WorldWideScience

Sample records for radial transport characterization

  1. On helicon wave induced radial plasma transport

    International Nuclear Information System (INIS)

    Petrzilka, V.

    1993-04-01

    Estimates of helicon wave induced radial plasma transport are presented. The wave induced transport grows or decreases in dependence on the sign of the azimuthal wave number; these changes in transport may play an important role in helicon wave plasma sources. (author) 5 figs., 18 refs

  2. Radial transport with perturbed magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Hazeltine, R. D. [Institute for Fusion Studies, University of Texas at Austin, Austin, Texas 78712 (United States)

    2015-05-15

    It is pointed out that the viscosity coefficient describing radial transport of toroidal angular momentum is proportional to the second power of the gyro-radius—like the corresponding coefficients for particle and heat transport—regardless of any geometrical symmetry. The observation is widely appreciated, but worth emphasizing because some literature gives the misleading impression that asymmetry can allow radial moment transport in first-order.

  3. Radial transport with perturbed magnetic field

    International Nuclear Information System (INIS)

    Hazeltine, R. D.

    2015-01-01

    It is pointed out that the viscosity coefficient describing radial transport of toroidal angular momentum is proportional to the second power of the gyro-radius—like the corresponding coefficients for particle and heat transport—regardless of any geometrical symmetry. The observation is widely appreciated, but worth emphasizing because some literature gives the misleading impression that asymmetry can allow radial moment transport in first-order

  4. Moment approach to tandem mirror radial transport

    International Nuclear Information System (INIS)

    Siebert, K.D.; Callen, J.D.

    1986-02-01

    A moment approach is proposed for the study of tandem mirror radial transport in the resonant plateau regime. The salient features of the method are described with reference to axisymmetric tokamak transport theory. In particular, the importance of momentum conservation to the establishment of the azimuthal variations in the electrostatic potential is demonstrated. Also, an ad hoc drift kinetic equation is solved to determine parallel viscosity coefficients which are required to close the moment system

  5. Characterization of Single Phase and Two Phase Heat and Momentum Transport in a Spiraling Radial Inow Microchannel Heat Sink

    Science.gov (United States)

    Ruiz, Maritza

    Thermal management of systems under high heat fluxes on the order of hundreds of W/cm2 is important for the safety, performance and lifetime of devices, with innovative cooling technologies leading to improved performance of electronics or concentrating solar photovoltaics. A novel, spiraling radial inflow microchannel heat sink for high flux cooling applications, using a single phase or vaporizing coolant, has demonstrated enhanced heat transfer capabilities. The design of the heat sink provides an inward swirl flow between parallel, coaxial disks that form a microchannel of 1 cm radius and 300 micron channel height with a single inlet and a single outlet. The channel is heated on one side through a conducting copper surface, and is essentially adiabatic on the opposite side to simulate a heat sink scenario for electronics or concentrated photovoltaics cooling. Experimental results on the heat transfer and pressure drop characteristics in the heat sink, using single phase water as a working fluid, revealed heat transfer enhancements due to flow acceleration and induced secondary flows when compared to unidirectional laminar fully developed flow between parallel plates. Additionally, thermal gradients on the surface are small relative to the bulk fluid temperature gain, a beneficial feature for high heat flux cooling applications. Heat flux levels of 113 W/cm2 at a surface temperature of 77 deg C were reached with a ratio of pumping power to heat rate of 0.03%. Analytical models on single phase flow are used to explore the parametric trends of the flow rate and passage geometry on the streamlines and pressure drop through the device. Flow boiling heat transfer and pressure drop characteristics were obtained for this heat sink using water at near atmospheric pressure as the working fluid for inlet subcooling levels ranging from 20 to 80 deg C and mean mass flux levels ranging from 184-716 kg/m. 2s. Flow enhancements similar to singlephase flow were expected, as well

  6. Radial Flow in a Multiphase Transport Model at FAIR Energies

    Directory of Open Access Journals (Sweden)

    Soumya Sarkar

    2018-01-01

    Full Text Available Azimuthal distributions of radial velocities of charged hadrons produced in nucleus-nucleus (AB collisions are compared with the corresponding azimuthal distribution of charged hadron multiplicity in the framework of a multiphase transport (AMPT model at two different collision energies. The mean radial velocity seems to be a good probe for studying radial expansion. While the anisotropic parts of the distributions indicate a kind of collective nature in the radial expansion of the intermediate “fireball,” their isotropic parts characterize a thermal motion. The present investigation is carried out keeping the upcoming Compressed Baryonic Matter (CBM experiment to be held at the Facility for Antiproton and Ion Research (FAIR in mind. As far as high-energy heavy-ion interactions are concerned, CBM will supplement the Relativistic Heavy-Ion Collider (RHIC and Large Hadron Collider (LHC experiments. In this context our simulation results at high baryochemical potential would be interesting, when scrutinized from the perspective of an almost baryon-free environment achieved at RHIC and LHC.

  7. Computer simulation of radial transport in tandem mirror machines

    International Nuclear Information System (INIS)

    Gilmore, J.M.

    1979-01-01

    A code used for simulation of classical radial transport in the 2XIIB experiment has been modified to simulate radial transport in TMX. Results have been obtained using classical transport coefficients and also using very simple trial neoclassical resonant transport coefficients. Comparison of the results obtained with solely classical transport and with both classical and neo-classical transport indicate that neoclassical transport depresses the ion density by approximately 5%. The central cell ion temperature is increased by approximately by the neo-classical transport, as is the electron temperature

  8. On radio frequency wave induced radial transport and wave helicity

    International Nuclear Information System (INIS)

    Petrzilka, V.

    1992-09-01

    Expressions for wave induced radial transport are derived allowing simple estimates. The transport is enhanced due to the presence of poloidal magnetostatic field and in the vicinity of the ion cyclotron resonance. The direction of the wave induced transport depends also on the wave polarization. (author) 19 refs

  9. Transport profiles induced by radially localized modes in tokamak

    International Nuclear Information System (INIS)

    Beklemishev, A.D.; Horton, W.

    1991-04-01

    We describe a new approach to the calculation of turbulent transport coefficients for radially localized modes. The theory takes into account the nonuniformity of the distribution of rational (resonant) magnetic surfaces in minor radius. This distribution function is proportional to the density of available states of excitation. The resulting density of state correction qualitatively changes the radial profile of the transport coefficients, as compared to the usual local diffusivity formulae. The correction factor calculated for the η i -mode transport allows a much better agreement of χ i with the experimental data than previously achieved. 8 refs., 3 figs

  10. Transport in Silicon Nanowires: Role of Radial Dopant Profile

    DEFF Research Database (Denmark)

    Markussen, Troels; Rurali, Riccardo; Jauho, Antti-Pekka

    2008-01-01

    distributions of P dopant impurities. We find that the radial distribution of the dopants influences the conductance properties significantly: surface doped wires have longer mean-free paths and smaller sample-to-sample fluctuations in the cross-over from ballistic to diffusive transport. These findings can...

  11. Transport analysis of radial electric field in helical plasmas

    International Nuclear Information System (INIS)

    Toda, S.; Itoh, K.

    2004-01-01

    A set of transport equations is analyzed which induces the radial transition of the electric field. A temperature profile which is related with the transport barrier is obtained by use of the theoretical model for the anomalous transport diffusivities. A dependence on the different initial condition is found even if the same values of the control parameters are used in calculations. A study of the temporal evolution of E r is done. We examine the test of the adopted theoretical model for the anomalous transport diffusivities compared with the experimental result in Large Helical Device (LHD). (authors)

  12. Transport modelling including radial electric field and plasma rotation

    International Nuclear Information System (INIS)

    Fukuyama, A.; Fuji, Y.; Itoh, S.-I.

    1994-01-01

    Using a simple turbulent transport model with a constant diffusion coefficient and a fixed temperature profile, the density profile in a steady state and the transient behaviour during the co and counter neutral beam injection are studied. More consistent analysis has been initiated with a turbulent transport model based on the current diffusive high-n ballooning mode. The enhancement of the radial electric field due to ion orbit losses and the reduction of the transport due to the poloidal rotation shear are demonstrated. The preliminary calculation indicates a sensitive temperature dependence of the density profile. (author)

  13. Bifurcated transition of radial transport in the HIEI tandem mirror

    International Nuclear Information System (INIS)

    Sakai, O.; Yasaka, Y.

    1995-01-01

    Transition to a high radial confinement mode in a mirror plasma is triggered by limiter biasing. Sheared plasma rotation is induced in the high confinement phase which is characterized by reduction of edge turbulence and a confinement enhancement factor of 2-4. Edge plasma parameters related to radial confinement show a hysteresis phenomenon as a function of bias voltage or bias current, leading to the fact that transition from low to high confinement mode occurs between the bifurcated states. A transition model based on azimuthal momentum balance is employed to clarify physics of the observed bifurcation. copyright 1995 American Institute of Physics

  14. Radial Transport and Meridional Circulation in Accretion Disks

    Energy Technology Data Exchange (ETDEWEB)

    Philippov, Alexander A. [Department of Astrophysical Sciences, Princeton University, Ivy Lane, Princeton, NJ 08540 (United States); Rafikov, Roman R., E-mail: sashaph@princeton.edu [Institute for Advanced Study, Einstein Drive, Princeton, NJ 08540 (United States)

    2017-03-10

    Radial transport of particles, elements and fluid driven by internal stresses in three-dimensional (3D) astrophysical accretion disks is an important phenomenon, potentially relevant for the outward dust transport in protoplanetary disks, origin of the refractory particles in comets, isotopic equilibration in the Earth–Moon system, etc. To gain better insight into these processes, we explore the dependence of meridional circulation in 3D disks with shear viscosity on their thermal stratification, and demonstrate a strong effect of the latter on the radial flow. Previous locally isothermal studies have normally found a pattern of the radial outflow near the midplane, switching to inflow higher up. Here we show, both analytically and numerically, that a flow that is inward at all altitudes is possible in disks with entropy and temperature steeply increasing with height. Such thermodynamic conditions may be typical in the optically thin, viscously heated accretion disks. Disks in which these conditions do not hold should feature radial outflow near the midplane, as long as their internal stress is provided by the shear viscosity. Our results can also be used for designing hydrodynamical disk simulations with a prescribed pattern of the meridional circulation.

  15. Compartmental analysis of roots in intact rapidly-growing Spergularia marina and Lactuca sativa: partial characterization of the symplasms functional in the radial transport of Na+ and K+

    International Nuclear Information System (INIS)

    Lazof, D.B.

    1987-01-01

    Techniques of compartmental analysis were adapted to the study of intact roots of rapidly-growing Spergularia marine and Lactuca sativa. Using large numbers of plants short time-courses of uptake and chase, 42 K + and 22 Na + transport could be resolved, even during a chase following a brief 10 minute labeling period. The use of intact plant systems allowed distinction of that portion of the isotope flux into the root, associated with the ion-conducting symplasms. A small compartment, which rapidly (t/sub .5/ + , accounting for the observed obtention of linear translocation rates within minutes of transferring to labeled solution. The ion contents of this compartment varied in proportion to the external ion concentration. When K + was at a high external concentration, labeled K + exchanged into this same symplasm, but chasing a short pulse indicated that K + transport to the xylem was not through a rapidly-exchanging compartment. At physiological concentrations of K + the evidence indicated that transport of K + across the root proceeded through a compartment which was not exchanging rapidly with the external medium. The rise to a linear rate of isotope translocation was gradual and translocation during a chase, following a brief pulse,was prolonged, indicating that this compartment retained its specific activity for a considerable period

  16. Neoclassical transport and radial electric fields in TJ-K

    International Nuclear Information System (INIS)

    Rahbarnia, K.; Greiner, F.; Ramisch, M.; Stroth, U.; Greiner, F.

    2003-01-01

    The neoclassical transport is investigated in the torsatron TJ-K, which is operated with a low-temperature plasma. In the low-collisionality regime neoclassical losses are not intrinsically ambipolar, leading to the formation of a radial electric field which acts on both neoclassical and turbulent transport. This electric field is measured with a combination of Langmuir and emissive probes. The data are compared with the ambipolar electric field calculated with an analytic model. The experimental fields are positive and larger than the calculated ones. Direct losses of the fast electrons might explain this discrepancy. (orig.)

  17. Interactions between Radial Electric Field, Transport and Structure in Helical Plasmas

    International Nuclear Information System (INIS)

    Ida, Katsumi and others

    2006-01-01

    Control of the radial electric field is considered to be important in helical plasmas, because the radial electric field and its shear are expected to reduce neoclassical and anomalous transport, respectively. Particle and heat transport, that determines the radial structure of density and electron profiles, sensitive to the structure of radial electric field. On the other hand, the radial electric field itself is determined by the plasma parameters. In general, the sign of the radial electric field is determined by the plasma collisionality, while the magnitude of the radial electric field is determined by the temperature and/or density gradients. Therefore the structure of radial electric field and temperature and density are strongly coupled through the particle and heat transport and formation mechanism of radial electric field. Interactions between radial electric field, transport and structure in helical plasmas is discussed based on the experiments on Large Helical Device

  18. Axial SPN and radial MOC coupled whole core transport calculation

    International Nuclear Information System (INIS)

    Cho, Jin-Young; Kim, Kang-Seog; Lee, Chung-Chan; Zee, Sung-Quun; Joo, Han-Gyu

    2007-01-01

    The Simplified P N (SP N ) method is applied to the axial solution of the two-dimensional (2-D) method of characteristics (MOC) solution based whole core transport calculation. A sub-plane scheme and the nodal expansion method (NEM) are employed for the solution of the one-dimensional (1-D) SP N equations involving a radial transverse leakage. The SP N solver replaces the axial diffusion solver of the DeCART direct whole core transport code to provide more accurate, transport theory based axial solutions. In the sub-plane scheme, the radial equivalent homogenization parameters generated by the local MOC for a thick plane are assigned to the multiple finer planes in the subsequent global three-dimensional (3-D) coarse mesh finite difference (CMFD) calculation in which the NEM is employed for the axial solution. The sub-plane scheme induces a much less nodal error while having little impact on the axial leakage representation of the radial MOC calculation. The performance of the sub-plane scheme and SP N nodal transport solver is examined by solving a set of demonstrative problems and the C5G7MOX 3-D extension benchmark problems. It is shown in the demonstrative problems that the nodal error reaching upto 1,400 pcm in a rodded case is reduced to 10 pcm by introducing 10 sub-planes per MOC plane and the transport error is reduced from about 150 pcm to 10 pcm by using SP 3 . Also it is observed, in the C5G7MOX rodded configuration B problem, that the eigenvalues and pin power errors of 180 pcm and 2.2% of the 10 sub-planes diffusion case are reduced to 40 pcm and 1.4%, respectively, for SP 3 with only about a 15% increase in the computing time. It is shown that the SP 5 case gives very similar results to the SP 3 case. (author)

  19. Radial transport of storm time ring current ions

    Science.gov (United States)

    Lui, A. T. Y.

    1993-01-01

    Radial transport of energetic ions for the development of the main phase of geomagnetic storms is investigated with data from the medium energy particle analyzer (MEPA) on the Charge Composition Explorer spacecraft, which monitored protons, helium ions, and the carbon-nitrogen-oxygen group, which is mostly dominated by oxygen ions. From a study of four geomagnetic storms, we show that the flux increase of these ions in the inner ring current region can be accounted for by an inward displacement of the ring current population by 0.5 to 3.5 R(E). There is a general trend that a larger inward displacement occurs at higher L shells than at lower ones. These results are in agreement with previous findings. The radially injected population consists of the prestorm population modified by substorm injections which occur on a much shorter time scale than that for a storm main phase. It is also found that the inward displacement is relatively independent of ion mass and energy, suggesting that the radial transport of these energetic ions is effected primarily by convective motion from a large electric field or by diffusion resulting from magnetic field fluctuations.

  20. Effects of radial electrical field on neoclassical transport in tokamaks

    International Nuclear Information System (INIS)

    Wang Zhongtian; Le Clair, G.

    1996-07-01

    Neoclassical transport theory for tokamaks in presence of a radial electrical field with shear is developed using Hamiltonian formalism. Diffusion coefficients are derived in both plateau regime including a large electric field and banana regime including the squeezing factor which can greatly affect diffusion at the plasma edge. The scaling on squeezing factor is different from the one given by Shaing and Hazeltine. Rotation speeds are calculated in the scrape-off region. They are in good agreement with measurements on TdeV Tokamak. (2 figs.)

  1. Potential measurement and radial transport in GAMMA 10 tandem mirror

    International Nuclear Information System (INIS)

    Ishii, K.; Katanuma, I.; Segawa, T.; Ohkawara, H.; Mase, A.; Miyoshi, S.

    1989-01-01

    GAMMA 10 is an effectively axisymmetric tandem mirror with thermal barriers. Potential information is important to investigate the plasma confinement. The barrier and central space potentials are determined by means of two gold neutral beam probes. Two-dimensional potential profiles have been measured in the barrier cell. In GAMMA 10, to assure magneto-hydrodynamic (MHD) stability, the nonaxisymmetric minimum-B mirror cells are contained between the central-solenoid and the plug/barrier cells at the ends of the machine. From the point of view of neoclassical resonant-plateau transport in circular equipotential contours, this effective axisymmetrization is successful. The measured potential profiles are slightly elongated during the onset of ω ce ECRH. In this paper we report the beam probe potential measurement, the neoclassical ion radial transport in the noncircular equipotential surface and the thermal barrier potential. (author) 6 refs., 5 figs

  2. Neoclassical transport, poloidal rotation and radial electric field at the L-H transition

    International Nuclear Information System (INIS)

    Minardi, E.; Gervasini, G.; Lazzaro, E.

    1993-01-01

    The transition to a high confinement regime in tokamaks operating with a magnetic divertor configuration is accompanied by the strong steepening of the edge temperature profile and the onset of a large positive poloidal mass rotation associated with a negative radial electric field. The latter phenomena are signatures of a neoclassical transport mechanism. We address the question of establishing whether neoclassical transport is indeed sufficient to establish high edge gradients and drive poloidal rotation under strong auxiliary heating. The heat transport equation is solved numerically in a narrow edge layer interfaced to the plasma body through heat flux continuity, but allowing for heat conductivity discontinuity. The results compared with recent experimental measurements support the assumption that a highly sheared neoclassical poloidal velocity profile can suppress the anomalous part of the heat transport, and that the neoclassical residual transport, characterizes the plasma behaviour at the edge during H modes. (author) 3 refs., 4 figs

  3. Numerical model for radial transport in the ELMO Bumpy Torus

    International Nuclear Information System (INIS)

    Jaeger, E.F.; Hedrick, C.L.

    1977-11-01

    Neutral and charged particle densities and temperatures are calculated as functions of radius for the toroidal plasma in the ELMO Bumpy Torus (EBT) experiment. Energy dependent ionization and charge-exchange rates, ambipolar diffusion, and self-consistent radial electric field profiles are included. Variation in magnetic field due to finite plasma pressure, effects of energetic electron rings, and transport due to drift waves and magnetic field errors are neglected. Diffusion is assumed to be neoclassical with enhanced losses at low collisionalities. The model reproduces many of the observed features of EBT operation in the quiescent toroidal (T) mode. The self-consistently calculated electric field is everywhere positive (not as in experiments) unless enhanced electron collisionality is included. Solutions for advanced EBT's are obtained and confinement parameters predicted

  4. Condition of damping of anomalous radial transport, determined by ordered convective electron dynamics

    International Nuclear Information System (INIS)

    Maslov, V.I.; Barchuk, S.V.; Lapshin, V.I.; Volkov, E.D.; Melentsov, Yu.V.

    2006-01-01

    It is shown, that at development of instability due to a radial gradient of density in the crossed electric and magnetic fields in nuclear fusion installations ordering convective cells can be excited. It provides anomalous particle transport. The spatial structures of these convective cells have been constructed. The radial dimensions of these convective cells depend on their amplitudes and on a radial gradient of density. The convective-diffusion equation for radial dynamics of the electrons has been derived. At the certain value of the universal controlling parameter, the convective cell excitation and the anomalous radial transport are suppressed. (author)

  5. Radial energy transport by magnetospheric ULF waves: Effects of magnetic curvature and plasma pressure

    Science.gov (United States)

    Kouznetsov, Igor; Lotko, William

    1995-01-01

    The 'radial' transport of energy by internal ULF waves, stimulated by dayside magnetospheric boundary oscillations, is analyzed in the framework of one-fluid magnetohydrodynamics. (the term radial is used here to denote the direction orthogonal to geomagnetic flux surfaces.) The model for the inhomogeneous magnetospheric plasma and background magnetic field is axisymmetric and includes radial and parallel variations in the magnetic field, magnetic curvature, plasma density, and low but finite plasma pressure. The radial mode structure of the coupled fast and intermediate MHD waves is determined by numerical solution of the inhomogeneous wave equation; the parallel mode structure is characterized by a Wentzel-Kramer-Brillouin (WKB) approximation. Ionospheric dissipation is modeled by allowing the parallel wave number to be complex. For boudnary oscillations with frequencies in the range from 10 to 48 mHz, and using a dipole model for the background magnetic field, the combined effects of magnetic curvature and finite plasma pressure are shown to (1) enhance the amplitude of field line resonances by as much as a factor of 2 relative to values obtained in a cold plasma or box-model approximation for the dayside magnetosphere; (2) increase the energy flux delivered to a given resonance by a factor of 2-4; and (3) broaden the spectral width of the resonance by a factor of 2-3. The effects are attributed to the existence of an 'Alfven buoyancy oscillation,' which approaches the usual shear mode Alfven wave at resonance, but unlike the shear Alfven mode, it is dispersive at short perpendicular wavelengths. The form of dispersion is analogous to that of an internal atmospheric gravity wave, with the magnetic tension of the curved background field providing the restoring force and allowing radial propagation of the mode. For nominal dayside parameters, the propagation band of the Alfven buoyancy wave occurs between the location of its (field line) resonance and that of the

  6. radial

    Directory of Open Access Journals (Sweden)

    JOHN WILLIAM BRANCH

    2007-01-01

    Full Text Available La creación de modelos de objetos reales es una tarea compleja para la cual se ha visto que el uso de técnicas tradicionales de modelamiento tiene restricciones. Para resolver algunos de estos problemas, los sensores de rango basados en láser se usan con frecuencia para muestrear la superficie de un objeto desde varios puntos de vista, lo que resulta en un conjunto de imágenes de rango que son registradas e integradas en un modelo final triangulado. En la práctica, debido a las propiedades reflectivas de la superficie, las oclusiones, y limitaciones de acceso, ciertas áreas de la superficie del objeto usualmente no son muestreadas, dejando huecos que pueden crear efectos indeseables en el modelo integrado. En este trabajo, presentamos un nuevo algoritmo para el llenado de huecos a partir de modelos triangulados. El algoritmo comienza localizando la frontera de las regiones donde están los huecos. Un hueco consiste de un camino cerrado de bordes de los triángulos en la frontera que tienen al menos un borde que no es compartido con ningún otro triangulo. El borde del hueco es entonces adaptado mediante un B-Spline donde la variación promedio de la torsión del la aproximación del B-spline es calculada. Utilizando un simple umbral de la variación promedio a lo largo del borde, se puede clasificar automáticamente, entre huecos reales o generados por intervención humana. Siguiendo este proceso de clasificación, se usa entonces una versión automatizada del interpolador de funciones de base radial para llenar el interior del hueco usando los bordes vecinos.

  7. Radial transport of poloidal momentum in ASDEX Upgrade in L-mode and H-mode

    DEFF Research Database (Denmark)

    Schrittwieser, R.; Mehlmann, F.; Naulin, Volker

    2012-01-01

    A reciprocating probe was used for localized measurements of the radial transport of poloidal momentum in the scrape-off layer (SOL) of ASDEX Upgrade (AUG). The probe measured poloidal and radial electric field components and density. We concentrate on three components of the momentum transport: ......: Reynolds stress, convective momentum flux and triple product of the fluctuating components of density, radial and poloidal electric field. For the evaluation we draw mainly on the probability density functions (PDFs)....

  8. Inward transport of a toroidally confined plasma subject to strong radial electric fields

    Science.gov (United States)

    Roth, J. R.; Krawczonek, W. M.; Powers, E. J.; Hong, J.; Kim, Y.

    1977-01-01

    The paper aims at showing that the density and confinement time of a toroidal plasma can be enhanced by radial electric fields far stronger than the ambipolar values, and that, if such electric fields point into the plasma, radially inward transport can result. The investigation deals with low-frequency fluctuation-induced transport using digitally implemented spectral analysis techniques and with the role of strong applied radial electric fields and weak vertical magnetic fields on plasma density and particle confinement times in a Bumpy Torus geometry. Results indicate that application of sufficiently strong radially inward electric fields results in radially inward fluctuation-induced transport into the toroidal electrostatic potential well; this inward transport gives rise to higher average electron densities and longer particle confinement times in the toroidal plasma.

  9. Axial and radial water transport and internal water storage in tropical forest canopy trees.

    Science.gov (United States)

    Shelley A. James; Frederick C. Meinzer; Guillermo Goldstein; David Woodruff; Timothy Jones; Teresa Restom; Monica Mejia; Michael Clearwater; Paula. Campanello

    2003-01-01

    Heat and stable isotope tracers were used to study axial and radial water transport in relation to sapwood anatomical characteristics and internal water storage in four canopy tree species of a seasonally dry tropical forest in Panama. Anatomical characteristics of the wood and radial profiles of sap flow were measured at the base, upper trunk, and crown of a single...

  10. Radial transport of high-energy oxygen ions into the deep inner magnetosphere observed by Van Allen Probes

    Science.gov (United States)

    Mitani, K.; Seki, K.; Keika, K.; Gkioulidou, M.; Lanzerotti, L. J.; Mitchell, D. G.; Kletzing, C.

    2017-12-01

    It is known that proton is main contributor of the ring current and oxygen ions can make significant contribution during major magnetic storms. Ions are supplied to the ring current by radial transport from the plasma sheet. Convective transport of lower-energy protons and diffusive transport of higher-energy protons were reported to contribute to the storm-time and quiet-time ring current respectively [e.g., Gkioulidou et al., 2016]. However, supply mechanisms of the oxygen ions are not clear. To characterize the supply of oxygen ions to the ring current during magnetic storms, we studied the properties of energetic proton and oxygen ion phase space densities (PSDs) for specific magnetic moment (μ) during the April 23-25, 2013, geomagnetic storm observed by the Van Allen Probes mission. We here report on radial transport of high-energy (μ ≥ 0.5 keV/nT) oxygen ions into the deep inner magnetosphere during the late main phase of the magnetic storm. Since protons show little change during this period, this oxygen radial transport is inferred to cause the development of the late main phase. Enhancement of poloidal magnetic fluctuations is simultaneously observed. We estimated azimuthal mode number ≤5 by using cross wavelet analysis with ground-based observation of IMAGE ground magnetometers. The fluctuations can resonate with drift and bounce motions of the oxygen ions. The results suggest that combination of the drift and drift-bounce resonances is responsible for the radial transport of high-energy oxygen ions into the deep inner magnetosphere. We also report on the radial transport of the high-energy oxygen ions into the deep inner magnetosphere during other magnetic storms.

  11. Radially sheared azimuthal flows and turbulent transport in a cylindrical helicon plasma device

    International Nuclear Information System (INIS)

    Tynan, G R; Burin, M J; Holland, C; Antar, G; Diamond, P H

    2004-01-01

    A radially sheared azimuthal flow is observed in a cylindrical helicon plasma device. The shear flow is roughly azimuthally symmetric and contains both time-stationary and slowly varying components. The turbulent radial particle flux is found to peak near the density gradient maximum and vanishes at the shear layer location. The shape of the radial plasma potential profile associated with the azimuthal E x B flow is predicted accurately by theory. The existence of the mean shear flow in a plasma with finite flow damping from ion-neutral collisions and no external momentum input implies the existence of radial angular momentum transport from the turbulent Reynolds-stress

  12. Variations of helicon wave induced radial plasma transport in different experimental conditions

    International Nuclear Information System (INIS)

    Petrzilka, V.

    1993-08-01

    Variations of the helicon wave induced radial plasma transport are presented in dependence on values of the plasma radius, magnetostatic field, plasma density, frequency of the helicon wave and on the ion charge. 22 refs., 14 figs

  13. Electron cyclotron absorption in Tokamak plasmas in the presence of radial transport of particles

    International Nuclear Information System (INIS)

    Rosa, Paulo R. da S.; Ziebell, Luiz F.

    1998-01-01

    We use quasilinear theory to study effects of particle radial transport on the electron cyclotron absorption coefficient by a current carrying plasma, in a tokamak modelated as a plasma slab. Our numerical results indicate significant modification in the profile of the electron cyclotron absorption coefficient when transport is taken into account relative to the situation without transport. (author)

  14. The influence of collisional and anomalous radial diffusion on parallel ion transport in edge plasmas

    International Nuclear Information System (INIS)

    Helander, P.; Hazeltine, R.D.; Catto, P.J.

    1996-01-01

    The orderings in the kinetic equations commonly used to study the plasma core of a tokamak do not allow a balance between parallel ion streaming and radial diffusion, and are, therefore, inappropriate in the plasma edge. Different orderings are required in the edge region where radial transport across the steep gradients associated with the scrape-off layer is large enough to balance the rapid parallel flow caused by conditions close to collecting surfaces (such as the Bohm sheath condition). In the present work, we derive and solve novel kinetic equations, allowing for such a balance, and construct distinctive transport laws for impure, collisional, edge plasmas in which the perpendicular transport is (i) due to Coulomb collisions of ions with heavy impurities, or (ii) governed by anomalous diffusion driven by electrostatic turbulence. In both the collisional and anomalous radial transport cases, we find that one single diffusion coefficient determines the radial transport of particles, momentum and heat. The parallel transport laws and parallel thermal force in the scrape-off layer assume an unconventional form, in which the relative ion-impurity flow is driven by a combination of the conventional parallel gradients, and new (i) collisional or (ii) anomalous terms involving products of radial derivatives of the temperature and density with the radial shear of the parallel velocity. Thus, in the presence of anomalous radial diffusion, the parallel ion transport cannot be entirely classical, as usually assumed in numerical edge computations. The underlying physical reason is the appearance of a novel type of parallel thermal force resulting from the combined action of anomalous diffusion and radial temperature and velocity gradients. In highly sheared flows the new terms can modify impurity penetration into the core plasma

  15. The role of fluctuation-induced transport in a toroidal plasma with strong radial electric fields

    Science.gov (United States)

    Roth, J. R.; Krawczonek, W. M.; Powers, E. J.; Hong, J. Y.; Kim, Y. C.

    1981-01-01

    Previous work employing digitally implemented spectral analysis techniques is extended to demonstrate that radial fluctuation-induced transport is the dominant ion transport mechanism in an electric field dominated toroidal plasma. Such transport can be made to occur against a density gradient, and hence may have a very beneficial effect on confinement in toroidal plasmas of fusion interest. It is shown that Bohm or classical diffusion down a density gradient, the collisional Pedersen-current mechanism, and the collisionless electric field gradient mechanism described by Cole (1976) all played a minor role, if any, in the radial transport of this plasma.

  16. Radial electric field and transport near the rational surface and the magnetic island in LHD

    International Nuclear Information System (INIS)

    Ida, K.; Inagaki, S.; Tamura, N.

    2002-10-01

    The structure of the radial electric field and heat transport at the magnetic island in the Large Helical Device is investigated by measuring the radial profile of poloidal flow with charge exchange spectroscopy. The convective poloidal flow inside the island is observed when the n/m=1/1 external perturbation field becomes large enough to increase the magnetic island width above a critical value (15-20% of minor radius) in LHD. This convective poloidal flow results in a non-flat space potential inside the magnetic island. The sign of the curvature of the space potential depends on the radial electric field at the boundary of the magnetic island. The heat transport inside the magnetic island is studied with a cold pulse propagation technique. The experimental results show the existence of the radial electric field shear at the boundary of the magnetic island and a reduction of heat transport inside the magnetic island. (author)

  17. Weighted radial dimension: an improved fractal measurement for highway transportation networks distribution

    Science.gov (United States)

    Feng, Yongjiu; Liu, Miaolong; Tong, Xiaohua

    2007-06-01

    An improved fractal measurement, the weighted radial dimension, is put forward for highway transportation networks distribution. The radial dimension (DL), originated from subway investigation in Stuttgart, is a fractal measurement for transportation systems under ideal assumption considering all the network lines to be homogeneous curves, ignoring the difference on spatial structure, quality and level, especially the highway networks. Considering these defects of radial dimension, an improved fractal measurement called weighted radial dimension (D WL) is introduced and the transportation system in Guangdong province is studied in detail using this novel method. Weighted radial dimensions are measured and calculated, and the spatial structure, intensity and connectivity of transportation networks are discussed in Guangdong province and the four sub-areas: the Pearl River Delta area, the East Costal area, the West Costal area and the Northern Guangdong area. In Guangdong province, the fractal spatial pattern characteristics of transportation system vary remarkably: it is the highest in the Pearl River Delta area, moderate in Costal area and lowest in the Northern Guangdong area. With the Pearl River Delta area as the centre, the weighted radial dimensions decrease with the distance increasing, while the decline level is smaller in the costal area and greater in the Northern Guangdong province. By analysis of the conic of highway density, it is recognized that the density decrease with the distance increasing from the calculation centre (Guangzhou), demonstrating the same trend as weighted radial dimensions shown. Evidently, the improved fractal measurement, weighted radial dimension, is an indictor describing the characteristics of highway transportation system more effectively and accurately.

  18. Effects of applied dc radial electric fields on particle transport in a bumpy torus plasma

    Science.gov (United States)

    Roth, J. R.

    1978-01-01

    The influence of applied dc radial electric fields on particle transport in a bumpy torus plasma is studied. The plasma, magnetic field, and ion heating mechanism are operated in steady state. Ion kinetic temperature is more than a factor of ten higher than electron temperature. The electric fields raise the ions to energies on the order of kilovolts and then point radially inward or outward. Plasma number density profiles are flat or triangular across the plasma diameter. It is suggested that the radial transport processes are nondiffusional and dominated by strong radial electric fields. These characteristics are caused by the absence of a second derivative in the density profile and the flat electron temperature profiles. If the electric field acting on the minor radius of the toroidal plasma points inward, plasma number density and confinement time are increased.

  19. A model for radial cesium transport in a fuel pellet

    International Nuclear Information System (INIS)

    Imoto, Shosuke

    1989-01-01

    In order to explain the radial redistribution of cesium in an irradiated pellet, a two-step release model is proposed. The first step involves the migration of cesium by atomic diffusion to some channels, such as grain boundaries and cracks, and the second step assumes a thermomigration down along the temperature gradient. Distribution profiles of cesium are obtained by numerical calculation with the present model assuming a constant and spatially uniform birth rate of cesium in the pellet. The result agrees well with the profile observed by micro-gamma scanning for the LWR fuel in the outer region of the pellet but diverges from it at the inner region. Discussion is made on the steady-state model hitherto generally utilized. (orig.)

  20. Radial transport of high-energy runaway electrons in ORMAK

    International Nuclear Information System (INIS)

    Zweben, S.J.; Swain, D.W.; Fleischmann, H.H.

    1978-01-01

    The transport of high-energy runaway electrons near the outside of a low-density ORMAK discharge is investigated by measuring the flux of runaways to the outer limiter during and after an inward shift of the plasma column. The experimental results are interpreted through a runaway confinement model which includes both the classical outward displacement of the runaway orbit with increasing energy and an additional runaway spatial diffusion coefficient which simulates an unspecified source of anomalous transport. Diffusion coefficients in the range D approximately equal to 10 2 -10 4 cms -1 are found under various discharge conditions indicating a significant non-collisional runaway transport near the outside of the discharge, particularly in the presence of MHD instability. (author)

  1. Impurity profiles and radial transport in the EXTRAP-T2 reversed field pinch

    International Nuclear Information System (INIS)

    Sallander, J.

    1999-01-01

    Radially resolved spectroscopy has been used to measure the radial distribution of impurity ions (O III-O V and C III-CVI) in the EXTRAP-T2 reversed field pinch (RFP). The radial profile of the emission is reconstructed from line emission measured along five lines of sight. The ion density profile is the fitted quantity in the reconstruction of the brightness profile and is thus obtained directly in this process. These measurements are then used to adjust the parameters in transport calculations in order to obtain consistency with the observed ion density profiles. Comparison between model and measurements show that a radial dependence in the diffusion is needed to explain the measured ion densities. (author)

  2. Impurity profiles and radial transport in the EXTRAP-T2 reversed field pinch

    Science.gov (United States)

    Sallander, J.

    1999-05-01

    Radially resolved spectroscopy has been used to measure the radial distribution of impurity ions (O III-O V and C III-CVI) in the EXTRAP-T2 reversed field pinch (RFP). The radial profile of the emission is reconstructed from line emission measured along five lines of sight. The ion density profile is the fitted quantity in the reconstruction of the brightness profile and is thus obtained directly in this process. These measurements are then used to adjust the parameters in transport calculations in order to obtain consistency with the observed ion density profiles. Comparison between model and measurements show that a radial dependence in the diffusion is needed to explain the measured ion densities.

  3. Ion confinement and transport in a toroidal plasma with externally imposed radial electric fields

    Science.gov (United States)

    Roth, J. R.; Krawczonek, W. M.; Powers, E. J.; Kim, Y. C.; Hong, H. Y.

    1979-01-01

    Strong electric fields were imposed along the minor radius of the toroidal plasma by biasing it with electrodes maintained at kilovolt potentials. Coherent, low-frequency disturbances characteristic of various magnetohydrodynamic instabilities were absent in the high-density, well-confined regime. High, direct-current radial electric fields with magnitudes up to 135 volts per centimeter penetrated inward to at least one-half the plasma radius. When the electric field pointed radially toward, the ion transport was inward against a strong local density gradient; and the plasma density and confinement time were significantly enhanced. The radial transport along the electric field appeared to be consistent with fluctuation-induced transport. With negative electrode polarity the particle confinement was consistent with a balance of two processes: a radial infusion of ions, in those sectors of the plasma not containing electrodes, that resulted from the radially inward fields; and ion losses to the electrodes, each of the which acted as a sink and drew ions out of the plasma. A simple model of particle confinement was proposed in which the particle confinement time is proportional to the plasma volume. The scaling predicted by this model was consistent with experimental measurements.

  4. Root cortical aerenchyma inhibits radial nutrient transport in maize (Zea mays).

    Science.gov (United States)

    Hu, Bo; Henry, Amelia; Brown, Kathleen M; Lynch, Jonathan P

    2014-01-01

    Formation of root cortical aerenchyma (RCA) can be induced by nutrient deficiency. In species adapted to aerobic soil conditions, this response is adaptive by reducing root maintenance requirements, thereby permitting greater soil exploration. One trade-off of RCA formation may be reduced radial transport of nutrients due to reduction in living cortical tissue. To test this hypothesis, radial nutrient transport in intact roots of maize (Zea mays) was investigated in two radiolabelling experiments employing genotypes with contrasting RCA. In the first experiment, time-course dynamics of phosphate loading into the xylem were measured from excised nodal roots that varied in RCA formation. In the second experiment, uptake of phosphate, calcium and sulphate was measured in seminal roots of intact young plants in which variation in RCA was induced by treatments altering ethylene action or genetic differences. In each of three paired genotype comparisons, the rate of phosphate exudation of high-RCA genotypes was significantly less than that of low-RCA genotypes. In the second experiment, radial nutrient transport of phosphate and calcium was negatively correlated with the extent of RCA for some genotypes. The results support the hypothesis that RCA can reduce radial transport of some nutrients in some genotypes, which could be an important trade-off of this trait.

  5. Analysis of influence of the radial electric field on turbulent transport in tandem mirror plasma

    International Nuclear Information System (INIS)

    Khvesyuk, Vladimir I.; Chirkov, Alexei Yu.; Pshenichnikov, Anton A.

    2000-01-01

    The model of anomalous transport in cylindrical non-uniform steady state plasma in uniform magnetic field under the influence of many mode drift wave oscillations is suggested. The effect of anomalous transport suppression due to radial electric field is studied, and physical picture of H mode in plasma of GAMMA-10 tandem mirror device is considered. Presented theoretical and numerical results agree with the experimental data obtained on GAMMA-10. (author)

  6. Energy transport in radially accreting white dwarf stars

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, A.M.

    1986-10-01

    Some of the non-thermal energy transport processes which may be present in a white dwarf accretion column are examined and it is determined whether these could in any way contribute to a resolution of the soft X-ray puzzle. The first two Chapters of this Thesis constitute a review of the observations and proposed models for white dwarf accretion columns. In Chapter 3 we show that in Kuijpers and Pringle's original bombardment model of white dwarf accretion columns, in which the energy of the accreting material is deposited uniformly into a static atmosphere which then radiates the energy away as optically thin bremsstrahlung/line radiation, an incorrect Coulomb collisional timescale was used. In Chapter 4 we extend the calculations of Chapter 3 to include the effect of cyclotron radiation. It is concluded that a cyclotron cooled bombardment solution for a white dwarf accretion column may exist. We extend this calculation to derive a simple piecewise uniform temperature structure for such an accretion column, incorporating the effect of thermal conduction. In Chaper 5 we examine two of the non thermal emission mechanisms that might be present in white dwarf accretion columns:- non thermal Lyman-{alpha} emission and non thermal inverse bremsstrahlung emission. It is shown that neither would actually be sufficiently large to be detectable. In Chapter 6 some possible extensions to the work presented are suggested. (author).

  7. Core radial electric field and transport in Wendelstein 7-X plasmas

    Science.gov (United States)

    Pablant, N. A.; Langenberg, A.; Alonso, A.; Beidler, C. D.; Bitter, M.; Bozhenkov, S.; Burhenn, R.; Beurskens, M.; Delgado-Aparicio, L.; Dinklage, A.; Fuchert, G.; Gates, D.; Geiger, J.; Hill, K. W.; Höfel, U.; Hirsch, M.; Knauer, J.; Krämer-Flecken, A.; Landreman, M.; Lazerson, S.; Maaßberg, H.; Marchuk, O.; Massidda, S.; Neilson, G. H.; Pasch, E.; Satake, S.; Svennson, J.; Traverso, P.; Turkin, Y.; Valson, P.; Velasco, J. L.; Weir, G.; Windisch, T.; Wolf, R. C.; Yokoyama, M.; Zhang, D.; W7-X Team

    2018-02-01

    The results from the investigation of neoclassical core transport and the role of the radial electric field profile (Er) in the first operational phase of the Wendelstein 7-X (W7-X) stellarator are presented. In stellarator plasmas, the details of the Er profile are expected to have a strong effect on both the particle and heat fluxes. Investigation of the radial electric field is important in understanding neoclassical transport and in validation of neoclassical calculations. The radial electric field is closely related to the perpendicular plasma flow (u⊥) through the force balance equation. This allows the radial electric field to be inferred from measurements of the perpendicular flow velocity, which can be measured using the x-ray imaging crystal spectrometer and correlation reflectometry diagnostics. Large changes in the perpendicular rotation, on the order of Δu⊥˜ 5 km/s (ΔEr ˜ 12 kV/m), have been observed within a set of experiments where the heating power was stepped down from 2 MW to 0.6 MW. These experiments are examined in detail to explore the relationship between heating power temperature, and density profiles and the radial electric field. Finally, the inferred Er profiles are compared to initial neoclassical calculations based on measured plasma profiles. The results from several neoclassical codes, sfincs, fortec-3d, and dkes, are compared both with each other and the measurements. These comparisons show good agreement, giving confidence in the applicability of the neoclassical calculations to the W7-X configuration.

  8. Experimental Characterization of Piezoelectric Radial Field Diaphragms for Fluidic Control

    Science.gov (United States)

    Bryant, R. G.; Kavli, S. E.; Thomas, R. A., Jr.; Darji, K. J.; Mossi, K. M.

    2004-01-01

    NASA has recently developed a new piezoelectric actuator, the Radial Field Diaphragm or RFD. This actuator uses a radially-directed electric field to generate concentric out-of-plane (Z-axis) motion that allows this packaged device to be used as a pump or valve diaphragm. In order to efficiently use this new active device, experimental determination of pressure, flow rate, mechanical work, power consumption and overall efficiency needs to be determined by actually building a pump. However, without an optimized pump design, it is difficult to assess the quality of the data, as these results are inherent to the actual pump. Hence, separate experiments must be conducted in order to generate independent results to help guide the design criteria and pump quality. This paper focuses on the experiments used to generate the RFD's operational parameters and then compares these results to the experimentally determined results of several types of ball pumps. Also discussed are how errors are inherently introduced into the experiments, the pump design, experimental hardware and their effects on the overall system efficiency.

  9. Radial transport in the Elmo Bumpy Torus in collisionless electron regimes

    International Nuclear Information System (INIS)

    Jaeger, E.F.; Hedrick, C.L.; Spong, D.A.

    1979-01-01

    One important area of disagreement between radial transport theory and the ELMO Bumpy Torus (EBT) experiment has been the degree of collisionality of the toroidal plasma electrons. Experiment shows relatively warm electrons (kTsub(e) approximately 300-600eV) and collisionless scaling, i.e. energy confinement increasing with temperature. But results of early one-dimensional (1-D), neoclassical transport models with radially inward pointing electric fields are limited to relatively cool electrons (kTsub(e) approximately 100-200eV) and collisional scaling. In this paper these early results are extended to include lowest-order effects of ion diffusion in regions where poloidal drift frequencies are small. The effects of direct, or non-diffusive, losses in such regions are neglected along with the effects of finite radial electric fields on electron transport coefficients and of self-consistent poloidal electric fields on ion transport coefficients. Results show that solutions in the collisionless electron regime do exist. Furthermore, when the effects of finite electron ring beta on magnetic fields near the plasma edge are included, these solutions occur at power levels consistent with experiment. (author)

  10. Finite-orbit-width effect and the radial electric field in neoclassical transport phenomena

    International Nuclear Information System (INIS)

    Satake, S.; Okamoto, M.; Nakajima, N.; Sugama, H.; Yokoyama, M.; Beidler, C.D.

    2005-01-01

    Modeling and detailed simulation of neoclassical transport phenomena both in 2D and 3D toroidal configurations are shown. The emphasis is put on the effect of finiteness of the drift-orbit width, which brings a non-local nature to neoclassical transport phenomena. Evolution of the self-consistent radial electric field in the framework of neoclassical transport is also investigated. The combination of Monte-Carlo calculation for ion transport and numerical solver of ripple-averaged kinetic equation for electrons makes it possible to calculate neoclassical fluxes and the time evolution of the radial electric field in the whole plasma region, including the finite-orbit-width (FOW) effects and global evolution of geodesic acoustic mode (GAM). The simulation results show that the heat conductivity around the magnetic axis is smaller than that obtained from standard neoclassical theory and that the evolution of GAM oscillation on each flux surface is coupled with other surfaces if the FOW effect is significant. A global simulation of radial electric field evolution in a non-axisymmetric plasma is also shown. (author)

  11. An axially averaged-radial transport model of tokamak edge plasmas

    International Nuclear Information System (INIS)

    Prinja, A.K.; Conn, R.W.

    1984-01-01

    A two-zone axially averaged-radial transport model for edge plasmas is described that incorporates parallel electron and ion conduction, localized recycling, parallel electron pressure gradient effects and sheath losses. Results for high recycling show that the radial electron temperature profile is determined by parallel electron conduction over short radial distances (proportional 3 cm). At larger radius where Tsub(e) has fallen appreciably, convective transport becomes equally important. The downstream density and ion temperature profiles are very flat over the region where electron conduction dominates. This is seen to result from a sharply decaying velocity profile that follows the radial electron temperature. A one-dimensional analytical recycling model shows that at high neutral pumping rates, the plasma density at the plate, nsub(ia), scales linearly with the unperturbed background density, nsub(io). When ionization dominates nsub(ia)/nsub(io) proportional exp(nsub(io)) while in the intermediate regime nsub(ia)/nsub(io) proportional exp(proportional nsub(io)). Such behavior is qualitatively in accord with experimental observations. (orig.)

  12. Overview on the radial electric field, plasma rotation and transport in the stellarator W7-AS

    International Nuclear Information System (INIS)

    Baldzuhn, J.; Kick, M.; Maassberg, H.; Ohlendorf, W.

    1998-01-01

    In the advanced stellarator W7-AS the radial electric field E r is measured by active charge exchange recombination spectroscopy CXRS. In parallel, it is calculated by using the neoclassical DKES code. A comparison of calculated and measured solutions reveals in how far the neoclassical model is valid for the description of the radial particle transport and the formation of E r . In general good consistency is found, even for the outer radii where the neoclassical fluxes become much smaller than the experimental ones. In this paper the interplay between the particular E r roots and transport is considered. For strongly positive E r a reduction of χ e is observed in the vicinity of the magnetic axis. The typically negative ion-root in the gradient region strongly influences the local ∇ T i , thus determining the maximum attainable T i (0). (author)

  13. Turbulent fluctuations and radial transport in the scrape-off layer of the ASDEX tokamak

    Energy Technology Data Exchange (ETDEWEB)

    Endler, M [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85740 Garching (Germany); Giannone, L. [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85740 Garching (Germany); McCormick, K [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85740 Garching (Germany); Niedermeyer, H [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85740 Garching (Germany); Rudyj, A [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85740 Garching (Germany); Theimer, G [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85740 Garching (Germany); Tsois, N [NCSR ` Demokritos` , Athens (Greece); ASDEX Team

    1995-04-01

    Electrostatic fluctuations have been measured in the scrape-off layer of ASDEX by Langmuir probes and by observation of H{sub {alpha}} light with high poloidal and temporal resolution. It was demonstrated that these fluctuations contribute a significant, if not dominant, fraction of the ``anomalous`` radial particle transport. A model for an instability mechanism specific to the SOL is presented including density, temperature and electric potential fluctuations. From this model mixing length estimates for the radial transport and resulting density and pressure gradients in the SOL are derived and compared to measurements in the mid-plane and in the divertor of ASDEX. In spite of several simplifications in the model a quantitative agreement up to factors of 1-3 and a qualitative agreement for variations of discharge parameters is achieved between the model predictions and the measurements. ((orig.)).

  14. Turbulent fluctuations and radial transport in the scrape-off layer of the ASDEX tokamak

    International Nuclear Information System (INIS)

    Endler, M.; Giannone, L.; McCormick, K.; Niedermeyer, H.; Rudyj, A.; Theimer, G.; Tsois, N.

    1995-01-01

    Electrostatic fluctuations have been measured in the scrape-off layer of ASDEX by Langmuir probes and by observation of H α light with high poloidal and temporal resolution. It was demonstrated that these fluctuations contribute a significant, if not dominant, fraction of the ''anomalous'' radial particle transport. A model for an instability mechanism specific to the SOL is presented including density, temperature and electric potential fluctuations. From this model mixing length estimates for the radial transport and resulting density and pressure gradients in the SOL are derived and compared to measurements in the mid-plane and in the divertor of ASDEX. In spite of several simplifications in the model a quantitative agreement up to factors of 1-3 and a qualitative agreement for variations of discharge parameters is achieved between the model predictions and the measurements. ((orig.))

  15. Theoretical transport analysis of density limit with radial electric field in helical plasmas

    International Nuclear Information System (INIS)

    Toda, S.; Itoh, K.

    2010-11-01

    The confinement property in helical toroidal plasmas is clarified. The analysis is performed by use of the one-dimensional transport equations with the effect of the radiative loss and the radial profile of the electric field. The analytical results in the edge region show the steep gradient in the electron temperature, which indicates the transport barrier formation. Because of the rapid increase of the radiative loss at the low electron temperature, the anomalous heat diffusivity is reduced near the edge. Next, the efficiency of the heating power input in the presence of the radiative loss is studied. The scaling of the critical density in helical devices is also derived. (author)

  16. Environmental efficiency analysis of transportation system in China: A non-radial DEA approach

    International Nuclear Information System (INIS)

    Chang, Young-Tae; Zhang, Ning; Danao, Denise; Zhang, Nan

    2013-01-01

    Many countries are worried about reducing energy consumption and environmental pollution while increasing the productivity and efficiency of their industries. This study intends to contribute to the literature by proposing a non-radial DEA model with the slacks-based measure (SBM) to analyze the environmental efficiency of China's transportation sector. The results show that most of the provinces in China do not have an eco-efficient transportation industry. The environmental efficiency levels in most of the provinces are lower than 50% of the ideal or target level. Therefore, China's transportation industry is environmentally very inefficient. China can reduce a great deal of carbon emissions in each province ranging from at least 1.6 million TOEs in Qinghai and at most 33 million TOEs in Guangdong and Shanghai. - Highlights: • Propose a non-radial DEA model with the slacks-based measure. • Analyze the environmental efficiency of China's transportation sector. • China's transportation industry is environmentally very inefficient. • Millions of TOE carbon emissions can be reduced in most of the provinces

  17. Numerical and Experimental Investigation of Turbulent Transport Control via Shaping of Radial Plasma Flow Profiles

    International Nuclear Information System (INIS)

    Gilmore, Mark Allen

    2017-01-01

    Turbulence, and turbulence-driven transport are ubiquitous in magnetically confined plasmas, where there is an intimate relationship between turbulence, transport, instability driving mechanisms (such as gradients), plasma flows, and flow shear. Though many of the detailed physics of the interrelationship between turbulence, transport, drive mechanisms, and flow remain unclear, there have been many demonstrations that transport and/or turbulence can be suppressed or reduced via manipulations of plasma flow profiles. This is well known in magnetic fusion plasmas [e.g., high confinement mode (H-mode) and internal transport barriers (ITB's)], and has also been demonstrated in laboratory plasmas. However, it may be that the levels of particle transport obtained in such cases [e.g. H-mode, ITB's] are actually lower than is desirable for a practical fusion device. Ideally, one would be able to actively feedback control the turbulent transport, via manipulation of the flow profiles. The purpose of this research was to investigate the feasibility of using both advanced model-based control algorithms, as well as non-model-based algorithms, to control cross-field turbulence-driven particle transport through appropriate manipulation of radial plasma flow profiles. The University of New Mexico was responsible for the experimental portion of the project, while our collaborators at the University of Montana provided plasma transport modeling, and collaborators at Lehigh University developed and explored control methods.

  18. Numerical and Experimental Investigation of Turbulent Transport Control via Shaping of Radial Plasma Flow Profiles

    Energy Technology Data Exchange (ETDEWEB)

    Gilmore, Mark Allen [Univ. of New Mexico, Albuquerque, NM (United States)

    2017-02-05

    Turbulence, and turbulence-driven transport are ubiquitous in magnetically confined plasmas, where there is an intimate relationship between turbulence, transport, instability driving mechanisms (such as gradients), plasma flows, and flow shear. Though many of the detailed physics of the interrelationship between turbulence, transport, drive mechanisms, and flow remain unclear, there have been many demonstrations that transport and/or turbulence can be suppressed or reduced via manipulations of plasma flow profiles. This is well known in magnetic fusion plasmas [e.g., high confinement mode (H-mode) and internal transport barriers (ITB’s)], and has also been demonstrated in laboratory plasmas. However, it may be that the levels of particle transport obtained in such cases [e.g. H-mode, ITB’s] are actually lower than is desirable for a practical fusion device. Ideally, one would be able to actively feedback control the turbulent transport, via manipulation of the flow profiles. The purpose of this research was to investigate the feasibility of using both advanced model-based control algorithms, as well as non-model-based algorithms, to control cross-field turbulence-driven particle transport through appropriate manipulation of radial plasma flow profiles. The University of New Mexico was responsible for the experimental portion of the project, while our collaborators at the University of Montana provided plasma transport modeling, and collaborators at Lehigh University developed and explored control methods.

  19. Nonlocality of plasma fluctuations and transport in magnetically confined plasmas nonlocal plasma transport and radial structural formation

    International Nuclear Information System (INIS)

    Toi, Kazuo

    2002-01-01

    Experimental evidence and underlying physical processes of nonlocal characters and structural formation in magnetically confined toroidal plasmas are reviewed. Radial profiles of the plasmas exhibit characteristic structures, depending on the various confinement regimes. Profile stiffness subjected to some global constraint and rapid plasma responses to applied plasma perturbation result from nonlocal transport. Once the plasma is free from the constraint, the plasma state can be changed to a new state exhibiting various types of prominent structural formation such as an internal transport barrier. (author)

  20. Radial transport processes as a precursor to particle deposition in drinking water distribution systems.

    Science.gov (United States)

    van Thienen, P; Vreeburg, J H G; Blokker, E J M

    2011-02-01

    Various particle transport mechanisms play a role in the build-up of discoloration potential in drinking water distribution networks. In order to enhance our understanding of and ability to predict this build-up, it is essential to recognize and understand their role. Gravitational settling with drag has primarily been considered in this context. However, since flow in water distribution pipes is nearly always in the turbulent regime, turbulent processes should be considered also. In addition to these, single particle effects and forces may affect radial particle transport. In this work, we present an application of a previously published turbulent particle deposition theory to conditions relevant for drinking water distribution systems. We predict quantitatively under which conditions turbophoresis, including the virtual mass effect, the Saffman lift force, and the Magnus force may contribute significantly to sediment transport in radial direction and compare these results to experimental observations. The contribution of turbophoresis is mostly limited to large particles (>50 μm) in transport mains, and not expected to play a major role in distribution mains. The Saffman lift force may enhance this process to some degree. The Magnus force is not expected to play any significant role in drinking water distribution systems. © 2010 Elsevier Ltd. All rights reserved.

  1. Kinetic transport properties of a bumpy torus with finite radial ambipolar field

    International Nuclear Information System (INIS)

    Spong, D.A.; Harris, E.G.; Hedrick, C.L.

    1978-04-01

    Bumpy torus neoclassical transport coefficients have been calculted including finite values of the radial ambipolar field. These are obtained by solving a bounce-averaged drift kinetic equation in a local approximation for perturbations in the distribution function (away from a stationary Maxwellian) caused by toroidicity and radial gradients in plasma density, temperature, and potential. Particle and energy fluxes along with the associated transport coefficients are then calculated by taking appropriate moments of the distribution function. Particle orbits are treated by breaking them up into a vertical drift component (due to toroidicity) and a theta precessional drift (as a result of Vector E x Vector B and drifts due to the bumpy toroidal field). The kinetic equation has been solved using both a functional expansion method and finite difference techniques [Alternating-Direction-Implicit (ADI)]. The resulting transport coefficients exhibit a strong dependence on the ambipolar electric field and plasma collisionality. In the large electric field limit, our results are in close agreement with the earlier work of Kovrizhnykh

  2. Large plasma pressure perturbations and radial convective transport in a tokamak

    International Nuclear Information System (INIS)

    Krasheninnikov, Sergei; Yu, Guanghui; Ryutov, Dmitri

    2004-01-01

    Strongly localized plasma structures with large pressure inhomogeneities (such as plasma blobs in the scrape-off-layer (SOL)/shadow regions, pellet clouds, Edge localized Modes (ELMs)) observed in the tokamaks, stellarators and linear plasma devices. Experimental studies of these phenomena reveal striking similarities including more convective rather than diffusive radial plasma transport. We suggest that rather simple models can describe many essentials of blobs, ELMs, and pellet clouds dynamics. The main ingredient of these models is the effective plasma gravity caused by magnetic curvature, centrifugal or friction forces effects. As a result, the equations governing plasma transport in such localized structures appear to be rather similar to that used to describe nonlinear evolution of thermal convection in the Boussinesq approximation (directly related to the Rayleigh-Taylor (RT) instability). (author)

  3. Formation of electron-root radial electric field and its effect on thermal transport in LHD high Te plasma

    International Nuclear Information System (INIS)

    Matsuoka, Seikichi; Satake, Shinsuke; Takahashi, Hiromi; Yokoyama, Masayuki; Ido, Takeshi; Shimizu, Akihiro; Shimozuma, Takashi; Wakasa, Arimitsu; Murakami, Sadayoshi

    2013-01-01

    Neoclassical transport analyses have been performed for a high electron temperature LHD plasma with steep temperature gradient using a neoclassical transport simulation code, FORTEC-3D. It is shown that the large positive radial electric field is spontaneously formed at the core along with the increase in the electron temperature, while the neoclassical heat diffusivity remains almost unchanged. This indicates that the 1/ν-type increase expected in the neoclassical transport in helical plasmas can be avoided by the spontaneous formation of the radial electric field. At the same time, it is found that the experimentally estimated heat diffusivity is significantly reduced. This suggests that the formation process of the transport barrier in the high electron temperature plasma can be caused by the spontaneous formation of the radial electric field. (author)

  4. Effects of finite-β and radial electric fields on neoclassical transport in the Large Helical Device

    International Nuclear Information System (INIS)

    Kanno, R.; Nakajima, N.; Sugama, H.; Okamoto, M.; Ogawa, Y.

    1997-01-01

    Effects of finite-β and radial electric fields on the neoclassical transport in the Large Helical Device are investigated with the DKES (Drift Kinetic Equation Solver) code. In the finite-β configuration, even orbits of deeply trapped particles deviate significantly from magnetic flux surfaces. Thus, neoclassical ripple transport coefficients in the finite-β configuration are several times larger than those in the vacuum configuration under the same condition of temperatures and radial electric fields. When the plasma temperature is several keV, a bifurcation of the electric fields appears under the ambipolarity condition, and sufficient large radial electric fields can be generated. As a result, the ExB drift rectifies orbits of particles and improves significantly the transport coefficients in the finite-β configuration. (author)

  5. Characterization of Radial Curved Fin Heat Sink under Natural and Forced Convection

    Science.gov (United States)

    Khadke, Rishikesh; Bhole, Kiran

    2018-02-01

    Heat exchangers are important structures widely used in power plants, food industries, refrigeration, and air conditioners and now widely used in computing systems. Finned type of heat sink is widely used in computing systems. The main aim of the design of the heat sink is to maintain the optimum temperature level. To achieve this goal so many geometrical configurations are implemented. This paper presents a characterization of radially curved fin heat sink under natural and forced convection. Forced convection is studied for the optimization of temperature for better efficiency. The different alternatives in geometry are considered in characterization are heat intensity, the height of the fin and speed of the fan. By recognizing these alternatives the heat sink is characterized by the heat flux usually generated in high-end PCs. The temperature drop characteristics across height and radial direction are presented for the constant heat input and air flow in the heat sink. The effect of dimensionless elevation height (0 ≤ Z* ≤ 1) and Elenbaas Number (0.4 ≤ El ≤ 2.8) of the heat sink were investigated for study of the Nusselt number. Based on experimental characterization, process plan has been developed for the selection of the similar heat sinks for desired output (heat dissipation and temperature distribution).

  6. Effect of base-pair inhomogeneities on charge transport along the DNA molecule, mediated by twist and radial polarons

    International Nuclear Information System (INIS)

    Palmero, F; Archilla, J F R; Hennig, D; Romero, F R

    2004-01-01

    Some recent results for a three-dimensional, semi-classical, tight-binding model for DNA show that there are two types of polarons, namely radial and twist polarons, which can transport charge along the DNA molecule. However, the existence of two types of base pairs in real DNA makes it crucial to find out if charge transport also exists in DNA chains with different base pairs. In this paper, we address this problem in its simple case, a homogeneous chain except for a single different base pair, which we call a base-pair inhomogeneity, and its effect on charge transport. Radial polarons experience either reflection or trapping. However, twist polarons are good candidates for charge transport along real DNA. This transport is also very robust with respect to weak parametric and diagonal disorder

  7. Analysis of radial electric field bifurcation in LHD based on neoclassical transport theory

    International Nuclear Information System (INIS)

    Yokoyama, Masayuki; Ida, Katsumi; Shimozuma, Takashi

    2003-01-01

    Radial electric field (E r ) properties in LHD have been investigated based on the neoclassical transport theory and have also applied to LHD experimental results. The effects of the helicity of the magnetic configuration on the condition required to realize the electron root are examined. The larger helicity makes the threshold temperature lower for the same electron density. A higher threshold temperature is anticipated to be required in the plasma core region based on this fact and also due to the larger density there. This high electron temperature (T e ) has been successfully obtained with a center-focused ECH. There is a threshold for the ECH power to achieve a steep gradient of T e , and it seems to be qualitatively consistent with the transition of E r , at least in the sense that the abrupt increase of T e occurs after entering the anticipated electron root regime. These experimental results, consistent with those of analysis of the neoclassical ambipolar E r , indicate that the transition phenomena of E r in LHD are predominantly governed by neoclassical features. (author)

  8. Measurements and modeling of transport and impurity radial profiles in the EXTRAP T2R reversed field pinch

    Science.gov (United States)

    Kuldkepp, M.; Brunsell, P. R.; Cecconello, M.; Dux, R.; Menmuir, S.; Rachlew, E.

    2006-09-01

    Radial impurity profiles of oxygen in the rebuilt reversed field pinch EXTRAP T2R [P. R. Brunsell et al., Plasma Phys. Control. Fusion 43, 1457 (2001)] have been measured with a multichannel spectrometer. Absolute ion densities for oxygen peak between 1-4×1010cm-3 for a central electron density of 1×1013cm-3. Transport simulations with the one-dimensional transport code STRAHL with a diffusion coefficient of 20m2 s-1 yield density profiles similar to those measured. Direct measurement of the ion profile evolution during pulsed poloidal current drive suggests that the diffusion coefficient is reduced by a factor ˜2 in the core but remains unaffected toward the edge. Core transport is not significantly affected by the radial magnetic field growth seen at the edge in discharges without feedback control. This indicates that the mode core amplitude remains the same while the mode eigenfunction increases at the edge.

  9. Measurements and modeling of transport and impurity radial profiles in the EXTRAP T2R reversed field pinch

    International Nuclear Information System (INIS)

    Kuldkepp, M.; Brunsell, P. R.; Cecconello, M.; Dux, R.; Menmuir, S.; Rachlew, E.

    2006-01-01

    Radial impurity profiles of oxygen in the rebuilt reversed field pinch EXTRAP T2R [P. R. Brunsell et al., Plasma Phys. Control. Fusion 43, 1457 (2001)] have been measured with a multichannel spectrometer. Absolute ion densities for oxygen peak between 1-4x10 10 cm -3 for a central electron density of 1x10 13 cm -3 . Transport simulations with the one-dimensional transport code STRAHL with a diffusion coefficient of 20 m 2 s -1 yield density profiles similar to those measured. Direct measurement of the ion profile evolution during pulsed poloidal current drive suggests that the diffusion coefficient is reduced by a factor ∼2 in the core but remains unaffected toward the edge. Core transport is not significantly affected by the radial magnetic field growth seen at the edge in discharges without feedback control. This indicates that the mode core amplitude remains the same while the mode eigenfunction increases at the edge

  10. Poloidal rotation dynamics, radial electric field, and neoclassical theory in the jet internal-transport-barrier region.

    Science.gov (United States)

    Crombé, K; Andrew, Y; Brix, M; Giroud, C; Hacquin, S; Hawkes, N C; Murari, A; Nave, M F F; Ongena, J; Parail, V; Van Oost, G; Voitsekhovitch, I; Zastrow, K-D

    2005-10-07

    Results from the first measurements of a core plasma poloidal rotation velocity (upsilontheta) across internal transport barriers (ITB) on JET are presented. The spatial and temporal evolution of the ITB can be followed along with the upsilontheta radial profiles, providing a very clear link between the location of the steepest region of the ion temperature gradient and localized spin-up of upsilontheta. The upsilontheta measurements are an order of magnitude higher than the neoclassical predictions for thermal particles in the ITB region, contrary to the close agreement found between the determined and predicted particle and heat transport coefficients [K.-D. Zastrow, Plasma Phys. Controlled Fusion 46, B255 (2004)]. These results have significant implications for the understanding of transport barrier dynamics due to their large impact on the measured radial electric field profile.

  11. CHARACTERIZING THE GALACTIC WHITE DWARF BINARY POPULATION WITH SPARSELY SAMPLED RADIAL VELOCITY DATA

    International Nuclear Information System (INIS)

    Maoz, Dan; Badenes, Carles; Bickerton, Steven J.

    2012-01-01

    We present a method to characterize statistically the parameters of a detached binary sample—binary fraction, separation distribution, and mass-ratio distribution—using noisy radial velocity data with as few as two, randomly spaced, epochs per object. To do this, we analyze the distribution of ΔRV max , the maximum radial velocity difference between any two epochs for the same object. At low values, the core of this distribution is dominated by measurement errors, but for large enough samples there is a high-velocity tail that can effectively constrain the parameters of the binary population. We discuss our approach for the case of a population of detached white dwarf (WD) binaries with separations that are decaying via gravitational wave emission. We derive analytic expressions for the present-day distribution of separations, integrated over the star formation history of the Galaxy, for parameterized initial WD separation distributions at the end of the common-envelope phase. We use Monte Carlo techniques to produce grids of simulated ΔRV max distributions with specific binary population parameters, and the same sampling cadences and radial velocity errors as the observations, and we compare them to the real ΔRV max distribution to constrain the properties of the binary population. We illustrate the sensitivity of the method to both the model and observational parameters. In the particular case of binary WDs, every model population predicts a merger rate per star which can easily be compared to specific Type Ia supernova rates. In a companion paper, we apply the method to a sample of ∼4000 WDs from the Sloan Digital Sky Survey. The binary fractions and separation distribution parameters allowed by the data indicate a rate of WD-WD mergers per unit stellar mass in the Galactic disk, ∼1 × 10 –13 mergers yr –1 M –1 ☉ , remarkably similar to the rate per unit mass of Type Ia supernovae in Milky Way like galaxies.

  12. Hybrid simulations of radial transport driven by the Rayleigh-Taylor instability

    Science.gov (United States)

    Delamere, P. A.; Stauffer, B. H.; Ma, X.

    2017-12-01

    Plasma transport in the rapidly rotating giant magnetospheres is thought to involve a centrifugally-driven flux tube interchange instability, similar to the Rayleigh-Taylor (RT) instability. In three dimensions, the convective flow patterns associated with the RT instability can produce strong guide field reconnection, allowing plasma mass to move radially outward while conserving magnetic flux (Ma et al., 2016). We present a set of hybrid (kinetic ion / fluid electron) plasma simulations of the RT instability using high plasma beta conditions appropriate for Jupiter's inner and middle magnetosphere. A density gradient, combined with a centrifugal force, provide appropriate RT onset conditions. Pressure balance is achieved by initializing two ion populations: one with fixed temperature, but varying density, and the other with fixed density, but a temperature gradient that offsets the density gradient from the first population and the centrifugal force (effective gravity). We first analyze two-dimensional results for the plane perpendicular to the magnetic field by comparing growth rates as a function of wave vector following Huba et al. (1998). Prescribed perpendicular wave modes are seeded with an initial velocity perturbation. We then extend the model to three dimensions, introducing a stabilizing parallel wave vector. Boundary conditions in the parallel direction prohibit motion of the magnetic field line footprints to model the eigenmodes of the magnetodisc's resonant cavity. We again compare growth rates based on perpendicular wave number, but also on the parallel extent of the resonant cavity, which fixes the size of the largest parallel wavelength. Finally, we search for evidence of strong guide field magnetic reconnection within the domain by identifying areas with large parallel electric fields or changes in magnetic field topology.

  13. Noble internal transport barriers and radial subdiffusion of toroidal magnetic lines

    Energy Technology Data Exchange (ETDEWEB)

    Misguich, J.H.; Reuss, J.D. [Association Euratom-CEA sur la Fusion, CEA/DSM/DRFC, 13 - Saint Paul lez Durance (France); Constantinescu, D.; Steinbrecher, G. [Association Euratom-N.A.S.T.I., Dept. of Physics, University of Craiova (Romania); Vlad, M.; Spineanu, F. [Association Euratom-N.A.S.T.I., National Institute of Laser, Plasma and Radiation Physics, Bucharest (Romania); Weyssow, B.; Balescu, R. [Association Euratom-Etat Belge sur la Fusion, Universite Libre de Bruxelles (Belgium)

    2002-02-01

    Internal transport barriers (ITB's) observed in tokamaks are described by a purely magnetic approach. Magnetic line motion in toroidal geometry with broken magnetic surfaces is studied from a previously derived Hamiltonian map in situation of incomplete chaos. This appears to reproduce in a realistic way the main features of a tokamak, for a given safety factor profile and in terms of a single parameter L representing the amplitude of the magnetic perturbation. New results are given concerning the Shafranov shift as function of L. For small values of L, closed magnetic surfaces exist (KAM tori) and island chains begin to appear on rational surfaces for higher values of L, with chaotic zones around hyperbolic points, as expected. Single trajectories of magnetic line motion indicate the persistence of a central protected plasma core, surrounded by a chaotic shell enclosed in a double-sided transport barrier. Magnetic lines which succeed to escape across this barrier begin to wander in a wide chaotic sea extending up to a very robust barrier (as long as L{<=}1). For values of L{>=}1, above the escape threshold, most magnetic lines succeed to escape out of the external barrier which has become a permeable Cantorus. Statistical analysis of a large number of trajectories, representing the evolution of a bunch of magnetic lines, indicate that the flux variable {psi} asymptotically grows in a diffuse manner as (L{sup 2}t) with a L{sup 2} scaling as expected, but that the average radial position r{sub m}(t) asymptotically grows as (L{sup 2}t){sup 1/4} while the mean square displacement around this average radius asymptotically grows in a sub-diffusive manner as (L{sup 2}t){sup 1/2}. This result shows the slower dispersion in the present incomplete chaotic regime, which is different from the usual quasilinear diffusion in completely chaotic situations. For physical times t{sub {phi}} of the order of the escape time defined by x{sub m}(t{sub {phi}}) {approx}1, the motion

  14. Noble internal transport barriers and radial subdiffusion of toroidal magnetic lines

    International Nuclear Information System (INIS)

    Misguich, J.H.; Reuss, J.D.; Constantinescu, D.; Steinbrecher, G.; Vlad, M.; Spineanu, F.; Weyssow, B.; Balescu, R.

    2002-02-01

    Internal transport barriers (ITB's) observed in tokamaks are described by a purely magnetic approach. Magnetic line motion in toroidal geometry with broken magnetic surfaces is studied from a previously derived Hamiltonian map in situation of incomplete chaos. This appears to reproduce in a realistic way the main features of a tokamak, for a given safety factor profile and in terms of a single parameter L representing the amplitude of the magnetic perturbation. New results are given concerning the Shafranov shift as function of L. For small values of L, closed magnetic surfaces exist (KAM tori) and island chains begin to appear on rational surfaces for higher values of L, with chaotic zones around hyperbolic points, as expected. Single trajectories of magnetic line motion indicate the persistence of a central protected plasma core, surrounded by a chaotic shell enclosed in a double-sided transport barrier. Magnetic lines which succeed to escape across this barrier begin to wander in a wide chaotic sea extending up to a very robust barrier (as long as L≤1). For values of L≥1, above the escape threshold, most magnetic lines succeed to escape out of the external barrier which has become a permeable Cantorus. Statistical analysis of a large number of trajectories, representing the evolution of a bunch of magnetic lines, indicate that the flux variable ψ asymptotically grows in a diffuse manner as (L 2 t) with a L 2 scaling as expected, but that the average radial position r m (t) asymptotically grows as (L 2 t) 1/4 while the mean square displacement around this average radius asymptotically grows in a sub-diffusive manner as (L 2 t) 1/2 . This result shows the slower dispersion in the present incomplete chaotic regime, which is different from the usual quasilinear diffusion in completely chaotic situations. For physical times t φ of the order of the escape time defined by x m (t φ ) ∼1, the motion appears to be super-diffusive, however, but less dangerous than

  15. Characterization of placental cholesterol transport

    DEFF Research Database (Denmark)

    Lindegaard, Marie L; Wassif, Christopher A; Vaisman, Boris

    2008-01-01

    Patients with Smith-Lemli-Opitz syndrome (SLOS) are born with multiple congenital abnormalities. Postnatal cholesterol supplementation is provided; however, it cannot correct developmental malformations due to in utero cholesterol deficit. Increased transport of cholesterol from maternal to fetal...... circulation might attenuate congenital malformations. The cholesterol transporters Abca1, Abcg1, and Sr-b1 are present in placenta; however, their potential role in placental transport remains undetermined. In mice, expression analyses showed that Abca1 and Abcg1 transcripts increased 2-3-fold between...... embryonic days 13.5 and 18.5 in placental tissue; whereas, Sr-b1 expression decreased. To examine the functional role of Abca1, Abcg1 and Sr-b1 we measured the maternal-fetal transfer of (14)C-cholesterol in corresponding mutant embryos. Disruption of either Abca1 or Sr-b1 decreased cholesterol transfer...

  16. Classification of the Group Invariant Solutions for Contaminant Transport in Saturated Soils under Radial Uniform Water Flows

    Directory of Open Access Journals (Sweden)

    M. M. Potsane

    2014-01-01

    Full Text Available The transport of chemicals through soils to the groundwater or precipitation at the soils surfaces leads to degradation of these resources. Serious consequences may be suffered in the long run. In this paper, we consider macroscopic deterministic models describing contaminant transport in saturated soils under uniform radial water flow backgrounds. The arising convection-dispersion equation given in terms of the stream functions is analyzed using classical Lie point symmetries. A number of exotic Lie point symmetries are admitted. Group invariant solutions are classified according to the elements of the one-dimensional optimal systems. We analyzed the group invariant solutions which satisfy the physical boundary conditions.

  17. Final Technical Report: Numerical and Experimental Investigation of Turbulent Transport Control via Shaping of Radial Plasma Flow Profiles

    Energy Technology Data Exchange (ETDEWEB)

    Schuster, Eugenio

    2014-05-02

    The strong coupling between the different physical variables involved in the plasma transport phenomenon and the high complexity of its dynamics call for a model-based, multivariable approach to profile control where those predictive models could be exploited. The overall objective of this project has been to extend the existing body of work by investigating numerically and experimentally active control of unstable fluctuations, including fully developed turbulence and the associated cross-field particle transport, via manipulation of flow profiles in a magnetized laboratory plasma device. Fluctuations and particle transport can be monitored by an array of electrostatic probes, and Ex B flow profiles can be controlled via a set of biased concentric ring electrodes that terminate the plasma column. The goals of the proposed research have been threefold: i- to develop a predictive code to simulate plasma transport in the linear HELCAT (HELicon-CAThode) plasma device at the University of New Mexico (UNM), where the experimental component of the proposed research has been carried out; ii- to establish the feasibility of using advanced model-based control algorithms to control cross-field turbulence-driven particle transport through appropriate manipulation of radial plasma flow profiles, iii- to investigate the fundamental nonlinear dynamics of turbulence and transport physics. Lehigh University (LU), including Prof. Eugenio Schuster and one full-time graduate student, has been primarily responsible for control-oriented modeling and model-based control design. Undergraduate students have also participated in this project through the National Science Foundation Research Experience for Undergraduate (REU) program. The main goal of the LU Plasma Control Group has been to study the feasibility of controlling turbulence-driven transport by shaping the radial poloidal flow profile (i.e., by controlling flow shear) via biased concentric ring electrodes.

  18. Efficiency of radial transport of ices in protoplanetary disks probed with infrared observations: the case of CO2

    Science.gov (United States)

    Bosman, Arthur D.; Tielens, Alexander G. G. M.; van Dishoeck, Ewine F.

    2018-04-01

    Context. Radial transport of icy solid material from the cold outer disk to the warm inner disk is thought to be important for planet formation. However, the efficiency at which this happens is currently unconstrained. Efficient radial transport of icy dust grains could significantly alter the composition of the gas in the inner disk, enhancing the gas-phase abundances of the major ice constituents such as H2O and CO2. Aim. Our aim is to model the gaseous CO2 abundance in the inner disk and use this to probe the efficiency of icy dust transport in a viscous disk. From the model predictions, infrared CO2 spectra are simulated and features that could be tracers of icy CO2, and thus dust, radial transport efficiency are investigated. Methods: We have developed a 1D viscous disk model that includes gas accretion and gas diffusion as well as a description for grain growth and grain transport. Sublimation and freeze-out of CO2 and H2O has been included as well as a parametrisation of the CO2 chemistry. The thermo-chemical code DALI was used to model the mid-infrared spectrum of CO2, as can be observed with JWST-MIRI. Results: CO2 ice sublimating at the iceline increases the gaseous CO2 abundance to levels equal to the CO2 ice abundance of 10-5, which is three orders of magnitude more than the gaseous CO2 abundances of 10-8 observed by Spitzer. Grain growth and radial drift increase the rate at which CO2 is transported over the iceline and thus the gaseous CO2 abundance, further exacerbating the problem. In the case without radial drift, a CO2 destruction rate of at least 10-11 s-1 or a destruction timescale of at most 1000 yr is needed to reconcile model prediction with observations. This rate is at least two orders of magnitude higher than the fastest destruction rate included in chemical databases. A range of potential physical mechanisms to explain the low observed CO2 abundances are discussed. Conclusions: We conclude that transport processes in disks can have

  19. Calculation of Self-consistent Radial Electric Field in Presence of Convective Electron Transport in a Stellarator

    International Nuclear Information System (INIS)

    Kernbichler, W.; Heyn, M.F.; Kasilov, S.V.

    2003-01-01

    Convective transport of supra-thermal electrons can play a significant role in the energy balance of stellarators in case of high power electron cyclotron heating. Here, together with neoclassical thermal particle fluxes also the supra-thermal electron flux should be taken into account in the flux ambipolarity condition, which defines the self-consistent radial electric field. Since neoclassical particle fluxes are non-linear functions of the radial electric field, one needs an iterative procedure to solve the ambipolarity condition, where the supra-thermal electron flux has to be calculated for each iteration. A conventional Monte-Carlo method used earlier for evaluation of supra-thermal electron fluxes is rather slow for performing the iterations in reasonable computer time. In the present report, the Stochastic Mapping Technique (SMT), which is more effective than the conventional Monte Carlo method, is used instead. Here, the problem with a local monoenergetic supra-thermal particle source is considered and the effect of supra-thermal electron fluxes on both, the self-consistent radial electric field and the formation of different roots of the ambipolarity condition are studied

  20. Study of impurity transport in HL-2A ECRH L-mode plasmas with radially different ECRH power depositions

    Science.gov (United States)

    Cui, Z. Y.; Zhang, K.; Morita, S.; Ji, X. Q.; Ding, X. T.; Xu, Y.; Sun, P.; Gao, J. M.; Dong, C. F.; Zheng, D. L.; Li, Y. G.; Jiang, M.; Li, D.; Zhong, W. L.; Liu, Yi; Dong, Y. B.; Song, S. D.; Yu, L. M.; Shi, Z. B.; Fu, B. Z.; Lu, P.; Huang, M.; Yuan, B. S.; Yang, Q. W.; Duan, X. R.

    2018-05-01

    In HL-2A, an inverse sawtooth oscillation is observed with a long-lasting m/n  =  1/1 mode during ECRH phase with power deposition inside sawtooth inversion radius (inner-deposited ECRH), while a normal sawtooth instead appears when the ECRH power is deposited outside sawtooth inversion radius (outer-deposited ECRH). Aluminum is then injected as a trace impurity with laser blow-off (LBO) method into the inner- and outer-deposited ECRH phases of HL-2A discharges to investigate the effect of ECRH on impurity transport. Temporal behavior of soft x-ray (SXR) array signals is analyzed with a 1D impurity transport code, and radial structures of impurity transport coefficients are obtained. The result shows that the radial transport of Al ions is strongly enhanced during the inner-deposited ECRH phase. In particular, an outward convection velocity is developed with positive values of 0  ⩽  V(ρ)  ⩽  3.8 m s-1 in ρ  ⩽  0.5, while the convection velocity is inward in ρ  ⩾  0.6. In the outer-deposited ECRH discharge, on the other hand, the convection velocity takes a big negative value in ρ  ⩽  0.4 and close to zero at ρ ~ 0.6. In ohmic discharges, an inward V(ρ) always appears in the whole plasma radii and gradually increases toward the plasma edge (-3.2 m s-1 at ρ  =  1). The simulation result also indicates that centrally-peaked Al ion density profiles presented in the outer-deposited ECRH discharge can be flattened by the inner-deposited ECRH. Modification of impurity transport is discussed in the presence of long-lasting m/n  =  1/1 MHD mode.

  1. Identifying the molecular functions of electron transport proteins using radial basis function networks and biochemical properties.

    Science.gov (United States)

    Le, Nguyen-Quoc-Khanh; Nguyen, Trinh-Trung-Duong; Ou, Yu-Yen

    2017-05-01

    The electron transport proteins have an important role in storing and transferring electrons in cellular respiration, which is the most proficient process through which cells gather energy from consumed food. According to the molecular functions, the electron transport chain components could be formed with five complexes with several different electron carriers and functions. Therefore, identifying the molecular functions in the electron transport chain is vital for helping biologists understand the electron transport chain process and energy production in cells. This work includes two phases for discriminating electron transport proteins from transport proteins and classifying categories of five complexes in electron transport proteins. In the first phase, the performances from PSSM with AAIndex feature set were successful in identifying electron transport proteins in transport proteins with achieved sensitivity of 73.2%, specificity of 94.1%, and accuracy of 91.3%, with MCC of 0.64 for independent data set. With the second phase, our method can approach a precise model for identifying of five complexes with different molecular functions in electron transport proteins. The PSSM with AAIndex properties in five complexes achieved MCC of 0.51, 0.47, 0.42, 0.74, and 1.00 for independent data set, respectively. We suggest that our study could be a power model for determining new proteins that belongs into which molecular function of electron transport proteins. Copyright © 2017 Elsevier Inc. All rights reserved.

  2. Evidence for a poloidally localized enhancement of radial transport in the scrape-off layer of the Tore Supra tokamak

    International Nuclear Information System (INIS)

    Gunn, J.P.; Boucher, C.; Dionne, M.; Duran, I.; Fuchs, V.; Loarer, T.; Nanobashvili, I.; Panek, R.; Pascal, J.-Y.; Saint-Laurent, F.; Stoeckel, J.; Rompuy, T. van; Zagorski, R.; Adamek, J.; Bucalossi, J.; Dejarnac, R.; Devynck, P.; Hertout, P.; Hron, M.; Lebrun, G.; Moreau, P.; Rimini, F.; Sarkissian, A.; Oost, G. van

    2007-01-01

    Near-sonic parallel flows are systematically observed in the far scrape-off layer (SOL) of the limiter tokamak Tore Supra, as in many L-mode X-point divertor tokamak plasmas. The poloidal variation of the parallel flow has been measured by moving the contact point of a small circular plasma onto limiters at different poloidal angles. The resulting variations of flow are consistent with the existence of a poloidally localized enhancement of radial transport concentrated in a 30 deg. sector near the outboard midplane. If the plasma contact point is placed on the inboard limiters, then the SOL expands to fill all the space between the plasma and the outboard limiters, with density decay lengths between 10 and 20 cm. On the other hand, if the contact point lies on the outboard limiters, the localized plasma outflux is scraped off and the SOL is very thin with decay lengths around 2-3 cm. The outboard radial transport would have to be about two orders of magnitude stronger than inboard to explain these results

  3. Turbulence induced radial transport of toroidal momentum in boundary plasma of EAST tokamak

    International Nuclear Information System (INIS)

    Zhao, N.; Yan, N.; Xu, G. S.; Wang, H. Q.; Wang, L.; Ding, S. Y.; Chen, R.; Chen, L.; Zhang, W.; Hu, G. H.; Shao, L. M.; Wang, Z. X.

    2016-01-01

    Turbulence induced toroidal momentum transport in boundary plasma is investigated in H-mode discharge using Langmuir-Mach probes on EAST. The Reynolds stress is found to drive an inward toroidal momentum transport, while the outflow of particles convects the toroidal momentum outwards in the edge plasma. The Reynolds stress driven momentum transport dominates over the passive momentum transport carried by particle flux, which potentially provides a momentum source for the edge plasma. The outflow of particles delivers a momentum flux into the scrape-off layer (SOL) region, contributing as a momentum source for the SOL flows. At the L-H transitions, the outward momentum transport suddenly decreases due to the suppression of edge turbulence and associated particle transport. The SOL flows start to decelerate as plasma entering into H-mode. The contributions from turbulent Reynolds stress and particle transport for the toroidal momentum transport are identified. These results shed lights on the understanding of edge plasma accelerating at L-H transitions.

  4. Impact of radial transport on the quasilinear plateau formation due to electron cyclotron wave absorption

    NARCIS (Netherlands)

    Peeters, A.G.; Westerhof, E.

    1996-01-01

    Numerical simulations using a three-dimensional Fokker-Planck code show that for small tokamaks the transport of electrons across the magnetic surfaces at a level consistent with anomalous transport has a large influence on the formation of the quasilinear plateau during electron cyclotron resonant

  5. Flow Characterization and Dynamic Analysis of a Radial Compressor with Passive Method of Surge Control

    Science.gov (United States)

    Guillou, Erwann

    Due to recent emission regulations, the use of turbochargers for force induction of internal combustion engines has increased. Actually, the trend in diesel engines is to downsize the engine by use of turbochargers that operate at higher pressure ratio. Unfortunately, increasing the rotational speed tends to reduce the turbocharger radial compressor range of operation which is limited at low mass flow rate by the occurrence of surge. In order to extent the operability of turbochargers, compressor housings can be equipped with a passive surge control device also known as ported shroud. This specific casing treatment has been demonstrated to enhance surge margin with minor negative impact on the compressor efficiency. However, the actual working mechanisms of the bypass system remain not well understood. In order to optimize the design of the ported shroud, it is then crucial to identify the dynamic flow changes induced by the implementation of the device to control instabilities. Experimental methods were used to assess the development of instabilities from stable, stall and eventually surge regimes of a ported shroud centrifugal compressor. Systematic comparison was conducted with the same compressor design without ported shroud. Hence, the full pressure dynamic survey of both compressors' performance characteristics converged toward two different and probably interrelated driving mechanisms to the development and/or propagation of unsteadiness within each compressor. One related the pressure disturbances at the compressor inlet, and notably the more apparent development of perturbations in the non-ported compressor impeller, whereas the other was attributed to the pressure distortions induced by the presence of the tongue in the asymmetric design of the compressor volute. Specific points of operation were selected to carry out planar flow measurements. At normal working, both standard and stereoscopic particle imaging velocimetry (PIV) measurements were performed

  6. Semianalytical characterization of turbulence from radial impellers, with experimental and numerical validation

    Czech Academy of Sciences Publication Activity Database

    Ben-Nun, R.; Sheintuch, M.; Kysela, Bohuš; Konfršt, Jiří; Fořt, I.

    2015-01-01

    Roč. 61, č. 4 (2015), s. 1413-1426 ISSN 0001-1541 R&D Projects: GA ČR GAP101/12/2274 Institutional support: RVO:67985874 Keywords : turbulent jet * mixing * radial impeller * stirred tank * Rushton turbine Subject RIV: BK - Fluid Dynamics Impact factor: 2.980, year: 2015

  7. Characterization of the loss allocation techniques for radial systems with distributed generation

    International Nuclear Information System (INIS)

    Carpaneto, Enrico; Chicco, Gianfranco; Sumaili Akilimali, Jean

    2008-01-01

    In the restructured electricity industry, meaningful loss allocation methods are required in order to send correct signals to the market taking into account the location and characteristics of loads and generations, including the local sources forming the distributed generation (DG). This paper addresses the issues related to loss allocation in radial distribution systems with DG, with a three-fold focus. First, the key differences in the formulation of the loss allocation problem for radial distribution systems with respect to transmission systems are discussed, specifying the modeling and computational issues concerning the treatment of the slack node in radial distribution systems. Then, the characteristics of derivative-based and circuit-based loss allocation techniques are presented and compared, illustrating the arrangements used for adapting the various techniques to be applied to radial distribution systems with DG. Finally, the effects of introducing voltage-controllable local generation on the calculation of the loss allocation coefficients are discussed, proposing the adoption of a ''reduced'' representation of the system capable of taking into proper account the characteristics of the nodes containing voltage-controllable DG units. Numerical results are provided to show the time evolution of the loss allocation coefficients for distribution systems with variable load and local generation patterns. (author)

  8. Characterization of a Twin-Entry Radial Turbine under Pulsatile Flow Condition

    Directory of Open Access Journals (Sweden)

    Mahfoudh Cerdoun

    2016-01-01

    Full Text Available In automotive applications radial gas turbines are commonly fitted with a twin-entry volute connected to a divided exhaust manifold, ensuring a better scavenge process owing to less interference between engines’ cylinders. This paper is concerned with the study of the unsteady performances related to the pulsating flows of a twin-entry radial turbine in engine-like conditions and the hysteresis-like behaviour during the pulses period. The results show that the aerodynamic performances deviate noticeably from the steady state and depend mainly on the time shifting between the actual output power and the isentropic power, which is distantly related to the apparent length. The maximum of efficiency and output shaft power are accompanied by low entropy generation through the shroud entry side, and their instantaneous behaviours tend to follow mainly the inlet total pressure curve. As revealed a billow is created by the interaction between the main flow and the infiltrated flow, affecting the flow incidence at rotor entry and producing high losses.

  9. Apparent directional mass-transfer capacity coefficients in three-dimensional anisotropic heterogeneous aquifers under radial convergent transport

    Science.gov (United States)

    Pedretti, D.; Fernàndez-Garcia, D.; Sanchez-Vila, X.; Bolster, D.; Benson, D. A.

    2014-02-01

    Aquifer hydraulic properties such as hydraulic conductivity (K) are ubiquitously heterogeneous and typically only a statistical characterization can be sought. Additionally, statistical anisotropy at typical characterization scales is the rule. Thus, regardless of the processes governing solute transport at the local (pore) scale, transport becomes non-Fickian. Mass-transfer models provide an efficient tool that reproduces observed anomalous transport; in some cases though, these models lack predictability as model parameters cannot readily be connected to the physical properties of aquifers. In this study, we focus on a multirate mass-transfer model (MRMT), and in particular the apparent capacity coefficient (β), which is a strong indicator of the potential of immobile zones to capture moving solute. We aim to find if the choice of an apparent β can be phenomenologically related to measures of statistical anisotropy. We analyzed an ensemble of random simulations of three-dimensional log-transformed multi-Gaussian permeability fields with stationary anisotropic correlation under convergent flow conditions. It was found that apparent β also displays an anisotropic behavior, physically controlled by the aquifer directional connectivity, which in turn is controlled by the anisotropic correlation model. A high hydraulic connectivity results in large β values. These results provide new insights into the practical use of mass-transfer models for predictive purposes.

  10. Characterization of chemical agent transport in paints.

    Science.gov (United States)

    Willis, Matthew P; Gordon, Wesley; Lalain, Teri; Mantooth, Brent

    2013-09-15

    A combination of vacuum-based vapor emission measurements with a mass transport model was employed to determine the interaction of chemical warfare agents with various materials, including transport parameters of agents in paints. Accurate determination of mass transport parameters enables the simulation of the chemical agent distribution in a material for decontaminant performance modeling. The evaluation was performed with the chemical warfare agents bis(2-chloroethyl) sulfide (distilled mustard, known as the chemical warfare blister agent HD) and O-ethyl S-[2-(diisopropylamino)ethyl] methylphosphonothioate (VX), an organophosphate nerve agent, deposited on to two different types of polyurethane paint coatings. The results demonstrated alignment between the experimentally measured vapor emission flux and the predicted vapor flux. Mass transport modeling demonstrated rapid transport of VX into the coatings; VX penetrated through the aliphatic polyurethane-based coating (100 μm) within approximately 107 min. By comparison, while HD was more soluble in the coatings, the penetration depth in the coatings was approximately 2× lower than VX. Applications of mass transport parameters include the ability to predict agent uptake, and subsequent long-term vapor emission or contact transfer where the agent could present exposure risks. Additionally, these parameters and model enable the ability to perform decontamination modeling to predict how decontaminants remove agent from these materials. Published by Elsevier B.V.

  11. Radial transport effects on ECCD in the TCV and DIII-D tokamaks and on Ohmic discharges in the MST RFP

    International Nuclear Information System (INIS)

    Harvey, R.W.; Sauter, O.; Nikkola, P.; Prater, R.; O'Connell, R.; Forest, C.B.

    2003-01-01

    The comprehensive CQL3D Fokker-Planck/Quasilinear simulation code has been benchmarked against experiment over a wide range of electron cyclotron conditions in the DIII-D tokamak (C.C. Petty et al., 14. Topical Conf. on RF Power in Plasmas, 2002). The same code, in disagreement with experiment, gives 560 kA of ECCD for a well documented, completely ECCD-driven, 100 kA TCV shot [O. Sauter et al, PRL, 2000]. Recent work (R.W. Harvey et al, Phys. Rev. Lett., 2002) has resolved the differences as due to radial transport at a level closely consistent with ITER scaling. Transport does not substantially affect DIII-D ECCD, but at similar ECH power has an overwhelming effect on the much smaller TCV. The transport is consistent with electrostatic-type diffusion (D ρρ constant in velocity space) and not with a magnetic-type diffusion (D ρρ ∝ |v || |). Fokker-Planck simulation of Ohmic reversed field pinch (RFP) discharges in the MST device reveals transport velocity dependence stronger than |v || |) will give agreement with current and soft X-ray spectra in standard discharges, but in the higher confinement, current profile controlled PPCD discharges, transport is again electrostatic-like. This is consistent with the object of PPCD, which is to replace magnetic turbulence driven current with auxiliary CD to improve transport. The tokamak and high-confinement RFP results mutually reinforce the constant-in-velocity-space 'electrostatic-type turbulence' conclusion. The steady-state energy and toroidal current are governed by the same radial transport equation. (authors)

  12. RADIAL TRANSPORT EFFECTS ON ECCD IN THE TCV AND DIII-D TOKAMAKS AND ON OHMIC DISCHARGES IN THE MST RFP

    International Nuclear Information System (INIS)

    HARVEY, R.W.; SAUTER, O.; PRATER, R.; NIKKOLA, P.; O'CONNELL, R.; FOREST, C.B.

    2002-01-01

    The comprehensive CQL3D Fokker-Planck/Quasilinear simulation code has been benchmarked against experiment over a wide range of electron cyclotron conditions in the DIII-D tokamak (C.C. Petty et al., 14th Topical Conf. on RF Power in Plasmas, 2002). The same code, in disagreement with experiment, gives 560 kA of ECCD for a well documented, completely ECCD-driven, 100 kA TCV shot [O. Sauter et al, PRL, 2000]. Recent work (R.W. Harvey et al, Phys. Rev. Lett., 2002) has resolved the differences as due to radial transport at a level closely consistent with ITER scaling. Transport does not substantially affect DIII-D ECCD, but at similar ECH power has an overwhelming effect on the much smaller TCV. The transport is consistent with electrostatic-type diffusion (D ρρ constant in velocity-space) and not with a magnetic-type diffusion (D ρρ ∝ |v(parallel)|). Fokker-Planck simulation of Ohmic reversed field pinch (RFP) discharges in the MST device reveals transport velocity dependence stronger than |v(parallel)| will give agreement with current and soft X-ray spectra in standard discharges, but in the higher confinement, current profile controlled PPCD discharges, transport is again electrostatic-like. This is consistent with the object of PPCD, which is to replace magnetic turbulence driven current with auxiliary CD to improve transport. The tokamak and high-confinement RFP results mutually reinforce the constant-in-velocity-space ''electrostatic-type turbulence'' conclusion. The steady-state energy and toroidal current are governed by the same radial transport equation

  13. Characterization of SLC transporters in human skin

    Directory of Open Access Journals (Sweden)

    Marion Alriquet

    2015-03-01

    Full Text Available Most identified drug transporters belong to the ATP-binding Cassette (ABC and Solute Carrier (SLC families. Recent research indicates that some of these transporters play an important role in the absorption, distribution and excretion of drugs, and are involved in clinically relevant drug-drug interactions for systemic drugs. However, very little is known about the role of drug transporters in human skin in the disposition of topically applied drugs and their involvement in drug-drug interactions. The aim of this work was to compare the expression in human skin (vs human hepatocytes and kidney of SLC transporters included in the EMA guidance as the most likely clinical sources of drug interactions. The expression of SLC transporters in human tissues was analyzed by quantitative RT-PCR. Modulation of SLC47A1 and SLC47A2 (MATE1 and MATE2 expression was analyzed after treatment of human skin in organ-culture with rifampicin and UV irradiation. The expression of SLCO2B1 (OATPB, SLCO3A1 (OATPD, SLCO4A1 (OATPE, SLC47A1 and SLC47A2 (MATE1 and MATE2 was detected in human skin, OATPE and MATE1 being the most expressed. OATPE is about 70 times more expressed in human skin than in human hepatocytes. Moreover, the expression of SLC47A1 and SLC47A2 was down-regulated after treatment with rifampicin or after exposure to UV light. The present findings demonstrate that SLCO4A1 (OATPE and SLC47A1 (MATE1 are highly expressed in human skin and suggest the involvement of SLC transporters in the disposition of topically applied drugs.

  14. Identification and characterization of jasmonate transporters

    DEFF Research Database (Denmark)

    Lambertz, Sophie Konstanze

    of the stimulus but also in distal tissues. The systemic accumulation has been the focus of many studies, which proposed that jasmonate is transported over long and short distances to induce defense responses. However, our knowledge of jasmonate transporting elements is marginal. In this thesis, two jasmonate...... Spodoptera littoralis and the fungus Botrytis cinerea was tested. Wounding assays indicate that the JEFFs are involved in systemic induction of the defense compounds glucosinolates, which may be caused by a JEFF mediated shift of jasmonate precursors to the biologically active form of jasmonates. Further...

  15. Molecular cloning and characterization of glucose transporter 1 ...

    African Journals Online (AJOL)

    Glucose transporter type-1 (glut1) and citrate synthase plays crucial role in glucose transport and regulation of tricarboxylic acid cycle (TCA) cycle in mammalian energy metabolism. The present study was aimed to clone and characterize glut1 and citrate synthase cDNA in water buffalo (Bubalus bubalis). Total of 90 ...

  16. A solution of the dispersion-convection equation of radial tracer transportation by the finite element variational method

    International Nuclear Information System (INIS)

    Hubert, J.

    1979-01-01

    The variational finite element method (of the Rayleigh-Ritz type) has been applied to solve the standard diffusion-convection equation of radial flow in a dispersive medium. It was shown that the imposing of the boundary condition ΔC/Δx = 0 (=null concentration gradient) introduced great errors in computation results. To remedy it this condition was imposed at the free end of the artifical domain. Its other end joined to the downstream boundary of the investigated domain. The results of calculations compared with the known analytical solutions of the parallel flow show their good accuracy. The method was used to discuss the applicability of the approximate analytical solutions of the radial flow. (author)

  17. Rapid assessment of pulmonary gas transport with hyperpolarized 129Xe MRI using a 3D radial double golden-means acquisition with variable flip angles.

    Science.gov (United States)

    Ruppert, Kai; Amzajerdian, Faraz; Hamedani, Hooman; Xin, Yi; Loza, Luis; Achekzai, Tahmina; Duncan, Ian F; Profka, Harrilla; Siddiqui, Sarmad; Pourfathi, Mehrdad; Cereda, Maurizio F; Kadlecek, Stephen; Rizi, Rahim R

    2018-04-22

    To demonstrate the feasibility of using a 3D radial double golden-means acquisition with variable flip angles to monitor pulmonary gas transport in a single breath hold with hyperpolarized xenon-129 MRI. Hyperpolarized xenon-129 MRI scans with interleaved gas-phase and dissolved-phase excitations were performed using a 3D radial double golden-means acquisition in mechanically ventilated rabbits. The flip angle was either held fixed at 15 ° or 5 °, or it was varied linearly in ascending or descending order between 5 ° and 15 ° over a sampling interval of 1000 spokes. Dissolved-phase and gas-phase images were reconstructed at high resolution (32 × 32 × 32 matrix size) using all 1000 spokes, or at low resolution (22 × 22 × 22 matrix size) using 400 spokes at a time in a sliding-window fashion. Based on these sliding-window images, relative change maps were obtained using the highest mean flip angle as the reference, and aggregated pixel-based changes were tracked. Although the signal intensities in the dissolve-phase maps were mostly constant in the fixed flip-angle acquisitions, they varied significantly as a function of average flip angle in the variable flip-angle acquisitions. The latter trend reflects the underlying changes in observed dissolve-phase magnetization distribution due to pulmonary gas uptake and transport. 3D radial double golden-means acquisitions with variable flip angles provide a robust means for rapidly assessing lung function during a single breath hold, thereby constituting a particularly valuable tool for imaging uncooperative or pediatric patient populations. © 2018 International Society for Magnetic Resonance in Medicine.

  18. Design for limit stresses of orange fruits (Citrus sinensis under axial and radial compression as related to transportation and storage design

    Directory of Open Access Journals (Sweden)

    Christopher Chukwutoo Ihueze

    2017-01-01

    Full Text Available This article employed the Hertz contact stress theory and the finite element method to evaluate the maximum contact pressure and the limit stresses of orange fruit under transportation and storage. The elastic properties of orange fruits subjected to axial and axial contact were measured such that elastic limit force, elastic modulus, Poisson’s ratio and bioyield stress were obtained as 18 N, 0.691 MPa, 0.367, 0.009 MPa for axial compression and for radial loading were 15.69 N, 0.645 MPa, 0.123, 0.010 MPa. The Hertz maximum contact pressure was estimated for axial and radial contacts as 0.036 MPa. The estimated limiting yield stress estimated as von Mises stresses for the induced surface stresses of the orange topologies varied from 0.005 MPa–0.03 MPa. Based on the distortion energy theory (DET the yield strength of orange fruit is recommended as 0.03 MPa while based on the maximum shear stress theory (MSST is 0.01 MPa for the design of orange transportation and storage system.

  19. MzPIP2;1: An Aquaporin Involved in Radial Water Movement in Both Water Uptake and Transportation, Altered the Drought and Salt Tolerance of Transgenic Arabidopsis.

    Directory of Open Access Journals (Sweden)

    Lin Wang

    Full Text Available Plants are unavoidably subjected to various abiotic stressors, including high salinity, drought and low temperature, which results in water deficit and even death. Water uptake and transportation play a critical role in response to these stresses. Many aquaporin proteins, localized at different tissues, function in various transmembrane water movements. We targeted at the key aquaporin in charge of both water uptake in roots and radial water transportation from vascular tissues through the whole plant.The MzPIP2;1 gene encoding a plasma membrane intrinsic protein was cloned from salt-tolerant apple rootstock Malus zumi Mats. The GUS gene was driven by MzPIP2;1 promoter in transgenic Arabidopsis. It indicated that MzPIP2;1 might function in the epidermal and vascular cells of roots, parenchyma cells around vessels through the stems and vascular tissues of leaves. The ectopically expressed MzPIP2;1 conferred the transgenic Arabidopsis plants enhanced tolerance to slight salt and drought stresses, but sensitive to moderate salt stress, which was indicated by root length, lateral root number, fresh weight and K+/Na+ ratio. In addition, the possible key cis-elements in response to salt, drought and cold stresses were isolated by the promoter deletion experiment.The MzPIP2;1 protein, as a PIP2 aquaporins subgroup member, involved in radial water movement, controls water absorption and usage efficiency and alters transgenic plants drought and salt tolerance.

  20. The role of the radial electric field in confinement and transport in H-mode and VH-mode discharges in the DIII-D tokamak

    International Nuclear Information System (INIS)

    Gohil, P.; Burrell, K.H.; Groebner, R.J.; Osborne, T.H.; Doyle, E.J.; Rettig, C.L.

    1993-08-01

    Measurements of the radial electric field, E r , with high spatial and high time resolution in H-mode and VH-mode discharges in the DIII-D tokamak have revealed the significant influence of the shear in E r on confinement and transport in these discharges. These measurements are made using the DIII-D Charge Exchange Recombination (CER) System. At the L-H transition in DIII-D plasmas, a negative well-like E r profile develops just within the magnetic separatrix. A region of shear in E r results, which extends 1 to 2 cm into the plasma from the separatrix. At the transition, this region of sheared E r exhibits the greatest increase in impurity ion poloidal rotation velocity and the greatest reduction in plasma fluctuations. A transport barrier is formed in this same region of E x B velocity shear as is signified by large increases in the observed gradients of the ion temperature, the carbon density, the electron temperature and electron density. The development of the region of sheared E r , the increase in impurity ion poloidal rotation, the reduction in plasma turbulence, and the transport barrier all occur simultaneously at the L-H transition. Measurements of the radial electric field, plasma turbulence, thermal transport, and energy confinement have been performed for a wide range of plasma conditions and configurations. The results support the supposition that the progression of improving confinement at the L-H transition, into the H-mode and then into the VH-mode can be explained by the hypothesis of the suppression of plasma turbulence by the increasing penetration of the region of sheared E x B velocity into the plasma interior

  1. Tryptophan Transport in Human Fibroblast Cells—A Functional Characterization

    Directory of Open Access Journals (Sweden)

    Ravi Vumma

    2011-01-01

    Full Text Available There are indications that serotonergic neurotransmission is disturbed in several psychiatric disorders. One explanation may be disturbed transport of tryptophan (precursor for serotonin synthesis across cell membranes. Human fibroblast cells offer an advantageous model to study the transport of amino acids across cell membranes, since they are easy to propagate and the environmental factors can be controlled. The aim of this study was to functionally characterize tryptophan transport and to identify the main transporters of tryptophan in fibroblast cell lines from healthy controls. Tryptophan kinetic parameters ( V max and K m at low and high concentrations were measured in fibroblasts using the cluster tray method. Uptake of 3 H (5-L-tryptophan at different concentrations in the presence and absence of excess concentrations of inhibitors or combinations of inhibitors of amino acid transporters were also measured. Tryptophan transport at high concentration (0.5 mM had low affinity and high V max and the LAT1 isoform of system-L was responsible for approximately 40% of the total uptake of tryptophan. In comparison, tryptophan transport at low concentration (50 nM had higher affinity, lower V max and approximately 80% of tryptophan uptake was transported by system-L with LAT1 as the major isoform. The uptake of tryptophan at the low concentration was mainly sodium (Na + dependent, while uptake at high substrate concentration was mainly Na + independent. A series of different transporter inhibitors had varying inhibitory effects on tryptophan uptake. This study indicates that tryptophan is transported by multiple transporters that are active at different substrate concentrations in human fibroblast cells. The tryptophan transport trough system-L was mainly facilitated by the LAT1 isoform, at both low and high substrate concentrations of tryptophan.

  2. Development of Nanoscale Graphitic Devices and The Transport Characterization

    International Nuclear Information System (INIS)

    Gunasekaran, Venugopal

    2011-02-01

    This dissertation describes the development of graphitic based nanoscale devices with its fabrication and transport characterization results. It covers graphite nano-scale stacked-junctions fabricated using focused ion beam (FIB) 3-D etching technique, a single layer graphite layer (graphene) preparation and its electrical transport characterization results and the synthesis and investigation of electrical transport behavior of graphene oxide based thin film devices. The first chapter describes the basic information about the carbon family in detail in which the electronic properties and structure of graphite, graphene and graphene oxide are discussed. In addition, the necessity of developing nanoscale graphitic devices is given. The second chapter explains the experimental techniques used in this research for fabricating nanoscale devices which includes focused ion beam 3-D fabrication procedures, mechanical exfoliation technique and photolithographic methods. In third chapter, we have reported the results on temperature dependence of graphite planar-type structures fabricated along ab-plane. In the fourth and fifth chapters, the fabrication and electrical transport characteristics of large in-plane area graphite planar-type structures (fabricated along ab-plane and c-axis) were discussed and their transport anisotropy properties were investigated briefly. In the sixth chapter, we focused the fabrication of the submicron sized graphite stacked junctions and their electrical transport characterization studies. In which, FIB was used to fabricated the submicron junctions with various in-plane area (with same stack height) are and their transport characteristics were compared. The seventh chapter reports investigation of electrical transport results of nanoscale graphite stacked-junctions in which the temperature dependent transport (R-T) studies, current-voltage measurements for the various in-plane areas and for various stack height samples were analyzed. The

  3. Observation of enhanced radial transport of energetic ion due to energetic particle mode destabilized by helically-trapped energetic ion in the Large Helical Device

    Science.gov (United States)

    Ogawa, K.; Isobe, M.; Kawase, H.; Nishitani, T.; Seki, R.; Osakabe, M.; LHD Experiment Group

    2018-04-01

    A deuterium experiment was initiated to achieve higher-temperature and higher-density plasmas in March 2017 in the Large Helical Device (LHD). The central ion temperature notably increases compared with that in hydrogen experiments. However, an energetic particle mode called the helically-trapped energetic-ion-driven resistive interchange (EIC) mode is often excited by intensive perpendicular neutral beam injections on high ion-temperature discharges. The mode leads to significant decrease of the ion temperature or to limiting the sustainment of the high ion-temperature state. To understand the effect of EIC on the energetic ion confinement, the radial transport of energetic ions is studied by means of the neutron flux monitor and vertical neutron camera newly installed on the LHD. Decreases of the line-integrated neutron profile in core channels show that helically-trapped energetic ions are lost from the plasma.

  4. On the influence of the magnetic topology on transport and radial electric fields in the TJ-II stellarator

    International Nuclear Information System (INIS)

    Castejon, F.; Ochando, M.; Estrada, T.; Pedrosa, M.A.; Lopez-Bruna, D.; Ascasibar, E.; Cappa, A.; Eguilior, S.; Fernandez-Curto, A.; Herranz, J.; Hidalgo, C.; Lopez-Fraguas, A.; Melnikov, A.V.; McCarthy, K.J.; Medina, F.; Pastor, I.; Chmyga, A.A.; Dreval, N.B.; Khrebtov, S.M.; Komarov, A.D.; Kozachok, A.S.; Krupnik, L.; Eliseev, L.

    2005-01-01

    The influence of the magnetic topology on plasma profiles and turbulence has been investigated in ECH plasmas in the stellarator TJ-II, taking advantage of the flexibility of this almost shearless device. A wide range of edge rotational transform values can be attained, but the rotational transform profile can also be tailored by inducing currents using both ECCD and two sets of OH coils. In this way it is possible to introduce rational surfaces inside the plasma and to modify the magnetic shear to examine their effect on confinement. Kinetic effects and flux changes due to the presence of resonances and ECRH are responsible of the formation of barriers in the plasma core, while the shear flow is a key ingredient in the plasma edge. The results here shown offer wide and valuable information to assess multiple mechanisms based on neoclassical/turbulent bifurcations and kinetic effects as candidates to explain the impact of magnetic topology on radial electric fields and confinement. (author)

  5. Poloidal electric field and variation of radial transport during ICRF heating in the JET scrape-off layer

    International Nuclear Information System (INIS)

    Clement, S.; Tagle, J.A.; Bures, M.; Vince, J.; Kock, L. de; Stangeby, P.C.

    1989-01-01

    The highly anomalous perpendicular transport in the plasma edge of a tokamak is generally attributed to plasma turbulence, primarily to density and electrostatic potential fluctuations. The edge transport could be modified by changing the geometry of objects in contact with the plasma (limiters, radio frequency antennae ...) and during additional heating experiments. Poloidal asymmetries in the scrape-off layer (SOL) in tokamaks using poloidal limiters (eg. ALCATOR-C) have been recently reported, indicating a poloidal asymmetry in cross-field transport. A poloidal ring limiter obstructs communications between different flux tubes in the SOL, thus permitting poloidal asymmetries in n e and T e to develop if D perpendicular is θ-dependent. When JET was operated with discrete limiters, equivalent to a single toroidal limiter at the outside mid-plane, little poloidal variation in the SOL plasma properties was observed. Currently JET is operated with two complete toroidal belt limiters located approximately one meter above and below the outside mid-plane. This configuration breaks the SOL into two regions: the low field side SOL (LFS), between the limiters, and the rest of the SOL on the high field side (HFS). Differences on the scrape-off lengths in the two SOLs are reported here, indicating that cross-field transport is faster on the LFS-SOL, in agreement with observations made on ASDEX and T-10. (author) 8 refs., 6 figs

  6. Characterization of molecule and particle transport through nanoscale conduits

    Science.gov (United States)

    Alibakhshi, Mohammad Amin

    Nanofluidic devices have been of great interest due to their applications in variety of fields, including energy conversion and storage, water desalination, biological and chemical separations, and lab-on-a-chip devices. Although these applications cross the boundaries of many different disciplines, they all share the demand for understanding transport in nanoscale conduits. In this thesis, different elusive aspects of molecule and particle transport through nanofluidic conduits are investigated, including liquid and ion transport in nanochannels, diffusion- and reaction-governed enzyme transport in nanofluidic channels, and finally translocation of nanobeads through nanopores. Liquid or solvent transport through nanoconfinements is an essential yet barely characterized component of any nanofluidic systems. In the first chapter, water transport through single hydrophilic nanochannels with heights down to 7 nm is experimentally investigated using a new measurement technique. This technique has been developed based on the capillary flow and a novel hybrid nanochannel design and is capable of characterizing flow in both single nanoconduits as well as nanoporous media. The presence of a 0.7 nm thick hydration layer on hydrophilic surfaces and its effect on increasing the hydraulic resistance of the nanochannels is verified. Next, ion transport in a new class of nanofluidic rectifiers is theoretically and experimentally investigated. These so called nanofluidic diodes are nanochannels with asymmetric geometries which preferentially allow ion transport in one direction. A nondimensional number as a function of electrolyte concentration, nanochannel dimensions, and surface charge is derived that summarizes the rectification behavior of this system. In the fourth chapter, diffusion- and reaction-governed enzyme transport in nanofluidic channels is studied and the theoretical background necessary for understanding enzymatic activity in nanofluidic channels is presented. A

  7. Evidence for a poloidally localized enhancement of radial transport in the scrape-off layer of the Tore Supra tokamak

    Czech Academy of Sciences Publication Activity Database

    Gunn, J. P.; Boucher, C.; Dionne, M.; Ďuran, Ivan; Fuchs, Vladimír; Loarer, T.; Nanobashvili, I.; Pánek, Radomír; Pascal, J.-Y.; Saint-Laurent, F.; Stöckel, Jan; Van Rompuy, T.; Zagórski, R.; Adámek, Jiří; Bucalossi, J.; Dejarnac, Renaud; Devynck, P.; Hertout, P.; Hron, Martin; Lebrun, G.; Moreau, P.; Rimini, F.; Sarkissian, A.; Van Oost, G.

    363-365, - (2007), s. 484-490 ISSN 0022-3115. [International Conference on Plasma-Surface Interactions in Controlled Fusion Devices/17th./. Hefei, 22.05.2006-26.05. 2006] R&D Projects: GA ČR GP202/03/P062 Institutional research plan: CEZ:AV0Z20430508 Keywords : Cross-field transport * Edge plasma * Plasma flow * Tore Supra Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.643, year: 2007

  8. Monitoring and characterization of radionuclide transport in the hydrogeologic system

    International Nuclear Information System (INIS)

    Phillips, S.J.; Raymond, J.R.

    1975-01-01

    The groundwater monitoring program provides information and data on groundwater quality required to evaluate the impact of waste disposal practices on the Hanford Reservation. The program includes: collection and analysis of groundwater samples on a routine basis; data processing, analysis and reporting; design, construction and maintenance of well sampling structures; and design and implementation of supporting research studies. Within the overall framework of the Groundwater Monitoring Program, the 300 Area and Wye Burial Ground Characterization Program was initiated to evaluate transport of radionuclides in the partially saturated zone above the water table and to provide site characterization at solid waste burial locations on the Reservation. Methods for collecting and analyzing program data include geophysical exploration by ground penetrating radar, refraction and reflection acoustics, magnetics, and metal detection; stratigraphic investigations by drilling and sample collection techniques; evaluation of transport phenomena by in situ psychrometric and gamma-neutron techniques; laboratory characterization of fluid and vapor transport-controlling mechanisms; and evaluation of biological radionuclide transport by organisms inhabiting contaminated areas

  9. Spiral phase plates with radial discontinuities for the generation of multiring orbital angular momentum beams: fabrication, characterization, and application

    Science.gov (United States)

    Ruffato, Gianluca; Massari, Michele; Carli, Marta; Romanato, Filippo

    2015-11-01

    A design of spiral phase plates for the generation of multiring beams carrying orbital angular momentum (OAM) is presented. Besides the usual helical profile, these phase plates present radial π-discontinuities in correspondence of the zeros of the associated Laguerre polynomials. Samples were fabricated by electron beam lithography over glass substrates coated with a polymethylmethacrylate resist layer. The optical response was analyzed and the purity of the generated beams was investigated in terms of Laguerre-Gaussian modes contributions. The far-field intensity pattern was compared with theoretical models and numerical simulations, while the expected phase features were confirmed by interferometric analysis with a Mach-Zehnder setup. The high quality of the output beams confirms the applicability of these phase plates for the generation of high-order OAM beams with nonzero radial index. An application consisting of the design of computer-generated holograms encoding information for light beams carrying phase singularities is presented and described. A numerical code based on an iterative Fourier transform algorithm has been developed for the computation of phase-only diffractive optical element for illumination under OAM beams. Numerical analysis and preliminary experimental results confirm the applicability of these devices as high-security optical elements for anticounterfeiting applications.

  10. Optical characterization of InAs quantum wells and dots grown radially on wurtzite InP nanowires

    International Nuclear Information System (INIS)

    Lindgren, David; Kawaguchi, Kenichi; Heurlin, Magnus; Borgström, Magnus T; Pistol, Mats-Erik; Samuelson, Lars; Gustafsson, Anders

    2013-01-01

    Correlated micro-photoluminescence (μPL) and cathodoluminescence (CL) measurements are reported for single core–shell InP–InAs wurtzite nanowires grown using metal–organic vapor phase epitaxy. Samples covering a radial InAs shell thickness of 1–12 ML were investigated. The effective masses for the wurtzite material were determined from the transition energy dependence of the InAs shell thickness, using a model based on linear deformation potential theory. InP cores with segments of mixed zincblende and wurtzite, on which quantum dots nucleated selectively, were also investigated. Narrow peaks were observed by μPL and the spatial origin of the emission was identified with CL imaging. (paper)

  11. Conjunction of radial basis function interpolator and artificial intelligence models for time-space modeling of contaminant transport in porous media

    Science.gov (United States)

    Nourani, Vahid; Mousavi, Shahram; Dabrowska, Dominika; Sadikoglu, Fahreddin

    2017-05-01

    As an innovation, both black box and physical-based models were incorporated into simulating groundwater flow and contaminant transport. Time series of groundwater level (GL) and chloride concentration (CC) observed at different piezometers of study plain were firstly de-noised by the wavelet-based de-noising approach. The effect of de-noised data on the performance of artificial neural network (ANN) and adaptive neuro-fuzzy inference system (ANFIS) was evaluated. Wavelet transform coherence was employed for spatial clustering of piezometers. Then for each cluster, ANN and ANFIS models were trained to predict GL and CC values. Finally, considering the predicted water heads of piezometers as interior conditions, the radial basis function as a meshless method which solves partial differential equations of GFCT, was used to estimate GL and CC values at any point within the plain where there is not any piezometer. Results indicated that efficiency of ANFIS based spatiotemporal model was more than ANN based model up to 13%.

  12. Workplace characterizations in case of rail transport of radioactive materials

    International Nuclear Information System (INIS)

    Donadille, L.; Itie, C.; Lahaye, T.; Muller, H.; Bottolier-Depois, J.F.

    2005-01-01

    Full text: Radioactive fuel and wastes are frequently transported for storage and/or reprocessing purposes. The main part of this transport is generally done by train. Before, during and after the journey, operators and drivers, who work directly in contact with and in the vicinity of the wagons, are exposed to external irradiations due to the radioactive materials that are confined inside the containers. In order to evaluate the dose that its personnel is liable to receive during such transports, the French National Railway Company (SNCF) has requested to the Institute of Radiological Protection and Nuclear Safety (IRSN) a series of workplaces characterizations for convoys of different types, that are considered to be representative of all types of possible transports. Each one is associated to a given radioactive material (low and medium activity wastes, new and used fuel, MOX, uranium fluoride, etc... ), involving photon or mixed neutron-photon fields. This measurement campaign has started in May 2004 and by the end of 2004 at least four types of radioactive convoys will have been investigated (three have already been measured). By using survey meters and spectrometers, the study consists in measuring the external exposure for different stages of the work that is done beside the wagons (for example coupling / decoupling two wagons, or checking the brakes) and inside the locomotive (driving). For each one of these workplaces, the exposure is estimated in terms of the ambient dose equivalent H*(10) by summing the dose all along the different phases carried out by the operator. In addition, a dosimetric characterization of each convoy is made by performing measurements along the wagons and spectrometric information about the photon and/or neutron fields are collected. This study provides helpful data to predict the dose that the operators are liable to integrate over long periods, typically one year. (author)

  13. The Kepler-19 System: A Thick-envelope Super-Earth with Two Neptune-mass Companions Characterized Using Radial Velocities and Transit Timing Variations

    Energy Technology Data Exchange (ETDEWEB)

    Malavolta, Luca; Borsato, Luca; Granata, Valentina; Piotto, Giampaolo; Nascimbeni, Valerio [Dipartimento di Fisica e Astronomia “Galileo Galilei”, Universita’di Padova, Vicolo dell’Osservatorio 3, I-35122 Padova (Italy); Lopez, Eric [SUPA, Institute for Astronomy, University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh, EH93HJ (United Kingdom); Vanderburg, Andrew; Charbonneau, David [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, Massachusetts 02138 (United States); Figueira, Pedro [Instituto de Astrofísica e Ciências do Espaço, Universidade do Porto, CAUP, Rua das Estrelas, PT4150-762 Porto (Portugal); Mortier, Annelies; Cameron, Andrew Collier [Centre for Exoplanet Science, SUPA, School of Physics and Astronomy, University of St. Andrews, St. Andrews KY16 9SS (United Kingdom); Affer, Laura [INAF—Osservatorio Astronomico di Palermo, Piazza del Parlamento 1, I-90124 Palermo (Italy); Bonomo, Aldo S. [INAF—Osservatorio Astrofisico di Torino, via Osservatorio 20, I-10025 Pino Torinese (Italy); Bouchy, Francois [Observatoire Astronomique de l’Université de Genève, 51 ch. des Maillettes, 1290 Versoix (Switzerland); Buchhave, Lars A. [Centre for Star and Planet Formation, Natural History Museum of Denmark and Niels Bohr Institute, University of Copenhagen, Øster Voldgade 5-7, DK-1350 Copenhagen K (Denmark); Cosentino, Rosario, E-mail: luca.malavolta@unipd.it [INAF—Fundación Galileo Galilei, Rambla José Ana Fernandez Pérez 7, E-38712 Breña Baja (Spain); and others

    2017-05-01

    We report a detailed characterization of the Kepler-19 system. This star was previously known to host a transiting planet with a period of 9.29 days, a radius of 2.2 R {sub ⊕}, and an upper limit on the mass of 20 M {sub ⊕}. The presence of a second, non-transiting planet was inferred from the transit time variations (TTVs) of Kepler-19b over eight quarters of Kepler photometry, although neither the mass nor period could be determined. By combining new TTVs measurements from all the Kepler quarters and 91 high-precision radial velocities obtained with the HARPS-N spectrograph, using dynamical simulations we obtained a mass of 8.4 ± 1.6 M {sub ⊕} for Kepler-19b. From the same data, assuming system coplanarity, we determined an orbital period of 28.7 days and a mass of 13.1 ± 2.7 M {sub ⊕} for Kepler-19c and discovered a Neptune-like planet with a mass of 20.3 ± 3.4 M {sub ⊕} on a 63-day orbit. By comparing dynamical simulations with non-interacting Keplerian orbits, we concluded that neglecting interactions between planets may lead to systematic errors that can hamper the precision in the orbital parameters when the data set spans several years. With a density of 4.32 ± 0.87 g cm{sup −3} (0.78 ± 0.16 ρ {sub ⊕}) Kepler-19b belongs to the group of planets with a rocky core and a significant fraction of volatiles, in opposition to low-density planets characterized only by transit time variations and an increasing number of rocky planets with Earth-like density. Kepler-19 joins the small number of systems that reconcile transit timing variation and radial velocity measurements.

  14. Characterization of HR coatings for the megajoule laser transport mirrors

    International Nuclear Information System (INIS)

    Fornier, A.; Cordillot, C.; Bernardino, D.; Lam, O.; Roussel, A.

    1997-01-01

    One of the concerns with the Megajoule Laser design is the laser-induced damage threshold of the transport mirrors. Earlier studies have shown that the main constraint on the laser damage threshold comes from nodules at the mirror surface. It is therefore important to restrict the number of such nodules. SFIM-ODS, in close collaboration with CEL-V, has initiated a special study to characterize these nodules as precisely as possible. The objective of the study is twofold: (1) to determine the origin of the nodules and subsequently to adapt the mirror fabrication process in order to limit their formation, (2) to analyze their shapes and dimensions in order to ascertain which nodules are critical for laser-induced damage. To understand the origin of the nodules and their effect on the laser damage threshold, the mirrors are characterized using various methods, (3) absorption and scatter mapping: does the presence of nodules result in specific absorption patterns? (4) surface analysis by atomic force microscopy: to characterize nodule shape and dimensions, (5) Focused Ion Beam (FIB) cutting of nodules: to locate the seed initiating the nodule (on the substrate or in the stack), and to characterize the seed shape and composition (contamination, material spatter during evaporation, etc.), and (6) laser damage threshold measurements: to determine the laser damage threshold of the mirror and study the behavior of nodules under laser irradiation depending on their dimensions and shape

  15. Radial nerve dysfunction

    Science.gov (United States)

    Neuropathy - radial nerve; Radial nerve palsy; Mononeuropathy ... Damage to one nerve group, such as the radial nerve, is called mononeuropathy . Mononeuropathy means there is damage to a single nerve. Both ...

  16. The riboflavin transporter RibU in Lactococcus lactis : Molecular characterization of gene expression and the transport mechanism

    NARCIS (Netherlands)

    Burgess, CM; Slotboom, DJ; Geertsma, ER; Duurkens, Hinderika; Poolman, B; van Sinderen, D

    This study describes the characterization of the riboflavin transport protein RibU in the lactic acid bacterium Lactococcus lactis subsp. cremoris NZ9000. RibU is predicted to contain five membrane-spanning segments and is a member of a novel transport protein family, not described in the Transport

  17. Radial Field Piezoelectric Diaphragms

    Science.gov (United States)

    Bryant, R. G.; Effinger, R. T., IV; Copeland, B. M., Jr.

    2002-01-01

    A series of active piezoelectric diaphragms were fabricated and patterned with several geometrically defined Inter-Circulating Electrodes "ICE" and Interdigitated Ring Electrodes "ICE". When a voltage potential is applied to the electrodes, the result is a radially distributed electric field that mechanically strains the piezoceramic along the Z-axis (perpendicular to the applied electric field). Unlike other piezoelectric bender actuators, these Radial Field Diaphragms (RFDs) strain concentrically yet afford high displacements (several times that of the equivalent Unimorph) while maintaining a constant circumference. One of the more intriguing aspects is that the radial strain field reverses itself along the radius of the RFD while the tangential strain remains relatively constant. The result is a Z-deflection that has a conical profile. This paper covers the fabrication and characterization of the 5 cm. (2 in.) diaphragms as a function of poling field strength, ceramic thickness, electrode type and line spacing, as well as the surface topography, the resulting strain field and displacement as a function of applied voltage at low frequencies. The unique features of these RFDs include the ability to be clamped about their perimeter with little or no change in displacement, the environmentally insulated packaging, and a highly repeatable fabrication process that uses commodity materials.

  18. The effect of modafinil on the rat dopamine transporter and dopamine receptors D1-D3 paralleling cognitive enhancement in the radial arm maze

    Directory of Open Access Journals (Sweden)

    Yasemin eKarabacak

    2015-08-01

    Full Text Available A series of drugs have been reported to increase memory performance modulating the dopaminergic system and herein modafinil was tested for its working memory (WM enhancing properties. Reuptake inhibition of dopamine, serotonin (SERT and norepinephrine (NET by modafinil was tested. 60 male Sprague Dawley rats were divided into six groups (modafinil-treated 1-5-10 mg/kg body weight, trained and untrained and vehicle treated trained and untrained rats; daily injected intraperitoneally for a period of 10 days and tested in a radial arm maze (RAM, a paradigm for testing spatial WM. Hippocampi were taken six hours following the last day of training and complexes containing the unphosphorylated or phosphorylated dopamine transporter (DAT-CC and pDAT-CC and complexes containing the D1-3 dopamine receptor subunits (D1-D3-CC were determined. Modafinil was binding to the DAT but insignificantly to SERT or NET and dopamine reuptake was blocked specifically (IC50=11.11; SERT 1547; NET 182. From day 8 (day 9 for 1 mg/kg body weight modafinil was decreasing WM errors in the RAM significantly and remarkably at all doses tested as compared to the vehicle controls. WMEs were linked to the D2R-CC and the pDAT-CC. pDAT and D1-D3-CC levels were modulated significantly and modafinil was shown to enhance spatial WM in the rat in a well-documented paradigm at all the three doses and dopamine reuptake inhibition with subsequent modulation of D1-3-CC is proposed as a possible mechanism of action.

  19. Development of a Radial Deconsolidation Method

    Energy Technology Data Exchange (ETDEWEB)

    Helmreich, Grant W. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Montgomery, Fred C. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Hunn, John D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2015-12-01

    A series of experiments have been initiated to determine the retention or mobility of fission products* in AGR fuel compacts [Petti, et al. 2010]. This information is needed to refine fission product transport models. The AGR-3/4 irradiation test involved half-inch-long compacts that each contained twenty designed-to-fail (DTF) particles, with 20-μm thick carbon-coated kernels whose coatings were deliberately fabricated such that they would crack under irradiation, providing a known source of post-irradiation isotopes. The DTF particles in these compacts were axially distributed along the compact centerline so that the diffusion of fission products released from the DTF kernels would be radially symmetric [Hunn, et al. 2012; Hunn et al. 2011; Kercher, et al. 2011; Hunn, et al. 2007]. Compacts containing DTF particles were irradiated at Idaho National Laboratory (INL) at the Advanced Test Reactor (ATR) [Collin, 2015]. Analysis of the diffusion of these various post-irradiation isotopes through the compact requires a method to radially deconsolidate the compacts so that nested-annular volumes may be analyzed for post-irradiation isotope inventory in the compact matrix, TRISO outer pyrolytic carbon (OPyC), and DTF kernels. An effective radial deconsolidation method and apparatus appropriate to this application has been developed and parametrically characterized.

  20. Monitoring and characterization of radionuclide transport in the hydrogeologic system

    International Nuclear Information System (INIS)

    Phillips, S.J.; Raymond, J.R.

    1975-01-01

    Historical records pertaining to the 300 North and Wye Burial Grounds at the Hanford Reservation were reviewed as a prerequisite to determining programs for land reclamation. All available historical documents, agency communications, and engineering drawings related to the study areas were located, reviewed, and analyzed. An inventory of recorded location, type, and quantity of radionuclides and associated materials in each burial ground was completed and distributed to cooperating investigators. A geophysical survey of the 300 North Burial Ground was conducted as a basis for detecting the composition, size, distribution, and depth of buried objects and characterizing the sediments in which they are buried. Acoustic, radar, magnetic, and metal detection surveys were completed and their applicability evaluated; drilling techniques and equipment for recovering and characterizing sediments and radioactive contaminated material were developed. Drilling will also determine the amount and dimensional extent of radionuclide migration; sediment-fluid interaction and fluid migration through the unsaturated zone at the 300 North Burial Ground were characterized. A study to determine biological transport of radionuclides at the Wye Burial Ground was also initiated. This study involved a preliminary survey of present flora and fauna inhabiting the Wye Burial Ground site. Plant tissue was chemically and radiochemically analyzed to determine radionuclide migration and possible dose effects and population dynamics of burrowing animals that could potentially be exposed to buried waste materials were investigated

  1. Functional expression and characterization of plant ABC transporters in Xenopus laevis oocytes for transport engineering purposes

    DEFF Research Database (Denmark)

    Xu, Deyang; Veres, Dorottya; Belew, Zeinu Mussa

    2016-01-01

    the question whether the oocytes system is suitable to express and characterize ABC transporters. Thus we have selected AtABCG25, previously characterized in insect cells as the exporter of commercially valuable abscisic acid—as case study for optimizing of characterization in Xenopus oocytes. The tools...

  2. Synthesis, characterization and field evaluation of a new calcium-based CO2 absorbent for radial diffusive sampler

    Science.gov (United States)

    Cucciniello, Raffaele; Proto, Antonio; Alfano, Davide; Motta, Oriana

    2012-12-01

    In this paper the use of passive sampling as a powerful approach to monitor atmospheric CO2 is assessed. Suitable substrate based on calcium-aluminium oxide was synthetized according to a process which permits to control the particle size of the CaO/Al based sorbent. The study shows that hydration of substrate is an essential part of the process of CO2 absorption and subsequent conversion to carbonate. X-ray diffraction, thermogravimetric analysis, environmental scanning electron microscopic analysis were used in order to characterize the substrate and to establish the best performances both in terms of particle size and CO2 absorption capacity. Passive samplers for CO2 monitoring were prepared and then tested at laboratory level and in the atmospheric environment. Validation was performed by comparison with an infrared continuous detector. Thermogravimetric analysis results, carried out to evaluate the absorbing capability of this new passive device, were in accordance with data collected at the same time by the active continuous analyser. The diffusive sampling rate and the diffusion coefficient of CO2 respect to this new passive device were also evaluated resulting equal to 47 ± 3 ml min-1 and 0.0509 ± 0.005 cm2 s-1, respectively.

  3. Advances in methods for identification and characterization of plant transporter function

    DEFF Research Database (Denmark)

    Larsen, Bo; Xu, Deyang; Halkier, Barbara Ann

    2017-01-01

    Transport proteins are crucial for cellular function at all levels. Numerous importers and exporters facilitate transport of a diverse array of metabolites and ions intra- and intercellularly. Identification of transporter function is essential for understanding biological processes at both......-based approaches. In this review, we highlight examples that illustrate how new technology and tools have advanced identification and characterization of plant transporter functions....

  4. Radial flow heat exchanger

    Science.gov (United States)

    Valenzuela, Javier

    2001-01-01

    A radial flow heat exchanger (20) having a plurality of first passages (24) for transporting a first fluid (25) and a plurality of second passages (26) for transporting a second fluid (27). The first and second passages are arranged in stacked, alternating relationship, are separated from one another by relatively thin plates (30) and (32), and surround a central axis (22). The thickness of the first and second passages are selected so that the first and second fluids, respectively, are transported with laminar flow through the passages. To enhance thermal energy transfer between first and second passages, the latter are arranged so each first passage is in thermal communication with an associated second passage along substantially its entire length, and vice versa with respect to the second passages. The heat exchangers may be stacked to achieve a modular heat exchange assembly (300). Certain heat exchangers in the assembly may be designed slightly differently than other heat exchangers to address changes in fluid properties during transport through the heat exchanger, so as to enhance overall thermal effectiveness of the assembly.

  5. FRACTEX: an experiment aiming at characterizing the transport properties of a secondary fault

    International Nuclear Information System (INIS)

    Wittebroodt, C.; Matray, J.M.; Dick, P.; Cabrera, J.; Barnichon, J.D.

    2012-01-01

    damaged, disturbed and undisturbed argillite. Additional laboratory hydraulic tests will be carried out on argillite samples selected to represent the different states of the argillaceous rock. To complete this hydraulic characterization, radial and through diffusion experiments of artificial water (HTO), anionic ( 36 Cl - ) and cationic ( 22 Na + ) radiotracers are also planned. Thus, the comparison between the time required to propagate a perturbation by advection and the diffusive transport time will permit to assess the relative significance of advective and diffusive transport for the different states of the rock (damaged, disturbed and undisturbed argillite). Finally, FRACTEX experiment will also give us the opportunity to acquire a horizontal profile of natural tracers ( 2 H, 18 O, Cl - ) and noble gas ( 4 He) distribution in the pore water. These data will be obtained by means of equilibration methods (vapour-exchange and radial diffusion experiments). Emplacement of this FRACTEX experiment will start September 2012. Data obtain within this project will allow to supply the numerical simulation tools databases. (authors)

  6. Chancellor Water Colloids: Characterization and Radionuclide Associated Transport

    Energy Technology Data Exchange (ETDEWEB)

    Reimus, Paul William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Boukhalfa, Hakim [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-09-26

    Column transport experiments were conducted in which water from the Chancellor nuclear test cavity was transported through crushed volcanic tuff from Pahute Mesa. In one experiment, the cavity water was spiked with solute 137Cs, and in another it was spiked with 239/240Pu(IV) nanocolloids. A third column experiment was conducted with no radionuclide spike at all, although the 137Cs concentrations in the water were still high enough to quantify in the column effluent. The radionuclides strongly partitioned to natural colloids present in the water, which were characterized for size distribution, mass concentration, zeta potential/surface charge, critical coagulation concentration, and qualitative mineralogy. In the spiked water experiments, the unanalyzed portion of the high-concentration column effluent samples were combined and re-injected into the respective columns as a second pulse. This procedure was repeated again for a third injection. Measurable filtration of the colloids was observed after each initial injection of the Chancellor water into the columns, but the subsequent injections (spiked water experiments only) exhibited no apparent filtration, suggesting that the colloids that remained mobile after relatively short transport distances were more resistant to filtration than the initial population of colloids. It was also observed that while significant desorption of 137Cs from the colloids occurred after the first injection in both the spiked and unspiked waters, subsequent injections of the spiked water exhibited much less 137Cs desorption (much greater 137Cs colloid-associated transport). This result suggests that the 137Cs that remained associated with colloids during the first injection represented a fraction that was more strongly adsorbed to the mobile colloids than the initial 137Cs associated with the colloids. A greater amount of the 239/240

  7. Characterization of Nanoscale Gas Transport in Shale Formations

    Science.gov (United States)

    Chai, D.; Li, X.

    2017-12-01

    Non-Darcy flow behavior can be commonly observed in nano-sized pores of matrix. Most existing gas flow models characterize non-Darcy flow by empirical or semi-empirical methods without considering the real gas effect. In this paper, a novel layered model with physical meanings is proposed for both ideal and real gas transports in nanopores. It can be further coupled with hydraulic fracturing models and consequently benefit the storage evaluation and production prediction for shale gas recovery. It is hypothesized that a nanotube can be divided into a central circular zone where the viscous flow behavior mainly exists due to dominant intermolecular collisions and an outer annular zone where the Knudsen diffusion mainly exists because of dominant collisions between molecules and the wall. The flux is derived based on integration of two zones by applying the virtual boundary. Subsequently, the model is modified by incorporating slip effect, real gas effect, porosity distribution, and tortuosity. Meanwhile, a multi-objective optimization method (MOP) is applied to assist the validation of analytical model to search fitting parameters which are highly localized and contain significant uncertainties. The apparent permeability is finally derived and analyzed with various impact factors. The developed nanoscale gas transport model is well validated by the flux data collected from both laboratory experiments and molecular simulations over the entire spectrum of flow regimes. It has a decrease of as much as 43.8% in total molar flux when the real gas effect is considered in the model. Such an effect is found to be more significant as pore size shrinks. Knudsen diffusion accounts for more than 60% of the total gas flux when pressure is lower than 0.2 MPa and pore size is smaller than 50 nm. Overall, the apparent permeability is found to decrease with pressure, though it rarely changes when pressure is higher than 5.0 MPa and pore size is larger than 50 nm.

  8. Radial transport in the far scrape-off layer of ASDEX upgrade during L-mode and ELMy H-mode

    DEFF Research Database (Denmark)

    Ionita, C.; Naulin, Volker; Mehlmann, F.

    2013-01-01

    The radial turbulent particle flux and the Reynolds stress in the scrape-off layer (SOL) of ASDEX Upgrade were investigated for two limited L-mode (low confinement) and one ELMy H-mode (high confinement) discharge. A fast reciprocating probe was used with a probe head containing five Langmuir...

  9. Characterization of ion heat conduction in JET and ASDEX Upgrade plasmas with and without internal transport barriers

    Energy Technology Data Exchange (ETDEWEB)

    Wolf, R C [Institut fuer Plasmaphysik, Forschungszentrum Juelich, Association EURATOM/FZJ, Trilateral Euregio Cluster, D-52425 Juelich (Germany); Baranov, Y [UKAEA/EURATOM Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Garbet, X [Association EURATOM-CEA sur la fusion, CEA Cadarache, F-13108 St Paul lez Durance (France); Hawkes, N [UKAEA/EURATOM Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Peeters, A G [Max-Planck-Institut fuer Plasmaphysik, EURATOM-Assoziation, D-85748 Garching (Germany); Challis, C [UKAEA/EURATOM Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Baar, M de [FOM Instituut voor Plasmafyisica Rijnhuizen, Association EURATO-FOM, Trilateral Euregio Cluster, PO Box 1207, 3430 BE Nieuwegein (Netherlands); Giroud, C [FOM Instituut voor Plasmafyisica Rijnhuizen, Association EURATO-FOM, Trilateral Euregio Cluster, PO Box 1207, 3430 BE Nieuwegein (Netherlands); Joffrin, E [Association EURATOM-CEA sur la fusion, CEA Cadarache, F-13108 St Paul lez Durance (France); Mantsinen, M [Helsinki University of Technology, Association-EURATOM Tekes, FIN-02015 HUT (Finland); Mazon, D [Association EURATOM-CEA sur la fusion, CEA Cadarache, F-13108 St Paul lez Durance (France); Meister, H [Max-Planck-Institut fuer Plasmaphysik, EURATOM-Assoziation, D-85748 Garching (Germany); Suttrop, W [Max-Planck-Institut fuer Plasmaphysik, EURATOM-Assoziation, D-85748 Garching (Germany); Zastrow, K-D [UKAEA/EURATOM Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom)

    2003-09-01

    In ASDEX Upgrade and JET, the ion temperature profiles can be described by R/L{sub Ti} which exhibits only little variations, both locally, when comparing different discharges, and radially over a wide range of the poloidal cross-section. Considering a change of the local ion heat flux of more than a factor of two, this behaviour indicates some degree of profile stiffness. In JET, covering a large ion temperature range from 1 to 25 keV, the normalized ion temperature gradient, R/L{sub Ti}, shows a dependence on the electron to ion temperature ratio or toroidal rotational shear. In particular, in hot ion plasmas, produced predominantly by neutral beam heating at low densities, in which large T{sub i}/T{sub e} is coupled to strong toroidal rotation, the effect of the two quantities cannot be distinguished. Both in ASDEX Upgrade and JET, plasmas with internal transport barriers (ITBs), including the PEP mode in JET, are characterized by a significant increase of R/L{sub Ti} above the value of L- and H-mode plasmas. In agreement with previous ASDEX Upgrade results, no increase of the ion heat transport in reversed magnetic shear ITB plasmas is found in JET when raising the electron heating. Evidence is presented that magnetic shear directly influences R/L{sub Ti}, namely decreasing the ion heat transport when going from weakly positive to negative magnetic shear.

  10. Phloem as Capacitor: Radial Transfer of Water into Xylem of Tree Stems Occurs via Symplastic Transport in Ray Parenchyma[OPEN

    Science.gov (United States)

    Renard, Justine; Tjoelker, Mark G.; Salih, Anya

    2015-01-01

    The transfer of water from phloem into xylem is thought to mitigate increasing hydraulic tension in the vascular system of trees during the diel cycle of transpiration. Although a putative plant function, to date there is no direct evidence of such water transfer or the contributing pathways. Here, we trace the radial flow of water from the phloem into the xylem and investigate its diel variation. Introducing a fluorescent dye (0.1% [w/w] fluorescein) into the phloem water of the tree species Eucalyptus saligna allowed localization of the dye in phloem and xylem tissues using confocal laser scanning microscopy. Our results show that the majority of water transferred between the two tissues is facilitated via the symplast of horizontal ray parenchyma cells. The method also permitted assessment of the radial transfer of water during the diel cycle, where changes in water potential gradients between phloem and xylem determine the extent and direction of radial transfer. When injected during the morning, when xylem water potential rapidly declined, fluorescein was translocated, on average, farther into mature xylem (447 ± 188 µm) compared with nighttime, when xylem water potential was close to zero (155 ± 42 µm). These findings provide empirical evidence to support theoretical predictions of the role of phloem-xylem water transfer in the hydraulic functioning of plants. This method enables investigation of the role of phloem tissue as a dynamic capacitor for water storage and transfer and its contribution toward the maintenance of the functional integrity of xylem in trees. PMID:25588734

  11. Using heterologous expression systems to characterize potassium and sodium transport activities.

    Science.gov (United States)

    Rodríguez, Alonso; Benito, Begoña; Cagnac, Olivier

    2012-01-01

    The expression of plant transporters in simple well-characterized cell systems is an irreplaceable technique for gaining insights into the kinetic and energetic features of plant transporters. Among all the available expression systems, yeast cells offer the highest simplicity and have the capacity to mimic the in vivo properties of plant transporters. Here, we describe the use of yeast mutants to express K(+) and Na(+) plant transporters and discuss some experimental problems that can produce misleading results.

  12. Molecular cloning, expression and characterization of a bovine serotonin transporter

    DEFF Research Database (Denmark)

    Mortensen, O V; Kristensen, A S; Rudnick, G

    1999-01-01

    The serotonin transporter (SERT) is a member of a highly homologous family of sodium/chloride dependent neurotransmitter transporters responsible for reuptake of biogenic amines from the extracellular fluid. SERT constitutes the pharmacological target of several clinically important antidepressan......-methylenedioxymethamphetamine (MDMA) was mainly unchanged. RT-PCR amplification of RNA from different tissues demonstrated expression of SERT in placenta, brain stem, bone marrow, kidney, lung, heart, adrenal gland, liver, parathyroid gland, thyroid gland, small intestine and pancreas....

  13. Physical mechanism determining the radial electric field and its radial structure in a toroidal plasma

    International Nuclear Information System (INIS)

    Ida, Katsumi; Miura, Yukitoshi; Itoh, Sanae

    1994-10-01

    Radial structures of plasma rotation and radial electric field are experimentally studied in tokamak, heliotron/torsatron and stellarator devices. The perpendicular and parallel viscosities are measured. The parallel viscosity, which is dominant in determining the toroidal velocity in heliotron/torsatron and stellarator devices, is found to be neoclassical. On the other hand, the perpendicular viscosity, which is dominant in dictating the toroidal rotation in tokamaks, is anomalous. Even without external momentum input, both a plasma rotation and a radial electric field exist in tokamaks and heliotrons/torsatrons. The observed profiles of the radial electric field do not agree with the theoretical prediction based on neoclassical transport. This is mainly due to the existence of anomalous perpendicular viscosity. The shear of the radial electric field improves particle and heat transport both in bulk and edge plasma regimes of tokamaks. (author) 95 refs

  14. Radial electric fields for improved tokamak performance

    International Nuclear Information System (INIS)

    Downum, W.B.

    1981-01-01

    The influence of externally-imposed radial electric fields on the fusion energy output, energy multiplication, and alpha-particle ash build-up in a TFTR-sized, fusing tokamak plasma is explored. In an idealized tokamak plasma, an externally-imposed radial electric field leads to plasma rotation, but no charge current flows across the magnetic fields. However, a realistically-low neutral density profile generates a non-zero cross-field conductivity and the species dependence of this conductivity allows the electric field to selectively alter radial particle transport

  15. Market Assessment and Commercialization Strategy for the Radial Sandia Cooler

    Energy Technology Data Exchange (ETDEWEB)

    Goetzler, William [Navigant Consulting, Inc., Burlington, MA (United States); Shandross, Richard [Navigant Consulting, Inc., Burlington, MA (United States); Weintraub, Daniel [Navigant Consulting, Inc., Burlington, MA (United States); Young, Jim [Navigant Consulting, Inc., Burlington, MA (United States)

    2014-02-01

    This market assessment and commercialization report characterizes and assesses the market potential of the rotating heat exchanger technology developed at Sandia National Laboratories (SNL), known as the Radial Sandia Cooler. The RSC is a novel, motor-driven, rotating, finned heat exchanger technology. The RSC was evaluated for the residential, commercial, industrial, and transportation markets. Recommendations for commercialization were made based on assessments of the prototype RSC and the Sandia Cooler technology in general, as well as an in-depth analysis of the six most promising products for initial RSC commercialization.

  16. Characterization and scaling of the tokamak edge transport barrier

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, Philip Adrian

    2012-04-24

    The high confinement regime (H-mode) in a tokamak plasma displays a remarkable edge region. On a small spatial scale of 1-2 cm the properties of the plasma change significantly. Certain parameters vary 1-2 orders of magnitude in this region, called the pedestal. Currently, there is no complete understanding of how the pedestal forms or how it is sustained. The goal of this thesis is to contribute to the theoretical understanding of the pedestal and provide scalings towards larger machines, like ITER and DEMO. A pedestal database was built with data from different tokamaks: ASDEX Upgrade, DIIID and JET. The pedestal was characterized with the same method for all three machines. This gives the maximum value, gradient and width of the pedestal in n{sub e}, T{sub e} and T{sub i}. These quantities were analysed along with quantities derived from them, such as the pressure or the confinement time. For this purpose two parameter sets were used: normalized parameters (pressure {beta}, time {nu}{sub *}, length {rho}{sub *}, shape f{sub q}) and machine parameters (size a, magnetic field B{sub t}, plasma current I{sub p}, heating P). All results are dependent on the choice of the coordinate system: normalized poloidal flux {Psi}{sub N} and real space r/a. The most significant result, which was obtained with both parameter sets, shows a different scaling of the pedestal width for the electron temperature and the electron density. The presented scalings predict that in ITER and DEMO the temperature pedestal will be appreciably wider than the density pedestal. The pedestal top scaling for the pressure reveals differences between the electron and the ion pressure. In extrapolations this results in values for T{sub e,ped} of 4 keV (ITER) and 10 keV (DEMO), but significantly lower values for the ion temperature. A two-term method was applied to use the pedestal pressure to determine the pedestal contribution to the global confinement time {tau}{sub E}. The dependencies in the

  17. Characterization and scaling of the tokamak edge transport barrier

    International Nuclear Information System (INIS)

    Schneider, Philip Adrian

    2012-01-01

    The high confinement regime (H-mode) in a tokamak plasma displays a remarkable edge region. On a small spatial scale of 1-2 cm the properties of the plasma change significantly. Certain parameters vary 1-2 orders of magnitude in this region, called the pedestal. Currently, there is no complete understanding of how the pedestal forms or how it is sustained. The goal of this thesis is to contribute to the theoretical understanding of the pedestal and provide scalings towards larger machines, like ITER and DEMO. A pedestal database was built with data from different tokamaks: ASDEX Upgrade, DIIID and JET. The pedestal was characterized with the same method for all three machines. This gives the maximum value, gradient and width of the pedestal in n e , T e and T i . These quantities were analysed along with quantities derived from them, such as the pressure or the confinement time. For this purpose two parameter sets were used: normalized parameters (pressure β, time ν * , length ρ * , shape f q ) and machine parameters (size a, magnetic field B t , plasma current I p , heating P). All results are dependent on the choice of the coordinate system: normalized poloidal flux Ψ N and real space r/a. The most significant result, which was obtained with both parameter sets, shows a different scaling of the pedestal width for the electron temperature and the electron density. The presented scalings predict that in ITER and DEMO the temperature pedestal will be appreciably wider than the density pedestal. The pedestal top scaling for the pressure reveals differences between the electron and the ion pressure. In extrapolations this results in values for T e,ped of 4 keV (ITER) and 10 keV (DEMO), but significantly lower values for the ion temperature. A two-term method was applied to use the pedestal pressure to determine the pedestal contribution to the global confinement time τ E . The dependencies in the scaling for τ E,ped are nearly identical to the IPB98 global

  18. Yucca Mountain transportation routes: Preliminary characterization and risk analysis

    International Nuclear Information System (INIS)

    Souleyrette, R.R. II; Sathisan, S.K.; di Bartolo, R.

    1991-01-01

    This report presents appendices related to the preliminary assessment and risk analysis for high-level radioactive waste transportation routes to the proposed Yucca Mountain Project repository. Information includes data on population density, traffic volume, ecologically sensitive areas, and accident history

  19. Prediction of FAD binding sites in electron transport proteins according to efficient radial basis function networks and significant amino acid pairs.

    Science.gov (United States)

    Le, Nguyen-Quoc-Khanh; Ou, Yu-Yen

    2016-07-30

    Cellular respiration is a catabolic pathway for producing adenosine triphosphate (ATP) and is the most efficient process through which cells harvest energy from consumed food. When cells undergo cellular respiration, they require a pathway to keep and transfer electrons (i.e., the electron transport chain). Due to oxidation-reduction reactions, the electron transport chain produces a transmembrane proton electrochemical gradient. In case protons flow back through this membrane, this mechanical energy is converted into chemical energy by ATP synthase. The convert process is involved in producing ATP which provides energy in a lot of cellular processes. In the electron transport chain process, flavin adenine dinucleotide (FAD) is one of the most vital molecules for carrying and transferring electrons. Therefore, predicting FAD binding sites in the electron transport chain is vital for helping biologists understand the electron transport chain process and energy production in cells. We used an independent data set to evaluate the performance of the proposed method, which had an accuracy of 69.84 %. We compared the performance of the proposed method in analyzing two newly discovered electron transport protein sequences with that of the general FAD binding predictor presented by Mishra and Raghava and determined that the accuracy of the proposed method improved by 9-45 % and its Matthew's correlation coefficient was 0.14-0.5. Furthermore, the proposed method enabled reducing the number of false positives significantly and can provide useful information for biologists. We developed a method that is based on PSSM profiles and SAAPs for identifying FAD binding sites in newly discovered electron transport protein sequences. This approach achieved a significant improvement after we added SAAPs to PSSM features to analyze FAD binding proteins in the electron transport chain. The proposed method can serve as an effective tool for predicting FAD binding sites in electron

  20. Radial pattern of nuclear decay processes

    International Nuclear Information System (INIS)

    Iskra, W.; Mueller, M.; Rotter, I.; Technische Univ. Dresden

    1994-05-01

    At high level density of nuclear states, a separation of different time scales is observed (trapping effect). We calculate the radial profile of partial widths in the framework of the continuum shell model for some 1 - resonances with 2p-2h nuclear structure in 16 O as a function of the coupling strength to the continuum. A correlation between the lifetime of a nuclear state and the radial profile of the corresponding decay process is observed. We conclude from our numerical results that the trapping effect creates structures in space and time characterized by a small radial extension and a short lifetime. (orig.)

  1. Characterization of a New Family of Metal Transporters

    Energy Technology Data Exchange (ETDEWEB)

    Mary Lou Geurinot; David Eide

    2002-04-29

    Metal ions are critical nutrients, yet overaccumulation of these same metals can also be toxic. To maintain appropriate intracellular levels, cells require specific metal uptake systems that are subject to precise homeostatic regulation. The long-range goal of our research is to define the molecular mechanism(s) and regulation of metal ion uptake in eukaryotic cells. Integrating genetic, molecular biological and biochemical approaches, we have examined these processes in the yeast Saccharomyces cerevisiae and the plant Arabidopsis thaliana. Both are proven model systems for studying fundamental cellular processes. Our work has focused on the ZIP family of metal transporters which we identified; this family has representatives in bacteria, fungi, plants and animals. IRT, one of the founding members of the ZIP family, is an essential cation transporter that is expressed in the epidermal cells of iron deficient plant roots and is responsible for uptake of iron from the soil. We now know that there are 15 ZIP genes in the Arabidopsis and the similarities among their encoded gene products. The ZIP family members display different substrate specificities for metals and different tissue distributions in Arabidopsis. Moreover, the family members respond differentially to metal deficiencies. For example, IRT1, ZIP6 and ZIP9 mRNA are expressed mainly in the roots of iron deficient plants whereas ZIP4 responds to both iron and zinc deficiency. Work in both yeast and Arabidopsis has addressed substrate specificity as well as how these transporters are regulated in response to metal availability

  2. Characterization of a New Family of Metal Transporters; FINAL

    International Nuclear Information System (INIS)

    Mary Lou Geurinot; David Eide

    2002-01-01

    Metal ions are critical nutrients, yet overaccumulation of these same metals can also be toxic. To maintain appropriate intracellular levels, cells require specific metal uptake systems that are subject to precise homeostatic regulation. The long-range goal of our research is to define the molecular mechanism(s) and regulation of metal ion uptake in eukaryotic cells. Integrating genetic, molecular biological and biochemical approaches, we have examined these processes in the yeast Saccharomyces cerevisiae and the plant Arabidopsis thaliana. Both are proven model systems for studying fundamental cellular processes. Our work has focused on the ZIP family of metal transporters which we identified; this family has representatives in bacteria, fungi, plants and animals. IRT, one of the founding members of the ZIP family, is an essential cation transporter that is expressed in the epidermal cells of iron deficient plant roots and is responsible for uptake of iron from the soil. We now know that there are 15 ZIP genes in the Arabidopsis and the similarities among their encoded gene products. The ZIP family members display different substrate specificities for metals and different tissue distributions in Arabidopsis. Moreover, the family members respond differentially to metal deficiencies. For example, IRT1, ZIP6 and ZIP9 mRNA are expressed mainly in the roots of iron deficient plants whereas ZIP4 responds to both iron and zinc deficiency. Work in both yeast and Arabidopsis has addressed substrate specificity as well as how these transporters are regulated in response to metal availability

  3. Characterization of sand lenses and their role for subsurface transport in low-permeability clay tills

    DEFF Research Database (Denmark)

    Kessler, Timo Christian; Klint, K. E.; Nilsson, B.

    2011-01-01

    Glacial sediments dominate large parts of the geological topology in Denmark. They predominantly consist of lowpermeability tills, but fractures and sand-lenses constitute zones of enhanced permeability facilitating preferential flow. This study focuses on characterization of sand deposits with r...... the sand lenses in hydro-geological models to successfully characterize subsurface flow and transport, e.g. for remediation activities....

  4. Transport processes investigation: A necessary first step in site scale characterization plans

    International Nuclear Information System (INIS)

    Roepke, C.; Glass, R.J.; Brainard, J.; Mann, M.; Kriel, K.; Holt, R.; Schwing, J.

    1995-01-01

    We propose an approach, which we call the Transport Processes Investigation or TPI, to identify and verify site-scale transport processes and their controls. The TPI aids in the formulation of an accurate conceptual model of flow and transport, an essential first step in the development of a cost effective site characterization strategy. The TPI is demonstrated in the highly complex vadose zone of glacial tills that underlie the Fernald Environmental Remediation Project (FEMP) in Fernald, Ohio. As a result of the TPI, we identify and verify the pertinent flow processes and their controls, such as extensive macropore and fracture flow through layered clays, which must be included in an accurate conceptual model of site-scale contaminant transport. We are able to conclude that the classical modeling and sampling methods employed in some site characterization programs will be insufficient to characterize contaminant concentrations or distributions at contaminated or hazardous waste facilities sited in such media

  5. Characterization of transport phenomena in porous transport layers using X-ray microtomography

    Science.gov (United States)

    Hasanpour, S.; Hoorfar, M.; Phillion, A. B.

    2017-06-01

    Among different methods available for estimating the transport properties of porous transport layers (PTLs) of polymer electrolyte membrane fuel cells, X-ray micro computed tomography (X-μCT) imaging in combination with image-based numerical simulation has been recognized as a viable tool. In this study, four commercially-available single-layer and dual-layer PTLs are analyzed using this method in order to compare and contrast transport properties between different PTLs, as well as the variability within a single sheet. Complete transport property datasets are created for each PTL. The simulation predictions indicate that PTLs with high porosity show considerable variability in permeability and effective diffusivity, while PTLs with low porosity do not. Furthermore, it is seen that the Tomadakis-Sotirchos (TS) analytical expressions for porous media match the image-based simulations when porosity is relatively low but predict higher permeability and effective diffusivity for porosity values greater than 80%. Finally, the simulations show that cracks within MPL of dual-layer PTLs have a significant effect on the overall permeability and effective diffusivity of the PTLs. This must be considered when estimating the transport properties of dual-layer PTLs. These findings can be used to improve macro-scale models of product and reactant transport within fuel cells, and ultimately, fuel cell efficiency.

  6. Advanced testing and characterization of transportation soils and bituminous sands

    CSIR Research Space (South Africa)

    Anochie-Boateng, Joseph

    2007-12-01

    Full Text Available This research study was intended to develop laboratory test procedures for advance testing and characterization of fine-grained cohesive soils and oil sand materials. The test procedures are based on typical field loading conditions and the loading...

  7. Contaminant Attenuation and Transport Characterization of 200-UP-1 Operable Unit Sediment Samples

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Brady D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Szecsody, James E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Qafoku, Nikolla [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); McElroy, Erin M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Baum, Steven R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Snyder, Michelle MV [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lawter, Amanda R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Resch, Charles T. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Gartman, Brandy N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zhong, Lirong [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Saunders, Danielle L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Williams, Benjamin D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Horner, Jacob A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Leavy, Ian I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Christiansen, Beren B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Clayton, Ray E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Johnson, Kayla C. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2017-09-27

    Contaminants disposed of at the land surface migrate through the vadose zone, forming plumes in groundwater. Processes that occur in the groundwater can attenuate contaminant concentrations during transport through the aquifer. For this reason, quantifying contaminant attenuation and contaminant transport processes in the aquifer, in support of the conceptual site model (CSM) and fate and transport modeling, are important for assessing the need for, and type of, remediation in the groundwater, including monitored natural attenuation (MNA). The framework to characterize attenuation and transport processes provided in U.S. Environmental Protection Agency (EPA) guidance documents was used to guide the laboratory effort reported herein.

  8. Yucca Mountain transportation routes: Preliminary characterization and risk analysis

    International Nuclear Information System (INIS)

    Souleyrette, R.R. II; Sathisan, S.K.; di Bartolo, R.

    1991-01-01

    In this study, rail and highway routes which may be used for shipments of high-level nuclear waste to a proposed repository at Yucca Mountain, Nevada are characterized. This characterization facilitates three types of impact analysis: comparative study, limited worst-case assessment, and more sophisticated probabilistic risk assessment techniques. Data for relative and absolute impact measures are provided to support comparisons of routes based on selected characteristics. A worst-case scenario assessment is included to determine potentially critical and most likely places for accidents or incidents to occur. The assessment facilitated by the data in this study is limited because impact measures are restricted to the identification of potential areas or persons affected. No attempt is made to quantify the magnitude of these impacts. Most likely locations for accidents to occur are determined relative to other locations within the scope of this study. Independent factors and historical trends used to identify these likely locations are only proxies for accident probability

  9. The characterization of radiocaesium transport and retention in Nordic lakes

    International Nuclear Information System (INIS)

    Bjoernstad, H.E.; Brittain, J.E.; Saxen, R.; Sundblad, B.

    1994-01-01

    Fractionation studies of radiocaesium have been carried out in three Nordic lakes, Oevre Heimdalsvatn in Norway, Hillesjoen in Sweden and Saarisjaervi in Finland. These lakes differ markedly in several aspects and provide insight into the factors determining radionuclide transport in a range of lake ecosystems. Transport of 137 Cs in plant material (Coarse Particulate Organic Matter, CPOM) was about 17 times greater to Oevre Heimdalsvatn than Saarisjaervi, although over 99% of the inflow CPOM was retained in both lakes. Inflows to Hillesjoen were an order of magnitude lower than to Saarisjaervi and the net retention was only 71%, on account of the outflow of autochthonous production, largely water lily fragments. With regard to the water phase, the lakes differed in the activity of 137 Cs in the various molecular weight fractions. This was a function of catchment processes, resuspension and biological activity in the lakes. In Oevre Heimdalsvatn and Saarisjaervi 45% of the 137 Cs in the water phase was retained in the lake, while in Hillesjoen ten times more 137 Cs in the water phase was retained in the lake, while in Hillesjoen ten times more 137 Cs flowed out than flowed in, due to resuspension of 137 Cs-rich sediments. (orig.)

  10. Characterization of current transport in ferroelectric polymer devices

    KAUST Repository

    Hanna, Amir

    2014-01-01

    We report the charge injection characteristics in poly(vinylidene fluoride-trifluoroethylene), P(VDF-TrFE), as a function of electrode material in metal/ferroelectric/metal device structures. Symmetric and asymmetric devices with Al, Ag, Au and Pt electrodes were fabricated to determine the dominant carrier type, injection current density, and to propose transport mechanisms in the ferroelectric polymer. Higher work function metals such as Pt are found to inject less charges compared to lower work function metals, implying n-type conduction behavior for P(VDF-TrFE) with electrons as the dominant injected carrier. Two distinct charge transport regimes were identified in the P(VDF-TrFE) devices; a Schottky-limited conduction regime for low to intermediate fields (E < 20 MV/m), and a space-charge limited conduction (SCLC) regime for high fields (20 < E < 120 MV/m). Implication of these results for degradation in P(VDF-TrFE) memory performance are discussed. © 2013 Elsevier B.V. All rights reserved.

  11. Radial nerve dysfunction (image)

    Science.gov (United States)

    The radial nerve travels down the arm and supplies movement to the triceps muscle at the back of the upper arm. ... the wrist and hand. The usual causes of nerve dysfunction are direct trauma, prolonged pressure on the ...

  12. Direct measurements of transport properties are essential for site characterization

    International Nuclear Information System (INIS)

    Wright, J.; Conca, J.L.

    1994-08-01

    Direct measurements of transport parameters on subsurface sediments using, the UFA method provided detailed hydrostratigraphic mapping, and subsurface flux distributions at a mixed-waste disposal site at Hanford. Seven hundred unsaturated conductivity measurements on fifty samples were obtained in only six months total of UFA run time. These data are used to provide realistic information to conceptual models, predictive models and restoration strategies. The UFA instrument consists of an ultracentrifuge with a constant, ultralow flow pump that provides fluid to the sample surface through a rotating seal assembly and microdispersal system. Effluent from the sample is collected in a transparent, volumetrically-calibrated chamber at the bottom of the sample assembly. Using a strobe light, an observer can check the chamber while the sample is being centrifuged. Materials can be run in the UFA as recomposited samples or in situ samples can be subcored directly into the sample UFA chamber

  13. Computational modeling and experimental characterization of indoor aerosol transport

    International Nuclear Information System (INIS)

    Konecni, Snezana; Whicker, Jeffrey J.; Martin, Richard A.

    2002-01-01

    When a hazardous aerosol or gas is inadvertently or deliberately released in an occupied facility, the airborne material presents a hazard to people. Inadvertent accidents and exposures continue to occur in Los Alamos and other nuclear facilities despite state-of-art engineering and administrative controls, and heightened diligence. Despite the obvious need in occupational settings and for homeland defense, the body of research in hazardous aerosol dispersion and control in large, complex, ventilated enclosures is extremely limited. The science governing generation, transport, inhalation, and detection of airborne hazards is lacking and must be developed to where it can be used by engineers or safety professionals in the prediction of worker exposure, in the prevention of accidents, or in the mitigation of terrorist actions. In this study, a commercial computational fluid dynamics (CFD) code, CFX5.4, and experiments were used to assess flow field characteristics, and to investigate aerosol release and transport in a large, ventilated workroom in a facility at Savannah River Site. Steady state CFD results illustrating a complex, ventilation-induced, flow field with vortices, velocity gradients, and quiet zones are presented, as are time-dependent CFD and experimental aerosol dispersion results. The comparison of response times between CFD and experimental results was favorable. It is believed that future applications of CFD and experiments can have a favorable impact on the design of ventilation (HVAC) systems and worker safety with consideration to facility costs. Ultimately, statistical methods will be used in conjunction with CFD calculations to determine the optimal number and location of detectors, as well as optimal egress routes in event of a release.

  14. Dynamic characterization of external and internal mass transport in heterotrophic biofilms from microsensors measurements.

    Science.gov (United States)

    Guimerà, Xavier; Dorado, Antonio David; Bonsfills, Anna; Gabriel, Gemma; Gabriel, David; Gamisans, Xavier

    2016-10-01

    Knowledge of mass transport mechanisms in biofilm-based technologies such as biofilters is essential to improve bioreactors performance by preventing mass transport limitation. External and internal mass transport in biofilms was characterized in heterotrophic biofilms grown on a flat plate bioreactor. Mass transport resistance through the liquid-biofilm interphase and diffusion within biofilms were quantified by in situ measurements using microsensors with a high spatial resolution (mass transport coefficients. The sensitivity of external and internal mass transport resistances to flow conditions within the range of typical fluid velocities over biofilms (Reynolds numbers between 0.5 and 7) was assessed. Estimated external mass transfer coefficients at different liquid phase flow velocities showed discrepancies with studies considering laminar conditions in the diffusive boundary layer near the liquid-biofilm interphase. The correlation of effective diffusivity with flow velocities showed that the heterogeneous structure of biofilms defines the transport mechanisms inside biofilms. Internal mass transport was driven by diffusion through cell clusters and aggregates at Re below 2.8. Conversely, mass transport was driven by advection within pores, voids and water channels at Re above 5.6. Between both flow velocities, mass transport occurred by a combination of advection and diffusion. Effective diffusivities estimated at different biofilm densities showed a linear increase of mass transport resistance due to a porosity decrease up to biofilm densities of 50 g VSS·L(-1). Mass transport was strongly limited at higher biofilm densities. Internal mass transport results were used to propose an empirical correlation to assess the effective diffusivity within biofilms considering the influence of hydrodynamics and biofilm density. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Characterizing fate and transport properties in karst aquifers under different hydrologic conditions

    Science.gov (United States)

    Rodriguez, E.; Padilla, I. Y.

    2017-12-01

    Karst landscapes contain very productive aquifers. The hydraulic and hydrogeological characteristics of karst aquifers make these systems capable of storing and transporting large amount of water, but also highly vulnerable to contamination. Their extremely heterogeneous nature prevents accurate prediction in contaminant fate and transport. Even more challenging is to understand the impact of hydrologic conditions changes on fate and transport processes. This studies aims at characterizing fate and transport processes in the karst groundwater system of northern Puerto Rico under different hydrologic conditions. The study involves injecting rhodamine and uranine dyes into a sinkhole, and monitoring concentrations at a spring. Results show incomplete recovery of tracers, but breaking curves can be used to estimate advective, dispersive and mass transfer characteristic of the karst system. Preliminary results suggest significant differences in fate and transport characteristics under different hydrologic conditions.

  16. Functional characterization of water transport and cellular localization of three aquaporin paralogs in the salmonid intestine

    DEFF Research Database (Denmark)

    Madsen, Steffen S; Olesen, Jesper H; Bedal, Konstanze

    2011-01-01

    Intestinal water absorption is greatly enhanced in salmonids upon acclimation from freshwater (FW) to seawater (SW); however, the molecular mechanism for water transport is unknown. We conducted a pharmacological characterization of water absorption in the rainbow trout intestine along......%), 0.1 ouabain (72%), and 0.1 bumetanide (82%) suggesting that active transport, Na(+), K(+)-ATPase and Na(+), K(+), 2Cl(-)-co-transport are involved in establishing the driving gradient for water transport. J(v) was also inhibited by 1 mmol L(-1) HgCl(2), serosally (23% in M and 44% in P), mucosally...... (27% in M), or both (61% in M and 58% in P), suggesting involvement of both apical and basolateral aquaporins in water transport. The inhibition was antagonized by 5 mmol L(-1) mercaptoethanol. By comparison, 10 mmol L(-1) mucosal tetraethylammonium, an inhibitor of certain aquaporins, inhibited J...

  17. Radial wedge flange clamp

    Science.gov (United States)

    Smith, Karl H.

    2002-01-01

    A radial wedge flange clamp comprising a pair of flanges each comprising a plurality of peripheral flat wedge facets having flat wedge surfaces and opposed and mating flat surfaces attached to or otherwise engaged with two elements to be joined and including a series of generally U-shaped wedge clamps each having flat wedge interior surfaces and engaging one pair of said peripheral flat wedge facets. Each of said generally U-shaped wedge clamps has in its opposing extremities apertures for the tangential insertion of bolts to apply uniform radial force to said wedge clamps when assembled about said wedge segments.

  18. Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

    KAUST Repository

    Scheu, Arne Hagen August

    2017-01-01

    Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

  19. An Inverse Analysis Approach to the Characterization of Chemical Transport in Paints

    Science.gov (United States)

    Willis, Matthew P.; Stevenson, Shawn M.; Pearl, Thomas P.; Mantooth, Brent A.

    2014-01-01

    The ability to directly characterize chemical transport and interactions that occur within a material (i.e., subsurface dynamics) is a vital component in understanding contaminant mass transport and the ability to decontaminate materials. If a material is contaminated, over time, the transport of highly toxic chemicals (such as chemical warfare agent species) out of the material can result in vapor exposure or transfer to the skin, which can result in percutaneous exposure to personnel who interact with the material. Due to the high toxicity of chemical warfare agents, the release of trace chemical quantities is of significant concern. Mapping subsurface concentration distribution and transport characteristics of absorbed agents enables exposure hazards to be assessed in untested conditions. Furthermore, these tools can be used to characterize subsurface reaction dynamics to ultimately design improved decontaminants or decontamination procedures. To achieve this goal, an inverse analysis mass transport modeling approach was developed that utilizes time-resolved mass spectroscopy measurements of vapor emission from contaminated paint coatings as the input parameter for calculation of subsurface concentration profiles. Details are provided on sample preparation, including contaminant and material handling, the application of mass spectrometry for the measurement of emitted contaminant vapor, and the implementation of inverse analysis using a physics-based diffusion model to determine transport properties of live chemical warfare agents including distilled mustard (HD) and the nerve agent VX. PMID:25226346

  20. Sirenomelia with radial dysplasia.

    Science.gov (United States)

    Kulkarni, M L; Abdul Manaf, K M; Prasannakumar, D G; Kulkarni, Preethi M

    2004-05-01

    Sirenomelia is a rare anomaly usually associated with other multiple malformations. In this communication the authors report a case of sirenomelia associated with multiple malformations, which include radial hypoplasia also. Though several theories have been proposed regarding the etiology of multiple malformation syndromes in the past, the recent theory of primary developmental defect during blastogenesis holds good in this case.

  1. Radially truncated galactic discs

    NARCIS (Netherlands)

    Grijs, R. de; Kregel, M.; Wesson, K H

    2000-01-01

    Abstract: We present the first results of a systematic analysis of radially truncatedexponential discs for four galaxies of a sample of disc-dominated edge-onspiral galaxies. Edge-on galaxies are very useful for the study of truncatedgalactic discs, since we can follow their light distributions out

  2. Variable stator radial turbine

    Science.gov (United States)

    Rogo, C.; Hajek, T.; Chen, A. G.

    1984-01-01

    A radial turbine stage with a variable area nozzle was investigated. A high work capacity turbine design with a known high performance base was modified to accept a fixed vane stagger angle moveable sidewall nozzle. The nozzle area was varied by moving the forward and rearward sidewalls. Diffusing and accelerating rotor inlet ramps were evaluated in combinations with hub and shroud rotor exit rings. Performance of contoured sidewalls and the location of the sidewall split line with respect to the rotor inlet was compared to the baseline. Performance and rotor exit survey data are presented for 31 different geometries. Detail survey data at the nozzle exit are given in contour plot format for five configurations. A data base is provided for a variable geometry concept that is a viable alternative to the more common pivoted vane variable geometry radial turbine.

  3. Estimation of Radial Runout

    OpenAIRE

    Nilsson, Martin

    2007-01-01

    The demands for ride comfort quality in today's long haulage trucks are constantly growing. A part of the ride comfort problems are represented by internal vibrations caused by rotating mechanical parts. This thesis work focus on the vibrations generated from radial runout on the wheels. These long haulage trucks travel long distances on smooth highways, with a constant speed of 90 km/h resulting in a 7 Hz oscillation. This frequency creates vibrations in the cab, which can be found annoying....

  4. Radial Fuzzy Systems

    Czech Academy of Sciences Publication Activity Database

    Coufal, David

    2017-01-01

    Roč. 319, 15 July (2017), s. 1-27 ISSN 0165-0114 R&D Projects: GA MŠk(CZ) LD13002 Institutional support: RVO:67985807 Keywords : fuzzy systems * radial functions * coherence Subject RIV: BA - General Mathematics OBOR OECD: Computer sciences, information science, bioinformathics (hardware development to be 2.2, social aspect to be 5.8) Impact factor: 2.718, year: 2016

  5. Perceived radial translation during centrifugation

    NARCIS (Netherlands)

    Bos, J.E.; Correia Grácio, B.J.

    2015-01-01

    BACKGROUND: Linear acceleration generally gives rise to translation perception. Centripetal acceleration during centrifugation, however, has never been reported giving rise to a radial, inward translation perception. OBJECTIVE: To study whether centrifugation can induce a radial translation

  6. Preliminary characterization of materials for a reactive transport model validation experiment

    International Nuclear Information System (INIS)

    Siegel, M.D.; Ward, D.B.; Cheng, W.C.; Bryant, C.; Chocas, C.S.; Reynolds, C.G.

    1993-01-01

    The geochemical properties of a porous sand and several tracers (Ni, Br, and Li) have been characterized for use in a caisson experiment designed to validate sorption models used in models of inactive transport. The surfaces of the sand grains have been examined by a combination of techniques including potentiometric titration, acid leaching, optical microscopy, and scanning electron microscopy with energy-dispersive spectroscopy. The surface studies indicate the presence of small amounts of carbonate, kaolinite and iron-oxyhydroxides. Adsorption of nickel, lithium and bromide by the sand was measured using batch techniques. Bromide was not sorbed by the sand. A linear (K d ) or an isotherm sorption model may adequately describe transport of Li; however, a model describing the changes of pH and the concentrations of other solution species as a function of time and position within the caisson and the concomitant effects on Ni sorption may be required for accurate predictions of nickel transport

  7. Characterization of putative multidrug resistance transporters of the major facilitator-superfamily expressed in Salmonella Typhi

    DEFF Research Database (Denmark)

    Shaheen, Aqsa; Ismat, Fouzia; Iqbal, Mazhar

    2015-01-01

    Multidrug resistance mediated by efflux pumps is a well-known phenomenon in infectious bacteria. Although much work has been carried out to characterize multidrug efflux pumps in Gram-negative and Gram-positive bacteria, such information is still lacking for many deadly pathogens. The aim...... of this study was to gain insight into the substrate specificity of previously uncharacterized transporters of Salmonella Typhi to identify their role in the development of multidrug resistance. S. Typhi genes encoding putative members of the major facilitator superfamily were cloned and expressed in the drug......-hypersensitive Escherichia coli strain KAM42, and tested for transport of 25 antibacterial compounds, including representative antibiotics of various classes, antiseptics, dyes and detergents. Of the 15 tested putative transporters, STY0901, STY2458 and STY4874 exhibited a drug-resistance phenotype. Among these, STY4874...

  8. Automated fabrication, characterization and transport of ICF pellets. Final report, March 1, 1979-October 31, 1980

    International Nuclear Information System (INIS)

    Clifford, .D.W.; Boyd, B.A.; Lilienkamp, R.H.

    1980-12-01

    The near-term objectives of the contract were threefold: (1) evaluate techniques for the production of frozen hydrogen microspheres and demonstrate concepts for coating them; (2) develop and demonstrate an optical characterization system which could lead to automated pellet inspection; and (3) develop and demonstrate a preliminary electrostatic pellet transport control system. This report describes the equipment assembled for these experiments and the results obtained

  9. Synthesis and Characterization of Valyloxy Methoxy Luciferin for the Detection of Valacyclovirase and Peptide Transporter

    Science.gov (United States)

    Amidon, Gordon L.; Lee, Kyung-Dall

    2014-01-01

    An amino acid ester derivative of luciferin (valoluc) was synthesized to mimic the transport and activation of valacyclovir. This molecule was characterized in vitro for specificity and enzymatic constants, and then assayed in two different, physiologically-relevant conditions. It was demonstrated that valoluc activation is sensitive to the same cellular factors as valacyclovir and thus has the potential to elucidate the dynamics of amino acid ester prodrug therapies in a functional, high-throughput manner. PMID:25240255

  10. Characterization of cadmium plasma membrane transport in gills of a mangrove crab Ucides cordatus

    International Nuclear Information System (INIS)

    Ortega, P.; Custódio, M.R.; Zanotto, F.P.

    2014-01-01

    Highlights: • Cd 2+ gill cell transport, a non-essential toxic metal, was characterized in a hypo-hyper-regulating mangrove crab Ucides cordatus. • Cd 2+ enter gill cells through Ca 2+ channels and is dependent of intracellular Ca 2+ levels. • Route of entry in gill cells also involves a Cd 2+ /Ca 2+ (2Na) exchanger. • Cd transport depends on Na + /K + -ATPase and gill cell electrochemical gradient. • Vanadate inhibits gill Cd 2+ transport and ouabain increase gill Cd 2+ transport. - Abstract: Membrane pathway for intracellular cadmium (Cd 2+ ) accumulation is not fully elucidated in many organisms and has not been studied in crab gill cells. To characterize membrane Cd 2+ transport of anterior and posterior gill cells of Ucides cordatus, a hypo-hyper-regulating crab, a change in intracellular Cd 2+ concentration under various experimental conditions was examined by using FluoZin, a fluorescent probe. The membrane Cd 2+ transport was estimated by the augmentation of FluoZin fluorescence induced by extracellular application of CdCl 2 and different inhibitors. Addition of extracellular calcium (Ca 2+ ) to the cells affected little the fluorescence of FluoZin, confirming that Cd 2+ was the main ion increasing intracellular fluorescence. Ca 2+ channels blockers (nimodipine and verapamil) decreased Cd 2+ influx as well as vanadate, a Ca 2+ -ATPase blocker. Chelating intracellular Ca 2+ (BAPTA) decreased Cd 2+ influx in gill cells, while increasing intracellular Ca 2+ (caffeine) augmented Cd influx. Cd 2+ and ATP added at different temporal conditions were not effective at increasing intracellular Cd 2+ accumulation. Ouabain (Na + /K + -ATPase inhibitor) increased Cd 2+ influx probably through a change in intracellular Na and/or a change in cell membrane potential. Routes of Cd 2+ influx, a non-essential metal, through the gill cell plasma membrane of crabs are suggested

  11. Radial reflection diffraction tomography

    Science.gov (United States)

    Lehman, Sean K.

    2012-12-18

    A wave-based tomographic imaging method and apparatus based upon one or more rotating radially outward oriented transmitting and receiving elements have been developed for non-destructive evaluation. At successive angular locations at a fixed radius, a predetermined transmitting element can launch a primary field and one or more predetermined receiving elements can collect the backscattered field in a "pitch/catch" operation. A Hilbert space inverse wave (HSIW) algorithm can construct images of the received scattered energy waves using operating modes chosen for a particular application. Applications include, improved intravascular imaging, bore hole tomography, and non-destructive evaluation (NDE) of parts having existing access holes.

  12. Evaluation of modelling of the TRUE-1 radially converging and dipole tests with conservative tracers. The Aespoe task force on modelling of groundwater flow and transport of solutes. Tasks 4C and 4D

    International Nuclear Information System (INIS)

    Elert, M.

    1999-05-01

    The 'Aespoe task force on modelling of groundwater flow and transport of solutes' is a forum for the international organisations supporting the Aespoe HRL Project. The purpose of the Task Force is to interact in the area of conceptual and numerical modelling of groundwater flow and solute transport in fractured rock. Task 4 of the Aespoe Modelling Task Force consists of modelling exercises in support of the TRUE-1 tracer tests. In this report, the modelling work performed within Tasks 4C and 4D is evaluated, which comprised predictive modelling of the radially converging tracer tests and dipole tracer tests performed within the TRUE-1 tests using non-sorbing tracers. The tests were performed between packed off boreholes penetrating a water-conducting geological feature with a simple structure (Feature A). These tests are to a great extent preparatory steps for the subsequent tests with sorbing radioactive tracers. In Tasks 4E and 4F of the Aespoe Modelling Task Force predictive modelling of the sorbing tracer tests is performed. Eight modelling teams representing seven organisations have performed predictive modelling using different modelling approaches and models. The modelling groups were initially given data from the site characterisation and data on the experimental set-up of the tracer tests. Based on this information model predictions were performed of drawdown, tracer mass recovery and tracer breakthrough. The performed predictions shows that the concept of Feature A as a singular well-connected feature with limited connectivity to its surroundings is quite adequate for predictions of drawdown in boreholes and conservative tracer breakthrough. Reasonable estimates were obtained using relatively simple models. However, more elaborate models with calibration or conditioning of transmissivities and transport apertures are required for more accurate predictions. The general flow and transport processes are well understood, but the methodology to derive the

  13. Evaluation of modelling of the TRUE-1 radially converging and dipole tests with conservative tracers. The Aespoe task force on modelling of groundwater flow and transport of solutes. Tasks 4C and 4D

    Energy Technology Data Exchange (ETDEWEB)

    Elert, M. [Kemakta Konsult AB, Stockholm (Sweden)

    1999-05-01

    The `Aespoe task force on modelling of groundwater flow and transport of solutes` is a forum for the international organisations supporting the Aespoe HRL Project. The purpose of the Task Force is to interact in the area of conceptual and numerical modelling of groundwater flow and solute transport in fractured rock. Task 4 of the Aespoe Modelling Task Force consists of modelling exercises in support of the TRUE-1 tracer tests. In this report, the modelling work performed within Tasks 4C and 4D is evaluated, which comprised predictive modelling of the radially converging tracer tests and dipole tracer tests performed within the TRUE-1 tests using non-sorbing tracers. The tests were performed between packed off boreholes penetrating a water-conducting geological feature with a simple structure (Feature A). These tests are to a great extent preparatory steps for the subsequent tests with sorbing radioactive tracers. In Tasks 4E and 4F of the Aespoe Modelling Task Force predictive modelling of the sorbing tracer tests is performed. Eight modelling teams representing seven organisations have performed predictive modelling using different modelling approaches and models. The modelling groups were initially given data from the site characterisation and data on the experimental set-up of the tracer tests. Based on this information model predictions were performed of drawdown, tracer mass recovery and tracer breakthrough. The performed predictions shows that the concept of Feature A as a singular well-connected feature with limited connectivity to its surroundings is quite adequate for predictions of drawdown in boreholes and conservative tracer breakthrough. Reasonable estimates were obtained using relatively simple models. However, more elaborate models with calibration or conditioning of transmissivities and transport apertures are required for more accurate predictions. The general flow and transport processes are well understood, but the methodology to derive the

  14. Functional characterization of apical transporters expressed in rat proximal tubular cells (PTCs) in primary culture.

    Science.gov (United States)

    Nakanishi, Takeo; Fukushi, Akimasa; Sato, Masanobu; Yoshifuji, Mayuko; Gose, Tomoka; Shirasaka, Yoshiyuki; Ohe, Kazuyo; Kobayashi, Masato; Kawai, Keiichi; Tamai, Ikumi

    2011-12-05

    Since in vitro cell culture models often show altered apical transporter expression, they are not necessarily suitable for the analysis of renal transport processes. Therefore, we aimed here to investigate the usefulness of primary-cultured rat proximal tubular cells (PTCs) for this purpose. After isolation of renal cortical cells from rat kidneys, PTCs were enriched and the gene expression and function of apical transporters were analyzed by means of microarray, RT-PCR and uptake experiments. RT-PCR confirmed that the major apical transporters were expressed in rat PTCs. Na(+)-dependent uptake of α-methyl-d-glucopyranoside (αMG), ergothioneine and carnitine by the PTCs suggests functional expression of Sglts, Octn1 and Octn2, respectively. Inhibition of pH-dependent glycylsarcosine uptake by low concentration of cephalexin, which is a β-lactam antibiotics recognized by Pepts, indicates a predominant role of high affinity type Pept2, but not low affinity type Pept1, in the PTCs. Moreover, the permeability ratio of [(14)C]αMG (apical to basolateral/basolateral to apical) across PTCs was 4.3, suggesting that Sglt-mediated reabsorptive transport is characterized. In conclusion, our results indicate that rat PTCs in primary culture are found to be a promising in vitro model to evaluate reabsorption processes mediated at least by Sglts, Pept2, Octn1 and Octn2.

  15. Characterization of vacuolar amino acid transporter from Fusarium oxysporum in Saccharomyces cerevisiae.

    Science.gov (United States)

    Lunprom, Siriporn; Pongcharoen, Pongsanat; Sekito, Takayuki; Kawano-Kawada, Miyuki; Kakinuma, Yoshimi; Akiyama, Koichi

    2015-01-01

    Fusarium oxysporum causes wilt disease in many plant families, and many genes are involved in its development or growth in host plants. A recent study revealed that vacuolar amino acid transporters play an important role in spore formation in Schizosaccharomyces pombe and Saccharomyces cerevisiae. To investigate the role of vacuolar amino acid transporters of this phytopathogenic fungus, the FOXG_11334 (FoAVT3) gene from F. oxysporum was isolated and its function was characterized. Transcription of FoAVT3 was upregulated after rapamycin treatment. A green fluorescent protein fusion of FoAvt3p was localized to vacuolar membranes in both S. cerevisiae and F. oxysporum. Analysis of the amino acid content of the vacuolar fraction and amino acid transport activities using vacuolar membrane vesicles from S. cerevisiae cells heterologously expressing FoAVT3 revealed that FoAvt3p functions as a vacuolar amino acid transporter, exporting neutral amino acids. We conclude that the FoAVT3 gene encodes a vacuolar neutral amino acid transporter.

  16. Functional characterization of Citrus macrophylla BOR1 as a boron transporter.

    Science.gov (United States)

    Cañon, Paola; Aquea, Felipe; Rodríguez-Hoces de la Guardia, Amparo; Arce-Johnson, Patricio

    2013-11-01

    Plants have evolved to develop an efficient system of boron uptake and transport using a range of efflux carriers named BOR proteins. In this work we isolated and characterized a boron transporter of citrus (Citrus macrophylla), which was named CmBOR1 for its high homology to AtBOR1. CmBOR1 has 4403 bp and 12 exons. Its coding region has 2145 bp and encodes for a protein of 714 amino acids. CmBOR1 possesses the molecular features of BORs such as an anion exchanger domain and the presence of 10 transmembrane domains. Functional analysis in yeast indicated that CmBOR1 has an efflux boron transporter activity, and transformants have increased tolerance to excess boron. CmBOR1 is expressed in leaves, stem and flowers and shows the greatest accumulation in roots. The transcript accumulation was significantly increased under boron deficiency conditions in shoots. In contrast, the accumulation of the transcript did not change in boron toxicity conditions. Finally, we observed that constitutive expression of CmBOR1 was able to increase tolerance to boron deficiency conditions in Arabidopsis thaliana, suggesting that CmBOR1 is a xylem loading boron transporter. Based on these results, it was determined that CmBOR1 encodes a boric acid/borate transporter involved in tolerance to boron deficiency in plants. © 2013 Scandinavian Plant Physiology Society.

  17. Experimental characterization of solid particle transport by slug flow using Particle Image Velocimetry

    International Nuclear Information System (INIS)

    Goharzadeh, A; Rodgers, P

    2009-01-01

    This paper presents an experimental study of gas-liquid slug flow on solid particle transport inside a horizontal pipe with two types of experiments conducted. The influence of slug length on solid particle transportation is characterized using high speed photography. Using combined Particle Image Velocimetry (PIV) with Refractive Index Matching (RIM) and fluorescent tracers (two-phase oil-air loop) the velocity distribution inside the slug body is measured. Combining these experimental analyses, an insight is provided into the physical mechanism of solid particle transportation due to slug flow. It was observed that the slug body significantly influences solid particle mobility. The physical mechanism of solid particle transportation was found to be discontinuous. The inactive region (in terms of solid particle transport) upstream of the slug nose was quantified as a function of gas-liquid composition and solid particle size. Measured velocity distributions showed a significant drop in velocity magnitude immediately upstream of the slug nose and therefore the critical velocity for solid particle lifting is reached further upstream.

  18. Identification and Functional Characterization of the Caenorhabditis elegans Riboflavin Transporters rft-1 and rft-2

    Science.gov (United States)

    Biswas, Arundhati; Elmatari, Daniel; Rothman, Jason; LaMunyon, Craig W.; Said, Hamid M.

    2013-01-01

    Two potential orthologs of the human riboflavin transporter 3 (hRFVT3) were identified in the C. elegans genome, Y47D7A.16 and Y47D7A.14, which share 33.7 and 30.5% identity, respectively, with hRFVT3. The genes are tandemly arranged, and we assign them the names rft-1 (for Y47D7A.16) and rft-2 (for Y47D7A.14). Functional characterization of the coding sequences in a heterologous expression system demonstrated that both were specific riboflavin transporters, although the rft-1 encoded protein had greater transport activity. A more detailed examination of rft-1 showed its transport of riboflavin to have an acidic pH dependence, saturability (apparent Km = 1.4±0.5 µM), inhibition by riboflavin analogues, and Na+ independence. The expression of rft-1 mRNA was relatively higher in young larvae than in adults, and mRNA expression dropped in response to RF supplementation. Knocking down the two transporters individually via RNA interference resulted in a severe loss of fertility that was compounded in a double knockdown. Transcriptional fusions constructed with two fluorophores (rft-1::GFP, and rft-2::mCherry) indicated that rft-1 is expressed in the intestine and a small subset of neuronal support cells along the entire length of the animal. Expression of rft-2 is localized mainly to the intestine and pharynx. We also observed a drop in the expression of the two reporters in animals that were maintained in high riboflavin levels. These results report for the first time the identification of two riboflavin transporters in C. elegans and demonstrate their expression and importance to metabolic function in worms. Absence of transporter function renders worms sterile, making them useful in understanding human disease associated with mutations in hRFVT3. PMID:23483992

  19. Characterization of copper transport in gill cells of a mangrove crab Ucides cordatus

    Energy Technology Data Exchange (ETDEWEB)

    Sá, M.G. [Biosciences Institute, Department of Physiology, University of São Paulo, Rua do Matão, Travessa 14, 101, São Paulo 05508-900, SP (Brazil); Zanotto, F.P., E-mail: fzanotto@usp.br [Biosciences Institute, Department of Physiology, University of São Paulo, Rua do Matão, Travessa 14, 101, São Paulo 05508-900, SP (Brazil); Department of Biophysics, Escola Paulista de Medicina, Universidade Federal de Sao Paulo, Rua Três de Maio 100, Sao Paulo 04044-020 (Brazil)

    2013-11-15

    Highlights: •Copper transport in gill cells of a mangrove crab Ucides cordatus is dependent of calcium. •Copper transport mechanism is ATP-dependent. •Transport was monitored second by second during 300 s. -- Abstract: The branchial epithelium of crustaceans is exposed to the environment and is the first site affected by metal pollution. The aim of this work was to characterize copper (Cu) transport using a fluorescent dye, Phen Green, in gill cells of a hypo-hyper-regulator mangrove crab Ucides cordatus. The results showed that added extracellular CuCl{sub 2} (0, 0.025, 0.150, 0.275, 0.550 and 1.110 μM) showed typical Michaelis–Menten transport for Cu in anterior and posterior gill cells (V{sub max} for anterior and posterior gills: 0.41 ± 0.12 and 1.76 ± 0.27 intracellular Cu in μM × 22.10{sup 4} cells{sup −1} × 300 s{sup −1} respectively and K{sub m} values: 0.44 ± 0.04 and 0.32 ± 0.13 μM, respectively). Intracellular Cu was significantly higher for posterior gill cells compared to anterior gill cells, suggesting differential accumulation for each gill type. Extracellular Ca at 20 mM decreased cellular Cu transport for both anterior and posterior gill cells. Nifedipine and verapamil, calcium channel inhibitors from plasma membrane, decreased Cu transport and affected K{sub m} for both gills. These results could be due to a competition between Cu and Ca. Amiloride, a Na/Ca exchanger inhibitor, as well as bafilomycin, a proton pump inhibitor, caused a decrease of intracellular Cu compared to control. Ouabain and KB-R 7943, acting on Na homeostasis, similarly decreased intracellular Cu in both gill cells. Besides that, gill cells exposed to ATP and Cu simultaneously, showed an increase in intracellular copper, which was inhibited by vanadate, an inhibitor of P-type ATPase. These results suggest either the presence of a Cu-ATPase in crab gill cells, responsible for Cu influx, or the effect of a change in electrochemical membrane potential that

  20. Characterization of copper transport in gill cells of a mangrove crab Ucides cordatus

    International Nuclear Information System (INIS)

    Sá, M.G.; Zanotto, F.P.

    2013-01-01

    Highlights: •Copper transport in gill cells of a mangrove crab Ucides cordatus is dependent of calcium. •Copper transport mechanism is ATP-dependent. •Transport was monitored second by second during 300 s. -- Abstract: The branchial epithelium of crustaceans is exposed to the environment and is the first site affected by metal pollution. The aim of this work was to characterize copper (Cu) transport using a fluorescent dye, Phen Green, in gill cells of a hypo-hyper-regulator mangrove crab Ucides cordatus. The results showed that added extracellular CuCl 2 (0, 0.025, 0.150, 0.275, 0.550 and 1.110 μM) showed typical Michaelis–Menten transport for Cu in anterior and posterior gill cells (V max for anterior and posterior gills: 0.41 ± 0.12 and 1.76 ± 0.27 intracellular Cu in μM × 22.10 4 cells −1 × 300 s −1 respectively and K m values: 0.44 ± 0.04 and 0.32 ± 0.13 μM, respectively). Intracellular Cu was significantly higher for posterior gill cells compared to anterior gill cells, suggesting differential accumulation for each gill type. Extracellular Ca at 20 mM decreased cellular Cu transport for both anterior and posterior gill cells. Nifedipine and verapamil, calcium channel inhibitors from plasma membrane, decreased Cu transport and affected K m for both gills. These results could be due to a competition between Cu and Ca. Amiloride, a Na/Ca exchanger inhibitor, as well as bafilomycin, a proton pump inhibitor, caused a decrease of intracellular Cu compared to control. Ouabain and KB-R 7943, acting on Na homeostasis, similarly decreased intracellular Cu in both gill cells. Besides that, gill cells exposed to ATP and Cu simultaneously, showed an increase in intracellular copper, which was inhibited by vanadate, an inhibitor of P-type ATPase. These results suggest either the presence of a Cu-ATPase in crab gill cells, responsible for Cu influx, or the effect of a change in electrochemical membrane potential that could also drive Cu to the gill cell

  1. Characterization of atmospheric aerosols in Ile-de-France: Local contribution and Long range transport

    International Nuclear Information System (INIS)

    Cuesta, J.E.

    2006-06-01

    Atmospheric aerosols interact directly in a great number of processes related to climate change and public health, modifying the energy budget and partly determining the quality of the air we breathe. In my PhD, I chose to study the perturbation, if not the aggravation, of the living conditions in Ile-de-France associated to aerosol transport episodes in the free troposphere. This situation is rather frequent and still badly known. To achieve my study, I developed the observation platform 'TReSS' Transportable Remote Sensing Station, whose instruments were developed at the Laboratoire de Meteorology Dynamique by the LiMAG team. 'TReSS' consists of a new high-performance 'Mini-Lidar' and of two standard radiometers: a sun photometer and a thermal infrared radiometer. The principle of my experimental approach is the synergy of the vertical Lidar profiles and the particle size distributions over the column, obtained by the 'Almucantar' inversion of sun photometer data. The new 'Lidar and Almucantar' method characterizes the vertical distribution by layer and the optical micro-physical properties of the local and transported aerosols. Firstly, I undertook the characterization of the Paris aerosol, mainly of anthropogenic origin. Their radiative properties were analyzed in the daily and yearly scales. Then, I conducted a statistical multi-year study of transport episodes and a two-week study case, representative of a succession of desert dust intrusion in Ile-de-France. My PhD work concludes by a study on the impact of biomass burning aerosols during the heat wave on August 2003. I study the impact of the transported aerosols into the local radiative budget and the possible consequences on the diurnal cycle of the atmospheric boundary layer. (author)

  2. Radial transfer effects for poloidal rotation

    Science.gov (United States)

    Hallatschek, Klaus

    2010-11-01

    Radial transfer of energy or momentum is the principal agent responsible for radial structures of Geodesic Acoustic Modes (GAMs) or stationary Zonal Flows (ZF) generated by the turbulence. For the GAM, following a physical approach, it is possible to find useful expressions for the individual components of the Poynting flux or radial group velocity allowing predictions where a mathematical full analysis is unfeasible. Striking differences between up-down symmetric flux surfaces and asymmetric ones have been found. For divertor geometries, e.g., the direction of the propagation depends on the sign of the ion grad-B drift with respect to the X-point, reminiscent of a sensitive determinant of the H-mode threshold. In nonlocal turbulence computations it becomes obvious that the linear energy transfer terms can be completely overwhelmed by the action of the turbulence. In contrast, stationary ZFs are governed by the turbulent radial transfer of momentum. For sufficiently large systems, the Reynolds stress becomes a deterministic functional of the flows, which can be empirically determined from the stress response in computational turbulence studies. The functional allows predictions even on flow/turbulence states not readily obtainable from small amplitude noise, such as certain transport bifurcations or meta-stable states.

  3. Creatine Transporter Deficiency: Screening of Males with Neurodevelopmental Disorders and Neurocognitive Characterization of a Case.

    Science.gov (United States)

    Thurm, Audrey; Himelstein, Daniel; DʼSouza, Precilla; Rennert, Owen; Jiang, Susanqi; Olatunji, Damilola; Longo, Nicola; Pasquali, Marzia; Swedo, Susan; Salomons, Gajja S; Carrillo, Nuria

    2016-05-01

    Creatine transporter deficiency (CTD) is an X-linked, neurometabolic disorder associated with intellectual disability that is characterized by brain creatine (Cr) deficiency and caused by mutations in SLC6A8, the Cr transporter 1 protein gene. CTD is identified by elevated urine creatine/creatinine (Cr/Crn) ratio or reduced Cr peak on brain magnetic resonance spectroscopy; the diagnosis is confirmed by decreased Cr uptake in cultured fibroblasts, and/or identification of a mutation in the SLC6A8 gene. Prevalence studies suggest this disorder may be underdiagnosed. We sought to identify cases from a well-characterized cohort of children diagnosed with neurodevelopmental disorders. Urine screening for CTD was performed on a cohort of 46 males with autism spectrum disorder (ASD) and 9 males with a history of non-ASD developmental delay (DD) classified with intellectual disability. We identified 1 patient with CTD in the cohort based on abnormal urine Cr/Crn, and confirmed the diagnosis by the identification of a novel frameshift mutation in the SLC6A8 gene. This patient presented without ASD but with intellectual disability, and was characterized by a nonspecific phenotype of early language delay and DD that persisted into moderate-to-severe intellectual disability, consistent with previous descriptions of CTD. Identification of patients with CTD is possible by measuring urine Cr and Crn levels and the current case adds to the growing literature of neurocognitive deficits associated with the disorder that affect cognition, language and behavior in childhood.

  4. Quantitative characterization of water transport and flooding in the diffusion layers of polymer electrolyte fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Casalegno, A.; Colombo, L.; Galbiati, S.; Marchesi, R. [Department of Energy, Politecnico di Milano, via Lambruschini 4, 20156 Milano (Italy)

    2010-07-01

    Optimization of water management in polymer electrolyte membrane fuel cells (PEMFC) and in direct methanol fuel cells (DMFC) is a very important factor for the achievement of high performances and long lifetime. A good hydration of the electrolyte membrane is essential for high proton conductivity; on the contrary water in excess may lead to electrode flooding and severe reduction in performances. Many studies on water transport across the gas diffusion layer (GDL) have been carried out to improve these components; anyway efforts in this field are affected by lack of effective experimental methods. The present work reports an experimental investigation with the purpose to determine the global coefficient of water transport across different diffusion layers under real operating conditions. An appropriate and accurate experimental apparatus has been designed and built to test the single GDL under a wide range of operating conditions. Data analysis has allowed quantification of both the water vapor transport across different diffusion layers, and the effects of micro-porous layers; furthermore flooding onset and its consequences on the mass transport coefficient have been characterized by means of suitably defined parameters. (author)

  5. Radial semiconductor drift chambers

    International Nuclear Information System (INIS)

    Rawlings, K.J.

    1987-01-01

    The conditions under which the energy resolution of a radial semiconductor drift chamber based detector system becomes dominated by the step noise from the detector dark current have been investigated. To minimise the drift chamber dark current attention should be paid to carrier generation at Si/SiO 2 interfaces. This consideration conflicts with the desire to reduce the signal risetime: a higher drift field for shorter signal pulses requires a larger area of SiO 2 . Calculations for the single shaping and pseudo Gaussian passive filters indicate that for the same degree of signal risetime sensitivity in a system dominated by the step noise from the detector dark current, the pseudo Gaussian filter gives only a 3% improvement in signal/noise and 12% improvement in rate capability compared with the single shaper performance. (orig.)

  6. ISR Radial Field Magnet

    CERN Multimedia

    1983-01-01

    There were 37 (normal) + 3 (special) Radial Field magnets in the ISR to adjust vertically the closed orbit. Gap heights and strengths were 200 mm and .12 Tm in the normal magnets, 220 mm and .18 Tm in the special ones. The core length was 430 mm in both types. Due to their small length as compared to the gap heights the end fringe field errors were very important and had to be compensated by suitably shaping the poles. In order to save on cables, as these magnets were located very far from their power supplies, the coils of the normal type magnets were formed by many turns of solid cpper conductor with some interleaved layers of hollow conductor directly cooled by circulating water

  7. The ARCS radial collimator

    International Nuclear Information System (INIS)

    Stone, M.B.; Abernathy, D.L.; Niedziela, J.L.; Overbay, M.A.

    2015-01-01

    We have designed, installed, and commissioned a scattered beam radial collimator for use at the ARCS Wide Angular Range Chopper Spectrometer at the Spallation Neutron Source. The collimator has been designed to work effectively for thermal and epithermal neutrons and with a range of sample environments. Other design considerations include the accommodation of working within a high vacuum environment and having the ability to quickly install and remove the collimator from the scattered beam. The collimator is composed of collimating blades (or septa). The septa are 12 micron thick Kapton foils coated on each side with 39 microns of enriched boron carbide ( 10 B 4 C with 10 B > 96%) in an ultra-high vacuum compatible binder. The collimator blades represent an additional 22 m 2 of surface area. In the article we present collimator's design and performance and methodologies for its effective use

  8. Atmospherical experiment in Angra I plant for characterizing the effluent transport threw in the atmospheric

    International Nuclear Information System (INIS)

    Silva Lobo, M.A. da; Kronemberger, B.M.E.

    1989-01-01

    Available as short communication only. The Environmental Safety Division of the Nuclear Safety and Fuel Department from FURNAS Electric Station S.A. joint with the National Oceanic and Atmospheric Administration (NOAA), achieved a field experiment for characterizing the atmospheric transport and diffusion in the site complex of Angra I Nuclear Power Plant. The complex topography with the thick vegetation and the neighbour building bring problems for the modelling of the effluent transport and the dispersion. The actual meteorological measure system is automatic and compound with four towers. An intensive atmospheric measure with captive balloon is included, and the collected data shows that the site flux is strongly influenced by the topography and insolation. (C.G.C.). 2 figs

  9. An integrated methodology for characterizing flow and transport processes in fractured rock

    International Nuclear Information System (INIS)

    Wu, Yu-Shu

    2007-01-01

    To investigate the coupled processes involved in fluid and heat flow and chemical transport in the highly heterogeneous, unsaturated-zone (UZ) fractured rock of Yucca Mountain, we present an integrated modeling methodology. This approach integrates a wide variety of moisture, pneumatic, thermal, and geochemical isotopic field data into a comprehensive three-dimensional numerical model for modeling analyses. The results of field applications of the methodology show that moisture data, such as water potential and liquid saturation, are not sufficient to determine in situ percolation flux, whereas temperature and geochemical isotopic data provide better constraints to net infiltration rates and flow patterns. In addition, pneumatic data are found to be extremely valuable in estimating large-scale fracture permeability. The integration of hydrologic, pneumatic, temperature, and geochemical data into modeling analyses is thereby demonstrated to provide a practical modeling approach for characterizing flow and transport processes in complex fractured formations

  10. Recent developments in the integrated approach toward characterization of radionuclide transport, Yucca Mountain, Nevada

    International Nuclear Information System (INIS)

    Simmons, A.M.; Canepa, J.A.

    1992-01-01

    The radionuclide migration program for the Yucca Mountain Site Characterization Project (YMP) includes studies of radionuclide solubility, sorption, diffusion, and transport. The study plans incorporate all possible parameters of investigation; decision-making strategies for prioritizing the parameters and evaluating their significance were developed in conjunction with the study plans. After definition of explicit research goals for each study, YMP evaluated the applicability of existing data and formulated experimental approaches for obtaining additional data. This resulted in development of individual testing strategies that were integrated into an overall strategy for the radionuclide migration program designed to provide input to credible performance assessments. The strategies allow for decision points at various steps of data collection and testing. They provide a streamlined process toward a defensible level of understanding of chemical retardation and transport processes that will be used to predict the mountain's ability to isolate waste. (author)

  11. Estimating Outer Zone Radial Diffusion Coefficients from Drift Scale Fluctuations in Van Allen Particle Data

    Science.gov (United States)

    O'Brien, T. P., III; Claudepierre, S. G.

    2017-12-01

    During geomagnetic storms, the Earth's outer radiation belt experiences enhanced radial transport. This transport occurs via phase-dependent radial displacements of particles, either by impulsive events or drift resonant waves. Because transport is phase dependent, it produces drift phase bunching, which can be observed with in situ particle detectors. We provide bounds on the radial diffusion coefficients derived from this drift phase structure as seen by NASA's Van Allen Probes. We compare these bounds to published radial diffusion coefficient models, particularly those derived independently from electromagnetic field observations.

  12. Spatially distributed characterization of hyporheic solute transport during baseflow recession in a headwater mountain stream using electrical geophysical imaging

    Science.gov (United States)

    Adam S. Ward; Michael N. Gooseff; Michael Fitzgerald; Thomas J. Voltz; Kamini Singha

    2014-01-01

    The transport of solutes along hyporheic flowpaths is recognized as central to numerous biogeochemical cycles, yet our understanding of how this transport changes with baseflow recession, particularly in a spatially distributed manner, is limited. We conducted four steady-state solute tracer injections and collected electrical resistivity data to characterize hyporheic...

  13. Antiproton compression and radial measurements

    CERN Document Server

    Andresen, G B; Bowe, P D; Bray, C C; Butler, E; Cesar, C L; Chapman, S; Charlton, M; Fajans, J; Fujiwara, M C; Funakoshi, R; Gill, D R; Hangst, J S; Hardy, W N; Hayano, R S; Hayden, M E; Humphries, A J; Hydomako, R; Jenkins, M J; Jorgensen, L V; Kurchaninov, L; Lambo, R; Madsen, N; Nolan, P; Olchanski, K; Olin, A; Page R D; Povilus, A; Pusa, P; Robicheaux, F; Sarid, E; Seif El Nasr, S; Silveira, D M; Storey, J W; Thompson, R I; Van der Werf, D P; Wurtele, J S; Yamazaki, Y

    2008-01-01

    Control of the radial profile of trapped antiproton clouds is critical to trapping antihydrogen. We report detailed measurements of the radial manipulation of antiproton clouds, including areal density compressions by factors as large as ten, achieved by manipulating spatially overlapped electron plasmas. We show detailed measurements of the near-axis antiproton radial profile, and its relation to that of the electron plasma. We also measure the outer radial profile by ejecting antiprotons to the trap wall using an octupole magnet.

  14. Characterization of cadmium plasma membrane transport in gills of a mangrove crab Ucides cordatus

    Energy Technology Data Exchange (ETDEWEB)

    Ortega, P.; Custódio, M.R. [Instituto de Biociências, Departamento de Fisiologia, Universidade de São Paulo, Rua do Matão, Travessa 14, #101, São Paulo 05508-900, SP (Brazil); Zanotto, F.P., E-mail: fzanotto@usp.br [Instituto de Biociências, Departamento de Fisiologia, Universidade de São Paulo, Rua do Matão, Travessa 14, #101, São Paulo 05508-900, SP (Brazil); Departamento de Biofísica, Escola Paulista de Medicina, Universidade Federal de São Paulo, Rua Três de Maio 100, São Paulo 04044-020 (Brazil)

    2014-12-15

    Highlights: • Cd{sup 2+} gill cell transport, a non-essential toxic metal, was characterized in a hypo-hyper-regulating mangrove crab Ucides cordatus. • Cd{sup 2+} enter gill cells through Ca{sup 2+} channels and is dependent of intracellular Ca{sup 2+} levels. • Route of entry in gill cells also involves a Cd{sup 2+}/Ca{sup 2+} (2Na) exchanger. • Cd transport depends on Na{sup +}/K{sup +}-ATPase and gill cell electrochemical gradient. • Vanadate inhibits gill Cd{sup 2+} transport and ouabain increase gill Cd{sup 2+} transport. - Abstract: Membrane pathway for intracellular cadmium (Cd{sup 2+}) accumulation is not fully elucidated in many organisms and has not been studied in crab gill cells. To characterize membrane Cd{sup 2+} transport of anterior and posterior gill cells of Ucides cordatus, a hypo-hyper-regulating crab, a change in intracellular Cd{sup 2+} concentration under various experimental conditions was examined by using FluoZin, a fluorescent probe. The membrane Cd{sup 2+} transport was estimated by the augmentation of FluoZin fluorescence induced by extracellular application of CdCl{sub 2} and different inhibitors. Addition of extracellular calcium (Ca{sup 2+}) to the cells affected little the fluorescence of FluoZin, confirming that Cd{sup 2+} was the main ion increasing intracellular fluorescence. Ca{sup 2+} channels blockers (nimodipine and verapamil) decreased Cd{sup 2+} influx as well as vanadate, a Ca{sup 2+}-ATPase blocker. Chelating intracellular Ca{sup 2+} (BAPTA) decreased Cd{sup 2+} influx in gill cells, while increasing intracellular Ca{sup 2+} (caffeine) augmented Cd influx. Cd{sup 2+} and ATP added at different temporal conditions were not effective at increasing intracellular Cd{sup 2+} accumulation. Ouabain (Na{sup +}/K{sup +}-ATPase inhibitor) increased Cd{sup 2+} influx probably through a change in intracellular Na and/or a change in cell membrane potential. Routes of Cd{sup 2+} influx, a non-essential metal, through the

  15. Radial expansion and multifragmentation

    International Nuclear Information System (INIS)

    Angelique, J.C.; Bizard, G.; Bougault, R.; Brou, R.; Buta, A.; Colin, J.; Cussol, D.; Durand, D.; Kerambrun, A.; Le Brun, C.; Lecolley, J.F.; Lopez, O.; Louvel, M.; Meslin, C.; Nakagawa, T.; Patry, J.P.; Peter, J.; Popescu, R.; Regimbart, R.; Steckmeyer, J.C.; Tamain, B.; Vient, E.; Yuasa-Nakagawa, K.; Wieloch, A.

    1998-01-01

    The light systems 36 Ar + 27 Al and 64 Zn + nat Ti were measured at several bombarding energies between ∼ 35 and 95 MeV/nucleon. It was found that the predominant part of the cross section is due to binary collisions. In this paper the focus is placed on the properties of the quasi-projectile nuclei. In the central collisions the excitation energies of the quasi-projectile reach values exceeding largely 10 MeV/nucleon. The slope of the high energy part of the distribution can give only an upper limit of the apparent temperature (the average temperature along the decay chain). The highly excited quasi-projectile may get rapidly fragmented rather than sequentially. The heavy fragments are excited and can emit light particles (n, p, d, t, 3 He, α,...) what perturbs additionally the spectrum of these particles. Concerning the expansion energy, one can determine the average kinetic energies of the product (in the quasi-projectile-framework) and compare with simulation values. To fit the experimental data an additional radial expansion energy is to be considered. The average expansion energy depends slightly on the impact parameter but it increases with E * / A, ranging from 0.4 to 1,2 MeV/nucleon for an excitation energy increasing from 7 to 10.5 MeV/nucleon. This collective radial energy seems to be independent of the fragment mass, what is possibly valid for the case of larger quasi-projectile masses. The origin of the expansion is to be determined. It may be due to a compression in the interaction zone at the initial stage of the collision, which propagates in the quasi-projectile and quasi-target, or else, may be due, simply, to the increase of thermal energy leading to a rapid fragment emission. The sequential de-excitation calculation overestimates light particle emission and consequently heavy residues, particularly, at higher excitation energies. This disagreement indicates that a sequential process can not account for the di-excitation of very hot nuclei

  16. Dynamical interplay between fluctuations, electric fields and transport in fusion plasmas

    International Nuclear Information System (INIS)

    Hidalgo, C.; Pedrosa, M.A.; Goncalves, B.

    2003-01-01

    A view of recent experimental results and progress in the characterization of the statistical properties of electrostatic turbulence in magnetically confined devices is given. An empirical similarity in the scaling properties of the probability distribution function (PDF) of turbulent transport has been observed in the plasma edge region in fusion plasmas. The investigation of the dynamical interplay between fluctuation in gradients, turbulent transport and radial electric fields has shows that these parameters are strongly coupled both in tokamak and stellarator plasmas. The bursty behaviour of turbulent transport is linked with a departure from the most probable radial gradient. The dynamical relation between fluctuations in gradients and transport is strongly affected by the presence of sheared poloidal flows which organized themselves near marginal stability. These results emphasize the importance of the statistical description of transport processes in fusion plasmas as an alternative approach to the traditional way to characterize transport based on the computation of effective transport coefficients. (author)

  17. Preparation, characterization, biological activity, and transport study of polystyrene based calcium–barium phosphate composite membrane

    Energy Technology Data Exchange (ETDEWEB)

    Khan, Mohammad Mujahid Ali; Rafiuddin,, E-mail: rafi_amu@rediffmail.com

    2013-10-15

    Calcium–barium phosphate (CBP) composite membrane with 25% polystyrene was prepared by co-precipitation method. Scanning electron microscopy (SEM), X-ray diffraction (XRD), Fourier transformed infrared (FTIR), and Thermogravimetric analysis (TGA) were used to characterize the membrane. The membrane was found to be crystalline in nature with consistent arrangement of particles and no indication of visible cracks. The electrical potentials measured across the composite membrane in contact with univalent electrolytes (KCl, NaCl and LiCl), have been found to increase with decrease in concentrations. Thus the membrane was found to be cation-selective. Transport properties of developed membranes may be utilized for the efficient desalination of saline water and more importantly demineralization process. The antibacterial study of this composite membrane shows good results for killing the disease causing bacteria along with waste water treatment. Highlights: • Transport properties of composite membrane are evaluated. • The composite membrane was found to be stable in all media. • TMS method is used for electrochemical characterization. • The membrane was found to be cation selective. • The order of surface charge density was found to be LiCl < NaCl < KCl.

  18. A nu-space for ICS: characterization and application to measure protein transport in live cells.

    Science.gov (United States)

    Potvin-Trottier, Laurent; Chen, Lingfeng; Horwitz, Alan Rick; Wiseman, Paul W

    2013-08-01

    We introduce a new generalized theoretical framework for image correlation spectroscopy (ICS). Using this framework, we extend the ICS method in time-frequency ( ν , nu) space to map molecular flow of fluorescently tagged proteins in individual living cells. Even in the presence of a dominant immobile population of fluorescent molecules, nu-space ICS (nICS) provides an unbiased velocity measurement, as well as the diffusion coefficient of the flow, without requiring filtering. We also develop and characterize a tunable frequency-filter for STICS that allows quantification of the density, the diffusion coefficient and the velocity of biased diffusion. We show that the techniques are accurate over a wide range of parameter space in computer simulation. We then characterize the retrograde flow of adhesion proteins ( α 6- and αLβ 2-GFP integrins and mCherry-paxillin) in CHO.B2 cells plated on laminin and ICAM ligands respectively. STICS with a tunable frequency filter, in conjunction with nICS, measures two new transport parameters, the density and transport bias coefficient (a measure of the diffusive character of a flow/biased diffusion), showing that molecular flow in this cell system has a significant diffusive component. Our results suggest that the integrinligand interaction, along with the internal myosin-motor generated force, varies for different integrin-ligand pairs, consistent with previous results.

  19. Thermal transport characterization of hexagonal boron nitride nanoribbons using molecular dynamics simulation

    Directory of Open Access Journals (Sweden)

    Asir Intisar Khan

    2017-10-01

    Full Text Available Due to similar atomic bonding and electronic structure to graphene, hexagonal boron nitride (h-BN has broad application prospects such as the design of next generation energy efficient nano-electronic devices. Practical design and efficient performance of these devices based on h-BN nanostructures would require proper thermal characterization of h-BN nanostructures. Hence, in this study we have performed equilibrium molecular dynamics (EMD simulation using an optimized Tersoff-type interatomic potential to model the thermal transport of nanometer sized zigzag hexagonal boron nitride nanoribbons (h-BNNRs. We have investigated the thermal conductivity of h-BNNRs as a function of temperature, length and width. Thermal conductivity of h-BNNRs shows strong temperature dependence. With increasing width, thermal conductivity increases while an opposite pattern is observed with the increase in length. Our study on h-BNNRs shows considerably lower thermal conductivity compared to GNRs. To elucidate these aspects, we have calculated phonon density of states for both h-BNNRs and GNRs. Moreover, using EMD we have explored the impact of different vacancies, namely, point vacancy, edge vacancy and bi-vacancy on the thermal conductivity of h-BNNRs. With varying percentages of vacancies, significant reduction in thermal conductivity is observed and it is found that, edge and point vacancies are comparatively more destructive than bi-vacancies. Such study would contribute further into the growing interest for accurate thermal transport characterization of low dimensional nanostructures.

  20. Radial gas turbine design

    Energy Technology Data Exchange (ETDEWEB)

    Krausche, S.; Ohlsson, Johan

    1998-04-01

    The objective of this work was to develop a program dealing with design point calculations of radial turbine machinery, including both compressor and turbine, with as few input data as possible. Some simple stress calculations and turbine metal blade temperatures were also included. This program was then implanted in a German thermodynamics program, Gasturb, a program calculating design and off-design performance of gas turbines. The calculations proceed with a lot of assumptions, necessary to finish the task, concerning pressure losses, velocity distribution, blockage, etc., and have been correlated with empirical data from VAT. Most of these values could have been input data, but to prevent the user of the program from drowning in input values, they are set as default values in the program code. The output data consist of geometry, Mach numbers, predicted component efficiency etc., and a number of graphical plots of geometry and velocity triangles. For the cases examined, the error in predicted efficiency level was within {+-} 1-2% points, and quite satisfactory errors in geometrical and thermodynamic conditions were obtained Examination paper. 18 refs, 36 figs

  1. Morphological, Chemical Surface, and Diffusive Transport Characterizations of a Nanoporous Alumina Membrane

    Directory of Open Access Journals (Sweden)

    María I. Vázquez

    2015-12-01

    Full Text Available Synthesis of a nanoporous alumina membrane (NPAM by the two-step anodization method and its morphological and chemical surface characterization by analyzing Scanning Electron Microscopy (SEM micrographs and X-Ray Photoelectron Spectroscopy (XPS spectra is reported. Influence of electrical and diffusive effects on the NaCl transport across the membrane nanopores is determined from salt diffusion measurements performed with a wide range of NaCl concentrations, which allows the estimation of characteristic electrochemical membrane parameters such as the NaCl diffusion coefficient and the concentration of fixed charges in the membrane, by using an appropriated model and the membrane geometrical parameters (porosity and pore length. These results indicate a reduction of ~70% in the value of the NaCl diffusion coefficient through the membrane pores with respect to solution. The transport number of ions in the membrane pores (Na+ and Cl−, respectively were determined from concentration potential measurements, and the effect of concentration-polarization at the membrane surfaces was also considered by comparing concentration potential values obtained with stirred solutions (550 rpm and without stirring. From both kinds of results, a value higher than 0.05 M NaCl for the feed solution seems to be necessary to neglect the contribution of electrical interactions in the diffusive transport.

  2. Size graded sediment dynamics: from the processes characterization to the transport modelling in the English Channel

    International Nuclear Information System (INIS)

    Blanpain, O.

    2009-10-01

    The purpose of this work is the implementation of a sediment transport model in the English Channel. The design of such a model requires the identification of the physical processes, their modelling and their in-situ validation. Because of the sedimentary particularities of the study area, modelling of the mechanical behaviour of a non uniform mixture of sediments and particularly of the fine grains within a coarse matrix is required. This study focused on the characterization of the relevant processes by acquisition of experimental and in-situ data. Data acquired in hydro-sedimentary conditions comparable to those found in the English Channel are scarce. A new instrument and image processing technique were specifically conceived and implemented in-situ to observe and measure, with a high temporal resolution, the dynamics of a strongly heterogeneous mixture of particles in a grain-size scale. The data collected compared well with several existing formulations. One of these formulations was chosen to be adapted. The transfer dynamics of fine grains in coarse sediments and their depth of penetration were acquired from stratigraphic samples. The sediment transport model deals with multi-size grains and multi sedimentary layers, it is forced by swell and currents, and accounts for bead load and suspended load transports. It was applied to realistic scenarios for the English Channel. (author)

  3. Dopamine transporter; solubilization and characterization of [3H] GBR-12935 binding in canine caudate

    International Nuclear Information System (INIS)

    Sallee, F.R.

    1988-01-01

    The dopamine (DA) transporter protein, as indexed by [ 3 H]GBR-12935 binding, was solubilized from canine striatal membranes with the detergent digitonin. This solubilized protein retained the same pharmacological characteristics as membrane attached uptake sites. The binding of [ 3 H]GBR-12935 to solubilized preparations was specific, saturable and reversible with an equilibrium dissociation constant of approximately 3 nM and a maximum ligand binding (B max ) of 3.4 pmol/mg protein. [ 3 H]GBR-12935 also bound to solubilized sites in a sodium-independent manner with a K D of approximately 6 nM and a B max of 1.2 ± 0.2 pmol/mg protein. Dopamine uptake inhibitors and substrates of DA uptake inhibited [ 3 H]GBR-12935 binding in a stereoselective and concentration dependent manner. For these compounds rank order of potency for inhibition of [ 3 H]GBR-12935 binding correlated with their potency for inhibition of dopamine uptake. K D values for DA uptake inhibitors in solubilized preparations correlated with those obtained on [ 3 H]GBR-12935 binding in the native state. The dopamine transporter appears to be a transmembrane glycoprotein by virtue of its absorption and specific elution from wheat germ agglutinin (WGA)-lectin column. Solubilization of the putative dopamine transporter with full retention of binding activity now allows for the purification and biochemical characterization of this important membrane protein

  4. Control of the radial electric field shear by modification of the magnetic field configuration in LHD

    International Nuclear Information System (INIS)

    Ida, K.; Yoshinuma, M.; Yokoyama, M.

    2005-01-01

    Control of the radial electric field, E γ , is considered to be important in helical plasmas, because the radial electric field and its shear are expected to reduce neoclassical and anomalous transport, respectively. In general, the radial electric field can be controlled by changing the collisionality, and positive or negative electric field have been obtained by decreasing or increasing the electron density, respectively. Although the sign of the radial electric field can be controlled by changing the collisionality, modification of the magnetic field is required to achieve further control of the radial electric field, especially producing a strong radial electric field shear. In the Large Helical Device (LHD) the radial electric field profiles are shown to be controlled by the modification of the magnetic field by 1) changing the radial profile of the helical ripples, ε h , 2) creating a magnetic island with an external perturbation field coil and 3) changing the local island divertor coil current. (author)

  5. Control of the radial electric field shear by modification of the magnetic field configuration in LHD

    International Nuclear Information System (INIS)

    Ida, K.; Yoshinuma, M.; Yokoyama, M.

    2005-01-01

    Control of the radial electric field, E r , is considered to be important in helical plasmas, because the radial electric field and its shear are expected to reduce neoclassical and anomalous transport, respectively. In general, the radial electric field can be controlled by changing the collisionality, and positive or negative electric fields have been obtained by decreasing or increasing the electron density, respectively. Although the sign of the radial electric field can be controlled by changing the collisionality, modification of the magnetic field is required to achieve further control of the radial electric field, especially to produce a strong radial electric field shear. In the Large Helical Device (LHD) the radial electric field profiles are shown to be controlled by the modification of the magnetic field by (1) changing the radial profile of the effective helical ripples, ε h (2) creating a magnetic island with an external perturbation field coil and (3) changing the local island divertor coil current

  6. Stability of radial swirl flows

    International Nuclear Information System (INIS)

    Dou, H S; Khoo, B C

    2012-01-01

    The energy gradient theory is used to examine the stability of radial swirl flows. It is found that the flow of free vortex is always stable, while the introduction of a radial flow will induce the flow to be unstable. It is also shown that the pure radial flow is stable. Thus, there is a flow angle between the pure circumferential flow and the pure radial flow at which the flow is most unstable. It is demonstrated that the magnitude of this flow angle is related to the Re number based on the radial flow rate, and it is near the pure circumferential flow. The result obtained in this study is useful for the design of vaneless diffusers of centrifugal compressors and pumps as well as other industrial devices.

  7. Characterization of transport properties in uranium dioxide: the case of the oxygen auto-diffusion

    International Nuclear Information System (INIS)

    Fraczkiewicz, M.; Baldinozzi, G.

    2008-01-01

    Point defects in uranium dioxide which control the transport phenomena are still badly known. The aim of this work is to show how in carrying out several experimental techniques, it is possible to demonstrate both the existence and to determine the nature (charge and localization) of predominant defects responsible of the transport phenomena in a fluorite-type structure oxide. The oxygen diffusion in the uranium dioxide illustrates this. In the first part of this work, the accent is put on the electric properties of uranium dioxide and more particularly on the variation laws of the electric conductivity in terms of temperature, of oxygen potential and of the impurities amounts present in the material. These evolutions are connected to point and charged complex defects models and the pertinence of these models is discussed. Besides, it is shown how the electric conductivity measurements can allow to define oxygen potential domains in which the concentrations in electronic carriers are controlled. This characterization being made, it is shown that the determination of the oxygen intrinsic diffusion coefficient and particularly its dependence to the oxygen potential and to the amount of impurity, allows to determine the main defect responsible to the atomic diffusion as well as its nature and its charge. In the second part, the experimental techniques to determine the oxygen diffusion coefficient are presented: there are the isotopic exchange technique for introducing the tracer in the material, and two techniques to characterize the diffusion profiles (SIMS and NRA). Examples of preliminary results are given for mono and polycrystalline samples. At last, from this methodology on uranium dioxide, studies considered to quantify the thermal and physicochemical effects are presented. Experiments considered with the aim to characterize the radiation diffusion in uranium dioxide are presented too. (O.M.)

  8. Characterization of events of transport over the Mediterranean Basin during summer 2012

    Science.gov (United States)

    Bucci, Silvia; Fierli, Federico; Di Donfrancesco, Guido; Diliberto, Luca; Viterbini, Maurizio; Ravetta, François; Pap, Ines; Weinhold, Kay; Größ, Johannes; Wiedensohler, Alfred; Cairo, Francesco

    2014-05-01

    Long-range transport has a great influence on the atmospheric composition in the Mediterranean Basin (MB). This work focuses on the dust intrusion events and the outflows of polluted air from the Po Valley during the PEGASOS (Pan-European Gas-AeroSOls Climate Interaction Study), TRAQA (TRAnsport et Qualité de l'Air au dessus du bassin Méditerranéen) and Supersito Arpa (Emilia Romagna) measurements campaigns of June - July 2012. In order to investigate the sources and identify the transport patterns, numerical simulations, in-situ, remote sensing and airborne aerosol measurements were jointly used. The ground based lidar situated at the San Pietro Capofiume (SPC) station, in the eastern part of the Po Valley, provides continuous measurements of backscatter and depolarization profiles and the Aerodynamical Particle Sizer (APS), in the same site, gives the aerosol spectral distribution at the ground. Observations show two main events of mineral aerosol inflow over north Italy (19- 21 June and 29-01 July). Optical properties provide a primary discrimination between coarser (likely dust) and finer particles (probably anthropogenic). The vertical statistical distribution of the different aerosol classes shows that larger particles are mainly individuated over the Planetary Boundary Layer (PBL) level while smaller particles tend to follow the daily evolution of the PBL or remain confined under it. Dust events are also detected during the TRAQA airborne campaign in the area of the gulf of Genoa, contributing to the identification of the dust plume characterization. Cluster trajectories analysis coupled to mesoscale simulations highlights the effective export of air masses from the Sahara with frequent intrusions of dust over the Po Valley, as recorded in the observational SPC site. Transport analysis also indicates an inversion of the main advection pattern (the Po Valley outflow is mainly directed eastward in the Adriatic region) during 23th and 26th June, with a

  9. Characterization of Contaminant Transport using Naturally-Occurring U-Series Disequilibria - Final Report

    International Nuclear Information System (INIS)

    Murrell, Michael T.; Ku, Teh-Lung

    2001-01-01

    The interactions of mixed wastes containing radionuclides with solid rock surface and the mobility of the radionuclides in aquifer systems depend not only on the chemistry of the nuclides and the physico-chemical effects of radioactive decay, but also on the site-specific hydrogeology. Thus, to characterize contaminant transport, it is best to cross-check figures derived from any small-scale laboratory experiments over limited times with that obtained from field-oriented, natural analog studies. We propose such a study using the naturally-occurring U and Th decay-series disequilibria. The work of ours and other researchers have shown that the parent/daughter disequilibrium patterns existing in groundwater systems can be modeled in terms of local nuclide mass balance to arrive at such information as the rock-water contact time (fluid flow) and rates of contaminant transport, taking into account the retardation effect due to nuclide/rock interaction contaminants at INEL by grouping them into three categories, represented by isotopes of (1) Th and Pa, (2) U and (3) Ra. Mass spectrometric measurements of these elements will be emphasized in order to minimize sample size requirements and to maximize precision. Results will form the data base for a model code for computing: (1) Fluid residence time (transport rates) in the basalt aquifers at various locations, (2) The in-situ adsorption and desorption rate constants, as well as the retardation factors, of various radionuclide wastes, and (3) Rock dissolution rate and its relation to preferential flow and contamination transport in the fractured rock

  10. Design and characterization of a neutralized-transport experiment for heavy-ion fusion

    Directory of Open Access Journals (Sweden)

    Enrique Henestroza

    2004-08-01

    Full Text Available In heavy-ion inertial-confinement fusion systems, intense beams of ions must be transported from the exit of the final-focus magnet system through the fusion chamber to hit spots on the target with radii of about 2 mm. For the heavy-ion-fusion power-plant scenarios presently favored in the U.S., a substantial fraction of the ion-beam space charge must be neutralized during this final transport. The most effective neutralization technique found in numerical simulations is to pass each beam through a low-density plasma after the final focusing. To provide quantitative comparisons of these theoretical predictions with experiment, the Virtual National Laboratory for Heavy Ion Fusion has completed the construction and has begun experimentation with the neutralized-transport experiment. The experiment consists of three main sections, each with its own physics issues. The injector is designed to generate a very high-brightness, space-charge-dominated potassium beam, while still allowing variable perveance by a beam aperturing technique. The magnetic-focusing section, consisting of four pulsed quadrupoles, permits the study of magnet tuning, as well as the effects of phase-space dilution due to higher-order nonlinear fields. In the final section, the converging ion beam exiting the magnetic section is transported through a drift region with plasma sources for beam neutralization, and the final spot size is measured under various conditions of neutralization. In this paper, we discuss the design and characterization of the three sections in detail and present initial results from the experiment.

  11. Oculoauriculovertebral spectrum with radial anomaly in child.

    Science.gov (United States)

    Taksande, Amar; Vilhekar, Krishna

    2013-01-01

    Oculoauriculovertebral spectrum (OAVS) or Goldenhar syndrome is a wide spectrum of congenital anomalies that involves structures arising from the first and second branchial arches. It is characterized by a wide spectrum of symptoms and physical features. These abnormalities mainly involve the cheekbones, jaws, mouth, ears, eyes, or vertebrae. Other conditions with ear and/or radial involvement, such as, the Nager syndrome, Holt-Oram syndrome, Radial-renal syndrome, facioauriculoradial dysplasia, Fanconi anemia, and Vertebral, Anal atresia, Cardiac, Trachea, Esophageal, Renal, and Limb (VACTERL) association should be considered for differential diagnosis. Here we report a child who had facial asymmetry, microsomia, microtia, congenital facial nerve palsy, conductive hearing loss, skin tags, iris coloboma, and preaxial polydactyly.

  12. Oculoauriculovertebral spectrum with radial anomaly in child

    Directory of Open Access Journals (Sweden)

    Amar Taksande

    2013-01-01

    Full Text Available Oculoauriculovertebral spectrum (OAVS or Goldenhar syndrome is a wide spectrum of congenital anomalies that involves structures arising from the first and second branchial arches. It is characterized by a wide spectrum of symptoms and physical features. These abnormalities mainly involve the cheekbones, jaws, mouth, ears, eyes, or vertebrae. Other conditions with ear and/or radial involvement, such as, the Nager syndrome, Holt-Oram syndrome, Radial-renal syndrome, facioauriculoradial dysplasia, Fanconi anemia, and Vertebral, Anal atresia, Cardiac, Trachea, Esophageal, Renal, and Limb (VACTERL association should be considered for differential diagnosis. Here we report a child who had facial asymmetry, microsomia, microtia, congenital facial nerve palsy, conductive hearing loss, skin tags, iris coloboma, and preaxial polydactyly.

  13. Stability of a radial immiscible drive

    Energy Technology Data Exchange (ETDEWEB)

    Bataille, J

    1968-11-01

    The stability of the displacement front between 2 immiscible fluids of radial flow between 2 parallel plates (Hele-Shaw model) is studied mathematically by superposing onto the circular displacement front a sinusoidal perturbation. The equations are reduced to dimensionless variables, and it is shown that the stable and unstable domains in a plot: dimensionless viscosity vs. dimensionless time are separated by a polygonal contour, each side of the contour being characterized by the (integer) number of perturbations along the circumference. There is a critical reduced time below which the perturbations are amortized but beyond which they are amplified. Experimental results have been in fair general agreement with theoretical results, the divergence between them being attributable to neglecting capillary phenomena, which may become very important at large radial distances. One test with miscible fluids has shown that even in this case, there is a critical time or an equivalent critical radius.

  14. Transportation

    National Research Council Canada - National Science Library

    Adams, James; Carr, Ron; Chebl, Maroun; Coleman, Robert; Costantini, William; Cox, Robert; Dial, William; Jenkins, Robert; McGovern, James; Mueller, Peter

    2006-01-01

    ...., trains, ships, etc.) and maximizing intermodal efficiency. A healthy balance must be achieved between the flow of international commerce and security requirements regardless of transportation mode...

  15. Investigation of methods for fabricating, characterizing, and transporting cryogenic inertial-confinement-fusion tartets

    International Nuclear Information System (INIS)

    Fanning, J.J.; Kim, K.

    1981-01-01

    The objective of this work is to investigate methods for fabricating, characterizing and transporting cryogenic inertial confinement fusion targets on a continuous basis. A microprocessor-based data acquisition system has been built that converts a complete target image to digital data, which are then analyzed by automated software procedures. The low temperatures required to freeze the hydrogen isotopes contained in a target is provided by a cryogenic cold chamber capable of attaining 15 K. A new method for target manipulation and positioning is studied that employs molecular gas beams to levitate a target and an electrostatic quadrupole structure to provide for its lateral containment. Since the electrostatic target-positioning scheme requires that the targets be charged, preliminary investigation has been carried out for a target-charging mechanism based on ion-bombardment

  16. Investigation of methods for fabricating, characterizing, and transporting cryogenic inertial-confinement-fusion tartets

    Energy Technology Data Exchange (ETDEWEB)

    Fanning, J.J.; Kim, K.

    1981-01-01

    The objective of this work is to investigate methods for fabricating, characterizing and transporting cryogenic inertial confinement fusion targets on a continuous basis. A microprocessor-based data acquisition system has been built that converts a complete target image to digital data, which are then analyzed by automated software procedures. The low temperatures required to freeze the hydrogen isotopes contained in a target is provided by a cryogenic cold chamber capable of attaining 15 K. A new method for target manipulation and positioning is studied that employs molecular gas beams to levitate a target and an electrostatic quadrupole structure to provide for its lateral containment. Since the electrostatic target-positioning scheme requires that the targets be charged, preliminary investigation has been carried out for a target-charging mechanism based on ion-bombardment.

  17. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz

    2013-01-01

    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  18. Transportation

    International Nuclear Information System (INIS)

    Anon.

    1998-01-01

    Here is the decree of the thirtieth of July 1998 relative to road transportation, to trade and brokerage of wastes. It requires to firms which carry out a road transportation as well as to traders and to brokers of wastes to declare their operations to the prefect. The declaration has to be renewed every five years. (O.M.)

  19. Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

    KAUST Repository

    Scheu, Arne Hagen August

    2017-05-01

    Soil salinity is a major abiotic stress for land plants, and multiple mechanisms of salt tolerance have evolved. Tissue tolerance is one of these mechanisms, which involves the sequestration of sodium into the vacuole to retain low cytosolic sodium concentrations. This enables the plant to maintain cellular functions, and ultimately maintain growth and yield. However, the molecular components involved in tissue tolerance remain elusive. Several candidate genes for vacuolar sodium sequestration have recently been identified by proteome analysis of vacuolar membranes purified from the salt-tolerant cereal Hordeum vulgare (barley). In this study, I aimed to characterize these candidates in more detail. I successfully cloned coding sequences for the majority of candidate genes with primers designed based on the barley reference genome sequence. During the course of this study a newer genome sequence with improved annotations was published, to which I also compared my observations. To study the candidate genes, I used the heterologous expression system Saccharomyces cerevisiae (yeast). I used several salt sensitive yeast strains (deficient in intrinsic sodium transporters) to test whether the candidate genes would affect their salt tolerance by mediating the sequestration of sodium into the yeast vacuole. I observed a reduction in growth upon expression for several of the gene candidate under salt-stress conditions. However, confocal microscopy suggests that most gene products are subject to degradation, and did not localize to the vacuolar membrane (tonoplast). Therefore, growth effects cannot be linked to protein function without further evidence. Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

  20. Characterizing the Role of Nanoparticle Design on Tumor Transport and Stability in the Extracellular Environment

    Science.gov (United States)

    Albanese, Alexandre

    Nanotechnology has emerged as an exciting strategy for the delivery of diagnostic and therapeutic agents into established tumors. Advancements in nanomaterial synthesis have generated an extensive number of nanoparticle designs made from different materials. Unfortunately, it remains impossible to predict a design's effectiveness for in vivo tumor accumulation. Little is known about how a nanoparticle's morphology and surface chemistry affect its interactions with cells and proteins inside the tumor tissue. This thesis focuses on the development of in vitro experimental tools to evaluate how nanoparticle design affects transport in a three-dimensional tumor tissue and stability in the tumor microenvironment. Nanoparticle transport was evaluated using a novel 'tumor-on-a-chip' system where multicellular tumor spheroids were immobilized in a microfluidic channel. This setup created a three-dimensional tumor environment displaying physiological cell density, extracellular matrix organization, and interstitial flow rates. The tumor-on-a-chip demonstrated that accumulation of nanoparticles was limited to diameters below 110 nm and was improved by receptor targeting. Nanoparticle stability in the tumor microenvironment was evaluated using media isolated from different tumor cell lines. Nanoparticle diameter and surface chemistry were important determinants of stability in cancer cell-conditioned media. Small nanoparticles with unstable surface chemistries adsorbed cellular proteins on their surface and were prone to aggregation. Nanoparticle aggregation altered cellular interactions leading to changes in cell uptake. Using a novel technique to generate different aggregate sizes possessing a uniform surface composition, it was determined that aggregation can change receptor affinity, cell internalization mechanisms and sub-cellular sequestration patterns. Data from this thesis characterize the behavior of nanoparticles within modeled tumor environments and provide some

  1. Genome-wide identification and expression characterization of ABCC-MRP transporters in hexaploid wheat.

    Science.gov (United States)

    Bhati, Kaushal K; Sharma, Shivani; Aggarwal, Sipla; Kaur, Mandeep; Shukla, Vishnu; Kaur, Jagdeep; Mantri, Shrikant; Pandey, Ajay K

    2015-01-01

    The ABCC multidrug resistance associated proteins (ABCC-MRP), a subclass of ABC transporters are involved in multiple physiological processes that include cellular homeostasis, metal detoxification, and transport of glutathione-conjugates. Although they are well-studied in humans, yeast, and Arabidopsis, limited efforts have been made to address their possible role in crop like wheat. In the present work, 18 wheat ABCC-MRP proteins were identified that showed the uniform distribution with sub-families from rice and Arabidopsis. Organ-specific quantitative expression analysis of wheat ABCC genes indicated significantly higher accumulation in roots (TaABCC2, TaABCC3, and TaABCC11 and TaABCC12), stem (TaABCC1), leaves (TaABCC16 and TaABCC17), flag leaf (TaABCC14 and TaABCC15), and seeds (TaABCC6, TaABCC8, TaABCC12, TaABCC13, and TaABCC17) implicating their role in the respective tissues. Differential transcript expression patterns were observed for TaABCC genes during grain maturation speculating their role during seed development. Hormone treatment experiments indicated that some of the ABCC genes could be transcriptionally regulated during seed development. In the presence of Cd or hydrogen peroxide, distinct molecular expression of wheat ABCC genes was observed in the wheat seedlings, suggesting their possible role during heavy metal generated oxidative stress. Functional characterization of the wheat transporter, TaABCC13 a homolog of maize LPA1 confirms its role in glutathione-mediated detoxification pathway and is able to utilize adenine biosynthetic intermediates as a substrate. This is the first comprehensive inventory of wheat ABCC-MRP gene subfamily.

  2. Fugitive emission source characterization using a gradient-based optimization scheme and scalar transport adjoint

    Science.gov (United States)

    Brereton, Carol A.; Joynes, Ian M.; Campbell, Lucy J.; Johnson, Matthew R.

    2018-05-01

    Fugitive emissions are important sources of greenhouse gases and lost product in the energy sector that can be difficult to detect, but are often easily mitigated once they are known, located, and quantified. In this paper, a scalar transport adjoint-based optimization method is presented to locate and quantify unknown emission sources from downstream measurements. This emission characterization approach correctly predicted locations to within 5 m and magnitudes to within 13% of experimental release data from Project Prairie Grass. The method was further demonstrated on simulated simultaneous releases in a complex 3-D geometry based on an Alberta gas plant. Reconstructions were performed using both the complex 3-D transient wind field used to generate the simulated release data and using a sequential series of steady-state RANS wind simulations (SSWS) representing 30 s intervals of physical time. Both the detailed transient and the simplified wind field series could be used to correctly locate major sources and predict their emission rates within 10%, while predicting total emission rates from all sources within 24%. This SSWS case would be much easier to implement in a real-world application, and gives rise to the possibility of developing pre-computed databases of both wind and scalar transport adjoints to reduce computational time.

  3. Experimental characterization of the water transport properties of PEM fuel cells diffusion media

    Science.gov (United States)

    Ramos-Alvarado, Bladimir; Sole, Joshua D.; Hernandez-Guerrero, Abel; Ellis, Michael W.

    2012-11-01

    A full experimental characterization of the liquid water transport properties of Toray TGP-090 paper is carried out in this work. Porosity, capillary pressure curves (capillary pressure-saturation relationships), absolute permeability, and relative permeability are obtained via experimental procedures. Porosity was determined using two methods, both aimed to obtain the solid volume of the network of fibers comprising the carbon paper. Capillary pressure curves were obtained using a gas displacement porosimeter where liquid water is injected using a syringe pump and the capillary pressure is recorded using a differential pressure transducer. Absolute and relative permeability were also measured with an apparatus designed at Virginia Tech. Absolute permeability was calculated at different flow rates using nitrogen. On the other hand, relative permeability was a more complicated task to carry out giving the complexity (two-phase flow condition) of this property. All of the water transport properties of Toray TGP-090 were studied under the effects of wet-proofing (PTFE treatment) and compression. Some observations were that wet-proofing reduces the porosity of the raw material, increases the hydrophobicity (Pc-S curves), and reduces the permeability of the material. Similar effects were observed for compression, where compressed material exhibited trends similar to those of wet-proofing effects. The results presented here will allow a more accurate modeling of PEMFCs, providing an experimentally verified alternative to the assumptions frequently employed.

  4. Radial retinotomy in the macula.

    Science.gov (United States)

    Bovino, J A; Marcus, D F

    1984-01-01

    Radial retinotomy is an operative procedure usually performed in the peripheral or equatorial retina. To facilitate retinal attachment, the authors used intraocular scissors to perform radial retinotomy in the macula of two patients during vitrectomy surgery. In the first patient, a retinal detachment complicated by periretinal proliferation and macula hole formation was successfully reoperated with the aid of three radial cuts in the retina at the edges of the macular hole. In the second patient, an intraoperative retinal tear in the macula during diabetic vitrectomy was also successfully repaired with the aid of radial retinotomy. In both patients, retinotomy in the macula was required because epiretinal membranes, which could not be easily delaminated, were hindering retinal reattachment.

  5. Detonation in supersonic radial outflow

    KAUST Repository

    Kasimov, Aslan R.; Korneev, Svyatoslav

    2014-01-01

    We report on the structure and dynamics of gaseous detonation stabilized in a supersonic flow emanating radially from a central source. The steady-state solutions are computed and their range of existence is investigated. Two-dimensional simulations

  6. Dedicated radial ventriculography pigtail catheter

    Energy Technology Data Exchange (ETDEWEB)

    Vidovich, Mladen I., E-mail: miv@uic.edu

    2013-05-15

    A new dedicated cardiac ventriculography catheter was specifically designed for radial and upper arm arterial access approach. Two catheter configurations have been developed to facilitate retrograde crossing of the aortic valve and to conform to various subclavian, ascending aortic and left ventricular anatomies. The “short” dedicated radial ventriculography catheter is suited for horizontal ascending aortas, obese body habitus, short stature and small ventricular cavities. The “long” dedicated radial ventriculography catheter is suited for vertical ascending aortas, thin body habitus, tall stature and larger ventricular cavities. This new design allows for improved performance, faster and simpler insertion in the left ventricle which can reduce procedure time, radiation exposure and propensity for radial artery spasm due to excessive catheter manipulation. Two different catheter configurations allow for optimal catheter selection in a broad range of patient anatomies. The catheter is exceptionally stable during contrast power injection and provides equivalent cavity opacification to traditional femoral ventriculography catheter designs.

  7. Forty years of 9Sr in situ migration: importance of soil characterization in modeling transport phenomena

    International Nuclear Information System (INIS)

    Fernandez, J.M.; Piault, E.; Macouillard, D.; Juncos, C.

    2006-01-01

    In 1960 experiments were carried out on the transfer of 9 Sr between soil, grapes and wine. The experiments were conducted in situ on a piece of land limited by two control strips. The 9 Sr migration over the last 40 years was studied by performing radiological and physico-chemical characterizations of the soil on eight 70 cm deep cores. The vertical migration modeling of 9 Sr required the definition of a triple layer conceptual model integrating the rainwater infiltration at constant flux as the only external factor of influence. Afterwards the importance of a detailed soil characterization for modeling was discussed and satisfactory simulation of the 9 Sr vertical transport was obtained and showed a calculated migration rate of about 1.0 cm year -1 in full agreement with the in situ measured values. The discussion was regarding some of the key parameters such as granulometry, organic matter content (in the Van Genuchten parameter determination), Kd and the efficient rainwater infiltration. Besides the experimental data, simplifying assumptions in modeling such as water-soil redistribution calculation and factual discontinuities in conceptual model were examined

  8. Characterization of a novel sialic acid transporter of the sodium solute symporter (SSS) family and in vivo comparison with known bacterial sialic acid transporters.

    Science.gov (United States)

    Severi, Emmanuele; Hosie, Arthur H F; Hawkhead, Judith A; Thomas, Gavin H

    2010-03-01

    The function of sialic acids in the biology of bacterial pathogens is reflected by the diverse range of solute transporters that can recognize these sugar acids. Here, we use an Escherichia coliDeltananT strain to characterize the function of known and proposed bacterial sialic acid transporters. We discover that the STM1128 gene from Salmonella enterica serovar Typhimurium, which encodes a member of the sodium solute symporter family, is able to restore growth on sialic acid to the DeltananT strain and is able to transport [(14)C]-sialic acid. Using the DeltananT genetic background, we performed a direct in vivo comparison of the transport properties of the STM1128 protein with those of sialic acid transporters of the major facilitator superfamily and tripartite ATP-independent periplasmic families, E. coli NanT and Haemophilus influenzae SiaPQM, respectively. This revealed that both STM1128 and SiaPQM are sodium-dependent and, unlike SiaPQM, both STM1128 and NanT are reversible secondary carriers, demonstrating qualitative functional differences in the properties of sialic acid transporters used by bacteria that colonize humans.

  9. Transportation

    National Research Council Canada - National Science Library

    Allshouse, Michael; Armstrong, Frederick Henry; Burns, Stephen; Courts, Michael; Denn, Douglas; Fortunato, Paul; Gettings, Daniel; Hansen, David; Hoffman, D. W; Jones, Robert

    2007-01-01

    .... The ability of the global transportation industry to rapidly move passengers and products from one corner of the globe to another continues to amaze even those wise to the dynamics of such operations...

  10. Radial propagation of microturbulence in tokamaks

    International Nuclear Information System (INIS)

    Garbet, X.; Laurent, L.; Roubin, J.P.; Samain, A.

    1992-01-01

    Energy confinement time in tokamaks exhibits a clear dependence on global plasma parameters. This is not the case for transport coefficients; their dependence on local plasma parameters cannot be precisely established. The aim of the present paper is to give a possible explanation of this behaviour; turbulence propagates radially because of departure from cylindrical geometry. This implies that the turbulence level at a given point and hence transport coefficients are not only functions of local plasma parameters. A quantitative estimate of the propagation velocity is derived from a Lagrangian formalism. Two cases are considered: the effect of toroidicity and the effect of non linear mode-mode coupling. The consequences of this model are discussed. This process does not depend on the type of instability. For the sake of simplicity only electrostatic perturbations are considered

  11. Characterization of Organic Anion Transporter 2 (SLC22A7): A Highly Efficient Transporter for Creatinine and Species-Dependent Renal Tubular Expression.

    Science.gov (United States)

    Shen, Hong; Liu, Tongtong; Morse, Bridget L; Zhao, Yue; Zhang, Yueping; Qiu, Xi; Chen, Cliff; Lewin, Anne C; Wang, Xi-Tao; Liu, Guowen; Christopher, Lisa J; Marathe, Punit; Lai, Yurong

    2015-07-01

    The contribution of organic anion transporter OAT2 (SLC22A7) to the renal tubular secretion of creatinine and its exact localization in the kidney are reportedly controversial. In the present investigation, the transport of creatinine was assessed in human embryonic kidney (HEK) cells that stably expressed human OAT2 (OAT2-HEK) and isolated human renal proximal tubule cells (HRPTCs). The tubular localization of OAT2 in human, monkey, and rat kidney was characterized. The overexpression of OAT2 significantly enhanced the uptake of creatinine in OAT2-HEK cells. Under physiologic conditions (creatinine concentrations of 41.2 and 123.5 µM), the initial rate of OAT2-mediated creatinine transport was approximately 11-, 80-, and 80-fold higher than OCT2, multidrug and toxin extrusion protein (MATE)1, and MATE2K, respectively, resulting in approximately 37-, 1850-, and 80-fold increase of the intrinsic transport clearance when normalized to the transporter protein concentrations. Creatinine intracellular uptake and transcellular transport in HRPTCs were decreased in the presence of 50 µM bromosulfophthalein and 100 µM indomethacin, which inhibited OAT2 more potently than other known creatinine transporters, OCT2 and multidrug and toxin extrusion proteins MATE1 and MATE2K (IC50: 1.3 µM vs. > 100 µM and 2.1 µM vs. > 200 µM for bromosulfophthalein and indomethacin, respectively) Immunohistochemistry analysis showed that OAT2 protein was localized to both basolateral and apical membranes of human and cynomolgus monkey renal proximal tubules, but appeared only on the apical membrane of rat proximal tubules. Collectively, the findings revealed the important role of OAT2 in renal secretion and possible reabsorption of creatinine and suggested a molecular basis for potential species difference in the transporter handling of creatinine. Copyright © 2015 by The American Society for Pharmacology and Experimental Therapeutics.

  12. Transport barriers in plasmas

    International Nuclear Information System (INIS)

    Caldas, I L; Szezech, J D Jr; Kroetz, T; Marcus, F A; Roberto, M; Viana, R L; Lopes, S R

    2012-01-01

    We discuss the creation of transport barriers in magnetically confined plasmas with non monotonic equilibrium radial profiles. These barriers reduce the transport in the shearless region (i.e., where the twist condition does not hold). For the chaotic motion of particles in an equilibrium electric field with a nonmonotonic radial profile, perturbed by electrostatic waves, we show that a nontwist transport barrier can be created in the plasma by modifying the electric field radial profile. We also show non twist barriers in chaotic magnetic field line transport in the plasma near to the tokamak wall with resonant modes due to electric currents in external coils.

  13. Effects of Radial Electric Fields on ICRF Waves

    International Nuclear Information System (INIS)

    Phillips, C.K.; Hosea, J.C.; Ono, M.; Wilson, J.R.

    2001-01-01

    Equilibrium considerations infer that large localized radial electric fields are associated with internal transport barrier structures in tokamaks and other toroidal magnetic confinement configurations. In this paper, the effects of an equilibrium electric field on fast magnetosonic wave propagation are considered in the context of a cold plasma model

  14. Characterization of dextran-grafted hydrophobic charge-induction resins: Structural properties, protein adsorption and transport.

    Science.gov (United States)

    Liu, Tao; Angelo, James M; Lin, Dong-Qiang; Lenhoff, Abraham M; Yao, Shan-Jing

    2017-09-29

    The structural and functional properties of a series of dextran-grafted and non-grafted hydrophobic charge-induction chromatographic (HCIC) agarose resins were characterized by macroscopic and microscopic techniques. The effects of dextran grafting and mobile phase conditions on the pore dimensions of the resins were investigated with inverse size exclusion chromatography (ISEC). A significantly lower pore radius (17.6nm) was found for dextran-grafted than non-grafted resins (29.5nm), but increased salt concentration would narrow the gap between the respective pore radii. Two proteins, human immunoglobulin G (hIgG) and bovine serum albumin (BSA), were used to examine the effect of protein characteristics. The results of adsorption isotherms showed that the dextran-grafted resin with high ligand density had substantially higher adsorption capacity and enhanced the salt-tolerance property for hIgG, but displayed a significantly smaller benefit for BSA adsorption. Confocal laser scanning microscopy (CLSM) showed that hIgG presented more diffuse and slower moving adsorption front compared to BSA during uptake into the resins because of the selective binding of multiple species from polyclonal IgG; polymer-grafting with high ligand density could enhance the rate of hIgG transport in the dextran-grafted resins without salt addition, but not for the case with high salt and BSA. The results indicate that microscopic analysis using ISEC and CLSM is useful to improve the mechanistic understanding of resin structure and of critical functional parameters involving protein adsorption and transport, which would guide the rational design of new resins and processes. Copyright © 2017. Published by Elsevier B.V.

  15. Radial lean direct injection burner

    Science.gov (United States)

    Khan, Abdul Rafey; Kraemer, Gilbert Otto; Stevenson, Christian Xavier

    2012-09-04

    A burner for use in a gas turbine engine includes a burner tube having an inlet end and an outlet end; a plurality of air passages extending axially in the burner tube configured to convey air flows from the inlet end to the outlet end; a plurality of fuel passages extending axially along the burner tube and spaced around the plurality of air passage configured to convey fuel from the inlet end to the outlet end; and a radial air swirler provided at the outlet end configured to direct the air flows radially toward the outlet end and impart swirl to the air flows. The radial air swirler includes a plurality of vanes to direct and swirl the air flows and an end plate. The end plate includes a plurality of fuel injection holes to inject the fuel radially into the swirling air flows. A method of mixing air and fuel in a burner of a gas turbine is also provided. The burner includes a burner tube including an inlet end, an outlet end, a plurality of axial air passages, and a plurality of axial fuel passages. The method includes introducing an air flow into the air passages at the inlet end; introducing a fuel into fuel passages; swirling the air flow at the outlet end; and radially injecting the fuel into the swirling air flow.

  16. Characterization of inorganic phosphate transport in the triple-negative breast cancer cell line, MDA-MB-231.

    Science.gov (United States)

    Russo-Abrahão, Thais; Lacerda-Abreu, Marco Antônio; Gomes, Tainá; Cosentino-Gomes, Daniela; Carvalho-de-Araújo, Ayra Diandra; Rodrigues, Mariana Figueiredo; Oliveira, Ana Carolina Leal de; Rumjanek, Franklin David; Monteiro, Robson de Queiroz; Meyer-Fernandes, José Roberto

    2018-01-01

    Recent studies demonstrate that interstitial inorganic phosphate is significantly elevated in the breast cancer microenvironment as compared to normal tissue. In addition it has been shown that breast cancer cells express high levels of the NaPi-IIb carrier (SLC34A2), suggesting that this carrier may play a role in breast cancer progression. However, the biochemical behavior of inorganic phosphate (Pi) transporter in this cancer type remains elusive. In this work, we characterize the kinetic parameters of Pi transport in the aggressive human breast cancer cell line, MDA-MB-231, and correlated Pi transport with cell migration and adhesion. We determined the influence of sodium concentration, pH, metabolic inhibitors, as well as the affinity for inorganic phosphate in Pi transport. We observed that the inorganic phosphate is dependent on sodium transport (K0,5 value = 21.98 mM for NaCl). Furthermore, the transport is modulated by different pH values and increasing concentrations of Pi, following the Michaelis-Menten kinetics (K0,5 = 0.08 mM Pi). PFA, monensin, furosemide and ouabain inhibited Pi transport, cell migration and adhesion. Taken together, these results showed that the uptake of Pi in MDA-MB-231 cells is modulated by sodium and by regulatory mechanisms of intracellular sodium gradient. General Significance: Pi transport might be regarded as a potential target for therapy against tumor progression.

  17. Characterization of the serotonin transporter knockout rat : A selective change in the functioning of the serotonergic system

    NARCIS (Netherlands)

    Homberg, J. R.; Olivier, J.D.A.; Smits, B. M. G.; Mul, J. D.; Mudde, J.; Verheul, M.; Nieuwenhuizen, O. F. M.; Cools, A. R.; Ronken, E; Cremers, Thomas; Schoffelmeere, A. N. M.; Ellenbroeik, B. A.; Cuppen, E.

    2007-01-01

    Serotonergic signaling is involved in many neurobiological processes and disturbed 5-HT homeostasis is implicated in a variety of psychiatric and addictive disorders. Here, we describe the functional characterization of the serotonin transporter (SERT) knockout rat model, that is generated by

  18. Characterization of the serotonin transporter knockout rat: a selective change in the functioning of the serotonergic system.

    NARCIS (Netherlands)

    Homberg, J.R.; Olivier, J.D.A.; Smits, B.M.; Mul, J.D.; Mudde, J.; Verheul, M.; Nieuwenhuizen, O.F.; Cools, A.R.; Ronken, E.; Cremers, T.; Schoffelmeer, A.N.; Ellenbroek, B.A.; Cuppen, E.

    2007-01-01

    Serotonergic signaling is involved in many neurobiological processes and disturbed 5-HT homeostasis is implicated in a variety of psychiatric and addictive disorders. Here, we describe the functional characterization of the serotonin transporter (SERT) knockout rat model, that is generated by

  19. Molecular Characterization of CTR-type Copper Transporters in an Oceanic Diatom, Thalassiosira oceanica 1005

    Science.gov (United States)

    Kong, L.; Price, N. M.

    2016-02-01

    Copper is an essential micronutrient for phytoplankton growth because of its role as a redox cofactor in electron transfer proteins in photosynthesis and respiration, and a potentially limiting resource in parts of the open sea. Thalassiosira oceanica 1005 can grow at inorganic copper concentrations varying from 10 fmol/L to 10 nmol/L by regulating copper uptake across plasma membrane. Four putative CTR-type copper transporter genes (ToCTR1, ToCTR2, ToCTR3.1 and ToCTR3.2) were identified by BLASTP search against the T. oceanica genome. Predicted gene models were revised by assembled mRNA sequencing transcripts and updated gene models contained all conserved features of characterized CTR-type copper transporters. ToCTR3.1 and ToCTR3.2 may arise from one another by gene duplication as they shared a sequence similarity of 97.6% with a peptide insertion of 5 amino acids at N-terminus of ToCTR3.1. The expression of ToCTR1, ToCTR2 and ToCTR3.1/3.2 was upregulated in low copper concentrations, but only ToCTR3.1/3.2 showed a significant increase (2.5 fold) in copper-starved cells. Both ToCTR3.1 and ToCTR3.2 restored growth of a yeast double mutant, Saccharomyces cerevisiae ctr1Δctr3Δ, in copper deficient medium. GFP-fused ToCTR expression showed that some ToCTR3.1 localized to the plasma membrane but a large portion was retained in the endoplasmic reticulum. Inefficient targeting of ToCTR3.1 to the yeast outer membrane may explain poorer growth compared to the Saccharomyces native ScCTR1 transformant. Thus, diatom CTR genes encoding CTR-type copper transporters show high-affinity copper uptake and their regulation may enable diatoms to survive in ocean environments containing a wide range of copper concentrations.

  20. Characterization of contaminant transport by gravity, capillarity and barometric pumping in heterogeneous vadose regimes. 1998 annual progress report

    International Nuclear Information System (INIS)

    Carrigan, C.R.; Hudson, G.B.

    1998-01-01

    'The intent of this research program is to obtain an improved understanding of vadose zone transport processes and to develop field and modeling techniques required to characterize contaminant transport in the unsaturated zone at DOE sites. For surface spills and near-surface leaks of chemicals, the vadose zone may well become a long-term source of contamination for the underlying water table. Transport of contaminants can occur in both the liquid and gas phases of the unsaturated zone. This transport occurs naturally as a result of diffusion, buoyancy forces (gravity), capillarity and barometric pressure variations. In some cases transport can be enhanced by anisotropies present in hydrologic regimes. This is particularly true for gas-phase transport which may be subject to vertical pumping resulting from atmospheric pressure changes. For liquid-phase flows, heterogeneity may enhance the downward transport of contaminants to the water table depending on soil properties and the scale of the surface spill or near-surface leak. Characterization techniques based upon the dynamics of transport processes are likely to yield a better understanding of the potential for contaminant transport at a specific site than methods depending solely on hydrologic properties derived from a borehole. Such dynamic-characterization techniques can be useful for evaluating sites where contamination presently exists as well as for providing an objective basis to evaluate the efficacy of proposed as well as implemented clean-up technologies. The real-time monitoring of processes that may occur during clean-up of tank waste and the mobility of contaminants beneath the Hanford storage tanks during sluicing operations is one example of how techniques developed in this effort can be applied to current remediation problems. In the future, such dynamic-characterization methods might also be used as part of the site-characterization process for determining suitable locations of new DOE facilities

  1. Effect of the radial electric field on turbulence

    International Nuclear Information System (INIS)

    Carreras, B.A.; Lynch, V.E.

    1990-01-01

    For many years, the neoclassical transport theory for three- dimensional magnetic configurations, such as magnetic mirrors, ELMO Bumpy Tori (EBTs), and stellarators, has recognized the critical role of the radial electric field in the confinement. It was in these confinement devices that the first experimental measurements of the radial electric field were made and correlated with confinement losses. In tokamaks, the axisymmetry implies that the neoclassical fluxes are ambipolar and, as a consequence, independent of the radial electric field. However, axisymmetry is not strict in a tokamak with turbulent fluctuations, and near the limiter ambipolarity clearly breaks down. Therefore, the question of the effect of the radial electric field on tokamak confinement has been raised in recent years. In particular, the radial electric field has been proposed to explain the transition from L-mode to H-mode confinement. There is some initial experimental evidence supporting this type of explanation, although there is not yet a self-consistent theory explaining the generation of the electric field and its effect on the transport. Here, a brief review of recent results is presented. 27 refs., 4 figs

  2. Cloning and characterization of a functional human ¿-aminobutyric acid (GABA) transporter, human GAT-2

    DEFF Research Database (Denmark)

    Christiansen, Bolette; Meinild, Anne-Kristine; Jensen, Anders A.

    2007-01-01

    Plasma membrane gamma-aminobutyric acid (GABA) transporters act to terminate GABA neurotransmission in the mammalian brain. Intriguingly four distinct GABA transporters have been cloned from rat and mouse, whereas only three functional homologs of these transporters have been cloned from human....... The aim of this study therefore was to search for this fourth missing human transporter. Using a bioinformatics approach, we successfully identified and cloned the full-length cDNA of a so far uncharacterized human GABA transporter (GAT). The predicted protein displays high sequence similarity to rat GAT......-2 and mouse GAT3, and in accordance with the nomenclature for rat GABA transporters, we therefore refer to the transporter as human GAT-2. We used electrophysiological and cell-based methods to demonstrate that this protein is a functional transporter of GABA. The transport was saturable...

  3. Characterizing the Occurrence and Transport of Brackish Groundwater in Southwest Bangladesh

    Science.gov (United States)

    worland, S.; Hornberger, G. M.

    2013-12-01

    Bangladesh is host to the largest and the most active delta system in the world. The morphology of the southern part of the country is characterized by low lying deltaic plains partitioned by the distributary networks of the Ganges, Brahmaputra and Meghna river systems. Much of the tidal mangrove forest ecosystem of the lower delta has been converted into poldered islands that sustain shrimp farming and rice production. The polder inhabitants depend on shallow groundwater as a primary source for drinking water and sanitation. Understanding the origin and hydrologic controls on the distribution of the brackish water and freshwater on the polder is a necessary step to ensuring a sustainable and potable freshwater source for drinking and irrigation. Preliminary sampling from shallow tube wells on Polder 32 in southwest Bangladesh suggests sporadic lateral apportioning of fresh water in the primarily brackish aquifer. This research characterizes the occurrence, transport and fate of the brackish groundwater through a combination of 3H and 14C dating, geochemical signatures, subsurface mapping using inversions from electromagnetic induction, and a 1D finite difference model and a 2D finite element model. The geochemical analysis and radiometric dating suggest that the salt water originates from paleo-brackish estuarine water deposited ~5000 years ago along with the sediments that compose the shallow aquifer. Inversions of electromagnetic survey data show potential freshwater recharge areas where the clay cap pinches out. The finite difference model demonstrates that recharge from the distributary channels is unlikely due to the low transmissivity of the clay channel beds. The finite element model gives reasonable estimates of the flushing rates of the connate brackish water beneath the polder. Inversion of electromagnetic data from a two hundred meter transect taken on Polder 32 Head gradient and groundwater flow vectors for fixed head boundary conditions across Polder

  4. Self-consistent radial sheath

    International Nuclear Information System (INIS)

    Hazeltine, R.D.

    1988-12-01

    The boundary layer arising in the radial vicinity of a tokamak limiter is examined, with special reference to the TEXT tokamak. It is shown that sheath structure depends upon the self-consistent effects of ion guiding-center orbit modification, as well as the radial variation of E /times/ B-induced toroidal rotation. Reasonable agreement with experiment is obtained from an idealized model which, however simplified, preserves such self-consistent effects. It is argued that the radial sheath, which occurs whenever confining magnetic field-lines lie in the plasma boundary surface, is an object of some intrinsic interest. It differs from the more familiar axial sheath because magnetized charges respond very differently to parallel and perpendicular electric fields. 11 refs., 1 fig

  5. Detonation in supersonic radial outflow

    KAUST Repository

    Kasimov, Aslan R.

    2014-11-07

    We report on the structure and dynamics of gaseous detonation stabilized in a supersonic flow emanating radially from a central source. The steady-state solutions are computed and their range of existence is investigated. Two-dimensional simulations are carried out in order to explore the stability of the steady-state solutions. It is found that both collapsing and expanding two-dimensional cellular detonations exist. The latter can be stabilized by putting several rigid obstacles in the flow downstream of the steady-state sonic locus. The problem of initiation of standing detonation stabilized in the radial flow is also investigated numerically. © 2014 Cambridge University Press.

  6. Characterization of nitride hole lateral transport in a charge trap flash memory by using a random telegraph signal method

    Science.gov (United States)

    Liu, Yu-Heng; Jiang, Cheng-Min; Lin, Hsiao-Yi; Wang, Tahui; Tsai, Wen-Jer; Lu, Tao-Cheng; Chen, Kuang-Chao; Lu, Chih-Yuan

    2017-07-01

    We use a random telegraph signal method to investigate nitride trapped hole lateral transport in a charge trap flash memory. The concept of this method is to utilize an interface oxide trap and its associated random telegraph signal as an internal probe to detect a local channel potential change resulting from nitride charge lateral movement. We apply different voltages to the drain of a memory cell and vary a bake temperature in retention to study the electric field and temperature dependence of hole lateral movement in a nitride. Thermal energy absorption by trapped holes in lateral transport is characterized. Mechanisms of hole lateral transport in retention are investigated. From the measured and modeled results, we find that thermally assisted trap-to-band tunneling is a major trapped hole emission mechanism in nitride hole lateral transport.

  7. Monte Carlo based radial shield design of typical PWR reactor

    Energy Technology Data Exchange (ETDEWEB)

    Gul, Anas; Khan, Rustam; Qureshi, M. Ayub; Azeem, Muhammad Waqar; Raza, S.A. [Pakistan Institute of Engineering and Applied Sciences, Islamabad (Pakistan). Dept. of Nuclear Engineering; Stummer, Thomas [Technische Univ. Wien (Austria). Atominst.

    2016-11-15

    Neutron and gamma flux and dose equivalent rate distribution are analysed in radial and shields of a typical PWR type reactor based on the Monte Carlo radiation transport computer code MCNP5. The ENDF/B-VI continuous energy cross-section library has been employed for the criticality and shielding analysis. The computed results are in good agreement with the reference results (maximum difference is less than 56 %). It implies that MCNP5 a good tool for accurate prediction of neutron and gamma flux and dose rates in radial shield around the core of PWR type reactors.

  8. Illumination Profile & Dispersion Variation Effects on Radial Velocity Measurements

    Science.gov (United States)

    Grieves, Nolan; Ge, Jian; Thomas, Neil B.; Ma, Bo; Li, Rui; SDSS-III

    2015-01-01

    The Multi-object APO Radial-Velocity Exoplanet Large-Area Survey (MARVELS) measures radial velocities using a fiber-fed dispersed fixed-delay interferometer (DFDI) with a moderate dispersion spectrograph. This setup allows a unique insight into the 2D illumination profile from the fiber on to the dispersion grating. Illumination profile investigations show large changes in the profile over time and fiber location. These profile changes are correlated with dispersion changes and long-term radial velocity offsets, a major problem within the MARVELS radial velocity data. Characterizing illumination profiles creates a method to both detect and correct radial velocity offsets, allowing for better planet detection. Here we report our early results from this study including improvement of radial velocity data points from detected giant planet candidates. We also report an illumination profile experiment conducted at the Kitt Peak National Observatory using the EXPERT instrument, which has a DFDI mode similar to MARVELS. Using profile controlling octagonal-shaped fibers, long term offsets over a 3 month time period were reduced from ~50 m/s to within the photon limit of ~4 m/s.

  9. Channeling of protons through radial deformed carbon nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Borka Jovanović, V., E-mail: vborka@vinca.rs [Atomic Physics Laboratory (040), Vinča Institute of Nuclear Sciences, University of Belgrade, P.O. Box 522, 11001 Belgrade (Serbia); Borka, D. [Atomic Physics Laboratory (040), Vinča Institute of Nuclear Sciences, University of Belgrade, P.O. Box 522, 11001 Belgrade (Serbia); Galijaš, S.M.D. [Faculty of Physics, University of Belgrade, P.O. Box 368, 11001 Belgrade (Serbia)

    2017-05-18

    Highlights: • For the first time we presented theoretically obtained distributions of channeled protons with radially deformed SWNT. • Our findings indicate that influence of the radial deformation is very strong and it should not be omitted in simulations. • We show that the spatial and angular distributions depend strongly of level of radial deformation of nanotube. • Our obtained results can be compared with measured distributions to reveal the presence of various types of defects in SWNT. - Abstract: In this paper we have presented a theoretical investigation of the channeling of 1 GeV protons with the radial deformed (10, 0) single-wall carbon nanotubes (SWNTs). We have calculated channeling potential within the deformed nanotubes. For the first time we presented theoretically obtained spatial and angular distributions of channeled protons with radially deformed SWNT. We used a Monte Carlo (MC) simulation technique. We show that the spatial and angular distributions depend strongly of level of radial deformation of nanotube. These results may be useful for nanotube characterization and production and guiding of nanosized ion beams.

  10. Transportation

    Science.gov (United States)

    2007-01-01

    Faculty ii INDUSTRY TRAVEL Domestic Assistant Deputy Under Secretary of Defense (Transportation Policy), Washington, DC Department of...developed between the railroad and trucking industries. Railroads: Today’s seven Class I freight railroad systems move 42% of the nation’s intercity ...has been successfully employed in London to reduce congestion and observed by this industry study during its travels . It is currently being

  11. Vortex Whistle in Radial Intake

    National Research Council Canada - National Science Library

    Tse, Man-Chun

    2004-01-01

    In a radial-to-axial intake with inlet guide vanes (IGV) at the entry, a strong flow circulation Gamma can be generated from the tangential flow components created by the IGVs when their setting exceed about halfclosing (approx. 45 deg...

  12. An experimental test plan for the characterization of molten salt thermochemical properties in heat transport systems

    International Nuclear Information System (INIS)

    Calderoni, Pattrick

    2010-01-01

    Molten salts are considered within the Very High Temperature Reactor program as heat transfer media because of their intrinsically favorable thermo-physical properties at temperatures starting from 300 C and extending up to 1200 C. In this context two main applications of molten salt are considered, both involving fluoride-based materials: as primary coolants for a heterogeneous fuel reactor core and as secondary heat transport medium to a helium power cycle for electricity generation or other processing plants, such as hydrogen production. The reference design concept here considered is the Advanced High Temperature Reactor (AHTR), which is a large passively safe reactor that uses solid graphite-matrix coated-particle fuel (similar to that used in gas-cooled reactors) and a molten salt primary and secondary coolant with peak temperatures between 700 and 1000 C, depending upon the application. However, the considerations included in this report apply to any high temperature system employing fluoride salts as heat transfer fluid, including intermediate heat exchangers for gas-cooled reactor concepts and homogeneous molten salt concepts, and extending also to fast reactors, accelerator-driven systems and fusion energy systems. The purpose of this report is to identify the technical issues related to the thermo-physical and thermo-chemical properties of the molten salts that would require experimental characterization in order to proceed with a credible design of heat transfer systems and their subsequent safety evaluation and licensing. In particular, the report outlines an experimental R and D test plan that would have to be incorporated as part of the design and operation of an engineering scaled facility aimed at validating molten salt heat transfer components, such as Intermediate Heat Exchangers. This report builds on a previous review of thermo-physical properties and thermo-chemical characteristics of candidate molten salt coolants that was generated as part

  13. An experimental test plan for the characterization of molten salt thermochemical properties in heat transport systems

    Energy Technology Data Exchange (ETDEWEB)

    Pattrick Calderoni

    2010-09-01

    Molten salts are considered within the Very High Temperature Reactor program as heat transfer media because of their intrinsically favorable thermo-physical properties at temperatures starting from 300 C and extending up to 1200 C. In this context two main applications of molten salt are considered, both involving fluoride-based materials: as primary coolants for a heterogeneous fuel reactor core and as secondary heat transport medium to a helium power cycle for electricity generation or other processing plants, such as hydrogen production. The reference design concept here considered is the Advanced High Temperature Reactor (AHTR), which is a large passively safe reactor that uses solid graphite-matrix coated-particle fuel (similar to that used in gas-cooled reactors) and a molten salt primary and secondary coolant with peak temperatures between 700 and 1000 C, depending upon the application. However, the considerations included in this report apply to any high temperature system employing fluoride salts as heat transfer fluid, including intermediate heat exchangers for gas-cooled reactor concepts and homogenous molten salt concepts, and extending also to fast reactors, accelerator-driven systems and fusion energy systems. The purpose of this report is to identify the technical issues related to the thermo-physical and thermo-chemical properties of the molten salts that would require experimental characterization in order to proceed with a credible design of heat transfer systems and their subsequent safety evaluation and licensing. In particular, the report outlines an experimental R&D test plan that would have to be incorporated as part of the design and operation of an engineering scaled facility aimed at validating molten salt heat transfer components, such as Intermediate Heat Exchangers. This report builds on a previous review of thermo-physical properties and thermo-chemical characteristics of candidate molten salt coolants that was generated as part of the

  14. Characterizing the transplanar and in-plane water transport properties of fabrics under different sweat rate: Forced Flow Water Transport Tester

    Science.gov (United States)

    Tang, K. P. M.; Chau, K. H.; Kan, C. W.; Fan, J. T.

    2015-11-01

    The water absorption and transport properties of fabrics are critical to wear comfort, especially for sportswear and protective clothing. A new testing apparatus, namely Forced Flow Water Transport Tester (FFWTT), was developed for characterizing the transplanar and in-plane wicking properties of fabrics based on gravimetric and image analysis technique. The uniqueness of this instrument is that the rate of water supply is adjustable to simulate varying sweat rates with reference to the specific end-use conditions ranging from sitting, walking, running to other strenuous activities. This instrument is versatile in terms of the types of fabrics that can be tested. Twenty four types of fabrics with varying constructions and surface finishes were tested. The results showed that FFWTT was highly sensitive and reproducible in differentiating these fabrics and it suggests that water absorption and transport properties of fabrics are sweat rate-dependent. Additionally, two graphic methods were proposed to map the direction of liquid transport and its relation to skin wetness, which provides easy and direct comparison among different fabrics. Correlation analysis showed that FFWTT results have strong correlation with subjective wetness sensation, implying validity and usefulness of the instrument.

  15. Modified radial v/s biatrial maze for atrial fibrillation in rheumatic valvular heart surgery

    Directory of Open Access Journals (Sweden)

    Sajid A. Sayed

    2014-09-01

    Discussion: In patients with AF undergoing rheumatic valvular surgery, radiofrequency radial approach is as effective as modified Cox's maze III for conversion to NSR with better atrial transport function.

  16. Cloning, characterization and tissue distribution of the rat ATP-binding cassette (ABC) transporter ABC2/ABCA2.

    OpenAIRE

    Zhao, L X; Zhou, C J; Tanaka, A; Nakata, M; Hirabayashi, T; Amachi, T; Shioda, S; Ueda, K; Inagaki, N

    2000-01-01

    The ABC1 (ABCA) subfamily of the ATP-binding cassette (ABC) transporter superfamily has a structural feature that distinguishes it from other ABC transporters. Here we report the cloning, molecular characterization and tissue distribution of ABC2/ABCA2, which belongs to the ABC1 subfamily. Rat ABC2 is a protein of 2434 amino acids that has 44.5%, 40.0% and 40.8% identity with mouse ABC1/ABCA1, human ABC3/ABCA3 and human ABCR/ABCA4 respectively. Immunoblot analysis showed that proteins of 260 ...

  17. Characterization of airborne float coal dust emitted during continuous mining, longwall mining and belt transport.

    Science.gov (United States)

    Shahan, M R; Seaman, C E; Beck, T W; Colinet, J F; Mischler, S E

    2017-09-01

    Float coal dust is produced by various mining methods, carried by ventilating air and deposited on the floor, roof and ribs of mine airways. If deposited, float dust is re-entrained during a methane explosion. Without sufficient inert rock dust quantities, this float coal dust can propagate an explosion throughout mining entries. Consequently, controlling float coal dust is of critical interest to mining operations. Rock dusting, which is the adding of inert material to airway surfaces, is the main control technique currently used by the coal mining industry to reduce the float coal dust explosion hazard. To assist the industry in reducing this hazard, the Pittsburgh Mining Research Division of the U.S. National Institute for Occupational Safety and Health initiated a project to investigate methods and technologies to reduce float coal dust in underground coal mines through prevention, capture and suppression prior to deposition. Field characterization studies were performed to determine quantitatively the sources, types and amounts of dust produced during various coal mining processes. The operations chosen for study were a continuous miner section, a longwall section and a coal-handling facility. For each of these operations, the primary dust sources were confirmed to be the continuous mining machine, longwall shearer and conveyor belt transfer points, respectively. Respirable and total airborne float dust samples were collected and analyzed for each operation, and the ratio of total airborne float coal dust to respirable dust was calculated. During the continuous mining process, the ratio of total airborne float coal dust to respirable dust ranged from 10.3 to 13.8. The ratios measured on the longwall face were between 18.5 and 21.5. The total airborne float coal dust to respirable dust ratio observed during belt transport ranged between 7.5 and 21.8.

  18. Virus in Groundwater: Characterization of transport mechanisms and impacts on an agricultural area in Uruguay

    Science.gov (United States)

    Gamazo, P. A.; Colina, R.; Victoria, M.; Alvareda, E.; Burutaran, L.; Ramos, J.; Lopez, F.; Soler, J.

    2014-12-01

    In many areas of Uruguay groundwater is the only source of water for human consumption and for industrial-agricultural economic activities. Traditionally considered as a safe source, due to the "natural filter" that occurs in porous media, groundwater is commonly used without any treatment. The Uruguayan law requires bacteriological analysis for most water uses, but virological analyses are not mentioned in the legislation. In the Salto district, where groundwater is used for human consumption and for agricultural activities, bacterial contamination has been detected in several wells but no viruses analysis have been performed. The Republic University (UDELAR), with the support of the National Agency for Research and Innovation (ANII), is studying the incidence of virus in groundwater on an intensive agriculture area of the Salto district. In this area water is pumped from the "Salto Aquifer", a free sedimentary aquifer. Below this sedimentary deposit is the "Arapey" basaltic formation, which is also exploited for water productions on its fractured zones. A screening campaign has been performed searching for bacterial and viral contamination. Total and fecal coliforms have been found on several wells and Rotavirus and Adenovirus have been detected. A subgroup of the screening wells has been selected for an annual survey. On this subgroup, besides bacteria and viruses analysis, a standard physical and chemical characterization was performed. Results show a significant seasonal variation on microbiological contamination. In addition to field studies, rotavirus circulation experiments on columns are being performed. The objective of this experiments is to determinate the parameters that control virus transport in porous media. The results of the study are expected to provide an insight into the impacts of groundwater on Salto's viral gastroenterocolitis outbreaks.

  19. Characterization of maximally random jammed sphere packings. III. Transport and electromagnetic properties via correlation functions

    Science.gov (United States)

    Klatt, Michael A.; Torquato, Salvatore

    2018-01-01

    In the first two papers of this series, we characterized the structure of maximally random jammed (MRJ) sphere packings across length scales by computing a variety of different correlation functions, spectral functions, hole probabilities, and local density fluctuations. From the remarkable structural features of the MRJ packings, especially its disordered hyperuniformity, exceptional physical properties can be expected. Here we employ these structural descriptors to estimate effective transport and electromagnetic properties via rigorous bounds, exact expansions, and accurate analytical approximation formulas. These property formulas include interfacial bounds as well as universal scaling laws for the mean survival time and the fluid permeability. We also estimate the principal relaxation time associated with Brownian motion among perfectly absorbing traps. For the propagation of electromagnetic waves in the long-wavelength limit, we show that a dispersion of dielectric MRJ spheres within a matrix of another dielectric material forms, to a very good approximation, a dissipationless disordered and isotropic two-phase medium for any phase dielectric contrast ratio. We compare the effective properties of the MRJ sphere packings to those of overlapping spheres, equilibrium hard-sphere packings, and lattices of hard spheres. Moreover, we generalize results to micro- and macroscopically anisotropic packings of spheroids with tensorial effective properties. The analytic bounds predict the qualitative trend in the physical properties associated with these structures, which provides guidance to more time-consuming simulations and experiments. They especially provide impetus for experiments to design materials with unique bulk properties resulting from hyperuniformity, including structural-color and color-sensing applications.

  20. Radial head dislocation during proximal radial shaft osteotomy.

    Science.gov (United States)

    Hazel, Antony; Bindra, Randy R

    2014-03-01

    The following case report describes a 48-year-old female patient with a longstanding both-bone forearm malunion, who underwent osteotomies of both the radius and ulna to improve symptoms of pain and lack of rotation at the wrist. The osteotomies were templated preoperatively. During surgery, after performing the planned radial shaft osteotomy, the authors recognized that the radial head was subluxated. The osteotomy was then revised from an opening wedge to a closing wedge with improvement of alignment and rotation. The case report discusses the details of the operation, as well as ways in which to avoid similar shortcomings in the future. Copyright © 2014 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.

  1. Riboflavin transport in the central nervous system. Characterization and effects of drugs.

    OpenAIRE

    Spector, R

    1980-01-01

    The relationship of riboflavin transport to the transport of other substances including drugs in rabbit choroid plexus, the anatomical locus of the blood-cerebrospinal fluid barrier, and brain cells were studied in vivo and in vitro. In vitro, the ability of rabbit choroid plexus to transport riboflavin from the medium (cerebrospinal fluid surface) through the choroid plexus epithelial cells into the extracellular and vascular spaces of the choroid plexus was documented using fluorescence mic...

  2. Contaminant Attenuation and Transport Characterization of 200-DV-1 Operable Unit Sediment Samples

    Energy Technology Data Exchange (ETDEWEB)

    Truex, Michael J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Szecsody, James E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Qafoku, Nikolla [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Strickland, Christopher E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Moran, James J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lee, Brady D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Snyder, Michelle M.V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lawter, Amanda R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Resch, Charles T. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Gartman, Brandy N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zhong, Lirong [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Nims, Megan K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Saunders, Danielle L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Williams, Benjamin D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Horner, Jacob A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Leavy, Ian I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Baum, Steven R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Christiansen, Beren B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Clayton, Ray E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); McElroy, Erin M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Appriou, Delphine [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Tyrrell, Kimberly J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Striluk, Miranda L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2017-05-15

    A laboratory study was conducted to quantify contaminant attenuation processes and associated contaminant transport parameters that are needed to evaluate transport of contaminants through the vadose zone to the groundwater. The laboratory study information, in conjunction with transport analyses, can be used as input to evaluate the feasibility of Monitored Natural Attenuation and other remedies for the 200-DV-1 Operable Unit at the Hanford Site.

  3. Subsurface Access, Characterization, Acquisition, Transport, Storage and Delivery in Microgravity, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — This project will develop geotechnical measurements, sample extraction and transport equipment for subsurface regolith on NEOs, asteroids, moons and planets,...

  4. A mountain-scale model for characterizing unsaturated flow and transport in fractured tuffs of Yucca Mountain

    International Nuclear Information System (INIS)

    Wu, Yu-Shu; Lu, Guoping; Zhang, Keni; Bodvarsson, G.S.

    2003-01-01

    This paper presents a large-scale modeling study characterizing fluid flow and tracer transport in the unsaturated zone of Yucca Mountain, Nevada, the proposed underground repository site for storing high-level radioactive waste. The modeling study is conducted using a three-dimensional numerical model, which incorporates a wide variety of field data and takes into account the coupled processes of flow and transport in Yucca Mountain's highly heterogeneous, unsaturated, fractured porous rock. The modeling approach is based on a dual-continuum formulation. Using different conceptual models of unsaturated flow, various scenarios of current and future climate conditions and their effects on the unsaturated zone are evaluated to aid in the assessment of the repository's system performance. These models are calibrated against field-measured data. Model-predicted flow and transport processes under current and future climates are discussed

  5. Cytochemical characterization of gill and hepatopancreatic cells of the crab Ucides cordatus (Crustacea, Brachyura validated by cell metal transport

    Directory of Open Access Journals (Sweden)

    Priscila Ortega

    2014-09-01

    Full Text Available Ucides cordatus (Linnaeus, 1763 is a hypo-hyper-regulating mangrove crab possessing gills for respiratory and osmoregulatory processes, separated in anterior and posterior sections. They also have hepatopancreas, which is responsible for digestion and absorption of nutrients and detoxification of toxic metals. Each of these organs has specific cells that are important for in vitro studies in cell biology, ion and toxic metals transport. In order to study and characterize cells from gills and hepatopancreas, both were separated using a Sucrose Gradient (SG from 10 to 40% and cells in each gradient were characterized using the vital mitochondrial dye DASPEI (2-(4-dimethylaminostyryl-N- ethylpyridinium iodide and Trichrome Mallory's stain. Both in 20 and 40% SG for gill cells and 30% SG for hepatopancreatic cells, a greater number of cells were colored with DASPEI, indicating a larger number of mitochondria in these cells. It is concluded that the gill cells present in 20% and 40% SG are Thin cells, responsible for respiratory processes and Ionocytes responsible for ion transport, respectively. For hepatopancreatic cells, the 30% SG is composed of Fibrillar cells that possess larger number of membrane ion and nutrient transporters. Moreover, the transport of toxic metal cadmium (Cd by isolated hepatopancreatic cells was performed as a way of following cell physiological integrity after cell separation and to study differences in transport among the cells. All hepatopancreatic cells were able to transport Cd. These findings are the first step for further work on isolated cells of these important exchange epithelia of crabs, using a simple separation method and to further develop successful in vitro cell culture in crabs.

  6. RADIAL STABILITY IN STRATIFIED STARS

    International Nuclear Information System (INIS)

    Pereira, Jonas P.; Rueda, Jorge A.

    2015-01-01

    We formulate within a generalized distributional approach the treatment of the stability against radial perturbations for both neutral and charged stratified stars in Newtonian and Einstein's gravity. We obtain from this approach the boundary conditions connecting any two phases within a star and underline its relevance for realistic models of compact stars with phase transitions, owing to the modification of the star's set of eigenmodes with respect to the continuous case

  7. Age versus size determination of radial variation in wood specific gravity : lessons from eccentrics

    Science.gov (United States)

    G. Bruce Williamson; Michael C. Wiemann

    2011-01-01

    Radial increases in wood specific gravity have been shown to characterize early successional trees from tropical forests. Here, we develop and apply a novel method to test whether radial increases are determined by tree age or tree size. The method compares the slopes of specific gravity changes across a short radius and a long radius of trees with eccentric trunks. If...

  8. Velocidades radiales en Collinder 121

    Science.gov (United States)

    Arnal, M.; Morrell, N.

    Se han llevado a cabo observaciones espectroscópicas de unas treinta estrellas que son posibles miembros del cúmulo abierto Collinder 121. Las mismas fueron realizadas con el telescopio de 2.15m del Complejo Astronómico El Leoncito (CASLEO). El análisis de las velocidades radiales derivadas del material obtenido, confirma la realidad de Collinder 121, al menos desde el punto de vista cinemático. La velocidad radial baricentral (LSR) del cúmulo es de +17 ± 3 km.s-1. Esta velocidad coincide, dentro de los errores, con la velocidad radial (LSR) de la nebulosa anillo S308, la cual es de ~20 ± 10 km.s-1. Como S308 se encuentra físicamente asociada a la estrella Wolf-Rayet HD~50896, es muy probable que esta última sea un miembro de Collinder 121. Desde un punto de vista cinemático, la supergigante roja HD~50877 (K3Iab) también pertenecería a Collinder 121. Basándonos en la pertenencia de HD~50896 a Collinder 121, y en la interacción encontrada entre el viento de esta estrella y el medio interestelar circundante a la misma, se estima para este cúmulo una distancia del orden de 1 kpc.

  9. Synthesis, spectroscopic characterization and acoustic, volumetric, transport and thermal properties of hydroxyl ammonium based ionic liquids

    International Nuclear Information System (INIS)

    Losetty, Venkatramana; Chennuri, Bharath Kumar; Gardas, Ramesh L.

    2016-01-01

    Graphical abstract: Density, ρ (■) in kg · m"−"3, speed of sound, u (●) in m · s"−"1, dynamic viscosity, η (▴) in mPa · s, electrical conductivity, σ (♦) in S · cm"−"1of [BHEA][TFA] as the function of temperature and at 0.1 MPa pressure. - Highlights: • N-butyl-(N-hydroxyethyl) ammonium based protic ionic liquids (PILs) were synthesized. • Density, speed of sound, electrical conductivity and viscosity were measured for studied PILs. • Transport property data were fitted to Vogel–Tammann–Fulcher (VTF) equation. • FT-IR spectrum was helpful to explain the hydrogen bonding between ions. • Measured and derived properties were analyzed in terms of chemical structure of PILs. - Abstract: In the present work, solvent-free synthesis of two hydroxyethyl ammonium-based ionic liquids (ILs) at room temperature was carried out namely, N-butyl-(N-hydroxyethyl) ammonium trifluoroacetate ([BHEA][TFA]) and N-butyl-(N-hydroxyethyl) ammonium nitrate ([BHEA][NO_3]). The synthesized ionic liquids were characterized by various spectroscopic techniques such as "1H-NMR, "1"3C-NMR and FTIR. Furthermore, density (ρ), speed of sound (u), electrical conductivity (σ) and viscosity (η) have been measured within the temperature range from T = (303.15 to 343.15) K and at 0.1 MPa pressure. The measured density and viscosity values were fitted to the linear and Vogel–Tammann–Fulcher (VTF) equation, respectively. The temperature dependence conductivity of the measured ILs was fitted to a similar equation type of viscosity (VTF). Furthermore, the refractive index was measured at T = 303.15 K, in turn molar refraction (R_m) and free volume (f_V) were calculated using the Lorentz–Lorenz equation. The thermodynamic properties such as thermal expansion coefficient (α), isentropic compressibility (β_S) and intermolecular free length (L_f) were calculated by using the experimental values of density and speed of sound. The thermal decomposition temperature (T

  10. Molecular characterization of ABC transporters in marine ciliate, Euplotes crassus: Identification and response to cadmium and benzo[a]pyrene.

    Science.gov (United States)

    Kim, Hokyun; Yim, Bora; Kim, Jisoo; Kim, Haeyeon; Lee, Young-Mi

    2017-11-30

    ATP-binding cassette (ABC) transporters participate in transporting various substances, including xenobiotics, in or out of cells. However, their genetic information and function in ciliates remain still unclear. In this study, we sequenced and characterized two ABC transporter genes (EcABCB and EcABCC), and investigated the effect of cadmium (Cd) and benzo[a]pyrene (B[a]P) on their function and gene expression, using efflux assay and real-time reverse transcription-polymerase chain reaction (qRT-PCR), respectively, in the marine ciliate, Euplotes crassus. Sequencing analysis and efflux assay showed that EcABCB and EcABCC are typical ABC transporters, possessing conserved function. Exposure to Cd (≥5mg/L) and B[a]P (≥50.5μg/L) enhanced accumulation of a substrate. A significant increase in the expression of EcABCB and EcABC mRNA was observed at lower concentration in response to Cd and B[a]P. Our findings indicate that Cd and B[a]P could inhibit the efflux function of ABC transporters, leading to cellular toxicity in the ciliate. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Hydrostatic radial bearing of centrifugal pump

    International Nuclear Information System (INIS)

    Skalicky, A.

    1976-01-01

    A hydrostatic radial pump is described characterized by the fact that part of the medium off-taken from delivery is used as a lubricating medium. Two additional bodies are placed alongside a hydrostatic bearing with coils in between them and the pump shaft; the coils have an opposite pitch. The feed channel for the hydrostatic bearing pocket is linked to delivery. The coil outlets are connected to the pump suction unit. Two rotating coils placed alongside the hydrostatic bearing will considerably simplify the communication channel design and reduce the dependence on the pump shaft deflections. The addition of another rotating coil in the close vicinity of the pump shaft or directly on the shaft further increases the efficiency. The bearing can be used in designing vertical circulating pumps for the cooling circuits of nuclear reactors. (J.B.)

  12. Radial electrical field effects in TJ-II. (Preliminary study)

    International Nuclear Information System (INIS)

    Guasp, J.

    1996-01-01

    The influence of the radial electric field upon the neoclassical transport coefficients of TJ-II helical axis Stellarator has been calculated as well on the microwave heating stage (ECRH) as on the neutral injection one (NBI). The influence of the solutions for the self-consistent ambipolar field on confinement times and temperatures has been studied by means of a zero-dimensional energy balance. The simultaneous presence of two roots, the electronic and the ionic one, is observed for the ECRH phase, while for NBI only the ionic root appears, although with a strong field intensity that could produce a favourable effect on confinement. The interest and need of the extension of these calculations to include radial profile effects by using spatial dependent transport codes in stressed

  13. Characterizing the tradeoffs and costs associated with transportation congestion in supply chains.

    Science.gov (United States)

    2010-01-21

    We consider distribution and location-planning models for supply chains that explicitly : account for traffic congestion effects. The majority of facility location and transportation : planning models in the operations research literature consider fa...

  14. Formulation of confinement matrices and characterization of their transport properties from solid to melt state

    International Nuclear Information System (INIS)

    Grandjean, A.

    2006-07-01

    The author gives an overview of his research activity during which she worked on three main subjects. The first one dealt with the investigation of transport mechanisms in metal alloys (experimental investigation of diffusion in amorphous alloys, oxidation mechanism of Zircaloy-4 under temperature and in water or in dry oxygen). The second one dealt with the synthesis and properties of specific confinement matrices (effect of chemical composition on sintering of a carbonate powder, effect of microstructure of high Mo and P content vitro-crystals on lixiviation properties, incorporation of fluorine compounds in the case of borosilicate systems). The third one dealt with the transport in borosilicate glasses and melts (ionic transport, properties, and electrical transport glass-RuO 2 particles composites)

  15. ITE CHARACTERIZATION TO SUPPORT CONCEPTUAL MODEL DEVELOPMENT FOR SUBSURFACE RADIONUCLIDE TRANSPORT

    Science.gov (United States)

    Remediation of radionuclide contaminants in ground water often begins with the development of conceptual and analytical models that guide our understanding of the processes controlling radionuclide transport. The reliability of these models is often predicated on the collection o...

  16. Characterization of an allosteric citalopram-binding site at the serotonin transporter

    DEFF Research Database (Denmark)

    Chen, Fenghua; Breum Larsen, Mads; Neubauer, Henrik Amtoft

    2005-01-01

    The serotonin transporter (SERT), which belongs to a family of       sodium/chloride-dependent transporters, is the major pharmacological       target in the treatment of several clinical disorders, including       depression and anxiety. In the present study we show that the dissociation       r...

  17. Visualization of Fuel Cell Water Transport and Performance Characterization under Freezing Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Kandlikar, Satish G. [Rochester Inst. of Technology, Rochester, NY (United States); Lu, Zijie [Rochester Inst. of Technology, Rochester, NY (United States); Rao, Navalgund [Rochester Inst. of Technology, Rochester, NY (United States); Sergi, Jacqueline [Rochester Inst. of Technology, Rochester, NY (United States); Rath, Cody [Rochester Inst. of Technology, Rochester, NY (United States); McDade, Christopher [Rochester Inst. of Technology, Rochester, NY (United States); Trabold, Thomas [General Motors, Honeoye Falls, NY (United States); Owejan, Jon [General Motors, Honeoye Falls, NY (United States); Gagliardo, Jeffrey [General Motors, Honeoye Falls, NY (United States); Allen, Jeffrey [Michigan Technological Univ., Houghton, MI (United States); Yassar, Reza S. [Michigan Technological Univ., Houghton, MI (United States); Medici, Ezequiel [Michigan Technological Univ., Houghton, MI (United States); Herescu, Alexandru [Michigan Technological Univ., Houghton, MI (United States)

    2010-05-30

    In this program, Rochester Institute of Technology (RIT), General Motors (GM) and Michigan Technological University (MTU) have focused on fundamental studies that address water transport, accumulation and mitigation processes in the gas diffusion layer and flow field channels of the bipolar plate. These studies have been conducted with a particular emphasis on understanding the key transport phenomena which control fuel cell operation under freezing conditions.

  18. Impact of carbonation on the durability of cementitious materials: water transport properties characterization

    Directory of Open Access Journals (Sweden)

    Le Bescop P.

    2013-07-01

    Full Text Available Within the context of long-lived intermediate level radioactive waste geological disposal, reinforced concrete would be used. In service life conditions, the concrete structures would be subjected to drying and carbonation. Carbonation relates to the reaction between carbon dioxide (CO2 and the main hydrates of the cement paste (portlandite and C-S-H. Beyond the fall of the pore solution pH, indicative of steel depassivation, carbonation induces mineralogical and microstructural changes (due to portlandite and C-S-H dissolution and calcium carbonate precipitation. This results in the modification of the transport properties, which can impact the structure durability. Because concrete durability depends on water transport, this study focuses on the influence of carbonation on water transport properties. In fact, the transport properties of sound materials are known but they still remain to be assessed for carbonated ones. An experimental program has been designed to investigate the transport properties in carbonated materials. Four hardened cement pastes, differing in mineralogy, are carbonated in an accelerated carbonation device (in controlled environmental conditions at CO2 partial pressure of about 3%. Once fully carbonated, all the data needed to describe water transport, using a simplified approach, will be evaluated.

  19. A high mitochondrial transport rate characterizes CNS neurons with high axonal regeneration capacity.

    Directory of Open Access Journals (Sweden)

    Romain Cartoni

    Full Text Available Improving axonal transport in the injured and diseased central nervous system has been proposed as a promising strategy to improve neuronal repair. However, the contribution of each cargo to the repair mechanism is unknown. DRG neurons globally increase axonal transport during regeneration. Because the transport of specific cargos after axonal insult has not been examined systematically in a model of enhanced regenerative capacity, it is unknown whether the transport of all cargos would be modulated equally in injured central nervous system neurons. Here, using a microfluidic culture system we compared neurons co-deleted for PTEN and SOCS3, an established model of high axonal regeneration capacity, to control neurons. We measured the axonal transport of three cargos (mitochondria, synaptic vesicles and late endosomes in regenerating axons and found that the transport of mitochondria, but not the other cargos, was increased in PTEN/SOCS3 co-deleted axons relative to controls. The results reported here suggest a pivotal role for this organelle during axonal regeneration.

  20. Radial, sideward and elliptic flow at AGS energies

    Indian Academy of Sciences (India)

    the sideward flow, the elliptic flow and the radial transverse mass distribution of protons data at. AGS energies. In order to ... data on both sideward and elliptic flow, NL3 model is better at 2 A¡GeV, while NL23 model is at 4–8. A¡GeV. ... port approach RBUU which is based on a coupled set of covariant transport equations for.

  1. Transport barrier in Helical system

    International Nuclear Information System (INIS)

    Ida, Katsumi

    1998-01-01

    Experiments on the transport barrier in Helical plasmas are reviewed. There are two mechanisms of transport improvement, that results in the formation of the transport barrier. One is the improvement of neoclassical transport by reducing the ripple loss with radial electric field, which exist only in helical plasma. The other is the improvement of anomalous transport due to the suppression of fluctuations associated with a radial electric field shear both in tokamak and helical plasma. The formation of the transport barrier can be triggered by the radial electric field shear associated with the transition of the radial electric field (L/H transition or ion-electron root transition) or the peaked density or the optimization of magnetic field shear. The mechanisms of transport barrier formation are also discussed. (author). 60 refs

  2. Exceptional circles of radial potentials

    International Nuclear Information System (INIS)

    Music, M; Perry, P; Siltanen, S

    2013-01-01

    A nonlinear scattering transform is studied for the two-dimensional Schrödinger equation at zero energy with a radial potential. Explicit examples are presented, both theoretically and computationally, of potentials with nontrivial singularities in the scattering transform. The singularities arise from non-uniqueness of the complex geometric optics solutions that define the scattering transform. The values of the complex spectral parameter at which the singularities appear are called exceptional points. The singularity formation is closely related to the fact that potentials of conductivity type are ‘critical’ in the sense of Murata. (paper)

  3. Colloidal transport of uranium in soil: Size fractionation and characterization by field-flow fractionation-multi-detection

    International Nuclear Information System (INIS)

    Claveranne-Lamolere, C.; Lespes, G.; Dubascoux, St.; Potin-Gautier, M.; Claveranne-Lamolere, C.; Aupiais, J.; Pointurier, F.

    2009-01-01

    The aim of this study was to characterize colloids associated with uranium by using an on-line fractionation/multi-detection technique based on asymmetrical flow field-flow fractionation (As-Fl-FFF) hyphenated with UV detector, multi angle laser light scattering (MALLS) and inductively coupling plasma-mass spectrometry (ICP-MS). Moreover, thanks to the As-Fl-FFF, the different colloidal fractions were collected and characterized by a total organic carbon analyzer (TOC). Thus it is possible to determine the nature (organic or inorganic colloids), molar mass, size (gyration and hydrodynamic radii) and quantitative uranium distribution over the whole colloidal phase. In the case of the site studied, two populations are highlighted. The first population corresponds to humic-like substances with a molar mass of (1500 ± 300) g mol -1 and a hydrodynamic diameter of (2. 0 ± 0. 2) nm. The second one has been identified as a mix of carbonated nano-particles or clays with organic particles (aggregates and/or coating of the inorganic particles) with a size range hydrodynamic diameter between 30 and 450 nm. Each population is implied in the colloidal transport of uranium: maximum 1% of the uranium content in soil leachate is transported by the colloids in the site studied, according to the depth in the soil. Indeed, humic substances are the main responsible of this transport in sub-surface conditions whereas nano-particles drive the phenomenon in depth conditions. (authors)

  4. Label-free nanoscale characterization of red blood cell structure and dynamics using single-shot transport of intensity equation

    Science.gov (United States)

    Poola, Praveen Kumar; John, Renu

    2017-10-01

    We report the results of characterization of red blood cell (RBC) structure and its dynamics with nanometric sensitivity using transport of intensity equation microscopy (TIEM). Conventional transport of intensity technique requires three intensity images and hence is not suitable for studying real-time dynamics of live biological samples. However, assuming the sample to be homogeneous, phase retrieval using transport of intensity equation has been demonstrated with single defocused measurement with x-rays. We adopt this technique for quantitative phase light microscopy of homogenous cells like RBCs. The main merits of this technique are its simplicity, cost-effectiveness, and ease of implementation on a conventional microscope. The phase information can be easily merged with regular bright-field and fluorescence images to provide multidimensional (three-dimensional spatial and temporal) information without any extra complexity in the setup. The phase measurement from the TIEM has been characterized using polymeric microbeads and the noise stability of the system has been analyzed. We explore the structure and real-time dynamics of RBCs and the subdomain membrane fluctuations using this technique.

  5. Evaluation of modelling of the TRUE-1 radially converging tests with sorbing tracers. The Aespoe task force on modelling of groundwater flow and transport of solutes. Tasks 4E and 4F

    Energy Technology Data Exchange (ETDEWEB)

    Elert, M.; Svensson, Haakan [Kemakta Konsult AB, Stockholm (Sweden)

    2001-05-01

    The Aespoe Task Force on Modelling of Groundwater Flow and Transport of Solutes is a forum for the international organisations supporting the Aespoe HRL Project. The purpose of the Task Force is to interact in the area of conceptual and numerical modelling of groundwater flow and solute transport in fractured rock. Task 4 of the Aespoe Modelling Task Force consists of modelling exercises in support of the TRUE-1 tracer tests. In this report, the modelling work performed within Tasks 4E and 4F is evaluated, which comprised predictive modelling of the tracer tests (STT-1, STT-1b and STT-2) performed within the TRUE-1 project using sorbing and non-sorbing tracers. The tests were made between packed off boreholes penetrating a water-conducting geological feature with a simple structure (Feature A). Nine modelling teams representing eight organisations have performed predictive modelling of the tracer tests using different modelling approaches and models. The modelling groups were initially given data from the site characterisation, data from preliminary tracer tests performed with non-sorbing tracers and data on the experimental set-up of the sorbing tracer tests. Based on this information, model predictions were made of drawdown, tracer mass recovery and tracer breakthrough. For the predictions of the STT-1b and STT-2 tests results from previous tracer tests with sorbing tracer were also available. The predictions of the sorbing tracer breakthrough in the initial tracer test (STT-1) generally underestimated the breakthrough time, suggesting the need to include additional processes and evaluate the application of the laboratory data. As a result of model calibration and modification the predictions were considerably improved for the latter tracer tests (STT-1b and STT-2). Task 4E and 4F have proved to be very valuable in increasing the understanding of non-sorbing tracer transport in fractured rock. There is a general consensus on the major processes responsible for

  6. Generation and Characterization of Anti-VGLUT Nanobodies Acting as Inhibitors of Transport.

    Science.gov (United States)

    Schenck, Stephan; Kunz, Laura; Sahlender, Daniela; Pardon, Els; Geertsma, Eric R; Savtchouk, Iaroslav; Suzuki, Toshiharu; Neldner, Yvonne; Štefanić, Saša; Steyaert, Jan; Volterra, Andrea; Dutzler, Raimund

    2017-08-01

    The uptake of glutamate by synaptic vesicles is mediated by vesicular glutamate transporters (VGLUTs). The central role of these transporters in excitatory neurotransmission underpins their importance as pharmacological targets. Although several compounds inhibit VGLUTs, highly specific inhibitors were so far unavailable, thus limiting applications to in vitro experiments. Besides their potential in pharmacology, specific inhibitors would also be beneficial for the elucidation of transport mechanisms. To overcome this shortage, we generated nanobodies (Nbs) by immunization of a llama with purified rat VGLUT1 and subsequent selection of binders from a phage display library. All identified Nbs recognize cytosolic epitopes, and two of the binders greatly reduced the rate of uptake of glutamate by reconstituted liposomes and subcellular fractions enriched with synaptic vesicles. These Nbs can be expressed as functional green fluorescent protein fusion proteins in the cytosol of HEK cells for intracellular applications as immunocytochemical and biochemical agents. The selected binders thus provide valuable tools for cell biology and neuroscience.

  7. Characterization of diffusive transport in cementitious materials: influence of microstructure in mortars

    International Nuclear Information System (INIS)

    Larbi, B.

    2013-01-01

    Concrete durability is a subject of considerable interest, especially with the use of cement based materials on structures increasingly demanding on term of sustainability and resistance to aggressive ions penetration or radionuclide release. Diffusion is considered as one of the main transport phenomena that cause migration of aggressive solutes and radionuclide in a porous media according to most studies. In order to enable more effective prediction of structures service life, the understanding of the link between cement based materials microstructure and transport macro properties needed to be enhanced. In this context, the present study is undertaken to enhance our understanding of the links between microstructure and tritiated water diffusivity in saturated mortars. The effect of aggregates via the ITZ (Interfacial Transition Zone) on transport properties and materials durability is studied. (author) [fr

  8. Molecular and functional characterization of riboflavin specific transport system in rat brain capillary endothelial cells

    Science.gov (United States)

    Patel, Mitesh; Vadlapatla, Ramya Krishna; Pal, Dhananjay; Mitra, Ashim K.

    2012-01-01

    Riboflavin is an important water soluble vitamin (B2) required for metabolic reactions, normal cellular growth, differentiation and function. Mammalian brain cells cannot synthesize riboflavin and must import from systemic circulation. However, the uptake mechanism, cellular translocation and intracellular trafficking of riboflavin in brain capillary endothelial cells are poorly understood. The primary objective of this study is to investigate the existence of riboflavin-specific transport system and delineate the uptake and intracellular regulation of riboflavin in immortalized rat brain capillary endothelial cells (RBE4). The uptake of [3H]-Riboflavin is sodium, temperature and energy dependent but pH independent. [3H]-Riboflavin uptake is saturable with Km and Vmax values of 19 ± 3 µM and 0.235 ± 0.012 picomoles/min/mg protein, respectively. The uptake process is inhibited by unlabelled structural analogs (lumiflavin, lumichrome) but not by structurally unrelated vitamins. Ca++/calmodulin and protein kinase A (PKA) pathways are found to play an important role in the intracellular regulation of [3H]-Riboflavin. Apical and baso-lateral uptake of [3H]-Riboflavin clearly indicate that riboflavin specific transport system is predominantly localized on the apical side of RBE4 cells. A 628 bp band corresponding to riboflavin transporter is revealed in RT-PCR analysis. These findings, for the first time report the existence of a specialized and high affinity transport system for riboflavin in RBE4 cells. Blood-brain barrier (BBB) is a major obstacle limiting drug transport inside the brain as it regulates drug permeation from systemic circulation. This transporter can be utilized for targeted delivery in enhancing brain permeation of highly potent drugs on systemic administration. PMID:22683359

  9. Direct minority carrier transport characterization of InAs/InAsSb superlattice nBn photodetectors

    International Nuclear Information System (INIS)

    Zuo, Daniel; Liu, Runyu; Wasserman, Daniel; Mabon, James; He, Zhao-Yu; Liu, Shi; Zhang, Yong-Hang; Kadlec, Emil A.; Olson, Benjamin V.; Shaner, Eric A.

    2015-01-01

    We present an extensive characterization of the minority carrier transport properties in an nBn mid-wave infrared detector incorporating a Ga-free InAs/InAsSb type-II superlattice as the absorbing region. Using a modified electron beam induced current technique in conjunction with time-resolved photoluminescence, we were able to determine several important transport parameters of the absorber region in the device, which uses a barrier layer to reduce dark current. For a device at liquid He temperatures, we report a minority carrier diffusion length of 750 nm and a minority carrier lifetime of 200 ns, with a vertical diffusivity of 3 × 10 −2  cm 2 /s. We also report on the device's optical response characteristics at 78 K

  10. Exploring a potential energy surface by machine learning for characterizing atomic transport

    Science.gov (United States)

    Kanamori, Kenta; Toyoura, Kazuaki; Honda, Junya; Hattori, Kazuki; Seko, Atsuto; Karasuyama, Masayuki; Shitara, Kazuki; Shiga, Motoki; Kuwabara, Akihide; Takeuchi, Ichiro

    2018-03-01

    We propose a machine-learning method for evaluating the potential barrier governing atomic transport based on the preferential selection of dominant points for atomic transport. The proposed method generates numerous random samples of the entire potential energy surface (PES) from a probabilistic Gaussian process model of the PES, which enables defining the likelihood of the dominant points. The robustness and efficiency of the method are demonstrated on a dozen model cases for proton diffusion in oxides, in comparison with a conventional nudge elastic band method.

  11. Characterization of intracellular regions in the human serotonin transporter for phosphorylation sites

    DEFF Research Database (Denmark)

    Sørensen, Lena; Strømgaard, Kristian; Kristensen, Anders S

    2014-01-01

    In the central nervous system, synaptic levels of the monoamine neurotransmitter serotonin are mainly controlled by the serotonin transporter (SERT), and drugs used in the treatment of various psychiatric diseases have SERT as primary target. SERT is a phosphoprotein that undergoes phosphorylation....../dephosphorylation during transporter regulation by multiple pathways. In particular, activation and/or inhibition of kinases including PKC, PKG, p38MAPK, and CaMKII modulate SERT function and trafficking. The molecular mechanisms by which kinase activity is linked to SERT regulation are poorly understood, including...

  12. Growth and characterization of Bi2Se3 crystals by chemical vapor transport

    Directory of Open Access Journals (Sweden)

    W. H. Jiao

    2012-06-01

    Full Text Available Regularly-shaped high-quality Bi2Se3 crystals were grown by a chemical vapor transport using iodine as the transport agent. In addition to exhibiting a characteristic Dirac cone for a topological insulator, the Bi2Se3 crystals show some outstanding properties including additional crystallographic surfaces, large residual resistance ratio (∼10, and high mobility (∼8000 cm2·V−1·s−1. The low-temperature resistivity abnormally increases with applying pressures up to 1.7 GPa, and no superconductivity was observed down to 0.4 K.

  13. Functional characterization of the human multidrug transporter, ABCG2, expressed in insect cells

    DEFF Research Database (Denmark)

    Ozvegy, C.; Litman, Thomas; Szakacs, G.

    2001-01-01

    ABCG2 (also called MXR (3), BCRP (4), or ABCP (5) is a recently-identified ABC half-transporter, which causes multidrug resistance in cancer. Here we report that the expression of the ABCG2 protein in Sf9 insect cells resulted in a high-capacity, vanadate-sensitive ATPase activity in isolated...

  14. Cloning, Expression, and Functional Characterization of Secondary Amino Acid Transporters of Lactococcus lactis

    NARCIS (Netherlands)

    Trip, Hein; Mulder, Niels L.; Lolkema, Juke S.

    Fourteen genes encoding putative secondary amino acid transporters were identified in the genomes of Lactococcus lactis subsp. cremoris strains MG1363 and SK11 and L. lactis subsp. lactis strains IL1403 and KF147, 12 of which were common to all four strains. Amino acid uptake in L. lactis cells

  15. Characterization and regulation of glycine transport in Fusarium oxysporum var. lini.

    Science.gov (United States)

    Castro, I M; Lima, A A; Nascimento, A F; Ruas, M M; Nicoli, J R; Brandão, R L

    1996-08-01

    Glycine was transported in Fusarium oxysporum cells, grown on glycine as the sole source of carbon and nitrogen, by a facilitated diffusion transport system with a half-saturation constant (Ks) of 11 mM and a maximum velocity (Vmax) of 1.2 mM (g dry weight)-1 h-1 at pH 5.0 and 26 degrees C. Under conditions of nitrogen starvation, the same system was present together with a high-affinity one (Ks) of about 47 microM and Vmax of about 60 microM (g dry weight)-1 h-1). The low-affinity system was more specific than the high-affinity system. Cells grown on gelatine showed the same behavior. In cells grown on glucose-gelatine medium, the low-affinity system was poorly expressed even after carbon and nitrogen starvation. Moreover, addition of glucose to cells grown on glycine and resuspended in mineral medium caused an increase of the glycine transport probably due to a boost in protein synthesis. This stimulation did not affect the Ks of the low-affinity system. These results demonstrate that, as is the case for other eukaryotic systems, F. oxysporum glycine transport is under control of nitrogen sources but its regulation by carbon sources appears to be more complex.

  16. Radial-Electric-Field Piezoelectric Diaphragm Pumps

    Science.gov (United States)

    Bryant, Robert G.; Working, Dennis C.; Mossi, Karla; Castro, Nicholas D.; Mane, Pooma

    2009-01-01

    In a recently invented class of piezoelectric diaphragm pumps, the electrode patterns on the piezoelectric diaphragms are configured so that the electric fields in the diaphragms have symmetrical radial (along-the-surface) components in addition to through-the-thickness components. Previously, it was accepted in the piezoelectric-transducer art that in order to produce the out-of-plane bending displacement of a diaphragm needed for pumping, one must make the electric field asymmetrical through the thickness, typically by means of electrodes placed on only one side of the piezoelectric material. In the present invention, electrodes are placed on both sides and patterned so as to produce substantial radial as well as through-the-thickness components. Moreover, unlike in the prior art, the electric field can be symmetrical through the thickness. Tests have shown in a given diaphragm that an electrode configuration according to this invention produces more displacement than does a conventional one-sided electrode pattern. The invention admits of numerous variations characterized by various degrees of complexity. Figure 1 is a simplified depiction of a basic version. As in other piezoelectric diaphragm pumps of similar basic design, the prime mover is a piezoelectric diaphragm. Application of a suitable voltage to the electrodes on the diaphragm causes it to undergo out-of-plane bending. The bending displacement pushes a fluid out of, or pulls the fluid into, a chamber bounded partly by the diaphragm. Also as in other diaphragm pumps in general, check valves ensure that the fluid flows only in through one port and only out through another port.

  17. Radial electron beam laser excitation: the REBLE report

    International Nuclear Information System (INIS)

    Ramirez, J.J.; Prestwich, K.R.

    1978-10-01

    The results of an investigation of techniques to generate high-power radially converging electron beams and the application of these beams to gas lasers is discussed. The design and performance of the REBLE accelerator that was developed for this program is presented. Reliable operation of the radial diode has been obtained at levels up to 1 MV, 200 kA, and 20 ns. It has been demonstrated that the anode current density can be made uniform to better than 15% over 1000 cm 2 areas with 100 to 250 A/cm 2 intensities. The measured total and spatially resolved energy deposition of this radial electron beam in various gases is compared with Monte Carlo calculations. In most cases, these codes give an accurate description of the beam transport and energy deposition. With the electron beam pumping xenon gas, the amplitude of xenon excimer radiation (1720 A 0 ) was radially uniform to within the experimental uncertainty. The efficiency of converting deposited electron beam energy to xenon excimer radiation was 20%

  18. SNPs altering ammonium transport activity of human Rhesus factors characterized by a yeast-based functional assay.

    Directory of Open Access Journals (Sweden)

    Aude Deschuyteneer

    Full Text Available Proteins of the conserved Mep-Amt-Rh family, including mammalian Rhesus factors, mediate transmembrane ammonium transport. Ammonium is an important nitrogen source for the biosynthesis of amino acids but is also a metabolic waste product. Its disposal in urine plays a critical role in the regulation of the acid/base homeostasis, especially with an acid diet, a trait of Western countries. Ammonium accumulation above a certain concentration is however pathologic, the cytotoxicity causing fatal cerebral paralysis in acute cases. Alteration in ammonium transport via human Rh proteins could have clinical outcomes. We used a yeast-based expression assay to characterize human Rh variants resulting from non synonymous single nucleotide polymorphisms (nsSNPs with known or unknown clinical phenotypes and assessed their ammonium transport efficiency, protein level, localization and potential trans-dominant impact. The HsRhAG variants (I61R, F65S associated to overhydrated hereditary stomatocytosis (OHSt, a disease affecting erythrocytes, proved affected in intrinsic bidirectional ammonium transport. Moreover, this study reveals that the R202C variant of HsRhCG, the orthologue of mouse MmRhcg required for optimal urinary ammonium excretion and blood pH control, shows an impaired inherent ammonium transport activity. Urinary ammonium excretion was RHcg gene-dose dependent in mouse, highlighting MmRhcg as a limiting factor. HsRhCG(R202C may confer susceptibility to disorders leading to metabolic acidosis for instance. Finally, the analogous R211C mutation in the yeast ScMep2 homologue also impaired intrinsic activity consistent with a conserved functional role of the preserved arginine residue. The yeast expression assay used here constitutes an inexpensive, fast and easy tool to screen nsSNPs reported by high throughput sequencing or individual cases for functional alterations in Rh factors revealing potential causal variants.

  19. Radial smoothing and closed orbit

    International Nuclear Information System (INIS)

    Burnod, L.; Cornacchia, M.; Wilson, E.

    1983-11-01

    A complete simulation leading to a description of one of the error curves must involve four phases: (1) random drawing of the six set-up points within a normal population having a standard deviation of 1.3 mm; (b) random drawing of the six vertices of the curve in the sextant mode within a normal population having a standard deviation of 1.2 mm. These vertices are to be set with respect to the axis of the error lunes, while this axis has as its origins the positions defined by the preceding drawing; (c) mathematical definition of six parabolic curves and their junctions. These latter may be curves with very slight curvatures, or segments of a straight line passing through the set-up point and having lengths no longer than one LSS. Thus one gets a mean curve for the absolute errors; (d) plotting of the actually observed radial positions with respect to the mean curve (results of smoothing)

  20. Waves on radial film flows

    Science.gov (United States)

    Cholemari, Murali R.; Arakeri, Jaywant H.

    2005-08-01

    We study the stability of surface waves on the radial film flow created by a vertical cylindrical water jet striking a horizontal plate. In such flows, surface waves have been found to be unstable and can cause transition to turbulence. This surface-wave-induced transition is different from the well-known Tollmien-Schlichting wave-induced transition. The present study aims at understanding the instability and the transition process. We do a temporal stability analysis by assuming the flow to be locally two-dimensional but including spatial variations to first order in the basic flow. The waves are found to be dispersive, mostly unstable, and faster than the mean flow. Spatial variation is the major destabilizing factor. Experiments are done to test the results of the linear stability analysis and to document the wave breakup and transition. Comparison between theory and experiments is fairly good and indicates the adequacy of the model.

  1. Radial flow gas dynamic laser

    International Nuclear Information System (INIS)

    Damm, F.C.

    1975-01-01

    The unique gas dynamic laser provides outward radial supersonic flow from a toroidal shaped stacked array of a plurality of nozzles, through a diffuser having ring shaped and/or linear shaped vanes, and through a cavity which is cylindrical and concentric with the stacked array, with the resultant laser beam passing through the housing parallel to the central axis of the diffuser which is coincident with the axis of the gas dynamic laser. Therefore, greater beam extraction flexibility is attainable, because of fewer flow shock disturbances, as compared to the conventional unidirectional flow gas dynamic laser in which unidirectional supersonic flow sweeps through a rectangular cavity and is exhausted through a two-dimensional diffuser. (auth)

  2. Ulnar nerve entrapment complicating radial head excision

    Directory of Open Access Journals (Sweden)

    Kevin Parfait Bienvenu Bouhelo-Pam

    Full Text Available Introduction: Several mechanisms are involved in ischemia or mechanical compression of ulnar nerve at the elbow. Presentation of case: We hereby present the case of a road accident victim, who received a radial head excision for an isolated fracture of the radial head and complicated by onset of cubital tunnel syndrome. This outcome could be the consequence of an iatrogenic valgus of the elbow due to excision of the radial head. Hitherto the surgical treatment of choice it is gradually been abandoned due to development of radial head implant arthroplasty. However, this management option is still being performed in some rural centers with low resources. Discussion: The radial head plays an important role in the stability of the elbow and his iatrogenic deformity can be complicated by cubital tunnel syndrome. Conclusion: An ulnar nerve release was performed with favorable outcome. Keywords: Cubital tunnel syndrome, Peripheral nerve palsy, Radial head excision, Elbow valgus

  3. Isolation and molecular characterization of methicillin-resistant Staphylococcus aureus from public transport.

    Science.gov (United States)

    Iwao, Yasuhisa; Yabe, Shizuka; Takano, Tomomi; Higuchi, Wataru; Nishiyama, Akihito; Yamamoto, Tatsuo

    2012-01-01

    Methicillin-resistant Staphylococcus aureus (MRSA) not only causes disease in hospitals, but also in the community. The characteristics of MRSA transmission in the environment remain uncertain. In this study, MRSA were isolated from public transport in Tokyo and Niigata, Japan. Of 349 trains examined, eight (2.3%) were positive for MRSA. The MRSA isolated belonged to sequence types (STs) 5, 8, 88, and 89, and included community infection-associated ST8 MRSA (with novel type IV staphylococcal cassette chromosome mec) and the ST5 New York/Japan hospital clone. The data indicate that public transport could contribute to the spread of community-acquired MRSA, and awareness of this mode of transmission is necessary. © 2012 The Societies and Blackwell Publishing Asia Pty Ltd.

  4. Characterization of Taurine Transporting Systems During Acquirement of Resistance to Platinum(II)-based, Chemotherapeutic Drugs

    DEFF Research Database (Denmark)

    Sørensen, Belinda Halling

    Although, cisplatin is one of the most effective broad-spectrum anticancer drugs, prolonged cisplatin treatment often results in development of chemoresistance and subsequent therapeutic failure. Dysregulation of the taurine transporting systems i.e., the taurine transporter (TauT) and volume....... Cisplatin resistance correlates with a reduction in the volume regulated anion current and taurine release mediated by VRACs, as well as an improved cellular accumulation of taurine through TauT. In human ovarian A2780 cancer cells, for instance, cisplatin resistance is associated with an absent swelling......-induced taurine release and inability to volume regulate. The dismissed taurine release was due to an almost absent leucin-rich-repeat containing 8A (LRRC8A) total protein expression. LRRC8A is an important component of VRACs. Cellular taurine contributes to the intracellular pool of organic osmolytes. Moreover...

  5. Synthesis, characterization and charge transport mechanism of CdZnO nanorods

    International Nuclear Information System (INIS)

    Mahmoud, Waleed E.; Al-Ghamdi, A.A.; El-Tantawy, F.; Al-Heniti, S.

    2009-01-01

    ZnO and Cd-doped ZnO nanostructures were prepared by new facile method at 80 deg. C. XRD measurement indicated that both samples had typical hexagonal wurtzite structures. Transmission electron microscopy (TEM) measurement shows that rod-like crystals have been formed. EDX measurement confirms the incorporation of the cadmium ion into the crystalline lattice of ZnO and indicated that cadmium ions uniformly distributed on the surface of the rods. The doping with cadmium ions has a great influence on the optical properties of the ZnO. The electrical measurements of Cd-doped ZnO nanorod were measured. The current-voltage (I-V) characteristic curve revealed that the charge transport above 4 V is mainly non-linear due to grain boundary contribution. The complex impedance spectroscopy was confirmed that the grain boundary effect controls the charge transport mechanism through CdZnO ceramic material.

  6. Characterization and expression profiling of ATP-binding cassette transporter genes in the diamondback moth, Plutella xylostella (L.).

    Science.gov (United States)

    Qi, Weiping; Ma, Xiaoli; He, Weiyi; Chen, Wei; Zou, Mingmin; Gurr, Geoff M; Vasseur, Liette; You, Minsheng

    2016-09-27

    ATP-binding cassette (ABC) transporters are one of the major transmembrane protein families found in all organisms and play important roles in transporting a variety of compounds across intra and extra cellular membranes. In some species, ABC transporters may be involved in the detoxification of substances such as insecticides. The diamondback moth, Plutella xylostella (L.), a destructive pest of cruciferous crops worldwide, is an important species to study as it is resistant to many types of insecticides as well as biological control Bacillus thuringiensis toxins. A total of 82 ABC genes were identified from our published P. xylostella genome, and grouped into eight subfamilies (ABCA-H) based on phylogenetic analysis. Genes of subfamilies ABCA, ABCC and ABCH were found to be expanded in P. xylostella compared with those in Bombyx mori, Manduca sexta, Heliconius melpomene, Danaus plexippus, Drosophila melanogaster, Tetranychus urticae and Homo sapiens. Phylogenetic analysis indicated that many of the ABC transporters in P. xylostella are orthologous to the well-studied ABC transporter genes in the seven other species. Transcriptome- and qRT-PCR-based analysis elucidated physiological effects of ABC gene expressions of P. xylostella which were developmental stage- and tissue-specific as well as being affected by whether or not the insects were from an insecticide-resistant strain. Two ABCC and one ABCA genes were preferentially expressed in midgut of the 4th-instar larvae of a susceptible strain (Fuzhou-S) suggesting their potential roles in metabolizing plant defensive chemicals. Most of the highly expressed genes in insecticide-resistant strains were also predominantly expressed in the tissues of Malpighian tubules and midgut. This is the most comprehensive study on identification, characterization and expression profiling of ABC transporter genes in P. xylostella to date. The diversified features and expression patterns of this gene family may be associated with

  7. Characterization of the Hanford 300 area burial grounds. Task IV. Biological transport

    International Nuclear Information System (INIS)

    Fitzner, R.E.; Gano, K.A.; Rickard, W.H.; Rogers, L.E.

    1979-10-01

    The characteristics of radioactive waste burial sites at the 300 area burial grounds on the Department of Energy's Hanford Site, southeastern Washington were studied. The potential vectors of radionuclide transport studied were vegetation and animals. The overall results showed a low potential for uptake and transport of radionuclides from the 300 area sites. However, additional methods to control physical and biological mechanisms may contribute to the effectiveness of waste burial practices. From the results, the Biological Transport task recommended field studies which include reduction of soil erosion and addition of biobarriers to plants and animals. Vegetation plays a major role in reducing soil erosion, and thereby maintaining the backfill over the burial sites. Of the several species found on the 300 area sites, cheatgrass (Bromus tectorum) appears to be the most desirable as a cover. Besides retarding erosion, it has a shallow root system (does not easily penetrate buried material); it has a low affinity for radionuclide uptake; and its tissues are not easily blown away. Small mammals (specifically, mice) appear to have the most potential for radionuclide exposure and uptake. Small mammals were live-trapped within 10 x 10-meter trap grids. Each animal trapped was surgically implanted with a thermoluminescent dosimeter. When the animal was recaptured, the dosimeter was removed and read for exposure. Exposures were reported in milli-Roentgens. The most consistently trapped small mammals were the Great Basin pocket mouse (Perognathus parvus) and the deer mouse (Peromyscus maniculatus). Results from the dosimeter readings showed that some of those animals had higher than background exposures. Biobarriers to animals could be considered as a mechanism to reduce the potential for radionuclide transport

  8. Characterization of the Hanford 300 area burial grounds. Task IV. Biological transport

    Energy Technology Data Exchange (ETDEWEB)

    Fitzner, R.E.; Gano, K.A.; Rickard, W.H.; Rogers, L.E.

    1979-10-01

    The characteristics of radioactive waste burial sites at the 300 area burial grounds on the Department of Energy's Hanford Site, southeastern Washington were studied. The potential vectors of radionuclide transport studied were vegetation and animals. The overall results showed a low potential for uptake and transport of radionuclides from the 300 area sites. However, additional methods to control physical and biological mechanisms may contribute to the effectiveness of waste burial practices. From the results, the Biological Transport task recommended field studies which include reduction of soil erosion and addition of biobarriers to plants and animals. Vegetation plays a major role in reducing soil erosion, and thereby maintaining the backfill over the burial sites. Of the several species found on the 300 area sites, cheatgrass (Bromus tectorum) appears to be the most desirable as a cover. Besides retarding erosion, it has a shallow root system (does not easily penetrate buried material); it has a low affinity for radionuclide uptake; and its tissues are not easily blown away. Small mammals (specifically, mice) appear to have the most potential for radionuclide exposure and uptake. Small mammals were live-trapped within 10 x 10-meter trap grids. Each animal trapped was surgically implanted with a thermoluminescent dosimeter. When the animal was recaptured, the dosimeter was removed and read for exposure. Exposures were reported in milli-Roentgens. The most consistently trapped small mammals were the Great Basin pocket mouse (Perognathus parvus) and the deer mouse (Peromyscus maniculatus). Results from the dosimeter readings showed that some of those animals had higher than background exposures. Biobarriers to animals could be considered as a mechanism to reduce the potential for radionuclide transport.

  9. Isolation and Characterization of the Colletotrichum acutatum ABC Transporter CaABC1

    Directory of Open Access Journals (Sweden)

    Suyoung Kim

    2014-12-01

    Full Text Available Fungi tolerate exposure to various abiotic stresses, including cytotoxic compounds and fungicides, via their ATP-driven efflux pumps belonging to ATP-binding cassette (ABC transporters. To clarify the molecular basis of interaction between the fungus and various abiotic stresses including fungicides, we constructed a cDNA library from germinated conidia of Colletotrichum acutatum, a major anthracnose pathogen of pepper (Capsicum annum L.. Over 1,000 cDNA clones were sequenced, of which single clone exhibited significant nucleotide sequence homology to ABC transporter genes. We isolated three fosmid clones containing the C. acutatum ABC1 (CaABC1 gene in full-length from genomic DNA library screening. The CaABC1 gene consists of 4,059 bp transcript, predicting a 1,353-aa protein. The gene contains the typical ABC signature and Walker A and B motifs. The 5′-flanking region contains a CAAT motif, a TATA box, and a Kozak region. Phylogenetic and structural analysis suggested that the CaABC1 is a typical ABC transporter gene highly conserved in various fungal species, as well as in Chromista, Metazoans, and Viridiplantae. We also found that CaABC1 was up-regulated during conidiation and a minimal medium condition. Moreover, CaABC1 was induced in iprobenfos, kresoxim-methyl, thiophanate-methyl, and hygromycin B. These results demonstrate that CaABC1 is necessary for conidiation, abiotic stress, and various fungicide resistances. These results will provide the basis for further study on the function of ABC transporter genes in C. acutatum.

  10. Characterization of bromine-76-labelled 5-bromo-6-nitroquipazine for PET studies of the serotonin transporter

    Energy Technology Data Exchange (ETDEWEB)

    Lundkvist, Camilla E-mail: Lundkvis@shfj.cea.fr; Loc' h, Christian; Halldin, Christer; Bottlaender, Michel; Ottaviani, Michele; Coulon, Christine; Fuseau, Chantal; Mathis, Chester; Farde, Lars; Maziere, Bernard

    1999-07-01

    The development of suitable radioligands for brain imaging of the serotonin transporter is of great importance for the study of depression and other affective disorders. The potent and selective serotonin transporter ligand, 5-iodo-6-nitro-2-piperazinylquinoline, has been labelled with iodine-123 and used as a radioligand for single photon emission computerized tomography. To evaluate the potential of the bromine-76-labelled analogue, 5-bromo-6-nitroquipazine, as a radioligand for positron emission tomography (PET), its brain distribution and binding characteristics were examined in rats. In vivo brain distribution and ex vivo autoradiography demonstrated that [{sup 76}Br]5-bromo-6-nitroquipazine enters the brain rapidly. The regional brain distribution of [{sup 76}Br]5-bromo-6-nitroquipazine was consistent with the known distribution of serotonin transporters in the midbrain, pons, thalamus, striatum, and neocortex. Specific binding was inhibited by the selective serotonin reuptake inhibitor citalopram. The peripheral metabolism in plasma was rapid, but more than 90% of the radioactivity in brain represented unchanged radioligand 2 h postinjection (p.i.). A preliminary PET study was also performed in a baboon. Following the intravenous injection of [{sup 76}Br]5-bromo-6-nitroquipazine in a baboon, there was a conspicuous accumulation of radioactivity in thalamus, striatum, and pons. The radioactivity in these brain regions was 1.5 times higher than in the cerebellum at 3 h and 2.5-4 times higher at 24 h. A rapid metabolism of the radioligand in plasma was observed (38% unchanged after 5 min). The results indicate that [{sup 76}Br]5-bromo-6-nitroquipazine has potential for PET imaging of the serotonin transporter.

  11. Characterization of a novel organic solute transporter homologue from Clonorchis sinensis.

    Directory of Open Access Journals (Sweden)

    Yanyan Lu

    2018-04-01

    Full Text Available Clonorchis sinensis is a liver fluke that can dwell in the bile ducts of mammals. Bile acid transporters function to maintain the homeostasis of bile acids in C. sinensis, as they induce physiological changes or have harmful effects on C. sinensis survival. The organic solute transporter (OST transports mainly bile acid and belongs to the SLC51 subfamily of solute carrier transporters. OST plays a critical role in the recirculation of bile acids in higher animals. In this study, we cloned full-length cDNA of the 480-amino acid OST from C. sinensis (CsOST. Genomic analysis revealed 11 exons and nine introns. The CsOST protein had a 'Solute_trans_a' domain with 67% homology to Schistosoma japonicum OST. For further analysis, the CsOST protein sequence was split into the ordered domain (CsOST-N at the N-terminus and disordered domain (CsOST-C at the C-terminus. The tertiary structure of each domain was built using a threading-based method and determined by manual comparison. In a phylogenetic tree, the CsOST-N domain belonged to the OSTα and CsOST-C to the OSTβ clade. These two domains were more highly conserved with the OST α- and β-subunits at the structure level than at sequence level. These findings suggested that CsOST comprised the OST α- and β-subunits. CsOST was localized in the oral and ventral suckers and in the mesenchymal tissues abundant around the intestine, vitelline glands, uterus, and testes. This study provides fundamental data for the further understanding of homologues in other flukes.

  12. Characterization of a novel organic solute transporter homologue from Clonorchis sinensis

    Science.gov (United States)

    Dai, Fuhong; Lee, Ji-Yun; Pak, Jhang Ho; Sohn, Woon-Mok

    2018-01-01

    Clonorchis sinensis is a liver fluke that can dwell in the bile ducts of mammals. Bile acid transporters function to maintain the homeostasis of bile acids in C. sinensis, as they induce physiological changes or have harmful effects on C. sinensis survival. The organic solute transporter (OST) transports mainly bile acid and belongs to the SLC51 subfamily of solute carrier transporters. OST plays a critical role in the recirculation of bile acids in higher animals. In this study, we cloned full-length cDNA of the 480-amino acid OST from C. sinensis (CsOST). Genomic analysis revealed 11 exons and nine introns. The CsOST protein had a ‘Solute_trans_a’ domain with 67% homology to Schistosoma japonicum OST. For further analysis, the CsOST protein sequence was split into the ordered domain (CsOST-N) at the N-terminus and disordered domain (CsOST-C) at the C-terminus. The tertiary structure of each domain was built using a threading-based method and determined by manual comparison. In a phylogenetic tree, the CsOST-N domain belonged to the OSTα and CsOST-C to the OSTβ clade. These two domains were more highly conserved with the OST α- and β-subunits at the structure level than at sequence level. These findings suggested that CsOST comprised the OST α- and β-subunits. CsOST was localized in the oral and ventral suckers and in the mesenchymal tissues abundant around the intestine, vitelline glands, uterus, and testes. This study provides fundamental data for the further understanding of homologues in other flukes. PMID:29702646

  13. Identification and Functional Characterization of a Tonoplast Dicarboxylate Transporter in Tomato (Solanum lycopersicum)

    OpenAIRE

    Liu, Ruiling; Li, Boqiang; Qin, Guozheng; Zhang, Zhanquan; Tian, Shiping

    2017-01-01

    Acidity plays an important role in flavor and overall organoleptic quality of fruit and is mainly due to the presence of organic acids. Understanding the molecular basis of organic acid metabolism is thus of primary importance for fruit quality improvement. Here, we cloned a putative tonoplast dicarboxylate transporter gene (SlTDT) from tomato, and submitted it to the NCBI database (GenBank accession number: KC733165). SlTDT protein contained 13 putative transmembrane domains in silico analys...

  14. Characterization of acetate transport in colorectal cancer cells and potential therapeutic implications

    Science.gov (United States)

    Ferro, Suellen; Azevedo-Silva, João; Casal, Margarida; Côrte-Real, Manuela; Baltazar, Fatima; Preto, Ana

    2016-01-01

    Acetate, together with other short chain fatty acids has been implicated in colorectal cancer (CRC) prevention/therapy. Acetate was shown to induce apoptosis in CRC cells. The precise mechanism underlying acetate transport across CRC cells membrane, that may be implicated in its selectivity towards CRC cells, is not fully understood and was addressed here. We also assessed the effect of acetate in CRC glycolytic metabolism and explored its use in combination with the glycolytic inhibitor 3-bromopyruvate (3BP). We provide evidence that acetate enters CRC cells by the secondary active transporters MCT1 and/or MCT2 and SMCT1 as well as by facilitated diffusion via aquaporins. CRC cell exposure to acetate upregulates the expression of MCT1, MCT4 and CD147, while promoting MCT1 plasma membrane localization. We also observed that acetate increases CRC cell glycolytic phenotype and that acetate-induced apoptosis and anti-proliferative effect was potentiated by 3BP. Our data suggest that acetate selectivity towards CRC cells might be explained by the fact that aquaporins and MCTs are found overexpressed in CRC clinical cases. Our work highlights the importance that acetate transport regulation has in the use of drugs such as 3BP as a new therapeutic strategy for CRC. PMID:28874966

  15. Site characterization and validation - monitoring of saline tracer transport by borehole radar measurements

    International Nuclear Information System (INIS)

    Olsson, O.; Andersson, P.; Gustafsson, E.

    1991-08-01

    The objective of this experiment was to map tracer transport in fractured crystalline rock through a combination of radar difference tomography and measurements of tracer concentration in boreholes and the validation drift. The experiment was performed twice, first the D-boreholes were used as a sink and then they were replaced by the validation drift and the experiment repeated. In both experiments saline tracer (200 ml/min, 2% salinity) was injected into fracture zone H about 25 m from the validation drift. The experiment revealed an inhomogeneous transmissivity distribution in Zone H. A significant portion of the tracer is transported upwards along Zone H and towards boreholes T1, T2, and W1. The breakthrough data from both experiments indicate that there are two major transport paths from borehole C2 to the D-boreholes/validation drift. One slow and diluted path to the bottom of the drift which carries the bulk of the mass and one fast path to the crown of the drift with high tracer concentration. The radar difference tomograms show that some tracer is lost through Zone S which intersects Zone H and is nearly perpendicular to it. The intersection between the two zones seems to constitute a preferred flow path. The breakthrough data and the radar difference tomograms have also been used to estimate flow porosity. The estimate obtained area of the same order approximately 10 -4 . (au) (28 refs.)

  16. Functional characterization of dopamine transporter in vivo using Drosophila melanogaster behavioral analysis.

    Directory of Open Access Journals (Sweden)

    Taro eUeno

    2014-09-01

    Full Text Available Dopamine mediates diverse functions such as motivation, reward, attention, learning/memory and sleep/arousal. Recent studies using model organisms including the fruit fly, have elucidated various physiological functions of dopamine, and identified specific neural circuits for these functions. Flies with mutations in the Drosophila dopamine transporter (dDAT gene show enhanced dopamine signaling, and short sleep and memory impairment phenotypes. However, understanding the mechanism by which dopamine signaling causes these phenotypes requires an understanding of the dynamics of dopamine release. Here we report the effects of dDAT expression on behavioral traits. We show that dDAT expression in a subset of dopaminergic neurons is sufficient for normal sleep. dDAT expression in other cell types such as Kenyon cells and glial cells can also rescue the short sleep phenotype of dDAT mutants. dDAT mutants also show a down-regulation of the D1-like dopamine receptor dDA1, and this phenotype is rescued when dDAT is expressed in the same cell types in which it rescues sleep. On the other hand, dDAT overexpression in mushroom bodies, which are the target of memory forming dopamine neurons, abolishes olfactory aversive memory. Our data demonstrate that expression of extrasynaptic dopamine transporters can rescue some aspects of dopamine signaling in dopamine transporter mutants. These results provide novel insights into regulatory systems that modulate dopamine signaling.

  17. Error characterization of CO2 vertical mixing in the atmospheric transport model WRF-VPRM

    Directory of Open Access Journals (Sweden)

    U. Karstens

    2012-03-01

    Full Text Available One of the dominant uncertainties in inverse estimates of regional CO2 surface-atmosphere fluxes is related to model errors in vertical transport within the planetary boundary layer (PBL. In this study we present the results from a synthetic experiment using the atmospheric model WRF-VPRM to realistically simulate transport of CO2 for large parts of the European continent at 10 km spatial resolution. To elucidate the impact of vertical mixing error on modeled CO2 mixing ratios we simulated a month during the growing season (August 2006 with different commonly used parameterizations of the PBL (Mellor-Yamada-Janjić (MYJ and Yonsei-University (YSU scheme. To isolate the effect of transport errors we prescribed the same CO2 surface fluxes for both simulations. Differences in simulated CO2 mixing ratios (model bias were on the order of 3 ppm during daytime with larger values at night. We present a simple method to reduce this bias by 70–80% when the true height of the mixed layer is known.

  18. Stirling Engine With Radial Flow Heat Exchangers

    Science.gov (United States)

    Vitale, N.; Yarr, George

    1993-01-01

    Conflict between thermodynamical and structural requirements resolved. In Stirling engine of new cylindrical configuration, regenerator and acceptor and rejector heat exchangers channel flow of working gas in radial direction. Isotherms in regenerator ideally concentric cylinders, and gradient of temperature across regenerator radial rather than axial. Acceptor and rejector heat exchangers located radially inward and outward of regenerator, respectively. Enables substantial increase in power of engine without corresponding increase in diameter of pressure vessel.

  19. A nu-space for image correlation spectroscopy: characterization and application to measure protein transport in live cells

    Science.gov (United States)

    Potvin-Trottier, Laurent; Chen, Lingfeng; Horwitz, Alan Rick; Wiseman, Paul W.

    2013-08-01

    We introduce a new generalized theoretical framework for image correlation spectroscopy (ICS). Using this framework, we extend the ICS method in time-frequency (ν, nu) space to map molecular flow of fluorescently tagged proteins in individual living cells. Even in the presence of a dominant immobile population of fluorescent molecules, nu-space ICS (nICS) provides an unbiased velocity measurement, as well as the diffusion coefficient of the flow, without requiring filtering. We also develop and characterize a tunable frequency-filter for spatio-temporal ICS (STICS) that allows quantification of the density, the diffusion coefficient and the velocity of biased diffusion. We show that the techniques are accurate over a wide range of parameter space in computer simulation. We then characterize the retrograde flow of adhesion proteins (α6- and αLβ2-GFP integrins and mCherry-paxillin) in CHO.B2 cells plated on laminin and intercellular adhesion molecule 1 (ICAM-1) ligands respectively. STICS with a tunable frequency filter, in conjunction with nICS, measures two new transport parameters, the density and transport bias coefficient (a measure of the diffusive character of a flow/biased diffusion), showing that molecular flow in this cell system has a significant diffusive component. Our results suggest that the integrin-ligand interaction, along with the internal myosin-motor generated force, varies for different integrin-ligand pairs, consistent with previous results.

  20. Functional characterization of the Bradyrhizobium japonicum modA and modB genes involved in molybdenum transport.

    Science.gov (United States)

    Delgado, María J; Tresierra-Ayala, Alvaro; Talbi, Chouhra; Bedmar, Eulogio J

    2006-01-01

    A modABC gene cluster that encodes an ABC-type, high-affinity molybdate transporter from Bradyrhizobium japonicum has been isolated and characterized. B. japonicum modA and modB mutant strains were unable to grow aerobically or anaerobically with nitrate as nitrogen source or as respiratory substrate, respectively, and lacked nitrate reductase activity. The nitrogen-fixing ability of the mod mutants in symbiotic association with soybean plants grown in a Mo-deficient mineral solution was severely impaired. Addition of molybdate to the bacterial growth medium or to the plant mineral solution fully restored the wild-type phenotype. Because the amount of molybdate required for suppression of the mutant phenotype either under free-living or under symbiotic conditions was dependent on sulphate concentration, it is likely that a sulphate transporter is also involved in Mo uptake in B. japonicum. The promoter region of the modABC genes has been characterized by primer extension. Reverse transcription and expression of a transcriptional fusion, P(modA)-lacZ, was detected only in a B. japonicum modA mutant grown in a medium without molybdate supplementation. These findings indicate that transcription of the B. japonicum modABC genes is repressed by molybdate.

  1. Modelling of radial electric field profile for different divertor configurations

    International Nuclear Information System (INIS)

    Rozhansky, V; Kaveeva, E; Voskoboynikov, S; Counsell, G; Kirk, A; Meyer, H; Coster, D; Conway, G; Schirmer, J; Schneider, R

    2006-01-01

    The impact of divertor configuration on the structure of the radial electric field has been simulated by the B2SOLPS5.0 transport fluid code. It is shown that the change in the parallel flows in the scrape-off layer, which are transported through the separatrix due to turbulent viscosity and diffusivity, should result in variation of the radial electric field and toroidal rotation in the separatrix vicinity. The modelling predictions are compared with the measurements of the radial electric field for the low field side equatorial mid-plane of ASDEX Upgrade in lower, upper and double-null (DN) divertor configurations. The parallel (toroidal) flows in the scrape-off layer and mechanisms for their formation are analysed for different geometries. It is demonstrated that a spike in the electric field exists at the high field side equatorial mid-plane in the connected DN divertor configuration. Its origin is connected with different potential drops between the separatrix vicinity and divertor plates in the two disconnected scrape-off layers, while the separatrix should be at almost the same potential. The spike might be important for additional turbulent suppression

  2. Characterization of heterologously expressed transporter genes by patch- and voltage-clamp methods: Application to cyclic nucleotide-dependent responses

    KAUST Repository

    Lemtiri-Chlieh, Fouad; Ali, Rashid Ayesha

    2013-01-01

    The application of patch- and voltage-clamp methods to study ion transport can be limited by many hurdles: the size of the cells to be patched and/or stabbed, the subcellular localization of the molecule of interest, and its density of expression that could be too low even in their own native environment. Functional expression of genes using recombinant DNA technology not only overcomes those hurdles but also affords additional and elegant investigations such as single-point mutation studies and subunit associations/regulations. In this chapter, we give a step-by-step description of two electrophysiological methods, patch clamp and two-electrode voltage clamp (TEVC), that are routinely used in combination with heterologous gene expression to assist researchers interested in the identification and characterization of ion transporters. We describe how to (1) obtain and maintain the cells suitable for the use with each of the above-mentioned methods (i.e., HEK-293 cells and yeast spheroplasts to use with the patch-clamp methodology and Xenopus laevis oocytes with TEVC), (2) transfect/inject them with the gene of interest, and (3) record ion transport activities. © Springer Science+Business Media New York 2013.

  3. Characterizing and modelling the radionuclide transport properties of fracture zones in plutonic rocks of the Canadian Shield

    International Nuclear Information System (INIS)

    Davison, C.C.; Kozak, E.T.; Frost, L.H.; Everitt, R.A.; Brown, A.; Gascoyne, M.; Scheier, N.W.

    1999-01-01

    Plutonic rocks of the Canadian Shield were investigated as a potential host medium for nuclear fuel waste disposal of used CANDU nuclear fuel. Field investigations at several geologic research areas on the Shield have shown that major fracture zones are the dominant pathways for the large scale movement of groundwater and solutes through plutonic rock bodies. Because of this, a significant amount of the geoscience work has focused on methods to identify, characterize and model the radionuclide transport properties of major fracture zones in the fractured plutonic rocks of the Shield. In order to quantify the transport properties of such fracture zones a series of, groundwater tracer tests were performed over a period of several years in several major, low dipping fracture zones. Sixteen tracer tests were performed using dipole recirculation methods to evaluate transport over distance scales ranging from 17 m to 700 m. It was concluded that only tracer tests can provide useful estimates of the effective porosity and dispersivity characteristics of these large fracture zones in plutonic rocks of the Canadian Shield. (author)

  4. Characterization of heterologously expressed transporter genes by patch- and voltage-clamp methods: Application to cyclic nucleotide-dependent responses

    KAUST Repository

    Lemtiri-Chlieh, Fouad

    2013-09-03

    The application of patch- and voltage-clamp methods to study ion transport can be limited by many hurdles: the size of the cells to be patched and/or stabbed, the subcellular localization of the molecule of interest, and its density of expression that could be too low even in their own native environment. Functional expression of genes using recombinant DNA technology not only overcomes those hurdles but also affords additional and elegant investigations such as single-point mutation studies and subunit associations/regulations. In this chapter, we give a step-by-step description of two electrophysiological methods, patch clamp and two-electrode voltage clamp (TEVC), that are routinely used in combination with heterologous gene expression to assist researchers interested in the identification and characterization of ion transporters. We describe how to (1) obtain and maintain the cells suitable for the use with each of the above-mentioned methods (i.e., HEK-293 cells and yeast spheroplasts to use with the patch-clamp methodology and Xenopus laevis oocytes with TEVC), (2) transfect/inject them with the gene of interest, and (3) record ion transport activities. © Springer Science+Business Media New York 2013.

  5. Characterization of crushed tuff for the evaluation of the fate of tracers in transport studies in the unsaturated zone

    International Nuclear Information System (INIS)

    Polzer, W.L.; Fuentes, H.R.; Raymond, R.; Bish, D.L.; Gladney, E.S.; Lopez, E.A.

    1987-03-01

    Results of field-scale (caisson) transport studies under unsaturated moisture and steady and nonsteady flow conditions indicate variability and a lack of conservation of mass in solute transport. The tuff materials used in that study were analyzed for the presence of tracers and of freshly precipitated material to help explain the variability and lack of conservation of mass. Selected tuff samples were characterized by neutron activation analysis for tracer identification, by x-ray diffraction for mineral identification, by petrographic analysis for identification of freshly precipitated material, and by x-ray fluorescence analysis for identification of major and trace elements. The results of these analyses indicate no obvious presence of freshly precipitated material that would retard tracer movement. The presence of the nonsorbing tracers (bromide and iodide) suggest the retention of these tracers in immobile water. The presence of the nonsorbing tracers (bromide and iodide) suggest the retention of these tracers in immobile water. The presence of sorbing and nonsorbing tracers on the tuff at some locations (even cesium at the 415-cm depth) and not at others suggests variability in transport. 15 refs., 14 figs., 9 tabs

  6. Multixenobiotic resistance in Mytilus edulis: Molecular and functional characterization of an ABCG2- type transporter in hemocytes and gills.

    Science.gov (United States)

    Ben Cheikh, Yosra; Xuereb, Benoit; Boulangé-Lecomte, Céline; Le Foll, Frank

    2018-02-01

    Among the cellular protection arsenal, ABC transporters play an important role in xenobiotic efflux in marine organisms. Two pumps belonging to B and C subfamily has been identified in Mytilus edulis. In this study, we investigated the presence of the third major subtype ABCG2/BCRP protein in mussel tissues. Transcript was expressed in hemocytes and with higher level in gills. Molecular characterization revealed that mussel ABCG2 transporter shares the sequence and organizational structure with mammalian and molluscan orthologs. Overall identity of the predicted amino acid sequence with corresponding homologs from other organisms was between 49% and 98%. Moreover, protein efflux activity was demonstrated using a combination of fluorescent allocrites and specific inhibitors. The accumulation of bodipy prazosin and pheophorbide A was heterogeneous in gills and hemocytes. Most of the used blockers enhanced probe accumulation at different levels, most significantly for bodipy prazosin. Moreover, Mrp classical blocker MK571 showed a polyspecificity. In conclusion, our data demonstrate that several ABC transporters contribute to MXR phenotype in the blue mussel including ABCG2 that forms an active pump in hemocytes and gills. Efforts are needed to distinguish between the different members and to explore their single function and specificity towards allocrites and chemosensitizers. Copyright © 2017 Elsevier B.V. All rights reserved.

  7. Investigation of radial propagation of electrostatic fluctuations in the IR-T1 tokamak plasma edge

    Energy Technology Data Exchange (ETDEWEB)

    Shariatzadeh, R; Ghoranneviss, M; Salem, M K [Plasma Physics Research Center, Science and Research Branch, Islamic Azad University (IAU), PO Box 14665-678, Tehran (Iran, Islamic Republic of); Emami, M, E-mail: rezashariatzadeh@gmail.com [Laser and Optics Research School, NSTRI, AEOI, PO Box 14155-1339, Tehran (Iran, Islamic Republic of)

    2011-01-15

    The radial propagation of electrostatic fluctuation is considered extremely important for understanding cross-field anomalous transport. In this paper, two arrays of Langmuir probes are used to analyze electrostatic fluctuations in the edge of IR-T1 tokamak plasma in both the radial and the poloidal directions. The propagation characteristics of the floating potential fluctuations are analyzed by the two-point correlation technique. The wavenumber spectrum shows that there is a net radially outward propagation of turbulent fluctuations in the edge and scrape-off layer (SOL) regions. Hence, edge turbulence presumably originates from core fluctuations.

  8. Investigation of radial propagation of electrostatic fluctuations in the IR-T1 tokamak plasma edge

    International Nuclear Information System (INIS)

    Shariatzadeh, R; Ghoranneviss, M; Salem, M K; Emami, M

    2011-01-01

    The radial propagation of electrostatic fluctuation is considered extremely important for understanding cross-field anomalous transport. In this paper, two arrays of Langmuir probes are used to analyze electrostatic fluctuations in the edge of IR-T1 tokamak plasma in both the radial and the poloidal directions. The propagation characteristics of the floating potential fluctuations are analyzed by the two-point correlation technique. The wavenumber spectrum shows that there is a net radially outward propagation of turbulent fluctuations in the edge and scrape-off layer (SOL) regions. Hence, edge turbulence presumably originates from core fluctuations.

  9. Development and characterization of a high yield transportable pulsed neutron source with efficient and compact pulsed power system

    Energy Technology Data Exchange (ETDEWEB)

    Verma, Rishi, E-mail: rishiv9@gmail.com, E-mail: rishiv@barc.gov.in; Mishra, Ekansh; Dhang, Prosenjit; Sagar, Karuna; Meena, Manraj; Shyam, Anurag [Energetics and Electromagnetics Division, Bhabha Atomic Research Centre Autonagar, Vishakapatnam 530012 (India)

    2016-09-15

    The results of characterization experiments carried out on a newly developed dense plasma focus device based intense pulsed neutron source with efficient and compact pulsed power system are reported. Its high current sealed pseudospark switch based low inductance capacitor bank with maximum stored energy of ∼10 kJ is segregated into four modules of ∼2.5 kJ each and it cumulatively delivers peak current in the range of 400 kA–600 kA (corresponding to charging voltage range of 14 kV–18 kV) in a quarter time period of ∼2 μs. The neutron yield performance of this device has been optimized by discretely varying deuterium filling gas pressure in the range of 6 mbar–11 mbar at ∼17 kV/550 kA discharge. At ∼7 kJ/8.5 mbar operation, the average neutron yield has been measured to be in the order of ∼4 × 10{sup 9} neutrons/pulse which is the highest ever reported neutron yield from a plasma focus device with the same stored energy. The average forward to radial anisotropy in neutron yield is found to be ∼2. The entire system is contained on a moveable trolley having dimensions 1.5 m × 1 m × 0.7 m and its operation and control (up to the distance of 25 m) are facilitated through optically isolated handheld remote console. The overall compactness of this system provides minimum proximity to small as well as large samples for irradiation. The major intended application objective of this high neutron yield dense plasma focus device development is to explore the feasibility of active neutron interrogation experiments by utilization of intense pulsed neutron sources.

  10. Synthesis, characterization, and monoamine transporter activity of the new psychoactive substance 3',4'-methylenedioxy-4-methylaminorex (MDMAR).

    Science.gov (United States)

    McLaughlin, Gavin; Morris, Noreen; Kavanagh, Pierce V; Power, John D; Twamley, Brendan; O'Brien, John; Talbot, Brian; Dowling, Geraldine; Mahony, Olivia; Brandt, Simon D; Patrick, Julian; Archer, Roland P; Partilla, John S; Baumann, Michael H

    2015-07-01

    The recent occurrence of deaths associated with the psychostimulant cis-4,4'-dimethylaminorex (4,4'-DMAR) in Europe indicated the presence of a newly emerged psychoactive substance on the market. Subsequently, the existence of 3,4-methylenedioxy-4-methylaminorex (MDMAR) has come to the authors' attention and this study describes the synthesis of cis- and trans-MDMAR followed by extensive characterization by chromatographic, spectroscopic, mass spectrometric platforms and crystal structure analysis. MDMAR obtained from an online vendor was subsequently identified as predominantly the cis-isomer (90%). Exposure of the cis-isomer to the mobile phase conditions (acetonitrile/water 1:1 with 0.1% formic acid) employed for high performance liquid chromatography analysis showed an artificially induced conversion to the trans-isomer, which was not observed when characterized by gas chromatography. Monoamine release activities of both MDMAR isomers were compared with the non-selective monoamine releasing agent (+)-3,4-methylenedioxymethamphetamine (MDMA) as a standard reference compound. For additional comparison, both cis- and trans-4,4'-DMAR, were assessed under identical conditions. cis-MDMAR, trans-MDMAR, cis-4,4'-DMAR and trans-4,4'-DMAR were more potent than MDMA in their ability to function as efficacious substrate-type releasers at the dopamine (DAT) and norepinephrine (NET) transporters in rat brain tissue. While cis-4,4'-DMAR, cis-MDMAR and trans-MDMAR were fully efficacious releasing agents at the serotonin transporter (SERT), trans-4,4'-DMAR acted as a fully efficacious uptake blocker. Currently, little information is available about the presence of MDMAR on the market but the high potency of ring-substituted methylaminorex analogues at all three monoamine transporters investigated here might be relevant when assessing the potential for serious side-effects after high dose exposure. Copyright © 2014 John Wiley & Sons, Ltd.

  11. Molecular cloning and functional characterization of an ATP-binding cassette transporter OtrC from Streptomyces rimosus

    Directory of Open Access Journals (Sweden)

    Yu Lan

    2012-08-01

    Full Text Available Abstract Background The otrC gene of Streptomyces rimosus was previously annotated as an oxytetracycline (OTC resistance protein. However, the amino acid sequence analysis of OtrC shows that it is a putative ATP-binding cassette (ABC transporter with multidrug resistance function. To our knowledge, none of the ABC transporters in S. rimosus have yet been characterized. In this study, we aimed to characterize the multidrug exporter function of OtrC and evaluate its relevancy to OTC production. Results In order to investigate OtrC’s function, otrC is cloned and expressed in E. coli The exporter function of OtrC was identified by ATPase activity determination and ethidium bromide efflux assays. Also, the susceptibilities of OtrC-overexpressing cells to several structurally unrelated drugs were compared with those of OtrC-non-expressing cells by minimal inhibitory concentration (MIC assays, indicating that OtrC functions as a drug exporter with a broad range of drug specificities. The OTC production was enhanced by 1.6-fold in M4018 (P = 0.000877 and 1.4-fold in SR16 (P = 0.00973 duplication mutants, while it decreased to 80% in disruption mutants (P = 0.0182 and 0.0124 in M4018 and SR16, respectively. Conclusions The results suggest that OtrC is an ABC transporter with multidrug resistance function, and plays an important role in self-protection by drug efflux mechanisms. This is the first report of such a protein in S. rimosus, and otrC could be a valuable target for genetic manipulation to improve the production of industrial antibiotics.

  12. Characterization of SiaA, a streptococcal heme-binding protein associated with a heme ABC transport system.

    Science.gov (United States)

    Sook, Brian R; Block, Darci R; Sumithran, Suganya; Montañez, Griselle E; Rodgers, Kenton R; Dawson, John H; Eichenbaum, Zehava; Dixon, Dabney W

    2008-02-26

    Many pathogenic bacteria require heme and obtain it from their environment. Heme transverses the cytoplasmic membrane via an ATP binding cassette (ABC) pathway. Although a number of heme ABC transport systems have been described in pathogenic bacteria, there is as yet little biophysical characterization of the proteins in these systems. The sia (hts) gene cluster encodes a heme ABC transporter in the Gram positive Streptococcus pyogenes. The lipoprotein-anchored heme binding protein (HBP) of this transporter is SiaA (HtsA). In the current study, resonance Raman (rR), magnetic circular dichroism (MCD), and nuclear magnetic resonance (NMR) spectroscopies were used to determine the coordination state and spin state of both the ferric and ferrous forms of this protein. Identifiers from these techniques suggest that the heme is six-coordinate and low-spin in both oxidation states of the protein, with methionine and histidine as axial ligands. SiaA has a pKa of 9.7 +/- 0.1, attributed to deprotonation of the axial histidine. Guanidinium titration studies show that the ferric state is less stable than the ferrous state, with DeltaG(H2O) values for the oxidized and reduced proteins of 7.3 +/- 0.8 and 16.0 +/- 3.6 kcal mol-1, respectively. The reductive and oxidative midpoint potentials determined via spectroelectrochemistry are 83 +/- 3 and 64 +/- 3 mV, respectively; the irreversibility of heme reduction suggests that redox cycling of the heme is coupled to a kinetically sluggish change in structure or conformation. The biophysical characterization described herein will significantly advance our understanding of structure-function relationships in HBP.

  13. Quantitative characterization of solute transport processes in the laboratory using electrical resistivity tomography

    NARCIS (Netherlands)

    Korteland, S.

    2013-01-01

    The shallow subsurface is an important zone from a social, economical, and environmental point of view. The increased use of the shallow subsurface together with the call for its protection and sustainable exploitation have increased the need for tools to monitor and characterize the subsurface, as

  14. Biophysical characterization of the proton-coupled oligopeptide transporter YjdL

    DEFF Research Database (Denmark)

    Jensen, Johanne Mørch; Simonsen, Fie C.; Mastali, Amir

    2012-01-01

    significantly different from prototypical POTs such as the human hPepT1. Nonetheless YjdL contains several highly conserved POT residues, which include Glu388 that is located in the putative substrate binding cavity. Here we present biophysical characterization of WT-YjdL and Glu388Gln. Isothermal titration...

  15. Turbulence in tokamak plasmas. Effect of a radial electric field shear; Turbulence dans les plasmas de tokamaks. Effet d`un cisaillement de champ electrique radial

    Energy Technology Data Exchange (ETDEWEB)

    Payan, J

    1994-05-01

    After a review of turbulence and transport phenomena in tokamak plasmas and the radial electric field shear effect in various tokamaks, experimental measurements obtained at Tore Supra by the means of the ALTAIR plasma diagnostic technique, are presented. Electronic drift waves destabilization mechanisms, which are the main features that could describe the experimentally observed microturbulence, are then examined. The effect of a radial electric field shear on electronic drift waves is then introduced, and results with ohmic heating are studied together with relations between turbulence and transport. The possible existence of ionic waves is rejected, and a spectral frequency modelization is presented, based on the existence of an electric field sheared radial profile. The position of the inversion point of this field is calculated for different values of the mean density and the plasma current, and the modelization is applied to the TEXT tokamak. The radial electric field at Tore Supra is then estimated. The effect of the ergodic divertor on turbulence and abnormal transport is then described and the density fluctuation radial profile in presence of the ergodic divertor is modelled. 80 figs., 120 refs.

  16. Characterization of the Hanford 300 Area Burial Grounds. Task III: fluid transport and modeling

    International Nuclear Information System (INIS)

    Gee, G.W.; Simmons, C.S.

    1979-08-01

    In Task III, Fluid Transport and Modeling, a computer model was developed and applied to the 300 Area Burial Grounds to analyze the influence of potential evaporation and rainfall patterns on drainage. The model describes one-dimensional unsaturated flow. Fluid transport equations were evaluated to describe the driving forces of fluid flow. The data indicate that the major processes are evaporative drying, capillarity, and gravity flow. Thermally induced transport does not appear significant in the subsurface sediments of the area. Several empirical evaporation methods are available for assessing potential evaporation/evapotranspiration. Four methods were used with the unsaturated flow model. Ultimately, the Blaney-Criddle method was chosen for subsequent simulation examples because it relies only on the climatic data available and gave results comparable to the other methods tested. Simulations showed that a dry layer formation is important in controlling the soil-water balance in the profile. The surface dry layer acts as a mulch to retard the evaporative water losses and increase water storage. The most important climatic factor in determining drainage appears to be yearly rainfall distribution. When rainfall is distributed in fall or winter, during periods of low potential evaporation, both water storage and drainage are increased. Summer showers, on the other hand, were shown to add little to the annual water storage. Rainfall occurring in one year influences the subsequent annual drainage for several succeeding years because of annual changes in water storage capacity and the transient nature of unsaturated flow in the storage zone. 47 figures, 9 tables

  17. Cloning and characterization of the promoter regions from the parent and paralogous creatine transporter genes.

    Science.gov (United States)

    Ndika, Joseph D T; Lusink, Vera; Beaubrun, Claudine; Kanhai, Warsha; Martinez-Munoz, Cristina; Jakobs, Cornelis; Salomons, Gajja S

    2014-01-10

    Interconversion between phosphocreatine and creatine, catalyzed by creatine kinase is crucial in the supply of ATP to tissues with high energy demand. Creatine's importance has been established by its use as an ergogenic aid in sport, as well as the development of intellectual disability in patients with congenital creatine deficiency. Creatine biosynthesis is complemented by dietary creatine uptake. Intracellular transport of creatine is carried out by a creatine transporter protein (CT1/CRT/CRTR) encoded by the SLC6A8 gene. Most tissues express this gene, with highest levels detected in skeletal muscle and kidney. There are lower levels of the gene detected in colon, brain, heart, testis and prostate. The mechanism(s) by which this regulation occurs is still poorly understood. A duplicated unprocessed pseudogene of SLC6A8-SLC6A10P has been mapped to chromosome 16p11.2 (contains the entire SLC6A8 gene, plus 2293 bp of 5'flanking sequence and its entire 3'UTR). Expression of SLC6A10P has so far only been shown in human testis and brain. It is still unclear as to what is the function of SLC6A10P. In a patient with autism, a chromosomal breakpoint that intersects the 5'flanking region of SLC6A10P was identified; suggesting that SLC6A10P is a non-coding RNA involved in autism. Our aim was to investigate the presence of cis-acting factor(s) that regulate expression of the creatine transporter, as well as to determine if these factors are functionally conserved upstream of the creatine transporter pseudogene. Via gene-specific PCR, cloning and functional luciferase assays we identified a 1104 bp sequence proximal to the mRNA start site of the SLC6A8 gene with promoter activity in five cell types. The corresponding 5'flanking sequence (1050 bp) on the pseudogene also had promoter activity in all 5 cell lines. Surprisingly the pseudogene promoter was stronger than that of its parent gene in 4 of the cell lines tested. To the best of our knowledge, this is the first

  18. Characterization of single crystalline ZnTe and ZnSe grown by vapor phase transport

    Energy Technology Data Exchange (ETDEWEB)

    Trigubo, A B; Di Stefano, M C [FRBA-UTN, (1179) Buenos Aires (Argentina); Aguirre, M H [Dpto de Quim Inorg, Fac de Cs Quim, Univ Complutense, (28040) Madrid (Spain); Martinez, A M; D' Elia, R; Canepa, H; Heredia, E, E-mail: atrigubo@citefa.gov.a [CINSO-CITEFA: (1603) Villa Martelli, Pcia de Buenos Aires (Argentina)

    2009-05-01

    Tubular furnaces were designed and built to obtain single crystalline ZnTe and ZnSe ingots using respectively physical and chemical transport methods. Different temperature profiles and growth rates were analyzed in order to optimize the necessary crystalline quality for device development. Optical and scanning electron micrographs of the corrosion figures produced by chemical etching were used to obtain the dislocation density and the misorientation between adjacent subgrains in ZnTe and ZnSe wafers. Structural quality of the single crystalline material was determined by transmission electronic microscopy. Optical transmittance was measured by infrared transmission spectrometry and the resulting values were compared to commercial samples.

  19. Functional characterization of folic acid transport in the intestine of the laying hen using the everted intestinal sac model.

    Science.gov (United States)

    Tactacan, G B; Rodriguez-Lecompte, J C; Karmin, O; House, J D

    2011-01-01

    Absorption at the level of the intestine is likely a primary regulatory mechanism for the deposition of dietary supplemented folic acid into the chicken egg. Therefore, factors affecting the intestinal transport of folic acid in the laying hen may influence the level of egg folate concentrations. To this end, a series of experiments using intestinal everted sacs were conducted to characterize intestinal folic acid absorption processes in laying hens. Effects of naturally occurring folate derivatives (5-methyl and 10-formyltetrahydrofolate) as well as heme on folic acid absorption were also investigated. Folic acid absorption was measured based on the rate of uptake of (3)H-labeled folic acid in the everted sac from various segments of the small and large intestines. Folic acid concentration, incubation length, and pH condition were optimized before the performance of uptake experiments. The distribution profile of folic acid transport along the intestine was highest in the upper half of the small intestine. Maximum uptake rate (nmol·100 g tissue(-1)·min(-1)) was observed in the duodenum (20.6 ± 1.9) and jejunum (22.3 ± 2.0) and decreased significantly in the ileum (15.3 ± 1.1) and cecum (9.3 ± 0.9). Transport increased proportionately (P methyl and 10-formyltetrahydrofolate as well as heme impeded folic acid uptake, reducing intestinal folic acid absorption when added at concentrations ranging from 0 to 100 µM. Overall, these data indicated the presence of a folic acid transport system in the entire intestine of the laying hen. Uptake of folic acid in the cecum raises the likelihood of absorption of bacterial-derived folate.

  20. Characterization of the Temporal-Spatial Variability of Trans-Atlantic Dust Transport Based on CALIPSO Lidar Measurements

    Science.gov (United States)

    Yu, Hongbin

    2015-01-01

    The trans-Atlantic dust transport has important implications for human and ecosystem health, the terrestrial and oceanic biogeochemical cycle, weather systems, and climate. A reliable assessment of these influences requires the characterization of dust distributions in three dimensions and over long time periods. We provide an observation-based multiyear estimate of trans-Atlantic dust transport by using a 7-year (2007 - 2013) lidar record from the Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) in both cloud-free and above-cloud conditions. We estimate that on a basis of the 7-year average and integration over 10S - 30N, 182 Tg a-1 dust leaves the coast of North Africa at 15W, of which 132 Tg a-1 and 43 Tg a-1 reaches 35W and 75W, respectively. These flux estimates have an overall known uncertainty of (45 - 70). The 7-year average of dust deposition into the Amazon Basin is estimated to be 28 (8 - 48) Tg a-1 or 29 (8 - 50) kg ha-1 a-1. This imported dust could provide about 0.022 (0.006 - 0.037) Tg P of phosphorus per year, equivalent to 23 (7 - 39) g P ha-1 a-1 to fertilize the Amazon rainforest, which is comparable to the loss of phosphorus to rainfall. Significant seasonal variations are observed in both the magnitude of total dust transport and its meridional and vertical distributions. The observed large interannual variability of annual dust transport is highly anti-correlated with the prior-year Sahel Precipitation Index. Comparisons of CALIPSO measurements with surface-based observations and model simulations will also be discussed.

  1. Radial head button holing: a cause of irreducible anterior radial head dislocation

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Su-Mi; Chai, Jee Won; You, Ja Yeon; Park, Jina [Seoul National University Seoul Metropolitan Government Boramae Medical Center, Department of Radiology, Seoul (Korea, Republic of); Bae, Kee Jeong [Seoul National University Seoul Metropolitan Government Boramae Medical Center, Department of Orthopedic Surgery, Seoul (Korea, Republic of)

    2016-10-15

    ''Buttonholing'' of the radial head through the anterior joint capsule is a known cause of irreducible anterior radial head dislocation associated with Monteggia injuries in pediatric patients. To the best of our knowledge, no report has described an injury consisting of buttonholing of the radial head through the annular ligament and a simultaneous radial head fracture in an adolescent. In the present case, the radiographic findings were a radial head fracture with anterior dislocation and lack of the anterior fat pad sign. Magnetic resonance imaging (MRI) clearly demonstrated anterior dislocation of the fractured radial head through the torn annular ligament. The anterior joint capsule and proximal portion of the annular ligament were interposed between the radial head and capitellum, preventing closed reduction of the radial head. Familiarity with this condition and imaging findings will aid clinicians to make a proper diagnosis and fast decision to perform an open reduction. (orig.)

  2. The H2 receptor antagonist nizatidine is a P-glycoprotein substrate: characterization of its intestinal epithelial cell efflux transport.

    Science.gov (United States)

    Dahan, Arik; Sabit, Hairat; Amidon, Gordon L

    2009-06-01

    The aim of this study was to elucidate the intestinal epithelial cell efflux transport processes that are involved in the intestinal transport of the H(2) receptor antagonist nizatidine. The intestinal epithelial efflux transport mechanisms of nizatidine were investigated and characterized across Caco-2 cell monolayers, in the concentration range 0.05-10 mM in both apical-basolateral (AP-BL) and BL-AP directions, and the transport constants of P-glycoprotein (P-gp) efflux activity were calculated. The concentration-dependent effects of various P-gp (verapamil, quinidine, erythromycin, ketoconazole, and cyclosporine A), multidrug resistant-associated protein 2 (MRP2; MK-571, probenecid, indomethacin, and p-aminohipuric acid), and breast cancer resistance protein (BCRP; Fumitremorgin C) inhibitors on nizatidine bidirectional transport were examined. Nizatidine exhibited 7.7-fold higher BL-AP than AP-BL Caco-2 permeability, indicative of net mucosal secretion. All P-gp inhibitors investigated displayed concentration-dependent inhibition on nizatidine secretion in both directions. The IC(50) of verapamil on nizatidine P-gp secretion was 1.2 x 10(-2) mM. In the absence of inhibitors, nizatidine displayed concentration-dependent secretion, with one saturable (J(max) = 5.7 x 10(-3) nmol cm(-2) s(-1) and K(m) = 2.2 mM) and one nonsaturable component (K(d) = 7 x 10(-4) microL cm(-2) s(-1)). Under complete P-gp inhibition, nizatidine exhibited linear secretory flux, with a slope similar to the nonsaturable component. V(max) and K(m) estimated for nizatidine P-gp-mediated secretion were 4 x 10(-3) nmol cm(-2) s(-1) and 1.2 mM, respectively. No effect was obtained with the MRP2 or the BCRP inhibitors. Being a drug commonly used in pediatrics, adults, and elderly, nizatidine susceptibility to efflux transport by P-gp revealed in this paper may be of significance in its absorption, distribution, and clearance, as well as possible drug-drug interactions.

  3. Experimental study of the plasma structure and characterization of the transport behaviour in the laminar zone of a stochastized plasma edge; Experimentelle Untersuchung der Plasmastruktur und Charakterisierung des Transportverhaltens in der laminaren Zone einer stochastisierten Plasmarandschicht

    Energy Technology Data Exchange (ETDEWEB)

    Schmitz, O.

    2006-07-15

    For a detailed study of the plasma structure and the transport characteristics of a stochastized plasma edge at the tokamak TEXTOR the dynamic ergodic divertor (DED) was constructed, by which differently shaped external disturbing fields are statically and dynamically generated. Aim of this thgesis is to study experimentally the radial and poloidal structure of the plasma edge stochastized by the DED disturbing field and to analyze its transport characteristics. For this spatially highly resolved radial profiles of the electron density and temperature were measured by means of radiation-emission spectroscopy on thermal helium at the high- and low-field side of TEXTOR. These experimental results yield a good stating base for the validation and further development of three-dimensional transport codes.

  4. Evaluate and characterize mechanisms controlling transport, fate, and effects of army smokes in the aerosol wind tunnel: Transport, transformations, fate, and terrestrial ecological effects of hexachloroethane obscurant smokes

    Energy Technology Data Exchange (ETDEWEB)

    Cataldo, D.A.; Ligotke, M.W.; Bolton, H. Jr.; Fellows, R.J.; Van Voris, P.; McVeety, B.D.; Li, Shu-mei W.; McFadden, K.M.

    1989-09-01

    The terrestrial transport, chemical fate, and ecological effects of hexachloroethane (HC) smoke were evaluated under controlled wind tunnel conditions. The primary objectives of this research program are to characterize and assess the impacts of smoke and obscurants on: (1) natural vegetation characteristic of US Army training sites in the United States; (2) physical and chemical properties of soils representative of these training sites; and (3) soil microbiological and invertebrate communities. Impacts and dose/responses were evaluated based on exposure scenarios, including exposure duration, exposure rate, and sequential cumulative dosing. Key to understanding the environmental impacts of HC smoke/obscurants is establishing the importance of environmental parameters such as relative humidity and wind speed on airborne aerosol characteristics and deposition to receptor surfaces. Direct and indirect biotic effects were evaluated using five plant species and two soil types. HC aerosols were generated in a controlled atmosphere wind tunnel by combustion of hexachloroethane mixtures prepared to simulate normal pot burn rates and conditions. The aerosol was characterized and used to expose plant, soil, and other test systems. Particle sizes of airborne HC ranged from 1.3 to 2.1 {mu}m mass median aerodynamic diameter (MMAD), and particle size was affected by relative humidity over a range of 20% to 85%. Air concentrations employed ranged from 130 to 680 mg/m{sup 3}, depending on exposure scenario. Chlorocarbon concentrations within smokes, deposition rates for plant and soil surfaces, and persistence were determined. The fate of principal inorganic species (Zn, Al, and Cl) in a range of soils was assessed.

  5. Acoustic characterization of a CANDU primary heat transport pump at the blade-passing frequency

    International Nuclear Information System (INIS)

    Rzentkowski, G.; Zbroja, S.

    2000-01-01

    In this paper, we examine the acoustics of a single-stage, double-volute CANDU heat transport pump based on a full-scale experimental investigation. We estimate the strength of source variables (acoustic pressure and velocity) and establish the pump characteristics as an acoustic source at the blade-passing frequency. We conduct this analysis by first assessing the resonance effects in the test loop, and then decomposing the measured signal into the components associated with pump action and loop acoustics with the use of a simple pump model. The pump model is based on a linear superposition of pressure wave transmission and excitation. The results of this analysis indicate that the pump source variables are nearly free of acoustic resonance effects in the test loop. The source pressure and velocity are each estimated at approximately 10 kPa (zero-to-peak). The results also indicate that the pump may act as both a pressure and a velocity source. At the loop resonance, the pump acoustic behavior is exclusively governed by the pressure term. This observation leads to the conclusion that the maximum amplification of pressure pulsations in a reactor heat transport system may be predicted by modeling the pump as a pressure source. (orig.)

  6. Characterization of transport of calcium by microsomal membranes from roots maize

    International Nuclear Information System (INIS)

    Vaughan, M.A.

    1985-01-01

    This study investigates calcium transport by membranes of roots of maize isolated by differential centrifugation. The preparation was determined to be enriched in plasma membrane using market enzyme and electron microscopy. Using the 45 Ca filtration technique and liquid scintillation counting, vesicular calcium uptake was shown to be stimulated by added calmodulin and specific for and dependent on ATP. Conditions for maximal calcium accumulation were found to be 30 min incubation in the presence of 5 mM ATP, 5 mM MgCl 2 , 50 μM CaCl 2 , at 23 0 C, and at pH 6.5. Calcium uptake was inhibited by the ionophores A23187, X-537A, and ionomycin. Sodium fluoride, ruthenium red, and p-chloromercuribenzoate completely inhibited transport: diamide and vanadate produced slight inhibition; caffeine, caffeic acid, oligomycin, and ouabain produced little or no inhibition. Chlorpromazine, W7, trifluoperazine, and R 24 571 inhibit calcium uptake irrespective of added calmodulin, while W5 showed little effect on uptake. Verapamil, nifedipine, cinnarizine, flunarizine, lidoflazine, and diltiazem decreased calcium uptake by 17%-50%. Electron microscopic localization of calcium by pyroantimonate showed vesicles incubated with calmodulin and ATP showed the greatest amount of precipitate. These results suggest that these vesicles accumulate calcium in an ATP-dependent, calmodulin-stimulated manner

  7. Functional and evolution characterization of SWEET sugar transporters in Ananas comosus.

    Science.gov (United States)

    Guo, Chengying; Li, Huayang; Xia, Xinyao; Liu, Xiuyuan; Yang, Long

    2018-02-05

    Sugars will eventually be exported transporters (SWEETs) are a group of recently identified sugar transporters in plants that play important roles in diverse physiological processes. However, currently, limited information about this gene family is available in pineapple (Ananas comosus). The availability of the recently released pineapple genome sequence provides the opportunity to identify SWEET genes in a Bromeliaceae family member at the genome level. In this study, 39 pineapple SWEET genes were identified in two pineapple cultivars (18 AnfSWEET and 21 AnmSWEET) and further phylogenetically classified into five clades. A phylogenetic analysis revealed distinct evolutionary paths for the SWEET genes of the two pineapple cultivars. The MD2 cultivar might have experienced a different expansion than the F153 cultivar because two additional duplications exist, which separately gave rise to clades III and IV. A gene exon/intron structure analysis showed that the pineapple SWEET genes contained highly conserved exon/intron numbers. An analysis of public RNA-seq data and expression profiling showed that SWEET genes may be involved in fruit development and ripening processes. AnmSWEET5 and AnmSWEET11 were highly expressed in the early stages of pineapple fruit development and then decreased. The study increases the understanding of the roles of SWEET genes in pineapple. Copyright © 2018 Elsevier Inc. All rights reserved.

  8. Characterization of an allosteric citalopram-binding site at the serotonin transporter

    DEFF Research Database (Denmark)

    Chen, Fenghua; Breum Larsen, Mads; Neubauer, Henrik Amtoft

    2005-01-01

    The serotonin transporter (SERT), which belongs to a family of       sodium/chloride-dependent transporters, is the major pharmacological       target in the treatment of several clinical disorders, including       depression and anxiety. In the present study we show that the dissociation......       rate, of [3H]S-citalopram from human SERT, is retarded by the presence of       serotonin, as well as by several antidepressants, when present in the       dissociation buffer. Dissociation of [3H]S-citalopram from SERT is most       potently inhibited by S-citalopram followed by R......-citalopram, sertraline,       serotonin and paroxetine. EC50 values for S- and R-citalopram are 3.6 +/-       0.4 microm and 19.4 +/- 2.3 microm, respectively. Fluoxetine, venlafaxine       and duloxetine have no significant effect on the dissociation of       [3H]S-citalopram. Allosteric modulation of dissociation...

  9. Characterization of thermal, optical and carrier transport properties of porous silicon using the photoacoustic technique

    International Nuclear Information System (INIS)

    Sheng, Chan Kok; Mahmood Mat Yunus, W.; Yunus, Wan Md. Zin Wan; Abidin Talib, Zainal; Kassim, Anuar

    2008-01-01

    In this work, the porous silicon layer was prepared by the electrochemical anodization etching process on n-type and p-type silicon wafers. The formation of the porous layer has been identified by photoluminescence and SEM measurements. The optical absorption, energy gap, carrier transport and thermal properties of n-type and p-type porous silicon layers were investigated by analyzing the experimental data from photoacoustic measurements. The values of thermal diffusivity, energy gap and carrier transport properties have been found to be porosity-dependent. The energy band gap of n-type and p-type porous silicon layers was higher than the energy band gap obtained for silicon substrate (1.11 eV). In the range of porosity (50-76%) of the studies, our results found that the optical band-gap energy of p-type porous silicon (1.80-2.00 eV) was higher than that of the n-type porous silicon layer (1.70-1.86 eV). The thermal diffusivity value of the n-type porous layer was found to be higher than that of the p-type and both were observed to increase linearly with increasing layer porosity

  10. Chemical and toxicological characterization of exhaust emissions from alternative fuels for urban public transport

    International Nuclear Information System (INIS)

    Turrio Baldassarri, L.; Conti, R.; Crebelli, B.; Iamicelli, A.L.; De Berardis, M.; Gambino, A.L.; Iannaccone, S.

    2008-01-01

    The Istituto Superiore di Sanita (ISS, the National Institute of Health of Italy) and the Istituto dei Motori (IM) of the Consiglio Nazionale delle Ricerche (CNR, National Research Council) have carried out this study, jointly funded by the two institutes together with the Ministry of Environment. The chemical and toxicological characteristics of emissions from two urban bus engines were studied: a diesel engine fueled with both diesel oil and bio diesel blend and an equivalent spark-ignition one fuelled with compressed natural gas, operating in steady-state conditions. Regulated and unregulated pollutants, such as carcinogenic polycyclic aromatic hydrocarbons and nitrated derivatives, carbonyl compounds and light aromatic hydrocarbons were quantified. Mutagenicity of the emissions was evaluated by the Salmonella typhimurium/mammalian microsome assay. The effect of the fuels under study on the size distribution of particulate matter was also evaluated. The impact of diesel-powered transport on urban air quality, and the potential benefits for human health deriving from the use of natural gas for public transport, are discussed [it

  11. Radial optimization of a BWR fuel cell using genetic algorithms

    International Nuclear Information System (INIS)

    Martin del Campo M, C.; Carmona H, R.; Oropeza C, I.P.

    2006-01-01

    The development of the application of the Genetic Algorithms (GA) to the optimization of the radial distribution of enrichment in a cell of fuel of a BWR (Boiling Water Reactor) is presented. The optimization process it was ties to the HELIOS simulator, which is a transport code of neutron simulation of fuel cells that has been validated for the calculation of nuclear banks for BWRs. With heterogeneous radial designs can improve the radial distribution of the power, for what the radial design of fuel has a strong influence in the global design of fuel recharges. The optimum radial distribution of fuel bars is looked for with different enrichments of U 235 and contents of consumable poison. For it is necessary to define the representation of the solution, the objective function and the implementation of the specific optimization process to the solution of the problem. The optimization process it was coded in 'C' language, it was automated the creation of the entrances to the simulator, the execution of the simulator and the extraction, in the exit of the simulator, of the parameters that intervene in the objective function. The objective function includes four parameters: average enrichment of the cell, average gadolinia concentration of the cell, peak factor of radial power and k-infinite multiplication factor. To be able to calculate the parameters that intervene in the objective function, the one evaluation process of GA was ties to the HELIOS code executed in a Compaq Alpha workstation. It was applied to the design of a fuel cell of 10 x 10 that it can be employee in the fuel assemble designs that are used at the moment in the Laguna Verde Nucleo electric Central. Its were considered 10 different fuel compositions which four contain gadolinia. Three heuristic rules that consist in prohibiting the placement of bars with gadolinia in the ends of the cell, to place the compositions with the smallest enrichment in the corners of the cell and to fix the placement of

  12. Photoelectric Radial Velocities, Paper XIX Additional Spectroscopic ...

    Indian Academy of Sciences (India)

    ian velocity curve that does justice to the measurements, but it cannot be expected to have much predictive power. Key words. Stars: late-type—stars: radial velocities—spectroscopic binaries—orbits. 0. Preamble. The 'Redman K stars' are a lot of seventh-magnitude K stars whose radial velocities were first observed by ...

  13. Radial velocities of RR Lyrae stars

    International Nuclear Information System (INIS)

    Hawley, S.L.; Barnes, T.G. III

    1985-01-01

    283 spectra of 57 RR Lyrae stars have been obtained using the 2.1-m telescope at McDonald Observatory. Radial velocities were determined using a software cross-correlation technique. New mean radial velocities were determined for 46 of the stars. 11 references

  14. Concepts of radial and angular kinetic energies

    DEFF Research Database (Denmark)

    Dahl, Jens Peder; Schleich, W.P.

    2002-01-01

    We consider a general central-field system in D dimensions and show that the division of the kinetic energy into radial and angular parts proceeds differently in the wave-function picture and the Weyl-Wigner phase-space picture, Thus, the radial and angular kinetic energies are different quantities...

  15. Characterization of Gas Transport Properties of Fractured Rocks By Borehole and Chamber Tests.

    Science.gov (United States)

    Shimo, M.; Shimaya, S.; Maejima, T.

    2014-12-01

    Gas transport characteristics of fractured rocks is a great concern to variety of engineering applications such as underground storage of LPG, nuclear waste disposal, CCS and gas flooding in the oil field. Besides absolute permeability, relative permeability and capillary pressure as a function of water saturation have direct influences to the results of two phase flow simulation. However, number of the reported gas flow tests for fractured rocks are limited, therefore, the applicability of the conventional two-phase flow functions used for porous media, such as Mualem-van Genuchten model, to prediction of the gas transport in the fractured rock mass are not well understood. The authors conducted the two types of in-situ tests, with different scales, a borehole gas-injection test and a chamber gas-injection test in fractured granitic rock. These tests were conducted in the Cretaceous granitic rocks at the Namikata underground LPG storage cavern construction site in Ehime Prefecture in Japan, preceding to the cavern scale gas-tightness test. A borehole injection test was conducted using vertical and sub-vertical boreholes drilled from the water injection tunnel nearly at the depth of the top of the cavern, EL-150m. A new type downhole gas injection equipment that is capable to create a small 'cavern' within a borehole was developed. After performing a series of preliminary tests to investigate the hydraulic conductivity and gas-tightness, i.e. threshold pressure, gas injection tests were conducted under different gas pressure. Fig.1 shows an example of the test results From a chamber test using a air pressurizing chamber with volume of approximately166m3, the gas-tightness was confirmed within the uncertainty of 22Pa under the storage pressure of 0.7MPa, however, significant air leakage occurred possibly through an open fracture intersecting the chamber just after cavern pressure exceeds the initial hydrostatic pressure at the ceiling level of the chamber. Anomalies

  16. Characterization of Uranium Contamination, Transport, and Remediation at Rocky Flats - Across Remediation into Post-Closure

    Science.gov (United States)

    Janecky, D. R.; Boylan, J.; Murrell, M. T.

    2009-12-01

    The Rocky Flats Site is a former nuclear weapons production facility approximately 16 miles northwest of Denver, Colorado. Built in 1952 and operated by the Atomic Energy Commission and then Department of Energy, the Site was remediated and closed in 2005, and is currently undergoing long-term surveillance and monitoring by the DOE Office of Legacy Management. Areas of contamination resulted from roughly fifty years of operation. Of greatest interest, surface soils were contaminated with plutonium, americium, and uranium; groundwater was contaminated with chlorinated solvents, uranium, and nitrates; and surface waters, as recipients of runoff and shallow groundwater discharge, have been contaminated by transport from both regimes. A region of economic mineralization that has been referred to as the Colorado Mineral Belt is nearby, and the Schwartzwalder uranium mine is approximately five miles upgradient of the Site. Background uranium concentrations are therefore elevated in many areas. Weapons-related activities included work with enriched and depleted uranium, contributing anthropogenic content to the environment. Using high-resolution isotopic analyses, Site-related contamination can be distinguished from natural uranium in water samples. This has been instrumental in defining remedy components, and long-term monitoring and surveillance strategies. Rocky Flats hydrology interlinks surface waters and shallow groundwater (which is very limited in volume and vertical and horizontal extent). Surface water transport pathways include several streams, constructed ponds, and facility surfaces. Shallow groundwater has no demonstrated connection to deep aquifers, and includes natural preferential pathways resulting primarily from porosity in the Rocky Flats alluvium, weathered bedrock, and discontinuous sandstones. In addition, building footings, drains, trenches, and remedial systems provide pathways for transport at the site. Removal of impermeable surfaces (buildings

  17. Characterization of acquired paclitaxel resistance of breast cancer cells and involvement of ABC transporters

    International Nuclear Information System (INIS)

    Němcová-Fürstová, Vlasta; Kopperová, Dana; Balušíková, Kamila; Ehrlichová, Marie; Brynychová, Veronika; Václavíková, Radka; Daniel, Petr; Souček, Pavel; Kovář, Jan

    2016-01-01

    Development of taxane resistance has become clinically very important issue. The molecular mechanisms underlying the resistance are still unclear. To address this issue, we established paclitaxel-resistant sublines of the SK-BR-3 and MCF-7 breast cancer cell lines that are capable of long-term proliferation in 100 nM and 300 nM paclitaxel, respectively. Application of these concentrations leads to cell death in the original counterpart cells. Both sublines are cross-resistant to doxorubicin, indicating the presence of the MDR phenotype. Interestingly, resistance in both paclitaxel-resistant sublines is circumvented by the second-generation taxane SB-T-1216. Moreover, we demonstrated that it was not possible to establish sublines of SK-BR-3 and MCF-7 cells resistant to this taxane. It means that at least the tested breast cancer cells are unable to develop resistance to some taxanes. Employing mRNA expression profiling of all known human ABC transporters and subsequent Western blot analysis of the expression of selected transporters, we demonstrated that only the ABCB1/PgP and ABCC3/MRP3 proteins were up-regulated in both paclitaxel-resistant sublines. We found up-regulation of ABCG2/BCRP and ABCC4 proteins only in paclitaxel-resistant SK-BR-3 cells. In paclitaxel-resistant MCF-7 cells, ABCB4/MDR3 and ABCC2/MRP2 proteins were up-regulated. Silencing of ABCB1 expression using specific siRNA increased significantly, but did not completely restore full sensitivity to both paclitaxel and doxorubicin. Thus we showed a key, but not exclusive, role for ABCB1 in mechanisms of paclitaxel resistance. It suggests the involvement of multiple mechanisms in paclitaxel resistance in tested breast cancer cells. - Highlights: • Expression of all ABC transporters in paclitaxel-resistant sublines of SK-BR-3 and MCF-7 cells was analyzed. • SK-BR-3 and MCF-7 cells are unable to develop resistance to some taxanes. • Some taxanes are able to overcome developed resistance to

  18. Characterization of acquired paclitaxel resistance of breast cancer cells and involvement of ABC transporters

    Energy Technology Data Exchange (ETDEWEB)

    Němcová-Fürstová, Vlasta, E-mail: vlasta.furstova@lf3.cuni.cz [Division of Cell and Molecular Biology, Third Faculty of Medicine, Charles University, Prague (Czech Republic); Kopperová, Dana; Balušíková, Kamila [Division of Cell and Molecular Biology, Third Faculty of Medicine, Charles University, Prague (Czech Republic); Ehrlichová, Marie; Brynychová, Veronika; Václavíková, Radka [Toxicogenomics Unit, National Institute of Public Health, Prague (Czech Republic); Daniel, Petr [Division of Cell and Molecular Biology, Third Faculty of Medicine, Charles University, Prague (Czech Republic); Souček, Pavel [Toxicogenomics Unit, National Institute of Public Health, Prague (Czech Republic); Kovář, Jan [Division of Cell and Molecular Biology, Third Faculty of Medicine, Charles University, Prague (Czech Republic)

    2016-11-01

    Development of taxane resistance has become clinically very important issue. The molecular mechanisms underlying the resistance are still unclear. To address this issue, we established paclitaxel-resistant sublines of the SK-BR-3 and MCF-7 breast cancer cell lines that are capable of long-term proliferation in 100 nM and 300 nM paclitaxel, respectively. Application of these concentrations leads to cell death in the original counterpart cells. Both sublines are cross-resistant to doxorubicin, indicating the presence of the MDR phenotype. Interestingly, resistance in both paclitaxel-resistant sublines is circumvented by the second-generation taxane SB-T-1216. Moreover, we demonstrated that it was not possible to establish sublines of SK-BR-3 and MCF-7 cells resistant to this taxane. It means that at least the tested breast cancer cells are unable to develop resistance to some taxanes. Employing mRNA expression profiling of all known human ABC transporters and subsequent Western blot analysis of the expression of selected transporters, we demonstrated that only the ABCB1/PgP and ABCC3/MRP3 proteins were up-regulated in both paclitaxel-resistant sublines. We found up-regulation of ABCG2/BCRP and ABCC4 proteins only in paclitaxel-resistant SK-BR-3 cells. In paclitaxel-resistant MCF-7 cells, ABCB4/MDR3 and ABCC2/MRP2 proteins were up-regulated. Silencing of ABCB1 expression using specific siRNA increased significantly, but did not completely restore full sensitivity to both paclitaxel and doxorubicin. Thus we showed a key, but not exclusive, role for ABCB1 in mechanisms of paclitaxel resistance. It suggests the involvement of multiple mechanisms in paclitaxel resistance in tested breast cancer cells. - Highlights: • Expression of all ABC transporters in paclitaxel-resistant sublines of SK-BR-3 and MCF-7 cells was analyzed. • SK-BR-3 and MCF-7 cells are unable to develop resistance to some taxanes. • Some taxanes are able to overcome developed resistance to

  19. Analysis of pedestal plasma transport

    International Nuclear Information System (INIS)

    Callen, J.D.; Groebner, R.J.; Osborne, T.H.; Canik, J.M.; Owen, L.W.; Pankin, A.Y.; Rafiq, T.; Rognlien, T.D.; Stacey, W.M.

    2010-01-01

    An H-mode edge pedestal plasma transport benchmarking exercise was undertaken for a single DIII-D pedestal. Transport modelling codes used include 1.5D interpretive (ONETWO, GTEDGE), 1.5D predictive (ASTRA) and 2D ones (SOLPS, UEDGE). The particular DIII-D discharge considered is 98889, which has a typical low density pedestal. Profiles for the edge plasma are obtained from Thomson and charge-exchange recombination data averaged over the last 20% of the average 33.53 ms repetition time between type I edge localized modes. The modelled density of recycled neutrals is largest in the divertor X-point region and causes the edge plasma source rate to vary by a factor ∼10 2 on the separatrix. Modelled poloidal variations in the densities and temperatures on flux surfaces are small on all flux surfaces up to within about 2.6 mm (ρ N > 0.99) of the mid-plane separatrix. For the assumed Fick's-diffusion-type laws, the radial heat and density fluxes vary poloidally by factors of 2-3 in the pedestal region; they are largest on the outboard mid-plane where flux surfaces are compressed and local radial gradients are largest. Convective heat flows are found to be small fractions of the electron (∼ 2 s -1 . Electron heat transport is found to be best characterized by electron-temperature-gradient-induced transport at the pedestal top and paleoclassical transport throughout the pedestal. The effective ion heat diffusivity in the pedestal has a different profile from the neoclassical prediction and may be smaller than it. The very small effective density diffusivity may be the result of an inward pinch flow nearly balancing a diffusive outward radial density flux. The inward ion pinch velocity and density diffusion coefficient are determined by a new interpretive analysis technique that uses information from the force balance (momentum conservation) equations; the paleoclassical transport model provides a plausible explanation of these new results. Finally, the measurements

  20. Characterization of intermittency of impurity turbulent transport in tokamak edge plasmas

    International Nuclear Information System (INIS)

    Futatani, S.; Benkadda, S.; Nakamura, Y.; Kondo, K.

    2008-01-01

    The statistical properties of impurity transport of a tokamak edge plasma embedded in a dissipative drift-wave turbulence are investigated using structure function analysis. The impurities are considered as a passive scalar advected by the plasma flow. Two cases of impurity advection are studied and compared: A decaying impurities case (given by a diffusion-advection equation) and a driven case (forced by a mean scalar gradient). The use of extended self-similarity enables us to show that the relative scaling exponent of structure functions of impurity density and vorticity exhibit similar multifractal scaling in the decaying case and follows the She-Leveque model. However, this property is invalidated for the impurity driven advection case. For both cases, potential fluctuations are self-similar and exhibit a monofractal scaling in agreement with Kolmogorov-Kraichnan theory for two-dimensional turbulence. These results obtained with a passive scalar model agree also with test-particle simulations.

  1. Simulation of tracer transport for the site characterization and validation site in the Stripa Mine

    International Nuclear Information System (INIS)

    Long, J.C.S.; Karasaki, K.

    1992-01-01

    This report describes a series of numerical simulations of tracer tests that were performed in a fracture zone (the H-zone) at the Stripa Mine in Sweden. The tracer simulations are bases on Equivalent Discontinuum models which were developed bases on geophysical measurements and hydraulic interference data (Long et al., 1992). The transport simulations are calibrated to one set of saline tracer breakthrough curves (from the first radar/saline experiment, RSI) and these calibrated models are used to predict another series of breakthrough curves. Predicted breakthrough curves can be compared to the actual data and simulated ''snapshots'' of concentration in the plan of the fracture zone can be compared to radar difference tomograms made during the saline tracer experiments

  2. Characterization of road freight transportation and its impact on the national emission inventory in China

    Science.gov (United States)

    Yang, X. F.; Liu, H.; Man, H. Y.; He, K. B.

    2014-06-01

    Mobile source emission inventories serve as critical input for atmospheric chemical transport models, which are used to simulate air quality and understand the role of mobile source emissions. The significance of mobile sources is even more important in China because the country has the largest vehicle population in the world, and that population continues to grow rapidly. Estimating emissions from diesel trucks is a critical work in mobile source emission inventories due to the importance and difficulties associated with estimating emissions from diesel trucks. Although diesel trucks are major contributors of nitrogen oxide (NOx) and primary particulate matter smaller than 2.5 μm (PM2.5), there are still more obstacles on the existing estimation of diesel truck emissions compared with that of cars; long-range freight transportation activities are complicated, and much of the basic data remain unclear. Most of existing inventories were based on local registration number. However, according to our research, a large number of trucks are conducting long-distance inter-city or inter province transportation. Instead of the local registration number based approach, a road emission intensity-based (REIB) approach is introduced in this research. To provide efficient data for the REIB approach, 1060 questionnaire responses and approximately 1.7 million valid seconds of onboard GPS monitoring data were collected. Both the questionnaire answers and GPS monitoring results indicated that the driving conditions on different types of road have significant impacts on the emission levels of freight trucks. We present estimated emissions of NOx and primary PM2.5 from diesel freight trucks for China in 2011. Using the REIB approach, the activity level and distribution data are obtained from the questionnaire answers. Emission factors are calculated with the International Vehicle Emission (IVE) model that interpolated local on-board measurement results in China according to the GPS

  3. Experimental characterization of X-ray transverse coherence in the presence of beam transport optics

    DEFF Research Database (Denmark)

    Chubar, O.; Fluerasu, A.; Chu, Y.S.

    2013-01-01

    A simple Boron fiber based interference scheme [1] and other similar schemes are currently routinely used for X-ray coherence estimation at 3rd generation synchrotron radiation sources. If such a scheme is applied after a perfect monochromator and without any focusing / transport optics...... in the optical path, the interpretation of the measured interference pattern is relatively straightforward and can be done in terms of the basic parameters of the source [2]. However, if the interference scheme is used after some focusing optics, e.g. close to the X-ray beam waist, the visibility of fringes can...... be significantly affected by the new shape of the focused beam phase-space. At the same time, optical element imperfections still have a negative impact on the transverse coherence. In such situations, which are frequently encountered in experiments at beamlines, the quantitative interpretation of a measured...

  4. Characterization of cesium uptake mediated by a potassium transport system of bacteria in a soil conditioner

    International Nuclear Information System (INIS)

    Zhang, Pengyao; Idota, Yoko; Yano, Kentaro; Negishi, Masayuki; Kawabata, Hideaki; Arakawa, Hiroshi; Ogihara, Takuo; Morimoto, Kaori; Tsuji, Akira

    2014-01-01

    We found that bacteria in a commercial soil conditioner sold in Ishinomaki, Miyagi, exhibited concentrative and saturable cesium ion (Cs + ) uptake in the natural range of pH and temperature. The concentration of intracellular Cs + could be condensed at least a few times higher compared with the outside medium of the cells. This uptake appeared to be mediated by a K + transport system, since Cs + uptake was dose-dependently inhibited by potassium ion (K + ). Eadie-Hofstee plot analysis indicated that the Cs + uptake involved a single saturable process. The maximum uptake amount (J max ) was the same in the presence and absence of K + , suggesting that Cs + and K + uptakes were competitive with respect to each other. These bacteria might be useful for bioremediation of cesium-contaminated soil. (author)

  5. Multi-path transportation futures study : vehicle characterization and scenario analyses.

    Energy Technology Data Exchange (ETDEWEB)

    Plotkin, S. E.; Singh, M. K.; Energy Systems; TA Engineering; ORNL

    2009-12-03

    Projecting the future role of advanced drivetrains and fuels in the light vehicle market is inherently difficult, given the uncertainty (and likely volatility) of future oil prices, inadequate understanding of likely consumer response to new technologies, the relative infancy of several important new technologies with inevitable future changes in their performance and costs, and the importance - and uncertainty - of future government marketplace interventions (e.g., new regulatory standards or vehicle purchase incentives). This Multi-Path Transportation Futures (MP) Study has attempted to improve our understanding of this future role by examining several scenarios of vehicle costs, fuel prices, government subsidies, and other key factors. These are projections, not forecasts, in that they try to answer a series of 'what if' questions without assigning probabilities to most of the basic assumptions.

  6. Expression, purification, and functional characterization of the insulin-responsive facilitative glucose transporter GLUT4.

    Science.gov (United States)

    Kraft, Thomas E; Hresko, Richard C; Hruz, Paul W

    2015-12-01

    The insulin-responsive facilitative glucose transporter GLUT4 is of fundamental importance for maintenance of glucose homeostasis. Despite intensive effort, the ability to express and purify sufficient quantities of structurally and functionally intact protein for biophysical analysis has previously been exceedingly difficult. We report here the development of novel methods to express, purify, and functionally reconstitute GLUT4 into detergent micelles and proteoliposomes. Rat GLUT4 containing FLAG and His tags at the amino and carboxy termini, respectively, was engineered and stably transfected into HEK-293 cells. Overexpression in suspension culture yielded over 1.5 mg of protein per liter of culture. Systematic screening of detergent solubilized GLUT4-GFP fusion protein via fluorescent-detection size exclusion chromatography identified lauryl maltose neopentyl glycol (LMNG) as highly effective for isolating monomeric GLUT4 micelles. Preservation of structural integrity and ligand binding was demonstrated via quenching of tryptophan fluorescence and competition of ATB-BMPA photolabeling by cytochalasin B. GLUT4 was reconstituted into lipid nanodiscs and proper folding was confirmed. Reconstitution of purified GLUT4 with amphipol A8-35 stabilized the transporter at elevated temperatures for extended periods of time. Functional activity of purified GLUT4 was confirmed by reconstitution of LMNG-purified GLUT4 into proteoliposomes and measurement of saturable uptake of D-glucose over L-glucose. Taken together, these data validate the development of an efficient means to generate milligram quantities of stable and functionally intact GLUT4 that is suitable for a wide array of biochemical and biophysical analyses. © 2015 The Protein Society.

  7. THE OCCURRENCE OF THE RADIAL CLUB HAND IN CHILDREN WITH DIFFERENT SYNDROMES

    Directory of Open Access Journals (Sweden)

    Sergey Ivanovich Golyana

    2013-03-01

    Full Text Available Radial club hand is a developmental anomaly of the upper extremity, being characterized as a longitudinal underdevelopment of a forearm and a hand on the radial surface, consisting in a hypo-/ aplazy radial bone and the thumb of various degree of expressiveness. Characteristic symptoms of this developmental anomaly are: shortening and bow-shaped curvature of a forearm, palmar and radial deviation of a hand, underdevelopment of the thumb from its proximal departments and structures, anomaly of development of three-phalanx fingers of a hand (is more often than the 2-4th, violation of a cosmetic condition and functionality of the affected segment. From 2000 for 2012 in FSI SRICO n.a. H.Turner examination and treatment of 23 children with various syndromes at which the radial club hand was revealed are conducted. The main syndromes at which it is revealed radial club hand - Holt-Orama syndrome, TAR- syndrome and VACTERL syndrome. Tactics and techniques of surgical treatment of a radial club hand it various syndromes most often don’t differ from treatment of other types of a radial club hand though demand an individual approach depending on severity and a type of deformation of the upper extremity.

  8. Fracture Characterization in Reactive Fluid-Fractured Rock Systems Using Tracer Transport Data

    Science.gov (United States)

    Mukhopadhyay, S.

    2014-12-01

    Fractures, whether natural or engineered, exert significant controls over resource exploitation from contemporary energy sources including enhanced geothermal systems and unconventional oil and gas reserves. Consequently, fracture characterization, i.e., estimating the permeability, connectivity, and spacing of the fractures is of critical importance for determining the viability of any energy recovery program. While some progress has recently been made towards estimating these critical fracture parameters, significant uncertainties still remain. A review of tracer technology, which has a long history in fracture characterization, reveals that uncertainties exist in the estimated parameters not only because of paucity of scale-specific data but also because of knowledge gaps in the interpretation methods, particularly in interpretation of tracer data in reactive fluid-rock systems. We have recently demonstrated that the transient tracer evolution signatures in reactive fluid-rock systems are significantly different from those in non-reactive systems (Mukhopadhyay et al., 2013, 2014). For example, the tracer breakthrough curves in reactive fluid-fractured rock systems are expected to exhibit a long pseudo-state condition, during which tracer concentration does not change by any appreciable amount with passage of time. Such a pseudo-steady state condition is not observed in a non-reactive system. In this paper, we show that the presence of this pseudo-steady state condition in tracer breakthrough patterns in reactive fluid-rock systems can have important connotations for fracture characterization. We show that the time of onset of the pseudo-steady state condition and the value of tracer concentration in the pseudo-state condition can be used to reliably estimate fracture spacing and fracture-matrix interface areas.

  9. Internal transport barrier in tokamak and helical plasmas

    Science.gov (United States)

    Ida, K.; Fujita, T.

    2018-03-01

    The differences and similarities between the internal transport barriers (ITBs) of tokamak and helical plasmas are reviewed. By comparing the characteristics of the ITBs in tokamak and helical plasmas, the mechanisms of the physics for the formation and dynamics of the ITB are clarified. The ITB is defined as the appearance of discontinuity of temperature, flow velocity, or density gradient in the radius. From the radial profiles of temperature, flow velocity, and density the ITB is characterized by the three parameters of normalized temperature gradient, R/{L}T, the location, {ρ }{ITB}, and the width, W/a, and can be expressed by ‘weak’ ITB (small R/{L}T) or ‘strong’ (large R/{L}T), ‘small’ ITB (small {ρ }{ITB}) or ‘large’ ITB (large {ρ }{ITB}), and ‘narrow’ (small W/a) or ‘wide’ (large W/a). Three key physics elements for the ITB formation, radial electric field shear, magnetic shear, and rational surface (and/or magnetic island) are described. The characteristics of electron and ion heat transport and electron and impurity transport are reviewed. There are significant differences in ion heat transport and electron heat transport. The dynamics of ITB formation and termination is also discussed. The emergence of the location of the ITB is sometimes far inside the ITB foot in the steady-state phase and the ITB region shows radial propagation during the formation of the ITB. The non-diffusive terms in momentum transport and impurity transport become more dominant in the plasma with the ITB. The reversal of the sign of non-diffusive terms in momentum transport and impurity transport associated with the formation of the ITB reported in helical plasma is described. Non-local transport plays an important role in determining the radial profile of temperature and density. The spontaneous change in temperature curvature (second radial derivative of temperature) in the ITB region is described. In addition, the key parameters of the control of the

  10. Purification and biochemical characterization of NpABCG5/NpPDR5, a plant pleiotropic drug resistance transporter expressed in Nicotiana tabacum BY-2 suspension cells.

    Science.gov (United States)

    Toussaint, Frédéric; Pierman, Baptiste; Bertin, Aurélie; Lévy, Daniel; Boutry, Marc

    2017-05-04

    Pleiotropic drug resistance (PDR) transporters belong to the ABCG subfamily of ATP-binding cassette (ABC) transporters and are involved in the transport of various molecules across plasma membranes. During evolution, PDR genes appeared independently in fungi and in plants from a duplication of a half-size ABC gene. The enzymatic properties of purified PDR transporters from yeast have been characterized. This is not the case for any plant PDR transporter, or, incidentally, for any purified plant ABC transporter. Yet, plant PDR transporters play important roles in plant physiology such as hormone signaling or resistance to pathogens or herbivores. Here, we describe the expression, purification, enzymatic characterization and 2D analysis by electron microscopy of NpABCG5/NpPDR5 from Nicotiana plumbaginifolia , which has been shown to be involved in the plant defense against herbivores. We constitutively expressed NpABCG5/NpPDR5, provided with a His-tag in a homologous system: suspension cells from Nicotiana tabacum (Bright Yellow 2 line). NpABCG5/NpPDR5 was targeted to the plasma membrane and was solubilized by dodecyl maltoside and purified by Ni-affinity chromatography. The ATP-hydrolyzing specific activity (27 nmol min -1  mg -1 ) was stimulated seven-fold in the presence of 0.1% asolectin. Electron microscopy analysis indicated that NpABCG5/NpPDR5 is monomeric and with dimensions shorter than those of known ABC transporters. Enzymatic data (optimal pH and sensitivity to inhibitors) confirmed that plant and fungal PDR transporters have different properties. These data also show that N. tabacum suspension cells are a convenient host for the purification and biochemical characterization of ABC transporters. © 2017 The Author(s); published by Portland Press Limited on behalf of the Biochemical Society.

  11. Preparation and characterization of nano-sized phase change emulsions as thermal energy storage and transport media

    International Nuclear Information System (INIS)

    Chen, J.; Zhang, P.

    2017-01-01

    Highlights: • The nano-sized phase change emulsions are prepared by using D-phase method. • The thermo-physical and transport properties are experimentally investigated. • The influence of surfactant on the melting temperature and latent heat of water is clarified. • The phase change emulsion can be used as the heat transfer fluid in a thermal energy storage system. - Abstract: Phase change emulsion (PCE) is a kind of two-phase heat transfer fluid with phase change material (PCM) dispersed in carrier fluid. It has received intensive attractions in recent years due to the fact that it can be used as both the thermal energy storage material and transport medium simultaneously in a thermal energy storage system. In the present study, nano-sized PCEs are prepared by the D-phase method with n-hexadecane and n-octadecane as PCMs. The thermo-physical and transport properties are characterized to facilitate the applications. The droplet size distribution of the PCE is measured by a Photon Correlation Spectroscopy, and the results show that the droplet size distributions are similar at different mass fractions. The rheological behavior and viscosity of the PCE are measured by a rheometer, which shows that the PCEs at mass fractions below 30.0 wt% are Newtonian fluids, and the viscosities are dependent on both the mass fraction and temperature. The differential scanning calorimetry (DSC) is employed to analyze the phase change characteristics of the PCE, and the results indicate large supercooling degree of water and PCM in the PCE. The melting temperature and latent heat of water in the PCE are much smaller than those of pure water. The thermal conductivities of the PCE with different mass fractions at different temperatures are measured by the transient hot-wire method. Furthermore, the energy transport characteristics of the PCEs are evaluated on the basis of the measured thermo-physical and transport properties. The results suggest that the PCEs show a drastic

  12. Chamber transport

    International Nuclear Information System (INIS)

    Olson, Craig L.

    2001-01-01

    Heavy ion beam transport through the containment chamber plays a crucial role in all heavy ion fusion (HIF) scenarios. Here, several parameters are used to characterize the operating space for HIF beams; transport modes are assessed in relation to evolving target/accelerator requirements; results of recent relevant experiments and simulations of HIF transport are summarized; and relevant instabilities are reviewed. All transport options still exist, including (1) vacuum ballistic transport, (2) neutralized ballistic transport, and (3) channel-like transport. Presently, the European HIF program favors vacuum ballistic transport, while the US HIF program favors neutralized ballistic transport with channel-like transport as an alternate approach. Further transport research is needed to clearly guide selection of the most attractive, integrated HIF system

  13. Temporally resolved characterization of shock-heated foam target with Al absorption spectroscopy for fast electron transport study

    Energy Technology Data Exchange (ETDEWEB)

    Yabuuchi, T.; Sawada, H.; Wei, M. S.; Beg, F. N. [Center for Energy Research, University of California, San Diego, La Jolla, California 92093 (United States); Regan, S. P.; Anderson, K.; Betti, R. [Laboratory for Laser Energetics, University of Rochester, Rochester, New York 14623 (United States); Hund, J.; Paguio, R. R.; Saito, K. M.; Stephens, R. B. [General Atomics, San Diego, California 92186 (United States); Key, M. H.; Mackinnon, A. J.; McLean, H. S.; Patel, P. K.; Wilks, S. C. [Lawrence Livermore National Laboratory, Livermore, California 94551 (United States)

    2012-09-15

    The CH foam plasma produced by a laser-driven shock wave has been characterized by a temporally resolved Al 1s-2p absorption spectroscopy technique. A 200 mg/cm{sup 3} foam target with Al dopant was developed for this experiment, which used an OMEGA EP [D. D. Meyerhofer et al., J. Phys.: Conf. Ser. 244, 032010 (2010)] long pulse beam with an energy of 1.2 kJ and 3.5 ns pulselength. The plasma temperatures were inferred with the accuracy of 5 eV from the fits to the measurements using an atomic physics code. The results show that the inferred temperature is sustained at 40-45 eV between 6 and 7 ns and decreases to 25 eV at 8 ns. 2-D radiation hydrodynamic simulations show a good agreement with the measurements. Application of the shock-heated foam plasma platform toward fast electron transport experiments is discussed.

  14. Transport and structural characterization of solution-processable doped ZnO nanowires

    KAUST Repository

    Noriega, Rodrigo

    2009-08-18

    The use of ZnO nanowires has become a widespread topic of interest in optoelectronics. In order to correctly assess the quality, functionality, and possible applications of such nanostructures it is important to accurately understand their electrical and optical properties. Aluminum- and gallium-doped crystalline ZnO nanowires were synthesized using a low-temperature solution-based process, achieving dopant densities of the order of 1020 cm-3. A non-contact optical technique, photothermal deflection spectroscopy, is used to characterize ensembles of ZnO nanowires. By modeling the free charge carrier absorption as a Drude metal, we are able to calculate the free carrier density and mobility. Determining the location of the dopant atoms in the ZnO lattice is important to determine the doping mechanisms of the ZnO nanowires. Solid-state NMR is used to distinguish between coordination environments of the dopant atoms.

  15. Synthesis and transport characterization of electrochemically deposited CdTe nanowires

    Science.gov (United States)

    Kaur, Jaskiran; Kaur, Harmanmeet; Singh, R. C.

    2018-04-01

    This paper reports the synthesis and characterization of CdTe nanowires. A thin polymeric films were irradiated with 80MeV Ag ions at a fluence of 8E7 ions/cm2, followed by UV irradiation and chemically etching in aqueous NaOH. Nanosizes go-through pores so formed were filled using a specially designed cell via electrodeposition. Nanowires so formed were further studied using SEM, I-V, UV and XRD analysis. SEM images show very smooth and uniform CdTe nanowires freely standing on the substrate. The in-situ I-V characteristics of nano-/micro structures was carried out at room temperature by leaving the structures embedded in the insulating template membrane itself.

  16. X-rays diffraction characterization of corrosion products transported by secondary side of a CANDU NPP

    International Nuclear Information System (INIS)

    Dinu, A.; Tunaru, M.; Velciu, L.

    2016-01-01

    To verify the chemistry of secondary side of CANDU steam generators, Millipore filters are used to sampling from condensing extraction pump, from feed water header and blow down of steam generator. These filters retain the corrosion products as very fine particles and are used as samples in chemistry water control. X-Ray diffraction technique is the able to distinguish the different crystallographic compounds present in oxide films deposited on the Millipore filters and gives information referring to the nature of corrosion products transported in secondary side. The XRD analysis has identified the following substance in deposited layer: magnetite (Fe_3O_4), hematite (Fe_2O_3), and iron oxide hydroxide (FeOOH). By optical microscopy it was observed a brown-reddish background specific to hematite and iron oxide hydroxide, especially for filters extracted from condensing extraction pump. The black colour of crud present on filters extracted from feed water header and blow down of steam generator shows the presence of magnetite. (authors)

  17. Walkability and walking for transport: characterizing the built environment using space syntax.

    Science.gov (United States)

    Koohsari, Mohammad Javad; Owen, Neville; Cerin, Ester; Giles-Corti, Billie; Sugiyama, Takemi

    2016-11-24

    Neighborhood walkability has been shown to be associated with walking behavior. However, the availability of geographical data necessary to construct it remains a limitation. Building on the concept of space syntax, we propose an alternative walkability index, space syntax walkability (SSW). This study examined associations of the full walkability index and SSW with walking for transport (WT). Data were collected in 2003-2004 from 2544 adults living in 154 Census Collection Districts (CCD) in Adelaide, Australia. Participants reported past week WT frequency. Full walkability (consisting of net residential density, intersection density, land use mix, and net retail area ratio) and SSW (consisting of gross population density and a space syntax measure of street integration) were calculated for each CCD using geographic information systems and space syntax software. Generalized linear models with negative binomial variance and logarithmic link functions were employed to examine the associations of each walkability index with WT frequency, adjusting for socio-demographic variables. Two walkability indices were closely correlated (ρ = 0.76, p walkability and SSW with WT frequency were positive, with regression coefficients of 1.12 (95% CI: 1.08, 1.17) and 1.14 (95% CI: 1.10, 1.19), respectively. SSW employs readily-available geographic data, yet is comparable to full walkability in its association with WT. The concept and methods of space syntax provide a novel approach to further understanding how urban design influences walking behaviors.

  18. Electrical characterization of non‐Fickian transport in groundwater and hyporheic systems

    Science.gov (United States)

    Singha, Kamini; Pidlisecky, Adam; Day-Lewis, Frederick D.; Gooseff, Michael N.

    2008-01-01

    Recent work indicates that processes controlling solute mass transfer between mobile and less mobile domains in porous media may be quantified by combining electrical geophysical methods and electrically conductive tracers. Whereas direct geochemical measurements of solute preferentially sample the mobile domain, electrical geophysical methods are sensitive to changes in bulk electrical conductivity (bulk EC) and therefore sample EC in both the mobile and immobile domains. Consequently, the conductivity difference between direct geochemical samples and remotely sensed electrical geophysical measurements may provide an indication of mass transfer rates and mobile and immobile porosities in situ. Here we present (1) an overview of a theoretical framework for determining parameters controlling mass transfer with electrical resistivity in situ; (2) a review of a case study estimating mass transfer processes in a pilot‐scale aquifer storage recovery test; and (3) an example application of this method for estimating mass transfer in watershed settings between streams and the hyporheic corridor. We demonstrate that numerical simulations of electrical resistivity studies of the stream/hyporheic boundary can help constrain volumes and rates of mobile‐immobile mass transfer. We conclude with directions for future research applying electrical geophysics to understand field‐scale transport in aquifer and fluvial systems subject to rate‐limited mass transfer.

  19. Neurochemical and behavioral characterization of neuronal glutamate transporter EAAT3 heterozygous mice

    Directory of Open Access Journals (Sweden)

    Luis F. González

    2017-10-01

    Full Text Available Abstract Background Obsessive–compulsive disorder (OCD is a severe neuropsychiatric condition affecting 1–3% of the worldwide population. OCD has a strong genetic component, and the SLC1A1 gene that encodes neuronal glutamate transporter EAAT3 is a strong candidate for this disorder. To evaluate the impact of reduced EAAT3 expression in vivo, we studied male EAAT3 heterozygous and wild-type littermate mice using a battery of behavioral paradigms relevant to anxiety (open field test, elevated plus maze and compulsivity (marble burying, as well as locomotor activity induced by amphetamine. Using high-performance liquid chromatography, we also determined tissue neurotransmitter levels in cortex, striatum and thalamus—brain areas that are relevant to OCD. Results Compared to wild-type littermates, EAAT3 heterozygous male mice have unaltered baseline anxiety-like, compulsive-like behavior and locomotor activity. Administration of acute amphetamine (5 mg/kg intraperitoneally increased locomotion with no differences across genotypes. Tissue levels of glutamate, GABA, dopamine and serotonin did not vary between EAAT3 heterozygous and wild-type mice. Conclusions Our results indicate that reduced EAAT3 expression does not impact neurotransmitter content in the corticostriatal circuit nor alter anxiety or compulsive-like behaviors.

  20. Characterization of the hole transport and electrical properties in poly(9,9-dioctylfluorene)

    International Nuclear Information System (INIS)

    Wang, L.G.; Zhang, H.W.; Tang, X.L.; Song, Y.Q.

    2011-01-01

    A systematic study of the hole transport and electrical properties in blue-emitting polymers as poly(9,9-dioctylfluorene) (PFO) has been performed. We show that the temperature dependent and thickness dependent current density versus voltage characteristics of PFO hole-only devices can be accurately described using our recently introduced improved mobility model based on both the Arrhenius temperature dependence and non-Arrhenius temperature dependence. Within the improved model, the mobility depends on three important physical quantities: temperature, carrier density, and electric field. For the polymer studied, we find the width of the density of states σ=0.115 eV and the lattice constant a=1.2 nm. Furthermore, we show that the boundary carrier density has an important effect on the current density versus voltage characteristics. Too large or too small values of the boundary carrier density lead to incorrect current density versus voltage characteristics. The numerically calculated carrier density is a decreasing function of distance from the interface. The numerically calculated electric field is an increasing function of distance. Both the maximum of carrier density and minimum of electric field appear near the interface.

  1. Electrical characterization of 6H-SiC grown by physical vapor transport method

    Energy Technology Data Exchange (ETDEWEB)

    Zaremba, G., E-mail: gzaremba@ite.waw.p [Institute of Electron Technology, Department of Analysis of Semiconductor Nanostructures, Al. Lotnikow 32/46, 02-668 Warsaw (Poland); Kaniewska, M.; Jung, W. [Institute of Electron Technology, Department of Analysis of Semiconductor Nanostructures, Al. Lotnikow 32/46, 02-668 Warsaw (Poland); Guziewicz, M. [Institute of Electron Technology, Department of Semiconductor Processing for Photonics, Al. Lotnikow 32/46, 02-668 Warsaw (Poland); Grasza, K. [Institute of Physics, Polish Academy of Sciences, Al. Lotnikow 32/46, 02-668 Warsaw (Poland); Institute of Electronic Materials Technology, ul. Wolczynska 133, 01-919 Warsaw (Poland)

    2009-11-25

    Deep level transient spectroscopy (DLTS) and capacitance versus voltage (C-V) measurements have been used to study the electrical properties of electron traps in n-type 6H-silicon carbide (SiC) grown by physical vapor transport (PVT) technique, designed as Schottky diodes. Ir Schottky- and Ni ohmic-contacts were deposited by sputtering. Current versus voltage (I-V) measurements showed that sputter deposition of the Schottky contact yields diodes with a reduced barrier height and poor rectification characteristics. Four main electron traps revealed in DLTS spectra have activation energies at 0. 39, 0.41, 0,66, and 0.74 eV below the conduction band. Based on a comparison made with electron traps reported in the literature, we conclude that three of them are well-known traps found in the as-grown or irradiated material. There was no emission signature in the literature to make such a correspondence for the trap at 0.74 eV. Strongly nonhomogenous spatial distribution with a tendency of the trap to accumulation at the surface was found by DLTS and C-V profiling. This together with the fact that the trap at 0.74 eV has not been previously reported in as-grown or processed material makes it possible that the trap is sputter deposition induced defect.

  2. Demonstrating Hybrid Heat Transport and Energy Conversion System Performance Characterization Using Intelligent Control Systems

    International Nuclear Information System (INIS)

    Ostrum, Lee; Manic, Milos

    2017-01-01

    The debate continues on the magnitude and validity of climate change caused by human activities. However, there is no debate about the need to make buildings, modes of transportation, factories, and homes as energy efficient as possible. Given that climate change could occur with the wasteful use of fossil fuel and the fact that fossil energy costs could and will swing wildly, it is imperative that every effort be made to utilize energy sources to their fullest. Hybrid energy systems (HES) are two or more separate energy producers used together to produce energy commodities. The HES this report focuses on is the use of nuclear reactor waste heat as a source of further energy utilization. Nuclear reactors use a fluid to cool the core and produce the steam needed for the production of electricity. Traditionally this steam, or coolant, is used to convert the energy then cooled elsewhere. The heat is released into the environment without being used further. By adding technologies to nuclear reactors to use the wasted heat, a system can be developed to make more than just electricity and allow for loading following capabilities.

  3. Khnifiss Beach's Black Sand: Provenance and Transport Pathways Investigation Using Heavy Minerals' Characterization

    Science.gov (United States)

    Adnani, M.; Elbelrhiti, H.; Ahmamou, M.; Masmoudi, L.

    2014-12-01

    Arid areas in south of Morocco suffer from silting problem causing destruction of villages infrastructure, roads, agriculture land and oasis heritage. Black sand on Khnifiss beach near Tarfaya city (S-W Morocco) is marked by enrichment of heavy minerals. This later is an important fraction that could help to assess the provenance and transport pathways of sediment. The sand's origin investigation could be useful to fight against erosion and silting problems from the source of supply, to this end, mineralogical analysis was carried out in Khnifiss beach's sand using Optic Microscope and Scanning Electronic Microscope with dispersive energy (SEM- EDS), in addition to physico-chemical analysis provided by Electronic Microprobe. The results revealed: (i) a high grade of oxides (Rutile, Ilmenite, Magnetite, Ulvöspinel) in samples, (ii) silicates (Quartz, Clinopyroxene, feldspar, Zircon), (iii) phosphate (apatite) and (iv) carbonate (calcite). The dominance of iron oxides justifies the black sand's colour. Then, the mineral composition supposes interference between different origins: proximal source (Calcareous cliff) for calcite, distal sources of oxides and silicates are supposed to be eroded and carried by Drâa valley from granite and igneous rocks in Anti-Atlasic field. Another source supposed might be a proximal volcanic island (Canaries island).

  4. Characterization of corrosive bacterial consortia isolated from petroleum-product-transporting pipelines

    Energy Technology Data Exchange (ETDEWEB)

    Rajasekar, Aruliah; Ting, Yen-Peng [National Univ. of Singapore (Singapore). Dept. of Chemical and Biomolecular Engineering; Anandkumar, Balakrishnan [Sourashtra Coll., Madurai (India). Dept. of Biotechnology; Maruthamuthu, Sundaram [Central Electrochemical Research Inst., Karaikudi (India). Biocorrosion Group; Rahman, Pattanathu K.S.M. [Teesside Univ., Tees Valley (United Kingdom). Chemical and Bioprocess Engineering Group

    2010-01-15

    Microbiologically influenced corrosion is a problem commonly encountered in facilities in the oil and gas industries. The present study describes bacterial enumeration and identification in diesel and naphtha pipelines located in the northwest and southwest region in India, using traditional cultivation technique and 16S rDNA gene sequencing. Phylogenetic analysis of 16S rRNA sequences of the isolates was carried out, and the samples obtained from the diesel and naphtha-transporting pipelines showed the occurrence of 11 bacterial species namely Serratia marcescens ACE2, Bacillus subtilis AR12, Bacillus cereus ACE4, Pseudomonas aeruginosa AI1, Klebsiella oxytoca ACP, Pseudomonas stutzeri AP2, Bacillus litoralis AN1, Bacillus sp., Bacillus pumilus AR2, Bacillus carboniphilus AR3, and Bacillus megaterium AR4. Sulfate-reducing bacteria were not detected in samples from both pipelines. The dominant bacterial species identified in the petroleum pipeline samples were B. cereus and S. marcescens in the diesel and naphtha pipelines, respectively. Therefore, several types of bacteria may be involved in biocorrosion arising from natural biofilms that develop in industrial facilities. In addition, localized (pitting) corrosion of the pipeline steel in the presence of the consortia was observed by scanning electron microscopy analysis. The potential role of each species in biofilm formation and steel corrosion is discussed. (orig.)

  5. Identification and Functional Characterization of a Tonoplast Dicarboxylate Transporter in Tomato (Solanum lycopersicum).

    Science.gov (United States)

    Liu, Ruiling; Li, Boqiang; Qin, Guozheng; Zhang, Zhanquan; Tian, Shiping

    2017-01-01

    Acidity plays an important role in flavor and overall organoleptic quality of fruit and is mainly due to the presence of organic acids. Understanding the molecular basis of organic acid metabolism is thus of primary importance for fruit quality improvement. Here, we cloned a putative tonoplast dicarboxylate transporter gene ( SlTDT ) from tomato, and submitted it to the NCBI database (GenBank accession number: KC733165). SlTDT protein contained 13 putative transmembrane domains in silico analysis. Confocal microscopic study using green fluorescent fusion proteins revealed that SlTDT was localized on tonoplast. The expression patterns of SlTDT in tomato were analyzed by RT-qPCR. The results indicated that SlTDT expressed in leaves, roots, flowers and fruits at different ripening stages, suggesting SlTDT may be associated with the development of different tissues. To further explore the function of SlTDT , we constructed both overexpression and RNAi vectors and obtained transgenic tomato plants by agrobacterium-mediated method. Gas chromatography-mass spectrometer (GC-MS) analysis showed that overexpression of SlTDT significantly increased malate content, and reduced citrate content in tomato fruit. By contrast, repression of SlTDT in tomato reduced malate content of and increased citrate content. These results indicated that SlTDT played an important role in remobilization of malate and citrate in fruit vacuoles.

  6. Demonstrating Hybrid Heat Transport and Energy Conversion System Performance Characterization Using Intelligent Control Systems

    Energy Technology Data Exchange (ETDEWEB)

    Ostrum, Lee [Univ. of Idaho and Idaho Falls Center, Idaho Falls, ID (United States); Manic, Milos [Virginia Commonwealth Univ., Richmond, VA (United States)

    2017-09-28

    The debate continues on the magnitude and validity of climate change caused by human activities. However, there is no debate about the need to make buildings, modes of transportation, factories, and homes as energy efficient as possible. Given that climate change could occur with the wasteful use of fossil fuel and the fact that fossil energy costs could and will swing wildly, it is imperative that every effort be made to utilize energy sources to their fullest. Hybrid energy systems (HES) are two or more separate energy producers used together to produce energy commodities. The HES this report focuses on is the use of nuclear reactor waste heat as a source of further energy utilization. Nuclear reactors use a fluid to cool the core and produce the steam needed for the production of electricity. Traditionally this steam, or coolant, is used to convert the energy then cooled elsewhere. The heat is released into the environment without being used further. By adding technologies to nuclear reactors to use the wasted heat, a system can be developed to make more than just electricity and allow for loading following capabilities.

  7. Radial distributions of star populations in elliptical galaxies

    International Nuclear Information System (INIS)

    Angeletti, Lucio; Giannone, Pietro

    2010-01-01

    The dynamical structure of stars in low-ellipticity early-type galaxies has been approached in a conceptually simple manner by making use of the mass structure inferred from the radial surface brightness and the stellar metal abundance as derived from that of the contracting gas mass when the stars formed. Families of models depending on three parameters can be used to fit the surface radial profiles of spectro-photometric indices. In particular, the behavior of the spectral index Mg 2 is selected, and the observations for eleven galaxies are matched with models. With the fitting values of the free parameters, we have studied the spatial (within the galaxy) and projected (on the image of the galaxy) distributions of the metal abundances. We present the results for three chosen galaxies characterized by rather different values of the fitting parameters. Our results can be of interest for the formation of stellar populations and call attention to the need for more detailed observations.

  8. Manipulation of viscous fingering in a radially tapered cell geometry

    Science.gov (United States)

    Bongrand, Grégoire; Tsai, Peichun Amy

    2018-06-01

    When a more mobile fluid displaces another immiscible one in a porous medium, viscous fingering propagates with a partial sweep, which hinders oil recovery and soil remedy. We experimentally investigate the feasibility of tuning such fingering propagation in a nonuniform narrow passage with a radial injection, which is widely used in various applications. We show that a radially converging cell can suppress the common viscous fingering observed in a uniform passage, and a full sweep of the displaced fluid is then achieved. The injection flow rate Q can be further exploited to manipulate the viscous fingering instability. For a fixed gap gradient α , our experimental results show a full sweep at a small Q but partial displacement with fingering at a sufficient Q . Finally, by varying α , we identify and characterize the variation of the critical threshold between stable and unstable displacements. Our experimental results reveal good agreement with theoretical predictions by a linear stability analysis.

  9. Inward open characterization of EmrD transporter with molecular dynamics simulation

    International Nuclear Information System (INIS)

    Tan, Xianwei; Wang, Boxiong

    2016-01-01

    EmrD is a member of the multidrug resistance exporter family. Up to now, little is known about the structural dynamics that underline the function of the EmrD protein in inward-facing open state and how the EmrD transits from an occluded state to an inward open state. For the first time the article applied the AT simulation to investigate the membrane transporter protein EmrD, and described the dynamic features of the whole protein, the domain, the helices, and the amino acid residues during an inward-open process from its occluded state. The gradual inward-open process is different from the current model of rigid-body domain motion in alternating-access mechanism. Simulation results show that the EmrD inward-open conformational fluctuation propagates from a C-terminal domain to an N-terminal domain via the linker region during the transition from its occluded state. The conformational fluctuation of the C-terminal domain is larger than that of the N-terminal domain. In addition, it is observed that the helices exposed to the surrounding membrane show a higher level of flexibility than the other regions, and the protonated E227 plays a key role in the transition from the occluded to the open state. -- Highlights: •This study described the dynamic features of the whole EmrD protein, during an inward-open process from its occluded state. •The EmrD inward-open conformational fluctuation propagates from a C-terminal domain to an N-terminal domain via the linker region during the transition from its occluded state. •The conformational fluctuation of the C-terminal domain is larger than that of the N-terminal domain. •The protonated E227 plays a key role in the transition from the occluded to the open state.

  10. Inward open characterization of EmrD transporter with molecular dynamics simulation

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Xianwei [School of Life Sciences, Tsinghua University, Beijing 100084 (China); Wang, Boxiong, E-mail: boxiong_wang@yahoo.com [Department of Precision Instrument, Tsinghua University, Beijing 100084 (China)

    2016-06-10

    EmrD is a member of the multidrug resistance exporter family. Up to now, little is known about the structural dynamics that underline the function of the EmrD protein in inward-facing open state and how the EmrD transits from an occluded state to an inward open state. For the first time the article applied the AT simulation to investigate the membrane transporter protein EmrD, and described the dynamic features of the whole protein, the domain, the helices, and the amino acid residues during an inward-open process from its occluded state. The gradual inward-open process is different from the current model of rigid-body domain motion in alternating-access mechanism. Simulation results show that the EmrD inward-open conformational fluctuation propagates from a C-terminal domain to an N-terminal domain via the linker region during the transition from its occluded state. The conformational fluctuation of the C-terminal domain is larger than that of the N-terminal domain. In addition, it is observed that the helices exposed to the surrounding membrane show a higher level of flexibility than the other regions, and the protonated E227 plays a key role in the transition from the occluded to the open state. -- Highlights: •This study described the dynamic features of the whole EmrD protein, during an inward-open process from its occluded state. •The EmrD inward-open conformational fluctuation propagates from a C-terminal domain to an N-terminal domain via the linker region during the transition from its occluded state. •The conformational fluctuation of the C-terminal domain is larger than that of the N-terminal domain. •The protonated E227 plays a key role in the transition from the occluded to the open state.

  11. Discontinuity model for internal transport barrier formation in reversed magnetic shear plasmas

    International Nuclear Information System (INIS)

    Kishimoto, Y.; Dettrick, S.A.; Li, J.Q.; Shirai, S.; Kim, J.Y.; Horton, W.; Tajima, T.; LeBrun, M.J.

    2000-01-01

    It is becoming clear that tokamak anomalous transport is dominated by radially extended non-local modes which originate from strong toroidal coupling of rational surfaces in non-uniform plasmas. To aid in understanding the internal transport barrier (ITB) formed in reversed magnetic shear experiments, in addition to the well known shear flow effect, the article points out an important non-local effect and/or finite size effect which comes from the complex behaviour of the mode over a finite radial region around the minimum q (safety factor) surface. The non-local mode, which is characterized by its radial extent and the degree of tilting in the poloidal direction (Δr, θ 0 ), changes its structure depending on the sign of the magnetic shear, and as a result such modes are weakly excited across the q min surface. This leads to a discontinuity or gap which disconnects the phase relation in the global wave structure across the q min surface. Once such a discontinuity (or gap) is formed, transport suppression occurs and therefore a transport barrier can be expected near the q min surface. The existence of this discontinuity is confirmed through use of a toroidal particle simulation. It is also shown that whether such a discontinuity is efficiently established depends on the presence of the radial electric field and the related plasma shear flow. (author)

  12. Radial MR images of the knee

    International Nuclear Information System (INIS)

    Hewes, R.C.; Miller, T.R.

    1988-01-01

    To profile optimally each portion of the meniscus, the authors use the multiangle, multisection feature of a General Electric SIGNA 1.5-T imager to produce radial images centered on each meniscus. A total of 12-15 sections are imaged at 10 0 -15 0 intervals of each meniscus, yielding perpendicular images of the entire meniscus, comparable with the arthrographic tangential views. The authors review their technique and demonstrate correlation cases between the radial gradient recalled acquisition in a steady state sequences, sagittal and coronal MR images, and arthrograms. Radial images should be a routine part of knee MR imaging

  13. Numerical characterization of the edge transport conditions and limiter fluxes of the HIDRA stellarator

    Science.gov (United States)

    Marcinko, Steven; Curreli, Davide

    2018-02-01

    The Hybrid Illinois Device for Research and Applications (HIDRA) is a new device for education and Plasma-Material Interaction research at the University of Illinois at Urbana-Champaign. In advance of its first operational campaign, EMC3-EIRENE simulations have been run on the device. EMC3-EIRENE has been modified to calculate a per-plasma-cell relaxed Bohm-like diffusivity simultaneously with the electron temperature at each iteration. In our characterization, the electron temperature, diffusivity, heat fluxes, and particle fluxes have been obtained for varying power levels on a HIDRA magnetic grid, and scaling laws have been extracted, using constraints from previous experimental data taken when the device was operated in Germany (WEGA facility). Peak electron temperatures and heat fluxes were seen to follow a power-law dependence on the deposited radiofrequency (RF) power of type f (PR F)∝a PRF b , with typical exponents in the range of b ˜0.55 to 0.60. Higher magnetic fields have the tendency to linearize the heat flux dependence on the RF power, with exponents in the range of b ˜ 0.75. Particle fluxes are seen to saturate first, and then slightly decline for RF powers above 120 kW in the low-field case and 180 kW in the high-field case.

  14. Characterizing aerosol transport into the Canadian High Arctic using aerosol mass spectrometry and Lagrangian modelling

    Science.gov (United States)

    Kuhn, T.; Damoah, R.; Bacak, A.; Sloan, J. J.

    2010-05-01

    We report the analysis of measurements made using an aerosol mass spectrometer (AMS; Aerodyne Research Inc.) that was installed in the Polar Environment Atmospheric Research Laboratory (PEARL) in summer 2006. PEARL is located in the Canadian high Arctic at 610 m above sea level on Ellesmere Island (80° N 86° W). PEARL is unique for its remote location in the Arctic and because most of the time it is situated within the free troposphere. It is therefore well suited as a receptor site to study the long range tropospheric transport of pollutants into the Arctic. Some information about the successful year-round operation of an AMS at a high Arctic site such as PEARL will be reported here, together with design considerations for reliable sampling under harsh low-temperature conditions. Computational fluid dynamics calculations were made to ensure that sample integrity was maintained while sampling air at temperatures that average -40 °C in the winter and can be as low as -55 °C. Selected AMS measurements of aerosol mass concentration, size, and chemical composition recorded during the months of August, September and October 2006 will be reported. During this period, sulfate was at most times the predominant aerosol component with on average 0.115 μg m-3 (detection limit 0.003 μg m-3). The second most abundant component was undifferentiated organic aerosol, with on average 0.11 μg m-3 detection limit (0.04 μg m-3). The nitrate component, which averaged 0.007 μg m-3, was above its detection limit (0.002 μg m-3), whereas the ammonium ion had an apparent average concentration of 0.02 μg m-3, which was approximately equal to its detection limit. A few episodes having increased mass concentrations and lasting from several hours to several days are apparent in the data. These were investigated further using a statistical analysis to determine their common characteristics. High correlations among some of the components arriving during the short term episodes provide

  15. Access of energetic particles to storm time ring current through enhanced radial diffusion

    International Nuclear Information System (INIS)

    Lyons, L.R.; Schulz, M.

    1989-01-01

    Magnetic storms are distinguishable from other periods of geomagnetic activity by the injection of trapped electrons and ions to the 2 approx-lt L approx-lt 4 region. It has been proposed previously that this injection results from an inward displacement of the preexisting trapped-particle population by enhanced storm time electric fields. However, high-energy (approx-gt 40 keV) ring-current particles have drift periods that are typically shorter than the time of the main-phase development, and so the direct radial transport of these particles is restricted. The authors propose here that the transport of approx-gt 40 keV particles into the storm time ring current can result from enhanced stochastic radial transport driven by fluctuating electric fields during a storm's main phase. They estimate the effects of such electric fields by applying radial-diffusion theory, assuming a preexisting trapped-particle population as the initial conditions, and they demonstrate the feasibility of explaining observed flux increases of approx-gt 40-keV particles at L approx-lt 4 by enhanced radial diffusion. It is necessary that new particles be injected near the outer boundary of the trapping region so as to maintain the fluxes there as an outer boundary condition, and they estimate that the approx-gt 40-keV portion of the storm time ring current at L ∼ 3 consists of about 50% preexisting and about 50% new particles. They thus find that formation of the storm time ring current may be explainable via a combination of direct radial transport at energies approx-lt 40 keV and diffusive radial transport at higher energies

  16. Radial pseudoaneurysm following diagnostic coronary angiography

    Directory of Open Access Journals (Sweden)

    Shankar Laudari

    2015-06-01

    Full Text Available The radial artery access has gained popularity as a method of diagnostic coronary catheterization compared to femoral artery puncture in terms of vascular complications and early ambulation. However, very rare complication like radial artery pseudoaneurysm may occur following cardiac catheterization which may give rise to serious consequences. Here, we report a patient with radial pseudoaneurysm following diagnostic coronary angiography. Adequate and correct methodology of compression of radial artery following puncture for maintaining hemostasis is the key to prevention.DOI: http://dx.doi.org/10.3126/jcmsn.v10i3.12776 Journal of College of Medical Sciences-Nepal, 2014, Vol-10, No-3, 48-50

  17. Turbulence in tokamak plasmas. Effect of a radial electric field shear

    International Nuclear Information System (INIS)

    Payan, J.

    1994-05-01

    After a review of turbulence and transport phenomena in tokamak plasmas and the radial electric field shear effect in various tokamaks, experimental measurements obtained at Tore Supra by the means of the ALTAIR plasma diagnostic technique, are presented. Electronic drift waves destabilization mechanisms, which are the main features that could describe the experimentally observed microturbulence, are then examined. The effect of a radial electric field shear on electronic drift waves is then introduced, and results with ohmic heating are studied together with relations between turbulence and transport. The possible existence of ionic waves is rejected, and a spectral frequency modelization is presented, based on the existence of an electric field sheared radial profile. The position of the inversion point of this field is calculated for different values of the mean density and the plasma current, and the modelization is applied to the TEXT tokamak. The radial electric field at Tore Supra is then estimated. The effect of the ergodic divertor on turbulence and abnormal transport is then described and the density fluctuation radial profile in presence of the ergodic divertor is modelled. 80 figs., 120 refs

  18. Paleoclassical electron heat transport

    International Nuclear Information System (INIS)

    Callen, J.D.

    2005-01-01

    Radial electron heat transport in low collisionality, magnetically-confined toroidal plasmas is shown to result from paleoclassical Coulomb collision processes (parallel electron heat conduction and magnetic field diffusion). In such plasmas the electron temperature equilibrates along magnetic field lines a long length L, which is the minimum of the electron collision length and a maximum effective half length of helical field lines. Thus, the diffusing field lines induce a radial electron heat diffusivity M ≅ L/(πR 0q ) ∼ 10 >> 1 times the magnetic field diffusivity η/μ 0 ≅ ν e (c/ω p ) 2 . The paleoclassical electron heat flux model provides interpretations for many features of 'anomalous' electron heat transport: magnitude and radial profile of electron heat diffusivity (in tokamaks, STs, and RFPs), Alcator scaling in high density plasmas, transport barriers around low order rational surfaces and near a separatrix, and a natural heat pinch (or minimum temperature gradient) heat flux form. (author)

  19. Stability of radial and non-radial pulsation modes of massive ZAMS models

    International Nuclear Information System (INIS)

    Odell, A.P.; Pausenwein, A.; Weiss, W.W.; Hajek, A.

    1987-01-01

    The authors have computed non-adiabatic eigenvalues for radial and non-radial pulsation modes of star models between 80 and 120 M solar with composition of chi=0.70 and Z=0.02. The radial fundamental mode is unstable in models with mass greater than 95 M solar , but the first overtone mode is always stable. The non-radial modes are all stable for all models, but the iota=2 f-mode is the closest to being driven. The non-radial modes are progressively more stable with higher iota and with higher n (for both rho- and g-modes). Thus, their results indicate that radial pulsation limits the upper mass of a star

  20. Characterization of the fate and transport of nitroaromatic compounds at a former DoD ordnance depot site

    Energy Technology Data Exchange (ETDEWEB)

    Klausmeier, M.E.; Yoon, J.

    1999-07-01

    The 975-acre Former Nansemond Ordnance Depot (FNOD) in Suffolk, Virginia was used by the Department of Defense (DoD) from 1917 until the mid-1950's for preparation, storage, transportation, inspection and demilitarization of many classes of ammunition and ordnance. Approximately 28 areas of Concern (AOC) have been identified by the EPA as areas that could pose potential risk to human health or the environment. The primary contaminants of concern are some trace metals and explosive compounds. During a summer 1987 field investigation, a slab of crystalline TNT was found which was estimated to weigh several tons. An enhanced MODFLOW model is being used to identify subsurface flow patterns. The calibrated model will be used to identify contaminant fate and transport behavior at the site. Enhancements to the MODFLOW model include an updated block-centered flow package (BCF4) and an updated recharge-seepage face boundary package (RSF4) to utilize for the FNOD site flow characterization. BCF4 package accurately delineates the water table without relying on an ad hoc rewetting procedure. This is accomplished by calculating the hydraulic head value required to transmit recharging water through the unsaturated zone without inactivating dry cells. The recharge-seepage face package eliminates the projection of heads above the ground surface by adjusting recharge to a cell when a user supplied ponding depth is reached. Using a regional model, a telescoping grid refinement technique was implemented to calculate the boundary conditions around the area of interest and to model quantity and quality interactions between surface and subsurface water regimes in a realistic manner.

  1. 21 CFR 866.4800 - Radial immunodiffusion plate.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES IMMUNOLOGY AND MICROBIOLOGY DEVICES Immunology Laboratory Equipment and Reagents § 866.4800 Radial immunodiffusion plate. (a) Identification. A radial immunodiffusion plate for clinical use...

  2. Functional characterization of the vertebrate primary ureter: Structure and ion transport mechanisms of the pronephric duct in axolotl larvae (Amphibia

    Directory of Open Access Journals (Sweden)

    Prehn Lea R

    2010-05-01

    Full Text Available Abstract Background Three kidney systems appear during vertebrate development: the pronephroi, mesonephroi and metanephroi. The pronephric duct is the first or primary ureter of these kidney systems. Its role as a key player in the induction of nephrogenic mesenchyme is well established. Here we investigate whether the duct is involved in urine modification using larvae of the freshwater amphibian Ambystoma mexicanum (axolotl as model. Results We investigated structural as well as physiological properties of the pronephric duct. The key elements of our methodology were: using histology, light and transmission electron microscopy as well as confocal laser scanning microscopy on fixed tissue and applying the microperfusion technique on isolated pronephric ducts in combination with single cell microelectrode impalements. Our data show that the fully differentiated pronephric duct is composed of a single layered epithelium consisting of one cell type comparable to the principal cell of the renal collecting duct system. The cells are characterized by a prominent basolateral labyrinth and a relatively smooth apical surface with one central cilium. Cellular impalements demonstrate the presence of apical Na+ and K+ conductances, as well as a large K+ conductance in the basolateral cell membrane. Immunolabeling experiments indicate heavy expression of Na+/K+-ATPase in the basolateral labyrinth. Conclusions We propose that the pronephric duct is important for the subsequent modification of urine produced by the pronephros. Our results indicate that it reabsorbs sodium and secretes potassium via channels present in the apical cell membrane with the driving force for ion movement provided by the Na+/K+ pump. This is to our knowledge the first characterization of the pronephric duct, the precursor of the collecting duct system, which provides a model of cell structure and basic mechanisms for ion transport. Such information may be important in understanding

  3. Characterization of SLCO5A1/OATP5A1, a solute carrier transport protein with non-classical function.

    Directory of Open Access Journals (Sweden)

    Katrin Sebastian

    Full Text Available Organic anion transporting polypeptides (OATP/SLCO have been identified to mediate the uptake of a broad range of mainly amphipathic molecules. Human OATP5A1 was found to be expressed in the epithelium of many cancerous and non-cancerous tissues throughout the body but protein characterization and functional analysis have not yet been performed. This study focused on the biochemical characterization of OATP5A1 using Xenopus laevis oocytes and Flp-In T-REx-HeLa cells providing evidence regarding a possible OATP5A1 function. SLCO5A1 is highly expressed in mature dendritic cells compared to immature dendritic cells (∼6.5-fold and SLCO5A1 expression correlates with the differentiation status of primary blood cells. A core- and complex- N-glycosylated polypeptide monomer of ∼105 kDa and ∼130 kDa could be localized in intracellular membranes and on the plasma membrane, respectively. Inducible expression of SLCO5A1 in HeLa cells led to an inhibitory effect of ∼20% after 96 h on cell proliferation. Gene expression profiling with these cells identified immunologically relevant genes (e.g. CCL20 and genes implicated in developmental processes (e.g. TGM2. A single nucleotide polymorphism leading to the exchange of amino acid 33 (L→F revealed no differences regarding protein expression and function. In conclusion, we provide evidence that OATP5A1 might be a non-classical OATP family member which is involved in biological processes that require the reorganization of the cell shape, such as differentiation and migration.

  4. Tuning porosity and radial mechanical properties of DNA origami nanotubes via crossover design

    Science.gov (United States)

    Ma, Zhipeng; Kawai, Kentaro; Hirai, Yoshikazu; Tsuchiya, Toshiyuki; Tabata, Osamu

    2017-06-01

    DNA origami nanotubes are utilized as structural platforms for the fabrication of various micro/nanosystems for drug delivery, optical or biological sensing, and even nanoscale robots. Their radial structural and mechanical properties, which play a crucial role in the effective use of micro/nanosystems, have not been fully studied. In particular, the effects of crossovers, which are basic structures for rationally assembling double-stranded DNA (dsDNA) helices into a nanotube configuration, have not yet been characterized experimentally. To investigate the effects of crossovers on the porosity and the radial mechanical properties of DNA origami nanotubes, we fabricated a DNA origami nanotube with varied crossover designs along the nanotube axis. The radial geometry of the DNA origami nanotube is experimentally characterized by both atomic force microscopy (AFM) and electron cryomicroscopy (cryo-EM). Moreover, the radial mechanical properties of the DNA origami nanotube including the radial modulus are directly measured by force-distance-based AFM. These measurements reveal that the porosity and the radial modulus of DNA origami nanotubes can be tuned by adjusting the crossover design, which enables the optimal design and construction of DNA origami nanostructures for various applications.

  5. Investigation of the Radial Compression of Carbon Nanotubes with a Scanning Probe Microscope

    Science.gov (United States)

    Shen, Weidian; Jiang, Bin; Han, Bao Shan; Xie, Si-Shen

    2001-03-01

    Carbon nanotubes have attracted great interest since they were first synthesized. The tubes have substantial promise in a variety of applications due to their unique properties. Efforts have been made to characterize the mechanical properties of the tubes. However, previous work has concentrated on the tubes’ longitudinal properties, and studies of their radial properties lag behind. We have operated a scanning probe microscope, NanoScopeTM IIIa, in the indentation/scratching mode to carry out a nanoindentation test on the top of multiwalled carbon nanotubes. We measured the correlation between the radial stress and the tube compression, and thereby determined the radial compressive elastic modulus at different compressive forces. The measurements also allowed us to estimate the radial compressive strength of the tubes. Support of this work by an Eastern Michigan University Faculty Research Fellowship and by the K. C. Wong Education Foundation, Hong Kong is gratefully acknowledged.

  6. Probability of primordial black hole formation and its dependence on the radial profile of initial configurations

    International Nuclear Information System (INIS)

    Hidalgo, J. C.; Polnarev, A. G.

    2009-01-01

    In this paper we derive the probability of the radial profiles of spherically symmetric inhomogeneities in order to provide an improved estimation of the number density of primordial black holes (PBHs). We demonstrate that the probability of PBH formation depends sensitively on the radial profile of the initial configuration. We do this by characterizing this profile with two parameters chosen heuristically: the amplitude of the inhomogeneity and the second radial derivative, both evaluated at the center of the configuration. We calculate the joint probability of initial cosmological inhomogeneities as a function of these two parameters and then find a correspondence between these parameters and those used in numerical computations of PBH formation. Finally, we extend our heuristic study to evaluate the probability of PBH formation taking into account for the first time the radial profile of curvature inhomogeneities.

  7. Boundary-artifact-free phase retrieval with the transport of intensity equation II: applications to microlens characterization.

    Science.gov (United States)

    Zuo, Chao; Chen, Qian; Li, Hongru; Qu, Weijuan; Asundi, Anand

    2014-07-28

    Boundary conditions play a crucial role in the solution of the transport of intensity equation (TIE). If not appropriately handled, they can create significant boundary artifacts across the reconstruction result. In a previous paper [Opt. Express 22, 9220 (2014)], we presented a new boundary-artifact-free TIE phase retrieval method with use of discrete cosine transform (DCT). Here we report its experimental investigations with applications to the micro-optics characterization. The experimental setup is based on a tunable lens based 4f system attached to a non-modified inverted bright-field microscope. We establish inhomogeneous Neumann boundary values by placing a rectangular aperture in the intermediate image plane of the microscope. Then the boundary values are applied to solve the TIE with our DCT-based TIE solver. Experimental results on microlenses highlight the importance of boundary conditions that often overlooked in simplified models, and confirm that our approach effectively avoid the boundary error even when objects are located at the image borders. It is further demonstrated that our technique is non-interferometric, accurate, fast, full-field, and flexible, rendering it a promising metrological tool for the micro-optics inspection.

  8. Identification and Characterization of Key Human Performance Issues and Research in the Next Generation Air Transportation System (NextGen)

    Science.gov (United States)

    Lee, Paul U.; Sheridan, Tom; Poage, james L.; Martin, Lynne Hazel; Jobe, Kimberly K.

    2010-01-01

    This report identifies key human-performance-related issues associated with Next Generation Air Transportation System (NextGen) research in the NASA NextGen-Airspace Project. Four Research Focus Areas (RFAs) in the NextGen-Airspace Project - namely Separation Assurance (SA), Airspace Super Density Operations (ASDO), Traffic Flow Management (TFM), and Dynamic Airspace Configuration (DAC) - were examined closely. In the course of the research, it was determined that the identified human performance issues needed to be analyzed in the context of NextGen operations rather than through basic human factors research. The main gaps in human factors research in NextGen were found in the need for accurate identification of key human-systems related issues within the context of specific NextGen concepts and better design of the operational requirements for those concepts. By focusing on human-system related issues for individual concepts, key human performance issues for the four RFAs were identified and described in this report. In addition, mixed equipage airspace with components of two RFAs were characterized to illustrate potential human performance issues that arise from the integration of multiple concepts.

  9. Raman and electronic transport characterization of few- and single-layer-thick α-RuCl3

    Science.gov (United States)

    Zhou, Boyi; Henriksen, Erik

    The layered magnetic semiconductor α-RuCl3, having a honeycomb lattice of spin-1/2 moments, has been identified as a potential candidate material to realize the Kitaev quantum spin liquid. In particular, bulk RuCl3 crystals have been studied and found to be on the cusp of manifesting QSL behavior. As the QSL is primarily a two-dimensional phenomenon, and since the layers of RuCl3 are weakly coupled, we propose to create and study a 2D spin-1/2 honeycomb system by isolating single sheets. Here we report the exfoliation of RuCl3 down to few- and single-layer-thick samples, which we characterize by Raman spectroscopy and atomic force microscopy at room temperature. We will also report our progress on measurements of basic electronic transport properties in the 2D RuCl3 system by controlling the chemical potential via gating in a field-effect configuration.

  10. Self-consistent model for the radial current generation during fishbone activity

    International Nuclear Information System (INIS)

    Lutsenko, V.V.; Marchenko, V.S.

    2002-01-01

    Line broadened quasilinear burst model, originally developed for the bump-on-tail instability [H. L. Berk et al., Nucl. Fusion 35, 1661 (1995)], is extended to the problem of sheared flow generation by the fishbone burst. It is supposed that the radial current of the resonant fast ions can be sufficient to create the transport barrier

  11. Radial electric field in JET advanced tokamak scenarios with toroidal field ripple

    NARCIS (Netherlands)

    Crombe, K.; Andrew, Y.; Biewer, T. M.; Blanco, E.; de Vries, P. C.; Giroud, C.; Hawkes, N. C.; Meigs, A.; Tala, T.; von Hellermann, M.; Zastrow, K. D.

    2009-01-01

    A dedicated campaign has been run on JET to study the effect of toroidal field (TF) ripple on plasma performance. Radial electric field measurements from experiments on a series of plasmas with internal transport barriers (ITBs) and different levels of ripple amplitude are presented. They have been

  12. HIGHLY RESOLVED MEASUREMENTS OF PERIODIC RADIAL ELECTRIC FIELD AND ASSOCIATED RELAXATIONS IN EDGE BIASING EXPERIMENTS

    Czech Academy of Sciences Publication Activity Database

    Peleman, P.; Xu, Y.; Spolaore, M.; Brotánková, Jana; Devynck, P.; Stöckel, Jan; Van Oost, G.; Boucher, C.

    363-365, č. 17 (2007), s. 638-642 ISSN 0022-3115. [ Plasma Surface Interactions in Controlled Fusion Devices/17th./. Hefei, 22.05.2007-26.05.2007] Institutional research plan: CEZ:AV0Z20430508 Keywords : Relaxations * Edge transport * Plasma flow * Radial electric fields Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.643, year: 2007

  13. Convective transport in tokamaks

    International Nuclear Information System (INIS)

    D'Ippolito, D.A.; Myra, J.R.; Russell, D.A.; Krasheninnikov, S.I.; Pigarov, A.Yu.; Yu, G.Q.; Xu, X.Q.; Nevins, W.M.

    2005-01-01

    Scrape-off-layer (SOL) convection in fusion experiments appears to be a universal phenomenon that can 'short-circuit' the divertor in some cases. The theory of 'blob' transport provides a simple and robust physical paradigm for studying convective transport. This paper summarizes recent advances in the theory of blob transport and its comparison with 2D and 3D computer simulations. We also discuss the common physical basis relating radial transport of blobs, pellets, and ELMs and a new blob regime that may lead to a connection between blob transport and the density limit. (author)

  14. Characterization of a putative grapevine Zn transporter, VvZIP3, suggests its involvement in early reproductive development in Vitis vinifera L

    Directory of Open Access Journals (Sweden)

    Gainza-Cortés Felipe

    2012-07-01

    Full Text Available Abstract Background Zinc (Zn deficiency is one of the most widespread mineral nutritional problems that affect normal development in plants. Because Zn cannot passively diffuse across cell membranes, it must be transported into intracellular compartments for all biological processes where Zn is required. Several members of the Zinc-regulated transporters, Iron-regulated transporter-like Protein (ZIP gene family have been characterized in plants, and have shown to be involved in metal uptake and transport. This study describes the first putative Zn transporter in grapevine. Unravelling its function may explain an important symptom of Zn deficiency in grapevines, which is the production of clusters with fewer and usually smaller berries than normal. Results We identified and characterized a putative Zn transporter from berries of Vitis vinifera L., named VvZIP3. Compared to other members of the ZIP family identified in the Vitis vinifera L. genome, VvZIP3 is mainly expressed in reproductive tissue - specifically in developing flowers - which correlates with the high Zn accumulation in these organs. Contrary to this, the low expression of VvZIP3 in parthenocarpic berries shows a relationship with the lower Zn accumulation in this tissue than in normal seeded berries where its expression is induced by Zn. The predicted protein sequence indicates strong similarity with several members of the ZIP family from Arabidopsis thaliana and other species. Moreover, VvZIP3 complemented the growth defect of a yeast Zn-uptake mutant, ZHY3, and is localized in the plasma membrane of plant cells, suggesting that VvZIP3 has the function of a Zn uptake transporter. Conclusions Our results suggest that VvZIP3 encodes a putative plasma membrane Zn transporter protein member of the ZIP gene family that might play a role in Zn uptake and distribution during the early reproductive development in Vitis vinifera L., indicating that the availability of this micronutrient

  15. Phase diagram of structure of radial electric field in helical plasmas

    International Nuclear Information System (INIS)

    Toda, S.; Itoh, K.

    2002-01-01

    A set of transport equations in toroidal helical plasmas is analyzed, including the bifurcation of the radial electric field. Multiple solutions of E r for the ambipolar condition induces domains of different electric polarities. A structure of the domain interface is analyzed and a phase diagram is obtained in the space of the external control parameters. The region of the reduction of the anomalous transport is identified. (author)

  16. Anomalies of radial and ulnar arteries

    Directory of Open Access Journals (Sweden)

    Rajani Singh

    Full Text Available Abstract During dissection conducted in an anatomy department of the right upper limb of the cadaver of a 70-year-old male, both origin and course of the radial and ulnar arteries were found to be anomalous. After descending 5.5 cm from the lower border of the teres major, the brachial artery anomalously bifurcated into a radial artery medially and an ulnar artery laterally. In the arm, the ulnar artery lay lateral to the median nerve. It followed a normal course in the forearm. The radial artery was medial to the median nerve in the arm and then, at the level of the medial epicondyle, it crossed from the medial to the lateral side of the forearm, superficial to the flexor muscles. The course of the radial artery was superficial and tortuous throughout the arm and forearm. The variations of radial and ulnar arteries described above were associated with anomalous formation and course of the median nerve in the arm. Knowledge of neurovascular anomalies are important for vascular surgeons and radiologists.

  17. The Effects of Radial and Poloidal ExB Drifts in the Tokamak SOL

    International Nuclear Information System (INIS)

    Ou Jing; Zhu Sizheng

    2006-01-01

    The effects of radial and poloidal ExB drifts in the scrape-off layer (SOL) of a limiter tokamak are studied with a one-dimensional fluid code. The transport equations are solved in the poloidal direction with the radial influxes as the source terms. The simulation results show that in the high recycling regime, the effect of the radial ExB drift on plasma density tends to be stronger than that of the poloidal ExB drift. In the sheath-limited regime, the effects of the radial ExB drift and poloidal ExB drift on plasma density are almost equally important. Considering the influence on the electron temperature, the poloidal ExB drift tends to be more important than the radial ExB drift in both the high recycling regime and sheath-limited regime. For the normal B φ , the poloidal ExB drift tends to raise the pressure at the low field side while the radial ExB drift favours the high field side. The simulation results also show that the ExB drift influences the asymmetries on the parameter distributions at the high field side and low field side, and the distributions are much more symmetric with the field reversal

  18. Radiation Belt Transport Driven by Solar Wind Dynamic Pressure Fluctuations

    Science.gov (United States)

    Kress, B. T.; Hudson, M. K.; Ukhorskiy, A. Y.; Mueller, H.

    2012-12-01

    The creation of the Earth's outer zone radiation belts is attributed to earthward transport and adiabatic acceleration of electrons by drift-resonant interactions with electromagnetic fluctuations in the magnetosphere. Three types of radial transport driven by solar wind dynamic pressure fluctuations that have been identified are: (1) radial diffusion [Falthammer, 1965], (2) significant changes in the phase space density radial profile due to a single or few ULF drift-resonant interactions [Ukhorskiy et al., 2006; Degeling et al., 2008], and (3) shock associated injections of radiation belt electrons occurring in less than a drift period [Li et al., 1993]. A progress report will be given on work to fully characterize different forms of radial transport and their effect on the Earth's radiation belts. The work is being carried out by computing test-particle trajectories in electric and magnetic fields from a simple analytic ULF field model and from global MHD simulations of the magnetosphere. Degeling, A. W., L. G. Ozeke, R. Rankin, I. R. Mann, and K. Kabin (2008), Drift resonant generation of peaked relativistic electron distributions by Pc 5 ULF waves, textit{J. Geophys. Res., 113}, A02208, doi:10.1029/2007JA012411. Fälthammar, C.-G. (1965), Effects of Time-Dependent Electric Fields on Geomagnetically Trapped Radiation, J. Geophys. Res., 70(11), 2503-2516, doi:10.1029/JZ070i011p02503. Li, X., I. Roth, M. Temerin, J. R. Wygant, M. K. Hudson, and J. B. Blake (1993), Simulation of the prompt energization and transport of radiation belt particles during the March 24, 1991 SSC, textit{Geophys. Res. Lett., 20}(22), 2423-2426, doi:10.1029/93GL02701. Ukhorskiy, A. Y., B. J. Anderson, K. Takahashi, and N. A. Tsyganenko (2006), Impact of ULF oscillations in solar wind dynamic pressure on the outer radiation belt electrons, textit{Geophys. Res. Lett., 33}(6), L06111, doi:10.1029/2005GL024380.

  19. Manufacturing of Precision Forgings by Radial Forging

    International Nuclear Information System (INIS)

    Wallner, S.; Harrer, O.; Buchmayr, B.; Hofer, F.

    2011-01-01

    Radial forging is a multi purpose incremental forging process using four tools on the same plane. It is widely used for the forming of tool steels, super alloys as well as titanium- and refractory metals. The range of application goes from reducing the diameters of shafts, tubes, stepped shafts and axels, as well as for creating internal profiles for tubes in Near-Net-Shape and Net-Shape quality. Based on actual development of a weight optimized transmission input shaft, the specific features of radial forging technology is demonstrated. Also a Finite Element Model for the simulation of the process is shown which leads to reduced pre-processing effort and reduced computing time compared to other published simulation methods for radial forging. The finite element model can be applied to quantify the effects of different forging strategies.

  20. Toward a Mechanistic Source Term in Advanced Reactors: Characterization of Radionuclide Transport and Retention in a Sodium Cooled Fast Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Brunett, Acacia J.; Bucknor, Matthew; Grabaskas, David

    2016-04-17

    A vital component of the U.S. reactor licensing process is an integrated safety analysis in which a source term representing the release of radionuclides during normal operation and accident sequences is analyzed. Historically, source term analyses have utilized bounding, deterministic assumptions regarding radionuclide release. However, advancements in technical capabilities and the knowledge state have enabled the development of more realistic and best-estimate retention and release models such that a mechanistic source term assessment can be expected to be a required component of future licensing of advanced reactors. Recently, as part of a Regulatory Technology Development Plan effort for sodium cooled fast reactors (SFRs), Argonne National Laboratory has investigated the current state of knowledge of potential source terms in an SFR via an extensive review of previous domestic experiments, accidents, and operation. As part of this work, the significant sources and transport processes of radionuclides in an SFR have been identified and characterized. This effort examines all stages of release and source term evolution, beginning with release from the fuel pin and ending with retention in containment. Radionuclide sources considered in this effort include releases originating both in-vessel (e.g. in-core fuel, primary sodium, cover gas cleanup system, etc.) and ex-vessel (e.g. spent fuel storage, handling, and movement). Releases resulting from a primary sodium fire are also considered as a potential source. For each release group, dominant transport phenomena are identified and qualitatively discussed. The key product of this effort was the development of concise, inclusive diagrams that illustrate the release and retention mechanisms at a high level, where unique schematics have been developed for in-vessel, ex-vessel and sodium fire releases. This review effort has also found that despite the substantial range of phenomena affecting radionuclide release, the

  1. Detailed characterization and preliminary adsorption model for materials for an intermediate-scale reactive-transport experiment

    International Nuclear Information System (INIS)

    Ward, D.B.; Bryan, C.R.

    1994-01-01

    An experiment involving migration of fluid and tracers (Li, Br, Ni) through a 6-m-high x 3-m-dia caisson Wedron 510 sand, is being carried out for Yucca Mountain Site Characterization Project. Sand's surface chemistry of the sand was studied and a preliminary surface-complexation model of Ni adsorption formulated for transport calculations. XPS and leaching suggest that surface of the quartz sand is partially covered by thin layers of Fe-oxyhydroxide and Ca-Mg carbonate and by flakes of kaolinite. Ni adsorption by the sand is strongly pH-dependent, showing no adsorption at pH 5 and near-total adsorption at pH 7. Location of adsorption edge is independent of ionic strength and dissolved Ni concentration; it is shifted to slightly lower pH with higher pCO2 and to slightly higher pH by competition with Li. Diminished adsorption at alkiline pH with higher pCO2 implies formation of dissolved Ni-carbonato complexes. Ni adsorption edges for goethite and quartz, two components of the sand were also measured. Ni adsorption on pure quartz is only moderately pH-dependent and differs in shape and location from that of the sand, whereas Ni adsorption by goethite is strongly pH-dependent. A triple-layer surface-complexation model developed for goethite provides a good fit to the Ni-adsorption curve of the sand. Based on this model, the apparent surface area of the Fe-oxyhydroxide coating is estimated to be 560 m 2 /g, compatible with its occurrence as amorphous Fe-oxyhydroxide. Potentiometric titrations on sand also differ from pure quartz and suggest that effective surface area of sand may be much greater than that measured by N 2 -BET gas adsorption. Attempts to model the adsorption of bulk sand in terms of properties of pure end member components suggest that much of the sand surface is inert. Although the exact Ni adsorption mechanisms remain ambiguous, this preliminary adsorption model provides an initial set of parameters that can be used in transport calculations

  2. The Matlab Radial Basis Function Toolbox

    Directory of Open Access Journals (Sweden)

    Scott A. Sarra

    2017-03-01

    Full Text Available Radial Basis Function (RBF methods are important tools for scattered data interpolation and for the solution of Partial Differential Equations in complexly shaped domains. The most straight forward approach used to evaluate the methods involves solving a linear system which is typically poorly conditioned. The Matlab Radial Basis Function toolbox features a regularization method for the ill-conditioned system, extended precision floating point arithmetic, and symmetry exploitation for the purpose of reducing flop counts of the associated numerical linear algebra algorithms.

  3. Radial velocity observations of VB10

    Science.gov (United States)

    Deshpande, R.; Martin, E.; Zapatero Osorio, M. R.; Del Burgo, C.; Rodler, F.; Montgomery, M. M.

    2011-07-01

    VB 10 is the smallest star known to harbor a planet according to the recent astrometric study of Pravdo & Shaklan [1]. Here we present near-infrared (J-band) radial velocity of VB 10 performed from high resolution (R~20,000) spectroscopy (NIRSPEC/KECK II). Our results [2] suggest radial velocity variability with amplitude of ~1 km/s, a result that is consistent with the presence of a massive planet companion around VB10 as found via long-term astrometric monitoring of the star by Pravdo & Shaklan. Employing an entirely different technique we verify the results of Pravdo & Shaklan.

  4. Plasma Signatures of Radial Field Power Dropouts

    International Nuclear Information System (INIS)

    Lucek, E.A.; Horbury, T.S.; Balogh, A.; McComas, D.J.

    1998-01-01

    A class of small scale structures, with a near-radial magnetic field and a drop in magnetic field fluctuation power, have recently been identified in the polar solar wind. An earlier study of 24 events, each lasting for 6 hours or more, identified no clear plasma signature. In an extension of that work, radial intervals lasting for 4 hours or more (89 in total), have been used to search for a statistically significant plasma signature. It was found that, despite considerable variations between intervals, there was a small but significant drop, on average, in plasma temperature, density and β during these events

  5. Reble, a radially converging electron beam accelerator

    International Nuclear Information System (INIS)

    Ramirez, J.J.; Prestwich, K.R.

    1976-01-01

    The Reble accelerator at Sandia Laboratories is described. This accelerator was developed to provide an experimental source for studying the relevant diode physics, beam propagation, beam energy deposition in a gas using a radially converging e-beam. The nominal parameters for Reble are 1 MV, 200 kA, 20 ns e-beam pulse. The anode and cathode are concentric cylinders with the anode as the inner cylinder. The radial beam can be propagated through the thin foil anode into the laser gas volume. The design and performance of the various components of the accelerator are presented

  6. Strong drifts effects on neoclassical transport

    International Nuclear Information System (INIS)

    Tessarotto, M.; Gregoratto, D.; White, R.B.

    1996-01-01

    It is well known that strong drifts play an important role in plasma equilibrium, stability and confinement A significant example concerns, in particular for tokamak plasmas, the case of strong toroidal differential rotation produced by E x B drift which is currently regarded as potentially important for its influence in equilibrium, stability and transport. In fact, theoretically, it has been found that shear flow can substantially affect the stability of microinstabilities as well modify substantially transport. Recent experimental observations of enhanced confinement and transport regimes in Tokamaks, show, however, evidence of the existence of strong drifts in the plasma core. These are produced not only by the radial electric field [which gives rise to the E x B drift], but also by density [N s ], temperature [T s ] and mass flow [V = ωRe var-phi , with e var-phi the toroidal unit vector, R the distance for the symmetry axis of the torus and ω being the toroidal angular rotation velocity] profiles which are suitably steep. This implies that, in a significant part of the plasma core, the relevant scale lengths of the gradients [of N s , T s , ω], i.e., respectively L N , L T and L ω can be as large as the radial scale length characterizing the banana orbits, L b . Interestingly enough, the transport estimates obtained appear close or even lower than the predictions based on the simplest neoclassical model. However, as is well known, the latter applies, in a strict sense only in the case of weak drifts and also ignoring even the contribution of shear flow related to strong E x B drift. Thus a fundamental problem appears the extension of neoclassical transport theory to include the effect of strong drifts in Tokamak confinement systems. The goal of this investigation is to develop a general formulation of neoclassical transport embodying such important feature

  7. Are Titan's radial Labyrinth terrains surface expressions of large laccoliths?

    Science.gov (United States)

    Schurmeier, L.; Dombard, A. J.; Malaska, M.; Radebaugh, J.

    2017-12-01

    The Labyrinth terrain unit may be the one of the best examples of the surface expression of Titan's complicated history. They are characterized as highly eroded, dissected, and elevated plateaus and remnant ridges, with an assumed composition that is likely organic-rich based on radar emissivity. How these features accumulated organic-rich sediments and formed topographic highs by either locally uplifting or surviving pervasive regional deflation or erosion is an important question for understanding the history of Titan. There are several subsets of Labyrinth terrains, presumably with differing evolutionary histories and formation processes. We aim to explain the formation of a subset of Labyrinth terrain units informally referred to as "radial Labyrinth terrains." They are elevated and appear dome-like, circular in planform, have a strong radial dissection pattern, are bordered by Undifferentiated Plains units, and are found in the mid-latitudes. Based on their shape, clustering, and dimensions, we suggest that they may be the surface expression of large subsurface laccoliths. A recent study by Manga and Michaut (Icarus, 2017) explained Europa's lenticulae (pits, domes, spots) with the formation of saucer-shaped sills that form laccoliths around the brittle-ductile transition depth within the ice shell (1-5 km). Here, we apply the same scaling relationships and find that the larger size of radial labyrinth terrains with Titan's higher gravity implies deeper intrusion depths of around 20-40 km. This intrusion depth matches the expected brittle-ductile transition on Titan based on our finite element simulations and yield strength envelope analyses. We hypothesize that Titan's radial labyrinth terrains formed as cryovolcanic (water) intrusions that rose to the brittle-ductile transition within the ice shell where they spread horizontally, and uplifted the overlying ice. The organic-rich sedimentary cover also uplifted, becoming more susceptible to pluvial and fluvial

  8. On the relation between neoclassical transport and turbulent transport

    International Nuclear Information System (INIS)

    Shaing, K.C.

    2005-01-01

    It is demonstrated through the flux-force relationship in the neoclassical theory that when neoclassical transport fluxes are improved, the damping rate of the radial electric field of the zonal flow is reduced. This, in turn, leads to improved turbulent transport fluxes. Thus, two seemingly unrelated transport fluxes are intimately connected through the momentum equation, and the neoclassical flux-force relation. This also implies a method to improve turbulent transport by improving neoclassical fluxes

  9. A novel radioligand for glycine transporter 1: characterization and use in autoradiographic and in vivo brain occupancy studies

    Energy Technology Data Exchange (ETDEWEB)

    Zeng Zhizhen [Imaging, Merck Research Laboratories, West Point, PA 19486 (United States)], E-mail: zhizhen_zeng@merck.com; O' Brien, Julie A. [Sleep and Psychiatric Disorders, Merck Research Laboratories, West Point, PA 19486 (United States); Lemaire, Wei [Medicinal Chemistry, Merck Research Laboratories, West Point, PA 19486 (United States); O' Malley, Stacey S.; Miller, Patricia J. [Imaging, Merck Research Laboratories, West Point, PA 19486 (United States); Zhao Zhijian [Medicinal Chemistry, Merck Research Laboratories, West Point, PA 19486 (United States); Wallace, Michael A. [Drug Metabolism, Merck Research Laboratories, Rahway, NJ 07065 (United States); Raab, Conrad [Drug Metabolism, Merck Research Laboratories, West Point, PA 19486 (United States); Lindsley, Craig W. [Medicinal Chemistry, Merck Research Laboratories, West Point, PA 19486 (United States); Departments of Pharmacology and Chemistry, Vanderbilt University, Nashville, TN 37232 (United States); Sur, Cyrille; Williams, David L. [Imaging, Merck Research Laboratories, West Point, PA 19486 (United States)

    2008-04-15

    Introduction: In an effort to develop agents to test the NMDA hypofunction hypothesis of schizophrenia, benchmark compounds from a program to discover potent, selective, competitive glycine transporter 1 (GlyT1) inhibitors were radiolabeled in order to further study the detailed pharmacology of these inhibitors and the distribution of GlyT1 in brain. We here report the in vitro characterization of [{sup 35}S](S)-2-amino-4-chloro-N-(1-(4-phenyl-1-(propylsulfonyl)piperidin-4-yl) ethyl)benzamide ([{sup 35}S]ACPPB), a radiotracer developed from a potent and selective non-sarcosine-derived GlyT1 inhibitor, its use in autoradiographic studies to localize (S)-2-amino-6-chloro-N-(1-(4-phenyl-1-(propylsulfonyl)piperidin-4-yl)ethyl) benzamide (ACPPB) binding sites in rat and rhesus brain and for in vivo occupancy assays of competitive GlyT1 inhibitors. Methods: Functional potencies of unlabeled compounds were characterized by [{sup 14}C]glycine uptake into JAR (human placental choriocarcinoma) cells and synaptosomes. Radioligand binding studies were performed with tissue homogenates. Autoradiographic studies were performed on tissue slices. Results: ACPPB is a potent (K{sub d}=1.9 nM), selective, GlyT1 inhibitor that, when radiolabeled with [{sup 35}S], is a well-behaved radioligand with low nondisplaceable binding. Autoradiographic studies of rat and rhesus brain slices with this ligand showed that specific binding sites were plentiful and nonhomogeneously distributed, with high levels of binding in the brainstem, cerebellar white matter, thalamus, cortical white matter and spinal cord gray matter. In vivo studies demonstrate displaceable binding of [{sup 35}S]ACPPB in rat brain tissues following iv administration of this radioligand. Conclusions: This is the first report of detailed anatomical localization of GlyT1 using direct radioligand binding, and the first demonstration that an in vivo occupancy assay is feasible, suggesting that it may also be feasible to develop

  10. A novel radioligand for glycine transporter 1: characterization and use in autoradiographic and in vivo brain occupancy studies

    International Nuclear Information System (INIS)

    Zeng Zhizhen; O'Brien, Julie A.; Lemaire, Wei; O'Malley, Stacey S.; Miller, Patricia J.; Zhao Zhijian; Wallace, Michael A.; Raab, Conrad; Lindsley, Craig W.; Sur, Cyrille; Williams, David L.

    2008-01-01

    Introduction: In an effort to develop agents to test the NMDA hypofunction hypothesis of schizophrenia, benchmark compounds from a program to discover potent, selective, competitive glycine transporter 1 (GlyT1) inhibitors were radiolabeled in order to further study the detailed pharmacology of these inhibitors and the distribution of GlyT1 in brain. We here report the in vitro characterization of [ 35 S](S)-2-amino-4-chloro-N-(1-(4-phenyl-1-(propylsulfonyl)piperidin-4-yl) ethyl)benzamide ([ 35 S]ACPPB), a radiotracer developed from a potent and selective non-sarcosine-derived GlyT1 inhibitor, its use in autoradiographic studies to localize (S)-2-amino-6-chloro-N-(1-(4-phenyl-1-(propylsulfonyl)piperidin-4-yl)ethyl) benzamide (ACPPB) binding sites in rat and rhesus brain and for in vivo occupancy assays of competitive GlyT1 inhibitors. Methods: Functional potencies of unlabeled compounds were characterized by [ 14 C]glycine uptake into JAR (human placental choriocarcinoma) cells and synaptosomes. Radioligand binding studies were performed with tissue homogenates. Autoradiographic studies were performed on tissue slices. Results: ACPPB is a potent (K d =1.9 nM), selective, GlyT1 inhibitor that, when radiolabeled with [ 35 S], is a well-behaved radioligand with low nondisplaceable binding. Autoradiographic studies of rat and rhesus brain slices with this ligand showed that specific binding sites were plentiful and nonhomogeneously distributed, with high levels of binding in the brainstem, cerebellar white matter, thalamus, cortical white matter and spinal cord gray matter. In vivo studies demonstrate displaceable binding of [ 35 S]ACPPB in rat brain tissues following iv administration of this radioligand. Conclusions: This is the first report of detailed anatomical localization of GlyT1 using direct radioligand binding, and the first demonstration that an in vivo occupancy assay is feasible, suggesting that it may also be feasible to develop positron emission

  11. Sausage instabilities stabilized by radial motion in Z-discharged plasma channel for beam propagation in LIB-fusion

    International Nuclear Information System (INIS)

    Murakami, Hiroyuki; Kawata, Shigeo; Niu, Keishiro.

    1983-01-01

    The stability of current-carrying plasma channels, which have been proposed for transporting intense ion beams from the diodes to the target in LIB-fusion devices, is discussed. The growth rate of the most dangerous surface mode, that is, the axisymmetric sausage instabilities, are examined for plasma channels with or without radial fluid motion. The growth rate of the channel with radial fluid motion is shown to be far smaller than that of the channel with no fluid motion. It is concluded that a stable plasma channel can be formed by radial fluid motion. (author)

  12. Shelter Index and a simple wind speed parameter to characterize vegetation control of sand transport threshold and Flu

    Science.gov (United States)

    Gillies, J. A.; Nield, J. M.; Nickling, W. G.; Furtak-Cole, E.

    2014-12-01

    Wind erosion and dust emissions occur in many dryland environments from a range of surfaces with different types and amounts of vegetation. Understanding how vegetation modulates these processes remains a research challenge. Here we present results from a study that examines the relationship between an index of shelter (SI=distance from a point to the nearest upwind vegetation/vegetation height) and particle threshold expressed as the ratio of wind speed measured at 0.45 times the mean plant height divided by the wind speed at 17 m when saltation commences, and saltation flux. The results are used to evaluate SI as a parameter to characterize the influence of vegetation on local winds and sediment transport conditions. Wind speed, wind direction, saltation activity and point saltation flux were measured at 35 locations in defined test areas (~13,000 m2) in two vegetation communities: mature streets of mesquite covered nebkhas and incipient nebkhas dominated by low mesquite plants. Measurement positions represent the most open areas, and hence those places most susceptible to wind erosion among the vegetation elements. Shelter index was calculated for each measurement position for each 10° wind direction bin using digital elevation models for each site acquired using terrestrial laser scanning. SI can show the susceptibility to wind erosion at different time scales, i.e., event, seasonal, or annual, but in a supply-limited system it can fail to define actual flux amounts due to a lack of knowledge of the distribution of sediment across the surface of interest with respect to the patterns of SI.

  13. Pharmacological Characterization of [3H]ATPCA as a Substrate for Studying the Functional Role of the Betaine/GABA Transporter 1 and the Creatine Transporter

    DEFF Research Database (Denmark)

    Al-Khawaja, Anas; Haugaard, Anne S; Marek, Ales

    2018-01-01

    for BGT1 among the four GATs (Km and Vmax values of 21 µM and 3.6 nmol ATPCA/(min×mg protein), respectively), but was also found to be a substrate for the creatine transporter (CreaT). In experiments with mouse cortical cell cultures, we observed a Na(+)H-dependent [(3)HH]ATPCA uptake in neurons...

  14. Revealing the radial modes in vortex beams

    CSIR Research Space (South Africa)

    Sephton, Bereneice C

    2016-10-01

    Full Text Available Light beams that carry orbital angular momentum are often approximated by modulating an initial beam, usually Gaussian, with an azimuthal phase variation to create a vortex beam. Such vortex beams are well defined azimuthally, but the radial profile...

  15. Measurement of Wear in Radial Journal Bearings

    NARCIS (Netherlands)

    Ligterink, D.J.; Ligterink, D.J.; de Gee, A.W.J.

    1996-01-01

    this article, the measurement of wear in radial journal bearings is discussed, where a distinction is made between stationary and non-stationary contact conditions. Starting with Holm/Archard's wear law, equations are derived for the calculation of the specific wear rate k of the bearing material as

  16. Radial interchange motions of plasma filaments

    DEFF Research Database (Denmark)

    Garcia, O.E.; Bian, N.H.; Fundamenski, W.

    2006-01-01

    on a biperiodic domain perpendicular to the magnetic field. It is demonstrated that a blob-like plasma structure develops dipolar vorticity and electrostatic potential fields, resulting in rapid radial acceleration and formation of a steep front and a trailing wake. While the dynamical evolution strongly depends...

  17. Spectral problem for the radial Schroedinger equation

    International Nuclear Information System (INIS)

    Vshivtsev, A.S.; Tatarintsev, A.V.; Prokopov, A.V.; Sorokin, V. N.

    1998-01-01

    For the first time, a procedure for determining spectra on the basis of generalized integral transformations is implemented for a wide class of radial Schroedinger equations. It is shown that this procedure works well for known types of potentials. Concurrently, this method makes it possible to obtain new analytic results for the Cornell potential. This may prove important for hadron physics

  18. Computing modal dispersion characteristics of radially Asymmetric ...

    African Journals Online (AJOL)

    We developed a matrix theory that applies to with non-circular/circular but concentric layers fibers. And we compute the dispersion characteristics of radially unconventional fiber, known as Asymmetric Bragg fiber. An attempt has been made to determine how the modal characteristics change as circular Bragg fiber is ...

  19. Busted Butte Unsaturated Zone Transport Test: Fiscal Year 1998 Status Report Yucca Mountain Site Characterization Program Deliverable SPU85M4

    International Nuclear Information System (INIS)

    Bussod, G.Y.; Turin, H.J.; Lowry, W.E.

    1999-01-01

    This report describes the status of the Busted Butte Unsaturated Zone Transport Test (UZTT) and documents the progress of construction activities and site and laboratory characterization activities undertaken in fiscal year 1998. Also presented are predictive flow-and-transport simulations for Test Phases 1 and 2 of testing and the preliminary results and status of these test phases. Future anticipated results obtained from unsaturated-zone (UZ) transport testing in the Calico Hills Formation at Busted Butte are also discussed in view of their importance to performance assessment (PA) needs to build confidence in and reduce the uncertainty of site-scale flow-and-transport models and their abstractions for performance for license application. The principal objectives of the test are to address uncertainties associated with flow and transport in the UZ site-process models for Yucca Mountain, as identified by the PA working group in February 1997. These include but are not restricted to: (1) The effect of heterogeneities on flow and transport in unsaturated and partially saturated conditions in the Calico Hills Formation. In particular, the test aims to address issues relevant to fracture-matrix interactions and permeability contrast boundaries; (2) The migration behavior of colloids in fractured and unfractured Calico Hills rocks; (3) The validation through field testing of laboratory sorption experiments in unsaturated Calico Hills rocks; (4) The evaluation of the 3-D site-scale flow-and-transport process model (i.e., equivalent-continuum/dual-permeability/discrete-fracture-fault representations of flow and transport) used in the PA abstractions for license application; and (5) The effect of scaling from lab scale to field scale and site scale

  20. Variations in the usage and composition of a radial cocktail during radial access coronary angiography procedures.

    LENUS (Irish Health Repository)

    Pate, G

    2011-10-01

    A survey was conducted of medication administered during radial artery cannulation for coronary angiography in 2009 in Ireland; responses were obtained for 15 of 20 centres, in 5 of which no radial access procedures were undertaken. All 10 (100%) centres which provided data used heparin and one or more anti-spasmodics; verapamil in 9 (90%), nitrate in 1 (10%), both in 2 (20%). There were significant variations in the doses used. Further work needs to be done to determine the optimum cocktail to prevent radial artery injury following coronary angiography.

  1. Radial wave crystals: radially periodic structures from anisotropic metamaterials for engineering acoustic or electromagnetic waves.

    Science.gov (United States)

    Torrent, Daniel; Sánchez-Dehesa, José

    2009-08-07

    We demonstrate that metamaterials with anisotropic properties can be used to develop a new class of periodic structures that has been named radial wave crystals. They can be sonic or photonic, and wave propagation along the radial directions is obtained through Bloch states like in usual sonic or photonic crystals. The band structure of the proposed structures can be tailored in a large amount to get exciting novel wave phenomena. For example, it is shown that acoustical cavities based on radial sonic crystals can be employed as passive devices for beam forming or dynamically orientated antennas for sound localization.

  2. Effects of the radial electric field in a quasisymmetric stellarator

    International Nuclear Information System (INIS)

    Landreman, Matt; Catto, Peter J

    2011-01-01

    Recent calculations have shown that a radial electric field can significantly alter the neoclassical ion heat flux, ion flow, bootstrap current and residual zonal flow in a tokamak, even when the E x B drift is much smaller than the ion thermal speed. Here we show the novel analytical methods used in these calculations can be adapted to a quasisymmetric stellarator. The methods are based on using the conserved helical momentum ψ * instead of the poloidal or toroidal flux as a radial coordinate in the kinetic equation. The banana-regime calculations also employ a model collision operator that keeps only the velocity-space derivatives normal to the trapped-passing boundary, even as this boundary is shifted and deformed by the E x B drift. We prove the isomorphism between quasisymmetric stellarators and tokamaks extends to the finite-E x B generalizations of both banana-regime and plateau-regime neoclassical theory and the residual zonal flow. The plateau-regime results may be relevant to the HSX stellarator, and both the plateau- and banana-regime results can be used to validate stellarator transport codes.

  3. Characterization of injection instabilities in electrohydrodynamics by numerical modelling: comparison of particle in cell and flux corrected transport methods for electroconvection between two plates

    International Nuclear Information System (INIS)

    Vazquez, P A; Georghiou, G E; Castellanos, A

    2006-01-01

    Numerical simulations are carried out for the characterization of injection instabilities in electrohydrodynamics and, in particular, the development of electroconvection between two parallel plates. The particle-in-cell and the finite element-flux corrected transport methods are used for the simulation of the test case, as they have proved very powerful and accurate in the solution of complex transport problems. Results are presented for unipolar injection (both strong and weak injections) between two plane electrodes immersed in a dielectric liquid, and the good agreement obtained by the two methods demonstrates not only their theoretical validity but also their practical ability to deal with transport problems in the presence of steep gradients. Some differences appear mainly in the prediction of small oscillations of the velocity and consequently of the electric current. These differences are highlighted and an explanation of their source is given

  4. Characterization of atmospheric aerosols in Ile-de-France: Local contribution and Long range transport; Caracteisation des aeosols atmospheiques en Ile-de-France: contribution locale et transport a longues distances

    Energy Technology Data Exchange (ETDEWEB)

    Cuesta, J.E

    2006-06-15

    Atmospheric aerosols interact directly in a great number of processes related to climate change and public health, modifying the energy budget and partly determining the quality of the air we breathe. In my PhD, I chose to study the perturbation, if not the aggravation, of the living conditions in Ile-de-France associated to aerosol transport episodes in the free troposphere. This situation is rather frequent and still badly known. To achieve my study, I developed the observation platform 'TReSS' Transportable Remote Sensing Station, whose instruments were developed at the Laboratoire de Meteorology Dynamique by the LiMAG team. 'TReSS' consists of a new high-performance 'Mini-Lidar' and of two standard radiometers: a sun photometer and a thermal infrared radiometer. The principle of my experimental approach is the synergy of the vertical Lidar profiles and the particle size distributions over the column, obtained by the 'Almucantar' inversion of sun photometer data. The new 'Lidar and Almucantar' method characterizes the vertical distribution by layer and the optical micro-physical properties of the local and transported aerosols. Firstly, I undertook the characterization of the Paris aerosol, mainly of anthropogenic origin. Their radiative properties were analyzed in the daily and yearly scales. Then, I conducted a statistical multi-year study of transport episodes and a two-week study case, representative of a succession of desert dust intrusion in Ile-de-France. My PhD work concludes by a study on the impact of biomass burning aerosols during the heat wave on August 2003. I study the impact of the transported aerosols into the local radiative budget and the possible consequences on the diurnal cycle of the atmospheric boundary layer. (author)

  5. Current density fluctuations and ambipolarity of transport

    International Nuclear Information System (INIS)

    Shen, W.; Dexter, R.N.; Prager, S.C.

    1991-10-01

    The fluctuation in the plasma current density is measured in the MIST reversed field pinch experiment. Such fluctuations, and the measured radial profile of the k spectrum of magnetic fluctuations, supports the view and that low frequency fluctuations (f r >) demonstrates that radial particle transport from particle motion parallel to a fluctuating magnetic field is ambipolar over the full frequency range

  6. Plasma confinement in self-consistent, one-dimensional transport equilibria in the collisionless-ion regime of EBT operation

    International Nuclear Information System (INIS)

    Chang, C.S.; Miller, R.L.

    1983-01-01

    It has long been recognized that if an EBT-confined plasma could be maintained in the collisionless-ion regime, characterized by positive ambipolar potential and positive radial electric field, the particle loss rates could be reduced by a large factor. The extent to which the loss rate of energy could be reduced has not been as clearly determined, and has been investigated recently using a one-dimensional, time-dependent transport code developed for this purpose. We find that the energy confinement can be improved by roughly an order of magnitude by maintaining a positive radial electric field that increases monotonically with radius, giving a large ExB drift near the outer edge of the core plasma. The radial profiles of heat deposition required to sustain these equilibria will be presented, and scenarios for obtaining dynamical access to the equilibria will be discussed

  7. Electron internal transport barrier in the core of TJ-II ECH plasmas

    Energy Technology Data Exchange (ETDEWEB)

    Estrada, T.; Hidalgo, C. [Laboratorio Nacional de Fusion por Confinamiento Magnetico. Asociacion EURATOM CIEMAT, Madrid (Spain); Dreval, N. [and others

    2003-07-01

    The influence of the magnetic topology on the formation of electron internal transport barriers (e-ITB) has been experimentally studied in the stellarator TJ-II. The formation of e-ITBs in electron cyclotron heated plasmas can be triggered by positioning a low order rational surface close to the plasma core region, while in configurations without any low order rational there are no indications of barrier formation within the available heating power. The e-ITB formation is characterized by an increase in the core electron temperature and plasma potential. Positive radial electric field increases in a factor of three in the plasma central region when the e-ITB forms. The results demonstrate that low order rational surfaces modify radial electric fields and electron heat transport. (orig.)

  8. The yeast plasma membrane ATP binding cassette (ABC) transporter Aus1: purification, characterization, and the effect of lipids on its activity.

    Science.gov (United States)

    Marek, Magdalena; Milles, Sigrid; Schreiber, Gabriele; Daleke, David L; Dittmar, Gunnar; Herrmann, Andreas; Müller, Peter; Pomorski, Thomas Günther

    2011-06-17

    The ATP binding cassette (ABC) transporter Aus1 is expressed under anaerobic growth conditions at the plasma membrane of the yeast Saccharomyces cerevisiae and is required for sterol uptake. These observations suggest that Aus1 promotes the translocation of sterols across membranes, but the precise transport mechanism has yet to be identified. In this study, an extraction and purification procedure was developed to characterize the Aus1 transporter. The detergent-solubilized protein was able to bind and hydrolyze ATP. Mutagenesis of the conserved lysine to methionine in the Walker A motif abolished ATP hydrolysis. Likewise, ATP hydrolysis was inhibited by classical inhibitors of ABC transporters. Upon reconstitution into proteoliposomes, the ATPase activity of Aus1 was specifically stimulated by phosphatidylserine (PS) in a stereoselective manner. We also found that Aus1-dependent sterol uptake, but not Aus1 expression and trafficking to the plasma membrane, was affected by changes in cellular PS levels. These results suggest a direct interaction between Aus1 and PS that is critical for the activity of the transporter.

  9. Characterization of contaminant transport by gravity, capilliarity and barometric pumping in heterogeneous vadose regimes. 1997 annual progress report

    International Nuclear Information System (INIS)

    Carrigan, C.R.

    1997-01-01

    'Vadose regimes can be the sites of complex interactions between the atmosphere and groundwater. When a volatile contaminant exists as free product or in dissolved form in the vadose environment, upward transport can occur with the contaminant ultimately being vented as a vapor into the atmosphere. This transport happens naturally and can be enhanced by anisotropy resulting from heterogenities in the vadose regime. Several stages in the transport process are involved in going from a volatile, liquid state contaminant to a contaminant vapor vented at the surface. In a three-year effort, called the Vadose Zone Transport Study, the authors are investigating, with the aid of existing data, new field studies involving dissolved tracer gases and 3-D diagnostic computer simulations that provide a framework to interpret the observations, the detailed nature of each of these stages of transport in several different kinds of vadose regimes. They are emphasizing the impact of features specific to a site, that is, the local geology and hydrology, on each stage of the transport process. In particular they want to better understand how the time scales for (1) partitioning contaminants from the liquid to the vapor states and then (2) transporting the vapor out of the vadose regime are dependent on the specific character of a site. Such time-scale information will be important for evaluating the potential of contaminant sources as well as remediation strategies including natural remediation approaches.'

  10. 3-D Characterization of Detrital Zircon Grains and its Implications for Fluvial Transport, Mixing, and Preservation Bias

    Science.gov (United States)

    Markwitz, V.; Kirkland, C. L.; Mehnert, A.; Gessner, K.; Shaw, J.

    2017-12-01

    Detrital zircon studies can suffer from selective loss of provenance information due to U-Pb age discordance, metamictization, metamorphic overprinting and fluviatile transport processes. The relationship between isotopic composition and zircon grain shape, and how grain shape is modified during transport, is largely unknown. We combine X-ray tomography with U-Pb geochronology to quantify how fluvial transport affects 3-D zircon shape, detrital age signature, and grain density along the Murchison River, whose catchment comprises Eoarchean to Early Paleozoic source rocks in Western Australia. We acquired tomographic volumes and isotopic data from 373 detrital zircons to document changes in size, shape and density in transport direction, and explore how grain shape, age spectra and the proportion of discordant material vary along the channel. Results show that shape characteristics are sensitive to transport distance, stream gradient, proximity to source material, and whether the source consists of primary or recycled zircons. With increasing transport distance, grain lengths decrease more than their widths. Furthermore, the loss of metamict grains occurs at a near constant rate, resulting in a linear increase of mean calculated zircon density by ca. 0.03 g/cm3 per 100 km transport distance. 3-D grain shape is therefore strongly linked to detrital age signature, and mean grain density is a function of the absolute transport distance. 3-D shape characteristics provide valuable information on detrital zircon populations, including the interaction between source materials with fluvial transport processes, which significantly affects preservation bias and, by inference, the representativeness of the sampled data.

  11. Lessons in the Design and Characterization Testing of the Semi-Span Super-Sonic Transport (S4T) Wind-Tunnel Model

    Science.gov (United States)

    2012-01-01

    This paper focuses on some of the more challenging design processes and characterization tests of the Semi-Span Super-Sonic Transport (S4T)-Active Controls Testbed (ACT). The model was successfully tested in four entries in the National Aeronautics and Space Administration Langley Transonic Dynamics Tunnel to satisfy the goals and objectives of the Fundamental Aeronautics Program Supersonic Project Aero-Propulso-Servo-Elastic effort. Due to the complexity of the S4T-ACT, only a small sample of the technical challenges for designing and characterizing the model will be presented. Specifically, the challenges encountered in designing the model include scaling the Technology Concept Airplane to model scale, designing the model fuselage, aileron actuator, and engine pylons. Characterization tests included full model ground vibration tests, wing stiffness measurements, geometry measurements, proof load testing, and measurement of fuselage static and dynamic properties.

  12. WWER radial reflector modeling by diffusion codes

    International Nuclear Information System (INIS)

    Petkov, P. T.; Mittag, S.

    2005-01-01

    The two commonly used approaches to describe the WWER radial reflectors in diffusion codes, by albedo on the core-reflector boundary and by a ring of diffusive assembly size nodes, are discussed. The advantages and disadvantages of the first approach are presented first, then the Koebke's equivalence theory is outlined and its implementation for the WWER radial reflectors is discussed. Results for the WWER-1000 reactor are presented. Then the boundary conditions on the outer reflector boundary are discussed. The possibility to divide the library into fuel assembly and reflector parts and to generate each library by a separate code package is discussed. Finally, the homogenization errors for rodded assemblies are presented and discussed (Author)

  13. Linear radial pulsation theory. Lecture 5

    International Nuclear Information System (INIS)

    Cox, A.N.

    1983-01-01

    We describe a method for getting an equilibrium stellar envelope model using as input the total mass, the envelope mass, the surface effective temperature, the total surface luminosity, and the composition of the envelope. Then wih the structure of the envelope model known, we present a method for obtaining the raidal pulsation periods and growth rates for low order modes. The large amplitude pulsations observed for the yellow and red giants and supergiants are always these radial models, but for the stars nearer the main sequence, as for all of our stars and for the white dwarfs, there frequently are nonradial modes occuring also. Application of linear theory radial pulsation theory is made to the giant star sigma Scuti variables, while the linear nonradial theory will be used for the B stars in later lectures

  14. SpicyNodes Radial Map Engine

    Science.gov (United States)

    Douma, M.; Ligierko, G.; Angelov, I.

    2008-10-01

    The need for information has increased exponentially over the past decades. The current systems for constructing, exploring, classifying, organizing, and searching information face the growing challenge of enabling their users to operate efficiently and intuitively in knowledge-heavy environments. This paper presents SpicyNodes, an advanced user interface for difficult interaction contexts. It is based on an underlying structure known as a radial map, which allows users to manipulate and interact in a natural manner with entities called nodes. This technology overcomes certain limitations of existing solutions and solves the problem of browsing complex sets of linked information. SpicyNodes is also an organic system that projects users into a living space, stimulating exploratory behavior and fostering creative thought. Our interactive radial layout is used for educational purposes and has the potential for numerous other applications.

  15. Identification and characterization of potential discharge areas for radionuclide transport by groundwater from a nuclear waste repository in Sweden.

    Science.gov (United States)

    Berglund, Sten; Bosson, Emma; Selroos, Jan-Olof; Sassner, Mona

    2013-05-01

    This paper describes solute transport modeling carried out as a part of an assessment of the long-term radiological safety of a planned deep rock repository for spent nuclear fuel in Forsmark, Sweden. Specifically, it presents transport modeling performed to locate and describe discharge areas for groundwater potentially carrying radionuclides from the repository to the surface where man and the environment could be affected by the contamination. The modeling results show that topography to large extent determines the discharge locations. Present and future lake and wetland objects are central for the radionuclide transport and dose calculations in the safety assessment. Results of detailed transport modeling focusing on the regolith and the upper part of the rock indicate that the identification of discharge areas and objects considered in the safety assessment is robust in the sense that it does not change when a more detailed model representation is used.

  16. Characterization of a novel variant of amino acid transport system asc in erythrocytes from Przewalski's horse (Equus przewalskii).

    Science.gov (United States)

    Fincham, D A; Ellory, J C; Young, J D

    1992-08-01

    In thoroughbred horses, red blood cell amino acid transport activity is Na(+)-independent and controlled by three codominant genetic alleles (h, l, s), coding for high-affinity system asc1 (L-alanine apparent Km for influx at 37 degrees C congruent to 0.35 mM), low-affinity system asc2 (L-alanine Km congruent to 14 mM), and transport deficiency, respectively. The present study investigated amino acid transport mechanisms in red cells from four wild species: Przewalski's horse (Equus przewalskii), Hartmann's zebra (Zebra hartmannae), Grevy's zebra (Zebra grevyi), and onager (Equus hemonius). Red blood cell samples from different Przewalski's horses exhibited uniformly high rates of L-alanine uptake, mediated by a high-affinity asc1-type transport system. Mean apparent Km and Vmax values (+/- SE) for L-alanine influx at 37 degrees C in red cells from 10 individual animals were 0.373 +/- 0.068 mM and 2.27 +/- 0.11 mmol (L cells.h), respectively. As in thoroughbreds, the Przewalski's horse transporter interacted with dibasic as well as neutral amino acids. However, the Przewalski asc1 isoform transported L-lysine with a substantially (6.4-fold) higher apparent affinity than its thoroughbred counterpart (Km for influx 1.4 mM at 37 degrees C) and was also less prone to trans-stimulation effects. The novel high apparent affinity of the Przewalski's horse transporter for L-lysine provides additional key evidence of functional and possible structural similarities between asc and the classical Na(+)-dependent system ASC and between these systems and the Na(+)-independent dibasic amino acid transport system y+. Unlike Przewalski's horse, zebra red cells were polymorphic with respect to L-alanine transport activity, showing high-affinity or low-affinity saturable mechanisms of L-alanine uptake. Onager red cells transported this amino acid with intermediate affinity (apparent Km for influx 3.0 mM at 37 degrees C). Radiation inactivation analysis was used to estimate the target

  17. Final technical report for project titled Quantitative Characterization of Cell Aggregation/Adhesion as Predictor for Distribution and Transport of Microorganisms in Subsurface Environment

    Energy Technology Data Exchange (ETDEWEB)

    Gu, April Z. [Northeastern Univ., Boston, MA (United States); Wan, Kai-tak [Northeastern Univ., Boston, MA (United States)

    2014-09-02

    This project aims to explore and develop enabling methodology and techniques for nano-scale characterization of microbe cell surface contact mechanics, interactions and adhesion quantities that allow for identification and quantification of indicative properties related to microorganism migration and transport behavior in porous media and in subsurface environments. Microbe transport has wide impact and therefore is of great interest in various environmental applications such as in situ or enhanced subsurface bioremediation,filtration processes for water and wastewater treatments and protection of drinking water supplies. Although great progress has been made towards understanding the identities and activities of these microorganisms in the subsurface, to date, little is known of the mechanisms that govern the mobility and transport of microorganisms in DOE’s contaminated sites, making the outcomes of in situ natural attenuation or contaminant stability enhancement unpredictable. Conventionally, movement of microorganisms was believed to follows the rules governing solute (particle) transport. However, recent studies revealed that cell surface properties, especially those pertaining to cell attachment/adhesion and aggregation behavior, can cause the microbe behavior to deviate from non-viable particles and hence greatly influence the mobility and distribution of microorganisms in porous media.This complexity highlights the need to obtain detailed information of cell-cell and cell-surface interactions in order to improve and refine the conceptual and quantitative model development for fate and transport of microorganisms and contaminant in subsurface. Traditional cell surface characterization methods are not sufficient to fully predict the deposition rates and transport behaviors of microorganism observed. A breakthrough of methodology that would allow for quantitative and molecular-level description of intrinsic cell surface properties indicative for cell

  18. Characterization of hexose transporters in Yarrowia lipolytica reveals new groups of Sugar Porters involved in yeast growth.

    Science.gov (United States)

    Lazar, Zbigniew; Neuvéglise, Cécile; Rossignol, Tristan; Devillers, Hugo; Morin, Nicolas; Robak, Małgorzata; Nicaud, Jean-Marc; Crutz-Le Coq, Anne-Marie

    2017-03-01

    Sugar assimilation has been intensively studied in the model yeast S. cerevisiae, and for two decades, it has been clear that the homologous HXT genes, which encode a set of hexose transporters, play a central role in this process. However, in the yeast Yarrowia lipolytica, which is well-known for its biotechnological applications, sugar assimilation is only poorly understood, even though this yeast exhibits peculiar intra-strain differences in fructose uptake: some strains (e.g., W29) are known to be slow-growing in fructose while others (e.g., H222) grow rapidly under the same conditions. Here, we retrieved 24 proteins of the Sugar Porter family from these two strains, and determined that at least six of these proteins can function as hexose transporters in the heterologous host Saccharomyces cerevisiae EBY.VW4000. Transcriptional studies and deletion analysis in Y. lipolytica indicated that two genes, YHT1 and YHT4, are probably the main players in both strains, with a similar role in the uptake of glucose, fructose, and mannose at various concentrations. The other four genes appear to constitute a set of 'reservoir' hexose transporters with an as-yet unclear physiological role. Furthermore, through examining Sugar Porters of the entire Yarrowia clade, we show that they constitute a dynamic family, within which hexose transport genes have been duplicated and lost several times. Our phylogenetic analyses support the existence of at least three distinct evolutionary groups of transporters which allow yeasts to grow on hexoses. In addition to the well-known and widespread Hxt-type transporters (which are not essential in Y. lipolytica), we highlight a second group of transporters, represented by Yht1, which are phylogenetically related to sensors that play a regulatory role in S. cerevisiae, and a third group, represented by Yht4, previously thought to contain only high-affinity glucose transporters related to Hgt1of Kluyveromyces lactis. Copyright © 2017

  19. Radial oxygen gradients over rat cortex arterioles

    OpenAIRE

    Galler, Michael

    2011-01-01

    Purpose: We present the results of the visualisation of radial oxygen gradients in rats’ cortices and their use in neurocritical management. Methods: PO2 maps of the cortex of 10 wistar rats were obtained with a camera (SensiMOD, PCO, Kehlheim, Germany). Those pictures were analyzed and edited by a custom-made software. We chose a vessel for examination. A matrix, designed to evaluate the cortical O2 partial pressure, was placed vertically to the artery and afterwards multiple regio...

  20. Variational method for integrating radial gradient field

    Science.gov (United States)

    Legarda-Saenz, Ricardo; Brito-Loeza, Carlos; Rivera, Mariano; Espinosa-Romero, Arturo

    2014-12-01

    We propose a variational method for integrating information obtained from circular fringe pattern. The proposed method is a suitable choice for objects with radial symmetry. First, we analyze the information contained in the fringe pattern captured by the experimental setup and then move to formulate the problem of recovering the wavefront using techniques from calculus of variations. The performance of the method is demonstrated by numerical experiments with both synthetic and real data.

  1. Numerical simulation of radial compressor stage

    Science.gov (United States)

    Syka, T.; Luňáček, O.

    2013-04-01

    Article describes numerical simulations of air flow in radial compressor stage in NUMECA CFD software. In simulations geometry variants with and without seals are used. During tasks evaluating was observed seals influence on flow field and performance parameters of compressor stage. Also is described CFDresults comparison with results from design software based on experimental measurements and monitoring of influence of seals construction on compressor stage efficiency.

  2. Numerical simulation of radial compressor stage

    OpenAIRE

    Luňáček O.; Syka T.

    2013-01-01

    Article describes numerical simulations of air flow in radial compressor stage in NUMECA CFD software. In simulations geometry variants with and without seals are used. During tasks evaluating was observed seals influence on flow field and performance parameters of compressor stage. Also is described CFDresults comparison with results from design software based on experimental measurements and monitoring of influence of seals construction on compressor stage efficiency.

  3. Numerical simulation of radial compressor stage

    Directory of Open Access Journals (Sweden)

    Luňáček O.

    2013-04-01

    Full Text Available Article describes numerical simulations of air flow in radial compressor stage in NUMECA CFD software. In simulations geometry variants with and without seals are used. During tasks evaluating was observed seals influence on flow field and performance parameters of compressor stage. Also is described CFDresults comparison with results from design software based on experimental measurements and monitoring of influence of seals construction on compressor stage efficiency.

  4. Radial excitations in nucleon-nucleon scattering

    International Nuclear Information System (INIS)

    Silvestre-Brac, B.; Carbonell, J.; Gignoux, C.

    1986-01-01

    In the non-relativistic constituent quark model, the role of the radial excitations of the nucleon is studied within a resonating group approach of the nucleon-nucleon scattering. It is shown that, rather than the inclusion of new channels, it is important to include mixed-symmetry spin-isospin components in the nucleon wave function. It is also found that during the collision there is no significant deformation of the nucleon. (orig.)

  5. Learning Methods for Radial Basis Functions Networks

    Czech Academy of Sciences Publication Activity Database

    Neruda, Roman; Kudová, Petra

    2005-01-01

    Roč. 21, - (2005), s. 1131-1142 ISSN 0167-739X R&D Projects: GA ČR GP201/03/P163; GA ČR GA201/02/0428 Institutional research plan: CEZ:AV0Z10300504 Keywords : radial basis function networks * hybrid supervised learning * genetic algorithms * benchmarking Subject RIV: BA - General Mathematics Impact factor: 0.555, year: 2005

  6. Atmospherical experiment in Angra I plant for characterizing the effluent transport threw in the atmospheric; Experimento atmosferico no local da Usina Angra I para caracterizar o transporte de efluentes lancados na atmosfera

    Energy Technology Data Exchange (ETDEWEB)

    Silva Lobo, M.A. da [FURNAS, Rio de Janeiro, RJ (Brazil); Kronemberger, B M.E.

    1990-12-31

    Available as short communication only. The Environmental Safety Division of the Nuclear Safety and Fuel Department from FURNAS Electric Station S.A. joint with the National Oceanic and Atmospheric Administration (NOAA), achieved a field experiment for characterizing the atmospheric transport and diffusion in the site complex of Angra I Nuclear Power Plant. The complex topography with the thick vegetation and the neighbour building bring problems for the modelling of the effluent transport and the dispersion. The actual meteorological measure system is automatic and compound with four towers. An intensive atmospheric measure with captive balloon is included, and the collected data shows that the site flux is strongly influenced by the topography and insolation. (C.G.C.). 2 figs.

  7. Genome-wide identification, characterization and phylogenetic analysis of 50 catfish ATP-binding cassette (ABC) transporter genes.

    Science.gov (United States)

    Liu, Shikai; Li, Qi; Liu, Zhanjiang

    2013-01-01

    Although a large set of full-length transcripts was recently assembled in catfish, annotation of large gene families, especially those with duplications, is still a great challenge. Most often, complexities in annotation cause mis-identification and thereby much confusion in the scientific literature. As such, detailed phylogenetic analysis and/or orthology analysis are required for annotation of genes involved in gene families. The ATP-binding cassette (ABC) transporter gene superfamily is a large gene family that encodes membrane proteins that transport a diverse set of substrates across membranes, playing important roles in protecting organisms from diverse environment. In this work, we identified a set of 50 ABC transporters in catfish genome. Phylogenetic analysis allowed their identification and annotation into seven subfamilies, including 9 ABCA genes, 12 ABCB genes, 12 ABCC genes, 5 ABCD genes, 2 ABCE genes, 4 ABCF genes and 6 ABCG genes. Most ABC transporters are conserved among vertebrates, though cases of recent gene duplications and gene losses do exist. Gene duplications in catfish were found for ABCA1, ABCB3, ABCB6, ABCC5, ABCD3, ABCE1, ABCF2 and ABCG2. The whole set of catfish ABC transporters provide the essential genomic resources for future biochemical, toxicological and physiological studies of ABC drug efflux transporters. The establishment of orthologies should allow functional inferences with the information from model species, though the function of lineage-specific genes can be distinct because of specific living environment with different selection pressure.

  8. Fast radial basis functions for engineering applications

    CERN Document Server

    Biancolini, Marco Evangelos

    2017-01-01

    This book presents the first “How To” guide to the use of radial basis functions (RBF). It provides a clear vision of their potential, an overview of ready-for-use computational tools and precise guidelines to implement new engineering applications of RBF. Radial basis functions (RBF) are a mathematical tool mature enough for useful engineering applications. Their mathematical foundation is well established and the tool has proven to be effective in many fields, as the mathematical framework can be adapted in several ways. A candidate application can be faced considering the features of RBF:  multidimensional space (including 2D and 3D), numerous radial functions available, global and compact support, interpolation/regression. This great flexibility makes RBF attractive – and their great potential has only been partially discovered. This is because of the difficulty in taking a first step toward RBF as they are not commonly part of engineers’ cultural background, but also due to the numerical complex...

  9. Fuel radial design using Path Relinking

    International Nuclear Information System (INIS)

    Campos S, Y.

    2007-01-01

    The present work shows the obtained results when implementing the combinatory optimization technique well-known as Path Re linking (Re-linkage of Trajectories), to the problem of the radial design of nuclear fuel assemblies, for boiling water reactors (BWR Boiling Water Reactor by its initials in English), this type of reactors is those that are used in the Laguna Verde Nucleo electric Central, Veracruz. As in any other electric power generation plant of that make use of some fuel to produce heat and that it needs each certain time (from 12 to 14 months) to make a supply of the same one, because this it wears away or it burns, in the nucleolectric plants to this activity is denominated fuel reload. In this reload different activities intervene, among those which its highlight the radial and axial designs of fuel assemblies, the patterns of control rods and the multi cycles study, each one of these stages with their own complexity. This work was limited to study in independent form the radial design, without considering the other activities. These phases are basic for the fuel reload design and of reactor operation strategies. (Author)

  10. The role of radial particle pinches in ELM suppression by resonant magnetic perturbations

    International Nuclear Information System (INIS)

    Stacey, W.M.; Evans, T.E.

    2011-01-01

    The force balance in the plasma edge in a matched pair of DIII-D (Luxon 2002 Nucl. Fusion 42 6149) tokamak discharges with and without resonant magnetic perturbations (RMPs) is evaluated in order to investigate the effects on particle transport of RMP applied for the purpose of suppressing edge-localized modes (ELMs). Experimental data are used to evaluate the radial and toroidal force balances, which may be written as a pinch-diffusion relation for the radial ion flux to facilitate investigation of transport effects. The radial electric field in the H-mode plasma had a sharp negative dip in the steep gradient region of the edge pedestal, associated with which was a large inward pinch velocity. The main effect of RMP was to make the edge electric field less negative or more positive, reducing this strong negative dip in the radial electric field (even reversing it from negative to positive over some regions), thereby reducing the strong inward particle pinch in the edge of an H-mode discharge, thus causing a reduction in edge density below the ELM threshold.

  11. Identification and characterization of calcium transporter gene family in finger millet in relation to grain calcium content.

    Science.gov (United States)

    Singh, Uma M; Metwal, Mamta; Singh, Manoj; Taj, Gohar; Kumar, Anil

    2015-07-15

    Calcium (Ca) is an essential mineral for proper growth and development of plants as well as animals. In plants including cereals, calcium is deposited in seed during its development which is mediated by specialized Ca transporters. Common cereal seeds contain very low amounts of Ca while the finger millet (Eleusine coracana) contains exceptionally high amounts of Ca in seed. In order to understand the role of Ca transporters in grain Ca accumulation, developing seed transcriptome of two finger millet genotypes (GP-1, low Ca and GP-45 high Ca) differing in seed Ca content was sequenced using Illumina paired-end sequencing technology and members of Ca transporter gene family were identified. Out of 109,218 and 120,130 contigs, 86 and 81 contigs encoding Ca transporters were identified in GP-1 and GP-45, respectively. After removal of redundant sequences, a total of 19 sequences were confirmed as Ca transporter genes, which includes 11 Ca(2+) ATPases, 07 Ca(2+)/cation exchangers and 01 Ca(2+) channel. The differential expressions of all genes were analyzed from transcriptome data and it was observed that 9 and 3 genes were highly expressed in GP-45 and GP-1 genotypes respectively. Validation of transcriptome expression data of selected Ca transporter genes was performed on different stages of developing spikes of both genotypes grown under different concentrations of exogenous Ca. In both genotypes, significant correlation was observed between the expression of these genes, especially EcCaX3, and on the amount of Ca accumulated in seed. The positive correlation of seed mass with the amount of Ca concentration was also observed. The efficient Ca transport property and responsiveness of EcCAX3 towards exogenous Ca could be utilized in future biofortification program. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. Cloning, Expression, and Characterization of Sorbitol Transporters from Developing Sour Cherry Fruit and Leaf Sink Tissues1

    Science.gov (United States)

    Gao, Zhifang; Maurousset, Laurence; Lemoine, Remi; Yoo, Sang-Dong; van Nocker, Steven; Loescher, Wayne

    2003-01-01

    The acyclic polyol sorbitol is a primary photosynthetic product and the principal photosynthetic transport substance in many economically important members of the family Rosaceace (e.g. almond [Prunus dulcis (P. Mill.) D.A. Webber], apple [Malus pumila P. Mill.], cherry [Prunus spp.], peach [Prunus persica L. Batsch], and pear [Pyrus communis]). To understand key steps in long-distance transport and particularly partitioning and accumulation of sorbitol in sink tissues, we have cloned two sorbitol transporter genes (PcSOT1 and PcSOT2) from sour cherry (Prunus cerasus) fruit tissues that accumulate large quantities of sorbitol. Sorbitol uptake activities and other characteristics were measured by heterologous expression of PcSOT1 and PcSOT2 in yeast (Saccharomyces cerevisiae). Both genes encode proton-dependent, sorbitol-specific transporters with similar affinities (Km sorbitol of 0.81 mm for PcSOT1 and 0.64 mm for PcSOT2). Analyses of gene expression of these transporters, however, suggest different roles during leaf and fruit development. PcSOT1 is expressed throughout fruit development, but especially when growth and sorbitol accumulation rates are highest. In leaves, PcSOT1 expression is highest in young, expanding tissues, but substantially less in mature leaves. In contrast, PcSOT2 is mainly expressed only early in fruit development and not in leaves. Compositional analyses suggest that transport mediated by PcSOT1 and PcSOT2 plays a major role in sorbitol and dry matter accumulation in sour cherry fruits. Presence of these transporters and the high fruit sorbitol concentrations suggest that there is an apoplastic step during phloem unloading and accumulation in these sink tissues. Expression of PcSOT1 in young leaves before completion of the transition from sink to source is further evidence for a role in determining sink activity. PMID:12692316

  13. Multi-axial correction system in the treatment of radial club hand.

    Science.gov (United States)

    Bhat, Suneel B; Kamath, Atul F; Sehgal, Kriti; Horn, B David; Hosalkar, Harish S

    2009-12-01

    Radial club hand is a well-recognized congenital malformation characterized by hypoplasia of bone and soft tissue on the radial aspect of the forearm and hand. The modalities of treatment have traditionally varied from stretching casts with soft-tissue procedures to the use of multiple corrective osteotomies. These osteotomies can be stabilized by a variety of methods, including external fixators that allow the possibility of gradual distraction with neohistiogenesis. This current study outlines the usage of one such device (multi-axial correction system [MAC]) in the management of deformity associated with severe radial club hand. Three consecutive cases of unilateral or bilateral severe (Bayne type IV) congenital radial club hand were corrected using MAC fixation in the last 5 years. This is a retrospective review of all three cases. Data parameters included: patient demographics, presentation findings, degree of deformity, amount of correction/lengthening, length of procedure, length of treatment, and associated complications. The surgical technique is described in detail for the benefit of the readership. The three patients with severe congenital radial club hand had a total of four limb involvements that underwent correction using osteotomies and usage of the MAC device for external fixation. All three patients underwent successful correction of deformity with the restoration of alignment, lengthening of forearm for improvement of function, and stabilization of the wrist (mean duration, mean lengthening, mean time to consolidation). The MAC system was well tolerated in all patients and associated complications were limited. The MAC fixator seems to be a good alternative modality of stabilization and correction for severe congenital radial club hand deformities. Its usage is fairly simple and it provides the ease of application of a mono-lateral fixator with far superior three-dimensional control, like the circular external fixator. We recommend that

  14. Study of radial die-wall pressure changes during pharmaceutical powder compaction.

    Science.gov (United States)

    Abdel-Hamid, Sameh; Betz, Gabriele

    2011-04-01

    In tablet manufacturing, less attention is paid to the measurement of die-wall pressure than to force-displacement diagrams. Therefore, the aim of this study was to investigate radial stress change during pharmaceutical compaction. The Presster(TM), a tablet-press replicator, was used to characterize compaction behavior of microcrystalline cellulose (viscoelastic), calcium hydrogen phosphate dihydrate (brittle), direct compressible mannitol (plastic), pre-gelatinized starch (plastic/elastic), and spray dried lactose monohydrate (plastic/brittle) by measuring radial die-wall pressure; therefore powders were compacted at different (pre) compaction pressures as well as different speeds. Residual die-wall pressure (RDP) and maximum die-wall pressure (MDP) were measured. Various tablet physical properties were correlated to radial die-wall pressure. With increasing compaction pressure, RDP and MDP (P compaction behavior of materials and detecting friction phenomena in the early stage of development.

  15. Radial Photonic Crystal for detection of frequency and position of radiation sources.

    Science.gov (United States)

    Carbonell, J; Díaz-Rubio, A; Torrent, D; Cervera, F; Kirleis, M A; Piqué, A; Sánchez-Dehesa, J

    2012-01-01

    Based on the concepts of artificially microstructured materials, i.e. metamaterials, we present here the first practical realization of a radial wave crystal. This type of device was introduced as a theoretical proposal in the field of acoustics, and can be briefly defined as a structured medium with radial symmetry, where the constitutive parameters are invariant under radial geometrical translations. Our practical demonstration is realized in the electromagnetic microwave spectrum, because of the equivalence between the wave problems in both fields. A device has been designed, fabricated and experimentally characterized. It is able to perform beam shaping of punctual wave sources, and also to sense position and frequency of external radiators. Owing to the flexibility offered by the design concept, other possible applications are discussed.

  16. Characterization of materials for a reactive transport model validation experiment: Interim report on the caisson experiment. Yucca Mountain Site Characterization Project

    International Nuclear Information System (INIS)

    Siegel, M.D.; Cheng, W.C.; Ward, D.B.; Bryan, C.R.

    1995-08-01

    Models used in performance assessment and site characterization activities related to nuclear waste disposal rely on simplified representations of solute/rock interactions, hydrologic flow field and the material properties of the rock layers surrounding the repository. A crucial element in the design of these models is the validity of these simplifying assumptions. An intermediate-scale experiment is being carried out at the Experimental Engineered Test Facility at Los Alamos Laboratory by the Los Alamos and Sandia National Laboratories to develop a strategy to validate key geochemical and hydrological assumptions in performance assessment models used by the Yucca Mountain Site Characterization Project

  17. Characterization of materials for a reactive transport model validation experiment: Interim report on the caisson experiment. Yucca Mountain Site Characterization Project

    Energy Technology Data Exchange (ETDEWEB)

    Siegel, M.D.; Cheng, W.C. [Sandia National Labs., Albuquerque, NM (United States); Ward, D.B.; Bryan, C.R. [Univ. of New Mexico, Albuquerque, NM (United States). Dept. of Earth and Planetary Sciences

    1995-08-01

    Models used in performance assessment and site characterization activities related to nuclear waste disposal rely on simplified representations of solute/rock interactions, hydrologic flow field and the material properties of the rock layers surrounding the repository. A crucial element in the design of these models is the validity of these simplifying assumptions. An intermediate-scale experiment is being carried out at the Experimental Engineered Test Facility at Los Alamos Laboratory by the Los Alamos and Sandia National Laboratories to develop a strategy to validate key geochemical and hydrological assumptions in performance assessment models used by the Yucca Mountain Site Characterization Project.

  18. Characterization of active ion transport across primary rabbit corneal epithelial cell layers (RCrECL) cultured at an air-interface.

    Science.gov (United States)

    Chang-Lin, Joan-En; Kim, Kwang-Jin; Lee, Vincent H L

    2005-06-01

    Previously, we reported the development of a primary culture model of tight rabbit corneal epithelial cell layers (RCrECL) characterizing bioelectric parameters, morphology, cytokeratin, and passive permeability. In the present study, we specifically evaluated the active ion transport processes of RCrECL cultured from either pigmented or albino rabbits. Primary cultured RCrECL were grown at an air-interface on Clear-Snapwells precoated with collagen/fibronectin/laminin and mounted in a modified Ussing-type chamber for the evaluation of their active ion transport processes under short-circuited conditions. Contribution of active Na(+) and Cl(-) transport to overall short-circuit current (I(sc)) was evaluated by removing Na(+) and Cl(-), respectively, from bathing fluids of RCrECL and measurements of net fluxes of Na(+) and Cl(-) using (22)Na and (36)Cl, respectively. Amiloride and benzamil were used to determine the role of apical Na(+)-channel activities to net Na(+) fluxes. N-phenylanthranilic acid (NPAA), ouabain, BaCl(2) and bumetanide were used to determine the role of basolateral Na,K-ATPase, apical Cl(-)-channel, and basolateral K(+)-channel and Na(+)(K(+))2Cl(-)-cotransporter activities, respectively, in active ion transport across RCrECL. I(sc) of RCrECL derived from pigmented rabbits was comprised of 64+/-2% and 44+/-5% for active Na(+) and Cl(-) transport, respectively, consistent with net Na(+) absorption and Cl(-) secretion of 0.062+/-0.006 and 0.046+/-0.008 muEq/cm(2)/hr estimated from radionuclide fluxes. Apical amiloride and benzamil inhibited I(sc) by up to approximately 50% with an IC(50) of 1 and 0.1 microm, respectively, consistent with participation of apical epithelial Na(+)-channels to net Na(+) absorption across RCrECL cultured from pigmented rabbits. Addition of ouabain to the basolateral, NPAA to the apical, BaCl(2) to the basolateral and bumetanide to basolateral fluid decreased I(sc) by 86+/-1.5%, 53+/-3%, 18+/-1.8% and 13+/-1.9% in RCr

  19. Radial Basis Function Networks for Conversion of Sound Spectra

    Directory of Open Access Journals (Sweden)

    Carlo Drioli

    2001-03-01

    Full Text Available In many advanced signal processing tasks, such as pitch shifting, voice conversion or sound synthesis, accurate spectral processing is required. Here, the use of Radial Basis Function Networks (RBFN is proposed for the modeling of the spectral changes (or conversions related to the control of important sound parameters, such as pitch or intensity. The identification of such conversion functions is based on a procedure which learns the shape of the conversion from few couples of target spectra from a data set. The generalization properties of RBFNs provides for interpolation with respect to the pitch range. In the construction of the training set, mel-cepstral encoding of the spectrum is used to catch the perceptually most relevant spectral changes. Moreover, a singular value decomposition (SVD approach is used to reduce the dimension of conversion functions. The RBFN conversion functions introduced are characterized by a perceptually-based fast training procedure, desirable interpolation properties and computational efficiency.

  20. Linear theory radial and nonradial pulsations of DA dwarf stars

    International Nuclear Information System (INIS)

    Starrfield, S.; Cox, A.N.; Hodson, S.; Pesnell, W.D.

    1982-01-01

    The Los Alamos stellar envelope and radial linear non-adiabatic computer code, along with a new Los Alamos non-radial code are used to investigate the total hydrogen mass necessary to produce the non-radial instability of DA dwarfs

  1. Radial distribution of ions in pores with a surface charge

    NARCIS (Netherlands)

    Stegen, J.H.G. van der; Görtzen, J.; Kuipers, J.A.M.; Hogendoorn, J.A.; Versteeg, G.F.

    2001-01-01

    A sorption model applicable to calculate the radial equilibrium concentrations of ions in the pores of ion-selective membranes with a pore structure is developed. The model is called the radial uptake model. Because the model is applied to a Nafion sulfonic layer with very small pores and the radial

  2. Experimental feasibility study of radial injection cooling of three-pad radial air foil bearings

    Science.gov (United States)

    Shrestha, Suman K.

    Air foil bearings use ambient air as a lubricant allowing environment-friendly operation. When they are designed, installed, and operated properly, air foil bearings are very cost effective and reliable solution to oil-free turbomachinery. Because air is used as a lubricant, there are no mechanical contacts between the rotor and bearings and when the rotor is lifted off the bearing, near frictionless quiet operation is possible. However, due to the high speed operation, thermal management is one of the very important design factors to consider. Most widely accepted practice of the cooling method is axial cooling, which uses cooling air passing through heat exchange channels formed underneath the bearing pad. Advantage is no hardware modification to implement the axial cooling because elastic foundation structure of foil bearing serves as a heat exchange channels. Disadvantage is axial temperature gradient on the journal shaft and bearing. This work presents the experimental feasibility study of alternative cooling method using radial injection of cooling air directly on the rotor shaft. The injection speeds, number of nozzles, location of nozzles, total air flow rate are important factors determining the effectiveness of the radial injection cooling method. Effectiveness of the radial injection cooling was compared with traditional axial cooling method. A previously constructed test rig was modified to accommodate a new motor with higher torque and radial injection cooling. The radial injection cooling utilizes the direct air injection to the inlet region of air film from three locations at 120° from one another with each location having three axially separated holes. In axial cooling, a certain axial pressure gradient is applied across the bearing to induce axial cooling air through bump foil channels. For the comparison of the two methods, the same amount of cooling air flow rate was used for both axial cooling and radial injection. Cooling air flow rate was

  3. Expression, purification and functional characterization of human equilibrative nucleoside transporter subtype-1 (hENT1) protein from Sf9 insect cells.

    Science.gov (United States)

    Rehan, Shahid; Jaakola, Veli-Pekka

    2015-10-01

    Human equilibrative nucleoside transporter-1 (hENT1) is the major plasma membrane transporter involved in transportation of natural nucleosides as well as nucleoside analog drugs, used in anti-cancer and anti-viral therapies. Despite extensive biochemical and pharmacological studies, little is known about the structure-function relationship of this protein. The major obstacles to purification include a low endogenous expression level, the lack of an efficient expression and purification protocol, and the hydrophobic nature of the protein. Here, we report protein expression, purification and functional characterization of hENT1 from Sf9 insect cells. hENT1 expressed by Sf9 cells is functionally active as demonstrated by saturation binding with a Kd of 1.2±0.2nM and Bmax of 110±5pmol/mg for [(3)H]nitrobenzylmercaptopurine ribonucleoside ([(3)H]NBMPR). We also demonstrate purification of hENT1 using FLAG antibody affinity resin in lauryl maltose neopentyl glycol detergent with a Kd of 4.3±0.7nM. The yield of hENT1 from Sf9 cells was ∼0.5mg active transporter per liter of culture. The purified protein is functionally active, stable, homogenous and appropriate for further biophysical and structural studies. Copyright © 2015 Elsevier Inc. All rights reserved.

  4. Determination of S-methyl-L-methionine (SMM) from Brassicaceae Family Vegetables and Characterization of the Intestinal Transport of SMM by Caco-2 Cells.

    Science.gov (United States)

    Song, Ji-Hoon; Lee, Hae-Rim; Shim, Soon-Mi

    2017-01-01

    The objectives of the current study were to determine S-methyl-L-methionine (SMM) from various Brassicaceae family vegetables by using validated analytical method and to characterize the intestinal transport mechanism of SMM by the Caco-2 cells. The SMM is well known to provide therapeutic activity in peptic ulcers. The amount of SMM from various Brassicaceae family vegetables ranged from 89.08 ± 1.68 μg/g to 535.98 ± 4.85 μg/g of dry weight by using validated ultra-performance liquid chromatography-electrospray ionization-mass spectrometry method. For elucidating intestinal transport mechanism, the cells were incubated with or without transport inhibitors, energy source, or a metabolic inhibitor. Phloridzin and verapamil as inhibitors of sodium glucose transport protein (SGLT1) and P-glycoprotein, respectively, were not responsible for cellular uptake of SMM. Glucose and sodium azide were not affected by the cellular accumulation of SMM. The efflux ratio of SMM was 0.26, implying that it is not effluxed through Caco-2 cells. The apparent coefficient permeability (P app ) of SMM was 4.69 × 10 -5 cm/s, indicating that it will show good oral absorption in in vivo. © 2016 Institute of Food Technologists®.

  5. Predictions of tracer transport in interwell tracer tests at the C-Hole complex. Yucca Mountain site characterization project report milestone 4077

    International Nuclear Information System (INIS)

    Reimus, P.W.

    1996-09-01

    This report presents predictions of tracer transport in interwell tracer tests that are to be conducted at the C-Hole complex at the Nevada Test Site on behalf of the Yucca Mountain Site Characterization Project. The predictions are used to make specific recommendations about the manner in which the tracer test should be conducted to best satisfy the needs of the Project. The objective of he tracer tests is to study flow and species transport under saturated conditions in the fractured tuffs near Yucca Mountain, Nevada, the site of a potential high-level nuclear waste repository. The potential repository will be located in the unsaturated zone within Yucca Mountain. The saturated zone beneath and around the mountain represents the final barrier to transport to the accessible environment that radionuclides will encounter if they breach the engineered barriers within the repository and the barriers to flow and transport provided by the unsaturated zone. Background information on the C-Holes is provided in Section 1.1, and the planned tracer testing program is discussed in Section 1.2

  6. Transit and radial velocity survey efficiency comparison for a habitable zone Earth

    International Nuclear Information System (INIS)

    Burke, Christopher J.; McCullough, P. R.

    2014-01-01

    Transit and radial velocity searches are two techniques for identifying nearby extrasolar planets to Earth that transit bright stars. Identifying a robust sample of these exoplanets around bright stars for detailed atmospheric characterization is a major observational undertaking. In this study we describe a framework that answers the question of whether a transit or radial velocity survey is more efficient at finding transiting exoplanets given the same amount of observing time. Within the framework we show that a transit survey's window function can be approximated using the hypergeometric probability distribution. We estimate the observing time required for a transit survey to find a transiting Earth-sized exoplanet in the habitable zone (HZ) with an emphasis on late-type stars. We also estimate the radial velocity precision necessary to detect the equivalent HZ Earth-mass exoplanet that also transits when using an equal amount of observing time as the transit survey. We find that a radial velocity survey with σ rv ∼ 0.6 m s –1 precision has comparable efficiency in terms of observing time to a transit survey with the requisite photometric precision σ phot ∼ 300 ppm to find a transiting Earth-sized exoplanet in the HZ of late M dwarfs. For super-Earths, a σ rv ∼ 2.0 m s –1 precision radial velocity survey has comparable efficiency to a transit survey with σ phot ∼ 2300 ppm.

  7. Validation of a standardized mapping system of the hip joint for radial MRA sequencing

    International Nuclear Information System (INIS)

    Klenke, Frank M.; Hoffmann, Daniel B.; Cross, Brian J.; Siebenrock, Klaus A.

    2015-01-01

    Intraarticular gadolinium-enhanced magnetic resonance arthrography (MRA) is commonly applied to characterize morphological disorders of the hip. However, the reproducibility of retrieving anatomic landmarks on MRA scans and their correlation with intraarticular pathologies is unknown. A precise mapping system for the exact localization of hip pathomorphologies with radial MRA sequences is lacking. Therefore, the purpose of the study was the establishment and validation of a reproducible mapping system for radial sequences of hip MRA. Sixty-nine consecutive intraarticular gadolinium-enhanced hip MRAs were evaluated. Radial sequencing consisted of 14 cuts orientated along the axis of the femoral neck. Three orthopedic surgeons read the radial sequences independently. Each MRI was read twice with a minimum interval of 7 days from the first reading. The intra- and inter-observer reliability of the mapping procedure was determined. A clockwise system for hip MRA was established. The teardrop figure served to determine the 6 o'clock position of the acetabulum; the center of the greater trochanter served to determine the 12 o'clock position of the femoral head-neck junction. The intra- and inter-observer ICCs to retrieve the correct 6/12 o'clock positions were 0.906-0.996 and 0.978-0.988, respectively. The established mapping system for radial sequences of hip joint MRA is reproducible and easy to perform. (orig.)

  8. Development and optimization of radiographic and tomographic methods for characterization of water transport processes in PEM fuel cell materials

    International Nuclear Information System (INIS)

    Markoetter, Henning

    2013-01-01

    Water transport in polymer electrolyte membrane fuel cells (PEMFC) was non-destructively studied during operation with synchrotron X-ray radiography and tomography. The focus was set on the influence of the three-dimensional morphology of the cell materials on the water distribution and transport. Water management is still one of the mayor issues in PEMFC research. If the fuel cell is too dry, the proton conductivity (of the membrane) decreases leading to a performance loss and, in the worst case, to an irreversible damage of the membrane. On the other hand, the presence of water hinders the gas supply and causes a decrease in the cell performance. For this reason, effective water transport is a prerequisite for successful fuel cell operation. In this work the three-dimensional water transport through the gas diffusion layer (GDL) and its correlated with the 3D morphology of the cell materials has been revealed for the first time. It was shown that water is transported preferably through only a few larger pores which form transport paths of low resistance. This effect is pronounced because of the hydrophobic properties of the employed materials. In addition, water transport was found to be bidirectional, i. e. at appropriate locations a back and forth transport between GDL and flow field channels was observed. Furthermore, liquid water in the GDL was found to agglomerate preferably at the ribs of the flow field. This can be explained by condensation due to a temperature gradient in the cell and by the position, which is sheltered from the gas flow. Larger water accumulations in the gas supply channels were mainly attached to the channel wall opposing the GDL. The gas flow can bypass these agglomerations allowing a continuous gas supply. Moreover, it was shown that randomly distributed cracks in the micro porous layers (MPL) play an important role for the agglomeration of liquid water as they form preferred low resistance transport paths. In this work also

  9. Radial effects in heating and thermal stability of a sub-ignited tokamak

    International Nuclear Information System (INIS)

    Fuchs, V.; Shoucri, M.M.; Thibaudeau, G.; Harten, L.; Bers, A.

    1982-02-01

    The existence of thermally stable sub-ignited equilibria of a tokamak reactor, sustained in operation by a feedback-controlled supplementary heating source, is demonstrated. The establishment of stability depends on a number of radially non-uniform, nonlinear processes whose effect is analyzed. One-dimensional (radial) stability analyses of model transport equations, together with numerical results from a 1-D transport code, are used in studying the heating of DT-plasmas in the thermonuclear regime. Plasma core supplementary heating is found to be a thermally more stable process than bulk heating. In the presence of impurity line radiation, however, core-heated temperature profiles may collapse, contracting inward from the limiter, the result of an instability caused by the increasing nature of the radiative cooling rate, with decreasing temperature. Conditions are established for the realization of a sub-ignited high-Q, toroidal reactor plasma with appreciable output power

  10. Turbulence simulations of blob formation and radial propagation in toroidally magnetized plasmas

    DEFF Research Database (Denmark)

    Garcia, O.E.; Naulin, V.; Nielsen, A.H.

    2006-01-01

    the presence of long- range correlations in the particle density fluctuations. Finally, conditional statistics of the particle flux demonstrates the intermittency of the turbulent plasma transport and the quasi-periodic apparency of blob structures due to bursting in the global turbulence level....... of particles and heat, which is coupled to a scrape-off layer with linear damping terms for all dependent variables corresponding to transport along open magnetic field lines. The formation of blob structures is related to profile variations caused by bursting in the global turbulence level, which is due...... to a dynamical regulation by self- sustained differential rotation of the plasma layer. Radial propagation of the blob structures follows from a vertical charge polarization due to magnetic guiding centre drifts in the toroidally magnetized plasma. Statistical analysis of the particle density, radial electric...

  11. Transitionless Enhanced Confinement and the Role of Radial Electric Field Shear

    International Nuclear Information System (INIS)

    Coppi, B.; Ernst, D.R.; Bell, M.G.; Bell, R.E.; Budny, R.V.

    1999-01-01

    Evidence for the role of radial electric field shear in enhanced confinement regimes attained without sharp bifurcations or transitions is presented. Temperature scans at constant density, created in the reheat phase following deuterium pellet injection into supershot plasmas in the Tokamak Fusion Test Reactor [J.D. Strachan, et al., Phys. Rev. Lett. 58 (1987) 1004] are simulated using a first-principles transport model. The slow reheat of the ion temperature profile, during which the temperature nearly doubles, is not explained by relatively comprehensive models of transport due to Ion Temperature Gradient Driven Turbulence (ITGDT), which depends primarily on the (unchanging) electron density gradient. An extended model, including the suppression of toroidal ITGDT by self-consistent radial electric field shear, does reproduce the reheat phase

  12. Identification and Characterization of RibN, a Novel Family of Riboflavin Transporters from Rhizobium leguminosarum and Other Proteobacteria

    Science.gov (United States)

    García Angulo, Víctor A.; Bonomi, Hernán R.; Posadas, Diana M.; Serer, María I.; Torres, Alfredo G.; Zorreguieta, Ángeles

    2013-01-01

    Rhizobia are symbiotic bacteria able to invade and colonize the roots of legume plants, inducing the formation of nodules, where bacteria reduce atmospheric nitrogen (N2) to ammonia (NH3). Riboflavin availability influences the capacity of rhizobia to survive in the rhizosphere and to colonize roots. In this study, we identified the RL1692 gene of Rhizobium leguminosarum downstream of a flavin mononucleotide (FMN) riboswitch. RL1692 encodes a putative transmembrane permease with two EamA domains. The presence of an FMN riboswitch regulating a transmembrane protein is usually observed in riboflavin transporters, suggesting that RL1692 may be involved in riboflavin uptake. The product of RL1692, which we named RibN, is conserved in members of the alpha-, beta-, and gammaproteobacteria and shares no significant identity with any riboflavin transporter previously identified. In this work, we show that RibN is localized in the membrane cellular fraction and its expression is downregulated by riboflavin. By heterologous expression in a Brucella abortus mutant auxotrophic for riboflavin, we demonstrate that RibN possesses flavin transport activity. Similarly, we also demonstrate that RibN orthologues from Ochrobactrum anthropi and Vibrio cholerae (which lacks the FMN riboswitch) are able to transport riboflavin. An R. leguminosarum ribN null mutant exhibited lower nodule occupancy levels in pea plants during symbiosis assays. Thus, we propose that RibN and its homologues belong to a novel family of riboflavin transporters. This work provides the first experimental description of riboflavin transporters in Gram-negative bacteria. PMID:23935051

  13. Immuno-detection of OCTN1 (SLC22A4) in HeLa cells and characterization of transport function.

    Science.gov (United States)

    Pochini, Lorena; Scalise, Mariafrancesca; Indiveri, Cesare

    2015-11-01

    OCTN1 was immuno-detected in the cervical cancer cell HeLa, in which the complete pattern of acetylcholine metabolizing enzymes is expressed. Comparison of immuno-staining intensity of HeLa OCTN1 with the purified recombinant human OCTN1 allowed measuring the specific OCTN1 concentration in the HeLa cell extract and, hence calculating the HeLa OCTN1 specific transport activity that was about 10 nmol×min(-1)×mg protein(-1), measured as uptake of [(3)H]acetylcholine in proteoliposomes reconstituted with HeLa extract. This value was very similar to the specific activity of the recombinant protein. Acetylcholine transport was suppressed by incubation of the protein or proteoliposomes with the anti-OCTN1 antibody and was strongly inhibited by PLP and MTSEA, known inhibitors of OCTN1. The absence of ATP in the internal side of proteoliposomes strongly impaired transport function of both the HeLa and, as expected, the recombinant OCTN1. HeLa OCTN1 was inhibited by spermine, NaCl (Na(+)), TEA, γ-butyrobetaine, choline, acetylcarnitine and ipratropium but not by neostigmine. Besides acetylcholine, choline was taken up by HeLa OCTN1 proteoliposomes. The transporter catalyzed also acetylcholine and choline efflux which, differently from uptake, was not inhibited by MTSEA. Time course of [(3)H]acetylcholine uptake in intact HeLa cells was measured. As in proteoliposomes, acetylcholine transport in intact cells was inhibited by TEA and NaCl. Efflux of [(3)H]acetylcholine occurred in intact cells, as well. The experimental data concur in demonstrating a role of OCTN1 in transporting acetylcholine and choline in HeLa cells. Copyright © 2015 Elsevier B.V. All rights reserved.

  14. Pharmacological characterization of human excitatory amino acid transporters EAAT1, EAAT2 and EAAT3 in a fluorescence-based membrane potential assay

    DEFF Research Database (Denmark)

    Jensen, Anders A.; Bräuner-Osborne, Hans

    2004-01-01

    We have expressed the human excitatory amino acid transporters EAAT1, EAAT2 and EAAT3 stably in HEK293 cells and characterized the transporters pharmacologically in a conventional [(3) H]-d-aspartate uptake assay and in a fluorescence-based membrane potential assay, the FLIPR Membrane Potential...... (FMP) assay. The K(m) and K(i) values obtained for 12 standard EAAT ligands at EAAT1, EAAT2 and EAAT3 in the FMP assay correlated well with the K(i) values obtained in the [(3) H]-d-aspartate assay (r(2) values of 0.92, 0.92, and 0.95, respectively). Furthermore, the pharmacological characteristics...

  15. Characterization of temperature-dependent carrier transport in disordered indium-tin-oxide/poly (3,4-ethylenedioxythiophene):poly(styrenesulfonate)/polyfluorene/Ca/Al polymer structures

    International Nuclear Information System (INIS)

    Jiang, Joe-Air; Wang, Jen-Cheng; Fang, Chia-Hui; Wu, Ya-Fen; Teng, Jen-Wei; Chen, Yu-Ting; Fan, Ping-Lin; Nee, Tzer-En

    2011-01-01

    The temperature-dependent electrical characteristics of polyfluorene-based polymer structures over a temperature range from 200 to 300 K are systematically investigated in this study. Initially, using the definitions of the Berthelot-type model, it is found that the sample exhibits a higher Berthelot-type temperature T B with high driving voltage, indicating that carrier transport in a disordered system manifests Berthelot-type behaviors. The ideal current density-voltage curve for the polymer structures given the carrier transmit mechanism is further elucidated by taking into account the ohmic conduction, trap charge limited current, and Mott and Gurney model of space charge limited current. The proposed procedure is simple and can be used to characterize the material with reasonable accuracy. We also study the density of the traps H t , and the characteristic energy of the distribution E t to better understand the carrier-transport process in organic materials and structures.

  16. In situ characterization of the film coverage and the charge transport in the alkylated-organic thin film transistor

    Science.gov (United States)

    Watanabe, Takeshi; Koganezawa, Tomoyuki; Kikuchi, Mamoru; Muraoka, Hiroki; Ogawa, Satoshi; Yoshimoto, Noriyuki; Hirosawa, Ichiro

    2018-03-01

    We propose an in situ experimental method of investigating the correlations of the film coverage of the organic semiconductor layers and charge transport properties of organic thin film transistors during vacuum deposition. The coverage of each monolayer was estimated using the intensity of off-specular diffuse scattering and diffraction. Experimental data were obtained from the in situ measurements of two-dimensional grazing incidence X-ray scattering and charge transport. The source-drain current increased over the film coverage of the first monolayer (= 0.48). This is in agreement with the critical percolation coverage, indicating that the conductivities of the first and second monolayers are different.

  17. Latitudinal Dependence of the Radial IMF Component - Interplanetary Imprint

    Science.gov (United States)

    Suess, S. T.; Smith, E. J.; Phillips, J.; Goldstein, B. E.; Nerney, S.

    1996-01-01

    Ulysses measurements have confirmed that there is no significant gradient with respect to heliomagnetic latitude in the radial component, B(sub r,), of the interplanetary magnetic field. There are two processes responsible for this observation. In the corona, the plasma beta is much less than 1, except directly above streamers, so both longitudinal and latitudinal (meridional) gradients in field strength will relax, due to the transverse magnetic pressure gradient force, as the solar wind carries magnetic flux away from the Sun. This happens so quickly that the field is essentially uniform by 5 solar radius. Beyond 10 solar radius, beta is greater than 1 and it is possible for a meridional thermal pressure gradient to redistribute magnetic flux - an effect apparently absent in Ulysses and earlier ICE and Interplanetary Magnetic Physics (IMP) data. We discuss this second effect here, showing that its absence is mainly due to the perpendicular part of the anisotropic thermal pressure gradient in the interplanetary medium being too small to drive significant meridional transport between the Sun and approx. 4 AU. This is done using a linear analytic estimate of meridional transport. The first effect was discussed in an earlier paper.

  18. Radial Distribution Functions of Strongly Coupled Two-Temperature Plasmas

    Science.gov (United States)

    Shaffer, Nathaniel R.; Tiwari, Sanat Kumar; Baalrud, Scott D.

    2017-10-01

    We present tests of three theoretical models for the radial distribution functions (RDFs) in two-temperature strongly coupled plasmas. RDFs are useful in extending plasma thermodynamics and kinetic theory to strong coupling, but they are usually known only for thermal equilibrium or for approximate one-component model plasmas. Accurate two-component modeling is necessary to understand the impact of strong coupling on inter-species transport, e.g., ambipolar diffusion and electron-ion temperature relaxation. We demonstrate that the Seuferling-Vogel-Toeppfer (SVT) extension of the hypernetted chain equations not only gives accurate RDFs (as compared with classical molecular dynamics simulations), but also has a simple connection with the Yukawa OCP model. This connection gives a practical means to recover the structure of the electron background from knowledge of the ion-ion RDF alone. Using the model RDFs in Effective Potential Theory, we report the first predictions of inter-species transport coefficients of strongly coupled plasmas far from equilibrium. This work is supported by NSF Grant No. PHY-1453736, AFSOR Award No. FA9550-16-1-0221, and used XSEDE computational resources.

  19. Methods and apparatus for radially compliant component mounting

    Science.gov (United States)

    Bulman, David Edward [Cincinnati, OH; Darkins, Jr., Toby George; Stumpf, James Anthony [Columbus, IN; Schroder, Mark S [Greenville, SC; Lipinski, John Joseph [Simpsonville, SC

    2012-03-27

    Methods and apparatus for a mounting assembly for a liner of a gas turbine engine combustor are provided. The combustor includes a combustor liner and a radially outer annular flow sleeve. The mounting assembly includes an inner ring surrounding a radially outer surface of the liner and including a plurality of axially extending fingers. The mounting assembly also includes a radially outer ring coupled to the inner ring through a plurality of spacers that extend radially from a radially outer surface of the inner ring to the outer ring.

  20. Characterization of the ZAT1p zinc transporter from Arabidopsis thaliana in microbial model organisms and reconstituted proteoliposomes.

    Science.gov (United States)

    Bloss, Tanja; Clemens, Stephan; Nies, Dietrich H

    2002-03-01

    The ZAT1p zinc transporter from Arabidopsis thaliana (L.) Heynh. is a member of the cation diffusion facilitator (CDF) protein family. When heterologously expressed in Escherichia coli, ZAT1p bound zinc in a metal blot. Binding of zinc occurred mainly to the hydrophilic amino acid region from H182 to H232. A ZAT1p/ZAT1p*Delta(M1-I25) protein mixture was purified and reconstituted into proteoliposomes. Uptake of zinc into the proteoliposomes did not require a proton gradient across the liposomal membrane. ZAT1p did not transport cobalt, and transported cadmium at only 1% of the zinc transport rate. ZAT1p functioned as an uptake system for 65Zn2+ in two strains of the Gram-negative bacterium Ralstonia metallidurans, which were different in their content of zinc-efflux systems. The ZAT1 gene did not rescue increased zinc sensitivity of a Delta ZRC1single-mutant strain or of a Delta ZRC1 Delta COT1 double-mutant strain of Saccharomyces cerevisiae, but ZAT1 complemented this phenotype in a Delta SpZRC1 mutant strain of Schizosaccharomyces pombe.