a peak at 420 nm corresponding to the plasmon absorbance of silver nanoparticles. Scanning electron microscopy micrograph showed formation of silver nanoparticles in the range of 15-50 nm. XRD-spectrum of the silver nanoparticles exhibited 2θ values corresponding to the silver nanocrystal that produce in hexagonal and cubic crystal configurations with different plane of orientation. In addition, the signals of the silver atoms were observed by EDS-spectrum analysis that confirms the presence of silver nanoparticles (AgNPs) in all positive
A 130 nm ASIC prototype for the NA62 Gigatracker readout
Energy Technology Data Exchange (ETDEWEB)
Dellacasa, G., E-mail: gdellaca@to.infn.it [I.N.F.N. sez. Torino, via Giuria 1, 10125 Torino (Italy); Garbolino, S. [Universita degli Studi di Torino, Dip. Fisica Sperimentale, via Giuria 1, 10125 Torino (Italy); Marchetto, F. [I.N.F.N. sez. Torino, via Giuria 1, 10125 Torino (Italy); Martoiu, S. [I.N.F.N. sez. Torino, via Giuria 1, 10125 Torino (Italy); CERN CH-1211, Geneve 23 (Switzerland); Mazza, G.; Rivetti, A.; Wheadon, R. [I.N.F.N. sez. Torino, via Giuria 1, 10125 Torino (Italy)
2011-09-11
One of the most challenging detectors of the NA62 experiment is the silicon tracker, called Gigatracker. It consists of three hybrid silicon pixel stations, each one covering an area of 27 mmx60 mm. While the maximum pixel size is fairly large, 300{mu}mx300{mu}m the system has to sustain a very high particle rate, 1.5 MHz/mm{sup 2}, which corresponds to 800 MHz for each station. To obtain an efficient tracking with such a high rate the required track timing resolution is 150 ps (rms). Therefore the front-end ASIC should provide for each pixel a 200 ps time measurement capability, thus leading to the requirement of time walk compensation and very compact TDCs. Moreover, Single Event Upset protection has to be implemented in order to protect the digital circuitry. An ASIC prototype has been realized in CMOS 130 nm technology, containing three pixel columns. The chip performs the time walk compensation by a Constant Fraction Discriminator circuit, while the time measurement is performed by a Time to Amplitude Converter based TDC, both of them implemented on each pixel cell. The End of Column circuit containing only digital logic is responsible for the data readout from the pixel cell. The whole chip works with a system clock of 160 MHz and the digital logic is SEU protected by the use of Hamming codes. The detailed architecture of the ASIC prototype and test results are presented.
Energy Technology Data Exchange (ETDEWEB)
Toloczko, M.B.; Garner, F.A. [Pacific Northwest National Lab., Richland, WA (United States); Munro, B. [AEA Technology, Dounreay (United Kingdom)] [and others
1997-04-01
Irradiation creep data are expensive and often difficult to obtain, especially when compared to swelling data. This requires that maximum use be made of available data sources in order to elucidate the parametric dependencies of irradiation creep for application to new alloys and to new environments such as those of proposed fusion environments. One previously untapped source of creep data is that of a joint U.S./U.K. experiment conducted in the Prototype Fast Reactor (PFR) in Dounreay, Scotland. In this experiment, five austenitic steels were irradiated in a variety of starting conditions. In particular, these steels spanned a large range (15-40%) of nickel contents, and contained strong variations in Mo, Ti, Al, and Nb. Some alloys were solution-strengthened and some were precipitation-strengthened. Several were cold-worked. These previously unanalyzed data show that at 420{degrees}C all austenitic steels have a creep compliance that is roughly independent of the composition of the steel at 2{+-}1 x 10{sup {minus}6}MPa{sup {minus}1} dpa{sup {minus}1}. The variation within this range may arise from the inability to completely separate the non-creep strains arising from precipitation reactions and the stress-enhancement of swelling. Each of these can be very sensitive to the composition and starting treatment of a steel.
International Nuclear Information System (INIS)
Bayukov, Yu D.; Bukiej, A.E.; Gavrilov, V.B.
1980-01-01
Studied are the main characteristics (efficiency, time delay and amplitude singal distribution) of a magnet-free hadron spectrometer, in which a plastic scintillator block is the main part. The plastic scintillator having the form of a cylinder of the 20 cm diameter and the 20 cm height is examined with a photomultiplier through a 50 cm light guide. The dependencies of the amplitude conversion coefficient and signal time delay on the distance between the scintillation point and the light guide are resented. The analysis of the results obtained has shown that the closer the beam passes to the light guide, the greater is the signal amplitude. The counter signal delay linearly increases with the distance increase between the beam and the light guide. The dependence of the spectrometer efficiency on the proton energy is measured as well. The investigations have proved possible utilization of the scintillation detector described for identification of charged particles in the 50-300 MeV range and measurement of their energy with the 3-8% accuracy
Directory of Open Access Journals (Sweden)
Ayman A. Gouda
2014-01-01
Full Text Available Simple, rapid, and extractive spectrophotometric methods were developed for the determination of some fluoroquinolones antibiotics: gemifloxacin mesylate (GMF, moxifloxacin hydrochloride (MXF, and enrofloxacin (ENF in pure forms and pharmaceutical formulations. These methods are based on the formation of ion-pair complexes between the basic drugs and acid dyes, namely, bromocresol green (BCG, bromocresol purple (BCP, bromophenol blue (BPB, bromothymol blue (BTB, and methyl orange (MO in acidic buffer solutions. The formed complexes were extracted with chloroform and measured at 420, 408, 416, 415, and 422 nm for BCG, BCP, BPB, BTB, and MO, respectively, for GMF; at 410, 415, 416, and 420 nm for BCP, BTB, BPB, and MO, respectively, for MXF; and at 419 and 414 nm for BCG and BTB, respectively, in case of ENF. The analytical parameters and their effects are investigated. Beer’s law was obeyed in the ranges 1.0–30, 1.0–20, and 2.0–24 μg mL−1 for GMF, MXF, and ENF, respectively. The proposed methods have been applied successfully for the analysis of the studied drugs in pure forms and pharmaceutical formulations. Statistical comparison of the results with the reference methods showed excellent agreement and indicated no significant difference in accuracy and precision.
Directory of Open Access Journals (Sweden)
Riccardo Montioli
2013-01-01
Full Text Available Human Dopa decarboxylase (hDDC, a pyridoxal 5′-phosphate (PLP enzyme, displays maxima at 420 and 335 nm and emits fluorescence at 384 and 504 nm upon excitation at 335 nm and at 504 nm when excited at 420 nm. Absorbance and fluorescence titrations of hDDC-bound coenzyme identify a single pKspec of ~7.2. This pKspec could not represent the ionization of a functional group on the Schiff base but that of an enzymic residue governing the equilibrium between the low- and the high-pH forms of the internal aldimine. During the reaction of hDDC with L-Dopa, monitored by stopped-flow spectrophotometry, a 420 nm band attributed to the 4′-N-protonated external aldimine first appears, and its decrease parallels the emergence of a 390 nm peak, assigned to the 4′-N-unprotonated external aldimine. The pH profile of the spectral change at 390 nm displays a pK of 6.4, a value similar to that (~6.3 observed in both kcat and kcat/Km profiles. This suggests that this pK represents the ESH+ → ES catalytic step. The assignment of the pKs of 7.9 and 8.3 observed on the basic side of kcat and the PLP binding affinity profiles, respectively, is also analyzed and discussed.
Energy Technology Data Exchange (ETDEWEB)
Belyaev, A.A.; Get' man, V.A.; Gorbenko, V.G.; Gushchin, V.A.; Derkach, A.Y.; Zhebrovskii, Y.V.; Karnaukhov, I.M.; Kolesnikov, L.Y.; Lukhanin, A.A.; Rubashkin, A.L.; Sorokin, P.V.; Sporov, E.A.; Telegin, Y.N.
1982-03-01
We report an experimental study of the ..sigma.., T, and P parameters of the cross section for the reaction ..gamma..p..-->..p..pi../sup 0/ for photon energies 300, 320, 350, 380, 400, 420 MeV in the range of pion emission angles 60--135/sup 0/ c.m.s. The technique of a double polarization experiment with use of linearly polarized photons and a polarized proton target is described. The experimental results are compared with the predictions of theoretical analyses.
Trace analysis for 300 MM wafers and processes with TXRF
International Nuclear Information System (INIS)
Nutsch, A.; Erdmann, V.; Zielonka, G.; Pfitzner, L.; Ryssel, H.
2000-01-01
Efficient fabrication of semiconductor devices is combined with an increasing size of silicon wafers. The contamination level of processes, media, and equipment has to decrease continuously. A new test laboratory for 300 mm was installed in view of the above mentioned aspects. Aside of numerous processing tools this platform consist electrical test methods, particle detection, vapor phase decomposition (VPD) preparation, and TXRF. The equipment is installed in a cleanroom. It is common to perform process or equipment control, development, evaluation and qualification with monitor wafers. The evaluation and the qualification of 300 mm equipment require direct TXRF on 300 mm wafers. A new TXRF setup was installed due to the wafer size of 300 mm. The 300 mm TXRF is equipped with tungsten and molybdenum anode. This combination allows a sensitive detection of elements with fluorescence energy below 10 keV for tungsten excitation. The molybdenum excitation enables the detection of a wide variety of elements. The detection sensitivity for the tungsten anode excited samples is ten times higher than for molybdenum anode measured samples. The system is calibrated with 1 ng Ni. This calibration shows a stability within 5 % when monitored to control system stability. Decreasing the amount of Ni linear results in a linear decrease of the measured Ni signal. This result is verified for a range of elements by multielement samples. New designs demand new processes and materials, e.g. ferroelectric layers and copper. The trace analysis of many of these materials is supported by the higher excitation energy of the molybdenum anode. Reclaim and recycling of 300 mm wafers demand for an accurate contamination control of the processes to avoid cross contamination. Polishing or etching result in modified surfaces. TXRF as a non-destructive test method allows the simultaneously detection of a variety of elements on differing surfaces in view of contamination control and process
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false [Reserved] 300.326 Section 300.326 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION ASSISTANCE TO STATES FOR THE EDUCATION OF CHILDREN WITH...
2010-10-01
... Wildlife and Fisheries INTERNATIONAL FISHING AND RELATED ACTIVITIES INTERNATIONAL FISHERIES REGULATIONS International Trade Documentation and Tracking Programs for Highly Migratory Species § 300.181 Definitions... international trade permit under § 300.182. [61 FR 35550, July 5, 1996, as amended at 73 FR 31385, June 2, 2008] ...
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Definitions. 158.300 Section 158.300 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS DATA REQUIREMENTS... substances, if specified by the Agency) that will prevent, destroy, repel or mitigate any pest, or that...
International Nuclear Information System (INIS)
Traube, K.
1976-01-01
The joint German-Belgian-Dutch loop-type 300 MW(e) LMFBR prototype is being constructed at Kalkar on the lower Rhine in Germany. Among the many arguments put forward in defense of SNR-300, that of acquiring licensing exprience has proven to be of major importance to the international breeder scene. The severity of the licensing procedures and of the safety standards imposed are unique in several respects, including timing: generally growing scepticism towards nuclear power increased severity of the licensing practice; organizational features: the procedure and criteria developed for commercial light water reactors have been applied without exemptions. This relates to the commercial-type contract under which SNR-300 is being built for private utilities by a private company; and German nuclear safety standards, known worldwide to be most stringent. The following three important areas are discussed in which SNR-300 decidedly deviates from its forerunners: protection against the hypothetical core disruptive accident (HCDA), protection against external events, and provisions for in-service inspection
Safety design philosophy of gas turbine high temperature reactor (GTHTR300)
International Nuclear Information System (INIS)
Katanishi, Shoji; Kunitomi, Kazuhiko
2003-01-01
Japan Atomic Energy Research Institute (JAERI) has been developing design studies of the Gas Turbine High Temperature Reactor (GTHTR300). The original safety design philosophy has also been discussed and fixed for the GTHTR300 based on the experience of the High Temperature Engineering Test Reactor (HTTR) of JAERI which is the first High Temperature Gas-cooled Reactor (HTGR) in Japan. One of the unique feature of the safety philosophy of the GTHTR300 is that a depressurization accident induced by a large pipe break is postulated as a design basis accident in order to show the high level of safety characteristics, though its probability of occurrence is lower than the probability range of design basis accident. Another feature of safety design is to adopt a double confinement that is one of the original concepts for the GTHTR300. By using a double confinement, a feasibility of safety design without containment vessel was clarified even in case of the depressurization accident. The safety design philosophies for passive cooling system, reactor shutdown system, and so on were determined. The methodology for the safety evaluation, such as safety criteria and selection of events to be evaluated by using estimation of probability of occurrence, were also discussed and determined. This article describes the safety design philosophy and some results of preliminary evaluations which were conducted in order to clarify the feasibility of original safety design of the GTHTR300. The present study is entrusted from Ministry of Education, Culture, Sports, Science and Technology of Japan. (author)
Histologic evaluation of laser lipolysis: pulsed 1064-nm Nd:YAG laser versus cw 980-nm diode laser.
Mordon, Serge; Eymard-Maurin, Anne Françoise; Wassmer, Benjamin; Ringot, Jean
2007-01-01
The use of the laser as an auxiliary tool has refined the traditional technique for lipoplasty. During laser lipolysis, the interaction between the laser and the fat produced direct cellular destruction before the suction, reduced bleeding, and promoted skin tightening. This study sought to perform a comparative histologic evaluation of laser lipolysis with the pulsed 1064-nm Nd:YAG laser versus a continuous 980-nm diode laser. A pulsed 1064-nm Nd:YAG (Smart-Lipo; Deka, Italy) and a CW 980-nm diode laser (Pharaon, Osyris, France) were evaluated at different energy settings for lipolysis on the thighs of a fresh cadaver. The lasers were coupled to a 600-microm optical fiber inserted in a 1-mm diameter cannula. Biopsy specimens were taken on irradiated and non-irradiated areas. Hematoxylin-erythrosin-safran staining and immunostaining (anti-PS100 polyclonal antibody) were performed to identify fat tissue damage. In the absence of laser exposures (control specimens), cavities created by cannulation were seen; adipocytes were round in appearance and not deflated. At low energy settings, tumescent adipocytes were observed. At higher energy settings, cytoplasmic retraction, disruption of membranes, and heat-coagulated collagen fibers were noted; coagulated blood cells were also present. For the highest energy settings, carbonization of fat tissue involving fibers and membranes was clearly seen. For equivalent energy settings, 1064-nm and 980-nm wavelengths gave similar histologic results. Laser lipolysis is a relatively new technique that is still under development. Our histologic findings suggest several positive benefits of the laser, including skin retraction and a reduction in intraoperative bleeding. The interaction of the laser with the tissue is similar at 980 nm and 1064 nm with the same energy settings. Because higher volumes of fat are removed with higher total energy, a high-power 980-nm diode laser could offer an interesting alternative to the 1064-nm Nd
Temperature-dependent absorption cross sections for hydrogen peroxide vapor
Nicovich, J. M.; Wine, P. H.
1988-01-01
Relative absorption cross sections for hydrogen peroxide vapor were measured over the temperature ranges 285-381 K for lambda = 230 nm-295 nm and 300-381 K for lambda = 193 nm-350 nm. The well established 298 K cross sections at 202.6 and 228.8 nm were used as an absolute calibration. A significant temperature dependence was observed at the important tropospheric photolysis wavelengths lambda over 300 nm. Measured cross sections were extrapolated to lower temperatures, using a simple model which attributes the observed temperature dependence to enhanced absorption by molecules possessing one quantum of O-O stretch vibrational excitation. Upper tropospheric photodissociation rates calculated using the extrapolated cross sections are about 25 percent lower than those calculated using currently recommended 298 K cross sections.
Spectroscopy of Pluto, 380-930 Nm at Six Longitudes
Cruikshank, D. P.; Pinilla-Alonso, N.; Lorenzi, V.; Grundy, William; Licandro, J.; Binzel, R. P.
2014-01-01
We have obtained spectra of the Pluto-Charon pair (unresolved) in the wavelength range 380-930 nm with resolution approx..450 at six roughly equally spaced longitudes. The data were taken in May and June, 2014, with the 4.2-m Isaac Newton Telescope at Roque de Los Muchachos Observatory in the Canary Islands, using the ACAM (auxiliary-port camera) in spectrometer mode, and using two solar analog stars. The new spectra clearly show absorption bands of solid CH4 at 620, 728, and 850-910 nm, which were known from earlier work. The 620-nm CH4 band is intrinsically very weak, and its appearance indicates a long optical path-length through the ice. This is especially true if it arises from CH4 dissolved in N2 ice. Earlier work (Owen et al. Science 261, 745, 1993) on the near-infrared spectrum of Pluto (1-2.5 microns) has shown that the CH4 bands are shifted to shorter wavelengths because the CH4 occurs as a solute in beta-phase crystalline N2. The optical path-length through the N2 crystals must be on the order of several cm to produce the N2 band observed at 2.15 microns. The new spectra exhibit a pronounced red slope across the entire wavelength range; the slope is variable with longitude, and differs in a small but significant way from that measured at comparable longitudes by Grundy & Fink (Icarus 124, 329, 1996) in their 15-year study of Pluto's spectrum (500-1000 nm). The new spectra will provide an independent means for calibrating the color filter bands on the Multispectral Visible Imaging Camera (MVIC) (Reuter et al. Space Sci. Rev. 140, 129, 2008) on the New Horizons spacecraft, which will encounter the Pluto-Charon system in mid-2015. They will also form the basis of modeling the spectrum of Pluto at different longitudes to help establish the nature of the non-ice component(s) of Pluto's surface. It is presumed that the non-ice component is the source of the yellow-red coloration of Pluto, which is known to be variable across the surface.
Hypersensitisation using 266nm Laser Light
DEFF Research Database (Denmark)
Sørensen, Henrik Rokkjær; Canning, John; Kristensen, Martin
UV-hypersensitisation using 266nm VW-light on hydrogenated Ge-doped fibre is reported. The optimum fluence to be between 5 to 10 kJ/cm2, coinciding with results obtained using 355nm light, indicating same end-process in both reactions.......UV-hypersensitisation using 266nm VW-light on hydrogenated Ge-doped fibre is reported. The optimum fluence to be between 5 to 10 kJ/cm2, coinciding with results obtained using 355nm light, indicating same end-process in both reactions....
Ranging Behaviour of Commercial Free-Range Broiler Chickens 1: Factors Related to Flock Variability.
Taylor, Peta S; Hemsworth, Paul H; Groves, Peter J; Gebhardt-Henrich, Sabine G; Rault, Jean-Loup
2017-07-20
Little is known about the ranging behaviour of chickens. Understanding ranging behaviour is required to improve management and shed and range design to ensure optimal ranging opportunities. Using Radio Frequency Identification technology, we tracked 300 individual broiler chickens in each of four mixed sex ROSS 308 flocks on one commercial farm across two seasons. Ranging behaviour was tracked from the first day of range access (21 days of age) until 35 days of age in winter and 44 days of age in summer. Range use was higher than previously reported from scan sampling studies. More chickens accessed the range in summer (81%) than winter (32%; p range use was greater in summer flocks (4.4 ± 0.1 visits for a total of 26.3 ± 0.8 min/day) than winter flocks (3.2 ± 0.2 visits for a total of 7.9 ± 1.0 min/day). Seasonal differences were only marginally explained by weather conditions and may reflect the reduction in range exposure between seasons (number of days, hours per day, and time of day). Specific times of the day ( p ranging and external factors that may explain ranging preferences.
McCarthy, K. J.; Tamura, N.; Combs, S. K.; García, R.; Hernández Sánchez, J.; Navarro, M.; Panadero, N.; Pastor, I.; Soleto, A.; the TJ-II Team
2018-03-01
43 spectral emission lines from F-like to Li-like sulphur ions have been identified in the wavelength range from 17.5 to 50 nm in spectra obtained following tracer injection into plasmas created in a magnetically confined plasma device, the stellarator TJ-II. Plasmas created and maintained in this heliac device with electron cyclotron resonance heating achieve central electron temperatures and densities up to 1.5 keV and 8 × 1018 m-3, respectively. Tracer injections were performed with ≤6 × 1016 atoms of sulphur contained within ˜300 μm diameter polystyrene capsules, termed tracer encapsulated solid pellets, using a gas propulsion system to achieve velocities between 250 and 450 m s-1. Once ablation of the exterior polystyrene shell by plasma particles is completed, the sulphur is deposited in the plasma core where it is ionized up to S+13 and transported about the plasma. In order to aid line identification, which is made using a number of atomic line emission databases, spectra are collected before and after injection using a 1 m focal length normal incidence spectrometer equipped with a CCD camera. This work is motivated by the need to clearly identify sulphur emission lines in the vacuum ultraviolet range of magnetically confined plasmas, as sulphur x-ray emission lines are regularly observed in both tokamak and stellarator plasmas.
2010-10-01
... accordance with the annual management measures published pursuant to 50 CFR 300.62. (b) Fish for halibut except in accordance with the catch sharing plans and domestic management measures implemented under 50... while commercial fishing or from sport fishing, as defined at § 300.61, except that persons authorized...
Biostimulative effects of 809 nm diode laser on cutaneous skin wounds
Solmaz, Hakan; Gülsoy, Murat; Ülgen, Yekta
2015-03-01
The use of low-level laser therapy (LLLT) for therapeutic purposes in medicine has become widespread recently. There are many studies in literature supporting the idea of therapeutic effects of laser irradiation on biological tissues. The aim of this study is to investigate the biostimulative effect of 809nm infrared laser irradiation on the healing process of cutaneous incisional skin wounds. 3-4 months old male Wistar Albino rats weighing 300 to 350 gr were used throughout this study. Lowlevel laser therapy was applied through local irradiation of 809nm infrared laser on open skin incisional wounds of 1 cm length. Each animal had six identical incisions on their right and left dorsal region symmetrical to each other. The wounds were separated into three groups of control, 1 J/cm2 and 3 J/cm2 of laser irradiation. Two of these six wounds were kept as control group and did not receive any laser application. Rest of the incisions was irradiated with continuous diode laser of 809nm in wavelength and 20mW power output. Two of them were subjected to laser irradiation of 1 J/cm2 and the other two were subjected to laser light with energy density of 3 J/cm2. Biostimulation effects of irradiation were studied by means of tensile strength tests and histological examinations. Wounded skin samples were morphologically examined and removed for mechanical and histological examinations at days 3, 5 and 7 following the laser applications. Three of the six fragments of skin incisions including a portion of peripheral healthy tissue from each animal were subjected to mechanical tests by means of a universal tensile test machine, whereas the other three samples were embedded in paraffin and stained with hematoxylin and eosin for histological examinations. The findings of the study show that tissue repair following laser irradiation of 809nm has been accelerated in terms of tissue morphology, strength and cellular content. These results seem to be consistent with the results of many
Blue laser diode (450 nm) systems for welding copper
Silva Sa, M.; Finuf, M.; Fritz, R.; Tucker, J.; Pelaprat, J.-M.; Zediker, M. S.
2018-02-01
This paper will discuss the development of high power blue laser systems for industrial applications. The key development enabling high power blue laser systems is the emergence of high power, high brightness laser diodes at 450 nm. These devices have a high individual brightness rivaling their IR counterparts and they have the potential to exceed their performance and price barriers. They also have a very high To resulting in a 0.04 nm/°C wavelength shift. They have a very stable lateral far-field profile which can be combined with other diodes to achieve a superior brightness. This paper will report on the characteristics of the blue laser diodes, their integration into a modular laser system suitable for scaling the output power to the 1 kW level and beyond. Test results will be presented for welding of copper with power levels ranging from 150 Watts to 600 Watts
White emission via electroplex emission from two blue materials.
Li, Junming; Song, Dandan; Zhao, Suling; Zhang, Fujun; Xu, Zheng; Song, Jinglu; Lu, Lifang; Liu, Xiaodong; Wang, Yongsheng
2010-03-01
Influences of electric fields on the emission from organic light-emitting diodes (OLEDs) based on poly (N-vinylcarbazole) (PVK); 2, 9-dimethyl-4, 7-diphenyl-1, 10-phenanthroline (BCP); and tris (8-hydroxyquinoline) aluminum (Alq3) were studied. There are three emission peaks at 420 nm, 520 nm, and 620 nm of the device ITO/PEDOT: PSS/PVK/BCP/LiF/Al under different driving voltages. The emissions at 420 nm and 520 nm should be from the exciton emission of PVK and Alq3, respectively. The last emission at 620 nm could be attributed to electroplex emission at the interface between the PVK and BCP layers. A high intensity white emission via electroplex formation was obtained with Commission International d'Eclairage (CIE) coordinates (0.33, 0.34) at 15 V, which is very close to the equienergy white point (0.33, 0.33).
2010-07-01
... REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION ASSISTANCE TO STATES FOR THE EDUCATION OF CHILDREN WITH... extent of the special education and related services that the child needs. (Authority: 20 U.S.C. 1414(a... 34 Education 2 2010-07-01 2010-07-01 false Evaluation. 300.15 Section 300.15 Education Regulations...
Rovere, Andrea; Jeong, Young-Gyun; Piccoli, Riccardo; Lee, Seung-Heon; Lee, Seung-Chul; Kwon, O-Pil; Jazbinsek, Mojca; Morandotti, Roberto; Razzari, Luca
2018-02-05
We present the generation of high-peak-electric-field terahertz pulses via collinear optical rectification in a 2-(4-hydroxy-3-methoxystyryl)-1-methilquinolinium-2,4,6-trimethylbenzenesulfonate (HMQ-TMS) organic crystal. The crystal is pumped by an amplified ytterbium laser system, emitting 170-fs-long pulses centered at 1030 nm. A terahertz peak electric field greater than 200 kV/cm is obtained for 420 µJ of optical pump energy, with an energy conversion efficiency of 0.26% - about two orders of magnitude higher than in common inorganic crystals collinearly pumped by amplified femtosecond lasers. An open-aperture Z-scan measurement performed on an n-doped InGaAs thin film using such terahertz source shows a nonlinear increase in the terahertz transmission of about 2.2 times. Our findings demonstrate the potential of this terahertz generation scheme, based on ytterbium laser technology, as a simple and efficient alternative to the existing intense table-top terahertz sources. In particular, we show that it can be readily used to explore nonlinear effects at terahertz frequencies.
Energy Technology Data Exchange (ETDEWEB)
Griffin, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2016-11-23
This Spill Prevention, Control, and Countermeasure (SPCC) Plan describes the measures that are taken at Lawrence Livermore National Laboratory’s (LLNL) Experimental Test Site (Site 300) near Tracy, California, to prevent, control, and handle potential spills from aboveground containers that can contain 55 gallons or more of oil. This SPCC Plan complies with the Oil Pollution Prevention regulation in Title 40 of the Code of Federal Regulations, Part 112 (40 CFR 112) and with 40 CFR 761.65(b) and (c), which regulates the temporary storage of polychlorinated biphenyls (PCBs). This Plan has also been prepared in accordance with Division 20, Chapter 6.67 of the California Health and Safety Code (HSC 6.67) requirements for oil pollution prevention (referred to as the Aboveground Petroleum Storage Act [APSA]), and the United States Department of Energy (DOE) Order No. 436.1. This SPCC Plan establishes procedures, methods, equipment, and other requirements to prevent the discharge of oil into or upon the navigable waters of the United States or adjoining shorelines for aboveground oil storage and use at Site 300. This SPCC Plan has been prepared for the entire Site 300 facility and replaces the three previous plans prepared for Site 300: LLNL SPCC for Electrical Substations Near Buildings 846 and 865 (LLNL 2015), LLNL SPCC for Building 883 (LLNL 2015), and LLNL SPCC for Building 801 (LLNL 2014).
300 Area Process Trenches Modified Closure/Postclosure Plan
International Nuclear Information System (INIS)
1997-09-01
This chapter provides a brief summary of the contents of each chapter of this plan for the closure of the 300 Area Process Trenches (300 APT) treatment, storage, and/or disposal unit. It also provides background information for this unit and discusses how its closure will be integrated with the remedial action for the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 300- FF-1 Operable Unit. The 300 APT is located within the 300 Area of the Hanford Site. This area contained reactor fuel fabrication facilities and research and development laboratories. The 300 APT was constructed and began operations in 1975 as the 316-5 Process Trenches. Effluent was discharged to the trenches by way of the 300 Area process sewer system, which has been the sole source of effluent for the 300 APT. The 316-5 Process Trenches gained Resource Conservation and Recovery Act of 1976 (RCRA) interim status as the 300 APT TSD unit on November 11, 1985. The unit has been administratively closed to discharges of dangerous waste since 1985
Highly efficient holograms based on c-Si metasurfaces in the visible range.
Martins, Augusto; Li, Juntao; da Mota, Achiles F; Wang, Yin; Neto, Luiz G; do Carmo, João P; Teixeira, Fernando L; Martins, Emiliano R; Borges, Ben-Hur V
2018-04-16
This paper reports on the first hologram in transmission mode based on a c-Si metasurface in the visible range. The hologram shows high fidelity and high efficiency, with measured transmission and diffraction efficiencies of ~65% and ~40%, respectively. Although originally designed to achieve full phase control in the range [0-2π] at 532 nm, these holograms have also performed well at 444.9 nm and 635 nm. The high tolerance to both fabrication and wavelength variations demonstrate that holograms based on c-Si metasurfaces are quite attractive for diffractive optics applications, and particularly for full-color holograms.
Erosion and corrosion resistance of laser cladded AISI 420 stainless steel reinforced with VC
Energy Technology Data Exchange (ETDEWEB)
Zhang, Zhe [Center for Laser-aided Manufacturing, Lyle School of Engineering, Southern Methodist University, 3101 Dyer Street, Dallas, TX 75206 (United States); Yu, Ting [Center for Laser-aided Manufacturing, Lyle School of Engineering, Southern Methodist University, 3101 Dyer Street, Dallas, TX 75206 (United States); School of Mechanical and Electrical Engineering, Nanchang University, Nanchang, Jiangxi 330031 (China); Kovacevic, Radovan, E-mail: kovacevi@smu.edu [Center for Laser-aided Manufacturing, Lyle School of Engineering, Southern Methodist University, 3101 Dyer Street, Dallas, TX 75206 (United States)
2017-07-15
Highlights: • The coatings of 420 stainless steel reinforced with VC were fabricated by high power direct diode laser. • The erosion resistance of the cladded layer was increased with the increase in the VC fraction. • No obvious improvement of erosion resistance was observed when the VC fraction was above 30 wt.%. • The corrosion resistance of the cladded layer was decreased with the increase in the VC fraction. - Abstract: Metal Matrix Composites (MMC) fabricated by the laser cladding process have been widely applied as protective coatings in industries to improve the wear, erosion, and corrosion resistance of components and prolong their service life. In this study, the AISI 420/VC metal matrix composites with different weight percentage (0 wt.%–40 wt.%) of Vanadium Carbide (VC) were fabricated on a mild steel A36 by a high power direct diode laser. An induction heater was used to preheat the substrate in order to avoid cracks during the cladding process. The effect of carbide content on the microstructure, elements distribution, phases, and microhardness was investigated in detail. The erosion resistance of the coatings was tested by using the abrasive waterjet (AWJ) cutting machine. The corrosion resistance of the coatings was studied utilizing potentiodynamic polarization. The results showed that the surface roughness and crack susceptibility of the laser cladded layer were increased with the increase in VC fraction. The volume fraction of the precipitated carbides was increased with the increase in the VC content. The phases of the coating without VC consisted of martensite and austenite. New phases such as precipitated VC, V{sub 8}C{sub 7}, M{sub 7}C{sub 3}, and M{sub 23}C{sub 6} were formed when the primary VC was added. The microhardness of the clads was increased with the increase in VC. The erosion resistance of the cladded layer was improved after the introduction of VC. The erosion resistance was increased with the increase in the VC content
Two-dimensional quasistatic stationary short range surface plasmons in flat nanoprisms.
Nelayah, J; Kociak, M; Stéphan, O; Geuquet, N; Henrard, L; García de Abajo, F J; Pastoriza-Santos, I; Liz-Marzán, L M; Colliex, C
2010-03-10
We report on the nanometer scale spectral imaging of surface plasmons within individual silver triangular nanoprisms by electron energy loss spectroscopy and on related discrete dipole approximation simulations. A dependence of the energy and intensity of the three detected modes as function of the edge length is clearly identified both experimentally and with simulations. We show that for experimentally available prisms (edge lengths ca. 70 to 300 nm) the energies and intensities of the different modes show a monotonic dependence as function of the aspect ratio of the prisms. For shorter or longer prisms, deviations to this behavior are identified thanks to simulations. These modes have symmetric charge distribution and result from the strong coupling of the upper and lower triangular surfaces. They also form a standing wave in the in-plane direction and are identified as quasistatic short range surface plasmons of different orders as emphasized within a continuum dielectric model. This model explains in simple terms the measured and simulated energy and intensity changes as function of geometric parameters. By providing a unified vision of surface plasmons in platelets, such a model should be useful for engineering of the optical properties of metallic nanoplatelets.
Database of average-power damage thresholds at 1064 nm
International Nuclear Information System (INIS)
Rainer, F.; Hildum, E.A.; Milam, D.
1987-01-01
We have completed a database of average-power, laser-induced, damage thresholds at 1064 nm on a variety of materials. Measurements were made with a newly constructed laser to provide design input for moderate and high average-power laser projects. The measurements were conducted with 16-ns pulses at pulse-repetition frequencies ranging from 6 to 120 Hz. Samples were typically irradiated for time ranging from a fraction of a second up to 5 minutes (36,000 shots). We tested seven categories of samples which included antireflective coatings, high reflectors, polarizers, single and multiple layers of the same material, bare and overcoated metal surfaces, bare polished surfaces, and bulk materials. The measured damage threshold ranged from 2 for some metals to > 46 J/cm 2 for a bare polished glass substrate. 4 refs., 7 figs., 1 tab
Lamiel-Garcia, Oriol; Ko, Kyoung Chul; Lee, Jin Yong; Bromley, Stefan T; Illas, Francesc
2017-04-11
All electron relativistic density functional theory (DFT) based calculations using numerical atom-centered orbitals have been carried out to explore the relative stability, atomic, and electronic structure of a series of stoichiometric TiO 2 anatase nanoparticles explicitly containing up to 1365 atoms as a function of size and morphology. The nanoparticles under scrutiny exhibit octahedral or truncated octahedral structures and span the 1-6 nm diameter size range. Initial structures were obtained using the Wulff construction, thus exhibiting the most stable (101) and (001) anatase surfaces. Final structures were obtained from geometry optimization with full relaxation of all structural parameters using both generalized gradient approximation (GGA) and hybrid density functionals. Results show that, for nanoparticles of a similar size, octahedral and truncated octahedral morphologies have comparable energetic stabilities. The electronic structure properties exhibit a clear trend converging to the bulk values as the size of the nanoparticles increases but with a marked influence of the density functional employed. Our results suggest that electronic structure properties, and hence reactivity, for the largest anatase nanoparticles considered in this study will be similar to those exhibited by even larger mesoscale particles or by bulk systems. Finally, we present compelling evidence that anatase nanoparticles become effectively bulklike when reaching a size of ∼20 nm diameter.
Directory of Open Access Journals (Sweden)
Krishna R. Gupta
2010-12-01
Full Text Available Three simple, accurate and economical methods for simultaneous estimation of pantoprazole and itopride hydrochloride in two component solid dosage forms have been developed. The proposed methods employ the application of simultaneous equation method (Method A, absorbance ratio method (Method B and multicomponent mode of analysis method (Method C. All these methods utilize distilled water as a solvent. In distilled water pantoprazole shows maximum absorbance at a wavelength of 289.0 nm while itopride hydrochloride shows maximum absorbance at a wavelength of 258.0 nm also the drugs show an isoabsorptive point at a wavelength of 270.0 nm. For multicomponent method, sampling wavelengths 289.0 nm, 270.0 nm and 239.5 nm were selected. All these methods showed linearity in the range from 4-20 µg/mL and 15-75 µg/mL for pantoprazole and itopride hydrochloride respectively. The results of analysis have been validated statistically and by recovery studies.
Preliminary study on preparation of BCNO phosphor particles using citric acid as carbon source
Energy Technology Data Exchange (ETDEWEB)
Nuryadin, Bebeh W.; Pratiwi, Tripuspita; Faryuni, Irfana D.; Iskandar, Ferry, E-mail: ferry@fi.itb.ac.id; Abdullah, Mikrajuddin; Khairurrijal [Department of Physics, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Ganesha 10 Bandung, Indonesia 40132 (Indonesia); Ogi, Takashi; Okuyama, Kikuo [Department of Chemical Engineering, Graduate School of Engineering, Hiroshima University, 1-4-1 Kagamiyama, Higashi Hiroshima, Japan 739-8527 (Japan)
2015-04-16
A citric acid was used as a carbon source in the preparation of boron carbon oxy-nitride (BCNO) phosphor particles by a facile process. The preparation process was conducted at relatively low temperature 750 °C and at ambient pressure. The prepared BCNO phosphors showed a high photoluminescence (PL) performance at peak emission wavelength of 470 nm under excitation by a UV light 365 nm. The effects of carbon/boron and nitrogen/boron molar ratios on the PL properties were also investigated. The result showed that the emission spectra with a wavelength peak ranging from 444 nm to 496 nm can be obtained by varying carbon/boron ratios from 0.1 to 0.9. In addition, the observations showed that the BCNO phosphor material has two excitation peaks located at the 365 nm (UV) and 420 nm (blue). Based on these observations, we believe that the citric acid derived BCNO phosphor particles can be a promising inexpensive material for phosphor conversion-based white LED.
Chaliyawala, Harsh A.; Purohit, Zeel; Khanna, Sakshum; Ray, Abhijit; Pati, Ranjan K.; Mukhopadhyay, Indrajit
2018-05-01
We report an alternative approach to fabricate the vertically aligned aperiodic Si nanowire arrays by controlling the diameter of the Ag nanoparticles and tuneable ultrasonic removal. The process begins by sputtering the Ag thin film (t=5 nm) on the Si/SiO2 substrates. Followed by Ag thin film, annealed for various temperature (T=300°C, 400°C, 500°C and 600°C) to selectively achieve a high density, well-spaced and diameter controlled Ag nanoparticles (AgNPs) on the Si/SiO2 substrates. The sacrificial layer of AgNPs size indicates the controlled diameter of the Si nanowire arrays. Image J analysis for various annealed samples gives an indication of the high density, uniformity and equal distribution of closely packed AgNPs. Furthermore, the AgNPs covered with Au/Pd mesh (5 nm) as a template, was removed by ultrasonication in the etchant solution for several times in different intervals of preparation. The conventional and facile metal assisted electroless etching approach was finally employed to fabricate the vertically aperiodic sub-50 nm SiNWAs, can be applicable to various nanoscale opto-electronic applications.
Golden Eagle Territories and Ecology at Site 300
Energy Technology Data Exchange (ETDEWEB)
Fratanduono, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2015-09-29
Garcia and Associates (GANDA) was contracted by the Lawrence Livermore National Laboratory (LLNL) to collect information on golden eagle (Aquila chrysaetos) use of Site 300. During 2014, we conducted surveys at Site 300 and for an area including a 10-mile radius of Site 300. Those surveys documented 42 golden eagle territories including two territories that overlapped with Site 300. These were named ‘Tesla’ and ‘Linac Road’. In 2015, we conducted surveys to refine the territory boundaries of golden eagle territories that overlapped with Site 300 and to document eagle activity at Site 300.
Courtin, Regis; Wagener, Richard; Mckay, Christopher P.; Caldwell, John; Fricke, Karl-Heinrich
1991-01-01
The theoretical model developed by McKay et al. (1989) to characterize the size distribution, thermal structure, and chemical composition of the stratospheric haze of Titan is applied to new 220-335-nm albedo measurements obtained with the long-wavelength prime camera of the IUE during August 1987. Data and model predictions are presented in extensive graphs and discussed in detail. It is shown that a simple model with particles of one size at a given altitude does not accurately reproduce the observed features in all spectral regions, but that good general agreement is obtained using a model with a uniformly mixed layer at 150-600 km and a bimodal distribution of small 'polymer' haze particles (radius less than 20 nm) and larger haze particles (radius 100-500 nm). The number densities implied by this model require, however, a mechanism such as electrostatic charging or reaction kinetics to inhibit coagulation of the smaller particles.
Directory of Open Access Journals (Sweden)
Zhen Yan
2017-02-01
Full Text Available Heterodisulfide reductases (Hdr of the HdrABC class are ancient enzymes and a component of the anaerobic core belonging to the prokaryotic common ancestor. The ancient origin is consistent with the widespread occurrence of genes encoding putative HdrABC homologs in metabolically diverse prokaryotes predicting diverse physiological functions; however, only one HdrABC has been characterized and that was from a narrow metabolic group of obligate CO2-reducing methanogenic anaerobes (methanogens from the domain Archaea. Here we report the biochemical characterization of an HdrABC homolog (HdrA2B2C2 from the acetate-utilizing methanogen Methanosarcina acetivorans with unusual properties structurally and functionally distinct from the only other HdrABC characterized. Homologs of the HdrA2B2C2 archetype are present in phylogenetically and metabolically diverse species from the domains Bacteria and Archaea. The expression of the individual HdrA2, HdrB2, and HdrB2C2 enzymes in Escherichia coli, and reconstitution of an active HdrA2B2C2 complex, revealed an intersubunit electron transport pathway dependent on ferredoxin or coenzyme F420 (F420H2 as an electron donor. Remarkably, HdrA2B2C2 couples the previously unknown endergonic oxidation of F420H2 and reduction of ferredoxin with the exergonic oxidation of F420H2 and reduction of the heterodisulfide of coenzyme M and coenzyme B (CoMS-SCoB. The unique electron bifurcation predicts a role for HdrA2B2C2 in Fe(III-dependent anaerobic methane oxidation (ANME by M. acetivorans and uncultured species from ANME environments. HdrA2B2C2, ubiquitous in acetotrophic methanogens, was shown to participate in electron transfer during acetotrophic growth of M. acetivorans and proposed to be essential for growth in the environment when acetate is limiting.
Effect of various SnO2 pH on ZnO/SnO2-composite film via immersion technique
Malek, M. F.; Mohamed, R.; Mamat, M. H.; Ismail, A. S.; Yusoff, M. M.; Rusop, M.
2018-05-01
ZnO/SnO2-composite film has been synthesized via immersion technique with various pH of SnO2. The pH of SnO2 were varied between 4.5 and 6.5. The optical measurements of the samples were carried out using Varian Cary 5000 UV-Vis spectrophotometer within the range from 350 nm to 800 nm at room temperature in air with a data interval of 1 nm. On the other hand, the optical photoluminescence properties were measured by a photoluminescence spectrometer (PL, model: Horiba Jobin Yvon - 79 DU420A-OE-325) using a He-Cd laser as the excitation source at 325 nm. These highly oriented ZnO/SnO2-composite film are potential for the creation of functional materials, such as the sensors, solar cells and etc.
Effects of Q-switched and long-pulsed 1064 nm Nd:YAG laser on enlarged facial pores.
Lee, Chang Nam; Kim, You Jeong; Lee, Hyun Seung; Kim, Hei Sung
2009-12-01
'Enlarged facial pore' is a subjective term, which is not clearly defined but often complained by many. A diverse range of treatments are used though evidence of efficacy remains largely anecdotal. We report a series of nine patients who underwent a split face trial with Q-switched 1064 nm Nd:YAG and long-pulsed 1064 nm Nd:YAG laser to treat enlarged facial pores.
300 Area Process Trenches Postclosure Plan
International Nuclear Information System (INIS)
Badden, J.W.
1998-05-01
The 300 Area Process Trenches (300 APT) certified closure under a modified closure option and in compliance with Condition II.K.3 oft he Hartford Facility Dangerous Waste Permit (Penit) (Ecology 1994). Modified closure has been determined to be the appropriate closure option for this unit due to groundwater that remains contaminated from past operations at the 300 APT. Corrective actions required for dangerous waste constituents remaining in groundwater will occur pursuant to the 300 APT Resource Conservation and Recovery Act (RCRA) Final Status Facility Ground Water Monitoring Plan, the Hanford Site Wide Dangerous Waste Permit, and in conjunction with the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) remedial actions at the 300-FF-5 Groundwater Operable Unit (OU) pursuant to the Record of Decision (ROD) (EPA 1996). This postclosure plan identifies the modified closure actions required at the unit under postclosure care. It contains a description of the unit, past closure actions, and postclosure care requirements subject to compliance under the Permit (condition II.K.3)
Mutagenesis of mNeptune Red-Shifts Emission Spectrum to 681-685 nm.
Li, ZhaoYang; Zhang, ZhiPing; Bi, LiJun; Cui, ZongQiang; Deng, JiaoYu; Wang, DianBing; Zhang, Xian-En
2016-01-01
GFP-like fluorescent proteins with diverse emission wavelengths have been developed through mutagenesis, offering many possible choices in cellular and tissue imaging, such as multi-targets imaging, deep tissue imaging that require longer emission wavelength. Here, we utilized a combined approach of random mutation and structure-based rational design to develop new NIR fluorescent proteins on the basis of a far-red fluorescent protein, mNeptune (Ex/Em: 600/650 nm). We created a number of new monomeric NIR fluorescent proteins with the emission range of 681-685 nm, which exhibit the largest Stocks shifts (77-80 nm) compared to other fluorescent proteins. Among them, mNeptune681 and mNeptune684 exhibit more than 30 nm redshift in emission relative to mNeptune, owing to the major role of the extensive hydrogen-bond network around the chromophore and contributions of individual mutations to the observed redshift. Furthermore, the two variants still maintain monomeric state in solution, which is a trait crucial for their use as protein tags. In conclusion, our results suggest that there is untapped potential for developing fluorescent proteins with desired properties.
Energy Technology Data Exchange (ETDEWEB)
Qu, Ailan, E-mail: qal67@163.com; Xie, Haolong; Xu, Xinmei; Zhang, Yangyu; Wen, Shengwu; Cui, Yifan
2016-07-01
Highlights: • High concentration yellow GQDs and TiO{sub 2} nanotubes were achieved by a simple and green method. • High quantum yield GQDs enhanced the photodegradation capacity of TiO{sub 2} nanotube. • The catalytic performance of GQDs/TiO{sub 2} depends on the GQDs loading. • The improved photocatalytic activity of GQDs/TiO{sub 2} was attributed to three aspects. - Abstract: Graphene quantum dots (GQDs) with high quantum yield (about 23.6% at an excitation wavelength of 320 nm) and GQDs/TiO{sub 2} nanotubes (GQDs/TiO{sub 2} NTs) composites were achieved by a simple hydrothermal method at low temperature. Photoluminescence characterization showed that the GQDs exhibited the down-conversion PL features at excitation from 300 to 420 nm and up-conversion photoluminescence in the range of 600–800 nm. The photocatalytic activity of prepared GQDs/TiO{sub 2} NTs composites on the degradation of methyl orange (MO) was significantly enhanced compared with that of pure TiO{sub 2} nanotubes (TiO{sub 2} NTs). For the composites coupling with 1.5%, 2.5% and 3.5% GQDs, the degradation of MO after 20 min irradiation under UV–vis light irradiation (λ = 380–780 nm) were 80.52%, 94.64% and 51.91%, respectively, which are much higher than that of pure TiO{sub 2} NTs (35.41%). It was inferred from the results of characterization that the improved photocatalytic activity of the GQDs/TiO{sub 2} NTs composites was attributed to the synergetic effect of up-conversion properties of the GQDs, enhanced visible light absorption and efficient separation of photogenerated electron-holes of the GQDs/TiO{sub 2} composite.
Range expansion of the hadeda ibis Bostrychia hagedash in ...
African Journals Online (AJOL)
The southern African range of the habeda ibis Bostrychia hagedash has expanded from 530 900 km 2 in 1910 to 1 323 300 km2 in 1985. Major range expansions have occurred in the fynbos biome of the south-western Cape, the Karoo, the grasslands of the eastern Cape, the Orange Free State and the Transvaal highveld.
Tanghetti Md, Emil; Jennings, John
2018-01-01
This study was performed to better understand the cutaneous effects of using a fractional picosecond laser at 755 nm with a diffractive lens array and a picosecond Nd:YAG laser at 532 mn and 1064 nm with a holographic optic. We characterized the injuries created by these devices on skin clinically and histologically over 24 hours. With this information we modeled the effects of these devices on a cutaneous target. Eight patients, representing Fitzpatrick skin types I-VI, were treated on their backs with a picosecond Alexandrite laser with a diffractive lens array, as well as a picosecond Nd:YAG laser at 532 nm and 1064 nm with a holographic optic. Photographs were taken 15 minutes and 24 hours after treatments. Punch biopsies were obtained at 24 hours and examined histologically. Treatment with the picosecond Nd:YAG laser at both 532 nm and 1064 nm with the holographic optic revealed erythema and small scatted areas of petechial hemorrhage areas immediately and in many cases at 24 hours after treatment. The 755 nm picosecond Alexandrite laser with diffractive lens array produced erythema immediately after treatment, which largely dissipated 24 hours later. Histologies revealed intra-epidermal vacuoles with all three wavelengths. Fractional picosecond Nd:YAG laser at 532 nm and 1064 nm with the holographic optic showed focal areas of dermal and intra-epidermal hemorrhage with areas of vascular damage in some patients. This study demonstrates that both fractional picosecond devices produce vacuoles in the skin, which are most likely due to areas of laser induced optical breakdown (LIOB). In the patients (skin type II-IV) we observed scatter areas of hemorrhage in the skin, due to vascular damage with the 532 nm and 1064 nm, but not with 755 nm wavelengths. Lasers Surg. Med. 50:37-44, 2018. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.
Influence of solution annealing on microstructure and mechanical properties of Maraging 300 steel
Energy Technology Data Exchange (ETDEWEB)
Lima Filho, Venceslau Xavier; Barros, Isabel Ferreira; Abreu, Hamilton Ferreira Gomes de, E-mail: venceslau@ifce.edu.br [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Departamento de Engenharia Metalurgica e Materiais. Laboratorio de Caracterizacao de Materiais, Metalurgia Fisica e Grupo de Pesquisa de Transformacao de Fase
2017-01-15
Maraging 300 belongs to a family of metallic materials with extremely high mechanical strength and good toughness. Some works have been published about aging temperatures that improve ultimate strength resistance with acceptable toughness levels in this steel family, where the prior austenite grain size obtained by different solution annealing temperature influence in the final mechanical properties. Solution annealing temperatures ranging from 860 °C to 1150 deg C and were kept constant until the aging temperature. These treatments were used in order to investigate their influence on the microstructure and mechanical properties of maraging steel 300, especially with regard to toughness. The characterization of the microstructure was performed by optical microscopy, scanning electron microscope (SEM) and X-ray diffraction (XRD). Mechanical properties were evaluated by Rockwell C hardness and Charpy impact tests. The results showed that there is a temperature range where one can get some improvement in toughness without a large loss of mechanical strength. (author)
Energy Technology Data Exchange (ETDEWEB)
Yuan, Sun Chien
2003-07-01
This study was to evaluate and compare the effects of the low intensity in laser radiation among GaAlAs 780 nm and GaAlAs 660 nm. The main proposal is to verify if there is any difference of the effects or results in low intensity laser application treatment of hypersensitive dentin, keeping the same parameters, only differing in wavelength. The samples were distributed in two groups. Group A 90 cases, treated with GaAlAs 780 nm and group B irradiated with GaAlAs 660 nm with a total of 76 cases analyzed. The results of application with GaAlAs 660 nm and GaAlAs 780 nm do not differ statistically. Which means using any one of the irradiation gives the same results. However can be noted that the response of reduction of hypersensitivity is faster with the radiation of GaAlAs 780 nm, but the results after three applications is the same for both types of radiation. (author)
34 CFR 300.27 - Limited English proficient.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Limited English proficient. 300.27 Section 300.27... CHILDREN WITH DISABILITIES General Definitions Used in This Part § 300.27 Limited English proficient. Limited English proficient has the meaning given the term in section 9101(25) of the ESEA. (Authority: 20...
20 CFR 300.1 - Words and phrases.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Words and phrases. 300.1 Section 300.1 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD UNEMPLOYMENT INSURANCE ACT DEFINITIONS § 300.1 Words and phrases. For the purposes of the regulations in this part, except where the...
40 CFR 300.110 - National Response Team.
2010-07-01
... 40 Protection of Environment 27 2010-07-01 2010-07-01 false National Response Team. 300.110... PLAN Responsibility and Organization for Response § 300.110 National Response Team. National planning... agencies named in § 300.175(b). Each agency shall designate a member to the team and sufficient alternates...
34 CFR 300.22 - Individualized education program.
2010-07-01
... CHILDREN WITH DISABILITIES General Definitions Used in This Part § 300.22 Individualized education program. Individualized education program or IEP means a written statement for a child with a disability that is developed... 34 Education 2 2010-07-01 2010-07-01 false Individualized education program. 300.22 Section 300.22...
Efficient continuous-wave 1112 nm Nd:YAG laser operation under direct diode pumping at 885 nm
International Nuclear Information System (INIS)
Gao, J; Dai, X J; Zhang, L; Wu, X D
2013-01-01
We report compact diode-end-pumped continuous-wave laser operation at 1112 nm under 885 nm diode-direct pumping for the first time. On the basis of the R 2 →Y 6 transition in a conventional Nd:YAG (yttrium aluminum garnet) single crystal, the maximum output power of 12.5 W is achieved, with an optical to optical efficiency of 46.6% and a slope efficiency of 52.9%. To the best of our knowledge, this represents the highest output at 1112 nm generated by a diode-end-pumped Nd:YAG laser. Furthermore, it is the highest optical to optical efficiency ever reported for 1112 nm Nd:YAG lasers. The short term power stability is ∼0.32% at 12.0 W output. (letter)
650 nm Laser stimulated dating from Side Antique Theatre, Turkey
International Nuclear Information System (INIS)
Doğan, M.; Meriç, N.
2014-01-01
Samples were taken from the archeological excavation site, which was at the backs of the Side Antique Theatre. Samples were taken from under the base rock in this area. Polymineral fine grains were examined to determine the ages of the sediments. Samples gathered from the Side Antique Theatre were investigated through using the SAR method. Firstly, one part of the samples were evaluated by using conventional IRSL reading head model of (ELSEC-9010) which is infrared (880±80 nm) stimulation source with Schott BG39 filter. The IRSL age dating with feldspar minerals, gives a number of overestimated or underestimated age values as a result. A new reading head was proposed with the following configuration attachments for overestimation of equivalent dose rates. Measurements were done with this newly designed red laser stimulating reading head which works with Elsec 9010 OSL age dating system. SAR measurements were performed by (650±10 nm) red laser light source with two Schott BG3 filters. With usage of the new designed reading head; closer results were obtained in comparision with the Antique Theatre′s expected age range. Fading rates were taken into consideration and these corrections were also handled for true age results. - Highlights: • Polymineral fine grain feldspar minerals were used for dating. • Two different reading heads were used to determine equivalent doses. • IR stimulated (880 nm) and laser stimulated (650 nm) dating results were compared
Spectral narrowing of a 980 nm tapered diode laser bar
Vijayakumar, Deepak; Jensen, Ole Bjarlin; Lucas Leclin, Ga"lle; Petersen, Paul Michael; Thestrup, Birgitte
2011-03-01
High power diode laser bars are interesting in many applications such as solid state laser pumping, material processing, laser trapping, laser cooling and second harmonic generation. Often, the free running laser bars emit a broad spectrum of the order of several nanometres which limit their scope in wavelength specific applications and hence, it is vital to stabilize the emission spectrum of these devices. In our experiment, we describe the wavelength narrowing of a 12 element 980 nm tapered diode laser bar using a simple Littman configuration. The tapered laser bar which suffered from a big smile has been "smile corrected" using individual phase masks for each emitter. The external cavity consists of the laser bar, both fast and slow axis micro collimators, smile correcting phase mask, 6.5x beam expanding lens combination, a 1200 lines/mm reflecting grating with 85% efficiency in the first order, a slow axis focusing cylindrical lens of 40 mm focal length and an output coupler which is 10% reflective. In the free running mode, the laser emission spectrum was 5.5 nm wide at an operating current of 30A. The output power was measured to be in excess of 12W. Under the external cavity operation, the wavelength spread of the laser could be limited to 0.04 nm with an output power in excess of 8 W at an operating current of 30A. The spectrum was found to be tuneable in a range of 16 nm.
Cavitation problems in mixing devices of SNR-300 fuel elements
International Nuclear Information System (INIS)
Benemann, A.
1976-01-01
Because of a complex flow path within the mixing device developed for the fuel elements of the SNR-300, in order to determine the minimum allowable interval to the beginning of cavitation, experimental tests with the original geometry are necessary. These conclusions show that for cavitation values CV>=1,3 - in the model and prototype - no cavitation zones can form. For reactor conditions a maximum velocity of Vsub(max)=4,7m/sec is therefore allowable in the free annular space of the compensator unit which corresponds to a massflow of M=22,5kg/sec. A cavitation value of CV=1,5 can be figured for the 120% load factor (M=20,4kg/sec,T=560 0 C). The mixing device developed is free of cavitation under the present conditions in the SNR-300. The condition of the fully developed cavitation is evidenced by a white noise with frequencies of at least 2.000 - 300.000cps and a signal/noise ratio S/R>40dB. The pressure amplitudes dependent on frequency are propagated in the streaming fluid and are severely damped by the locally existing two-phase flow. The unstable range at the beginning of cavitation is characterized by frequencies of about f=15.000cps